1I1OA

Room temperature crystal structure flavodoxin d. vulgaris mutant y98h at 2.0 ang. resolution
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
147
structure length
147
Chain Sequence
AKALIVYGSTTGNTEYTAETIARELADAGYEVDSRDAASVEAGGLFEGFDLVLLGCSTWGDDSIELQDDFIPLFDSLEETGAQGRKVACFGCGDSSHEYFCGAVDAIEEKLKNLGAEIVQDGLRIDGDPRAARDDIVGWAHDVRGAI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structures and comparison of the Y98H (2.0 A) and Y98W (1.5 A) mutants of flavodoxin (Desulfovibrio vulgaris).
pubmed doi rcsb
source organism Desulfovibrio vulgaris
molecule tags Electron transport
molecule keywords FLAVODOXIN
total genus 49
structure length 147
sequence length 147
ec nomenclature
pdb deposition date 2001-02-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00258 Flavodoxin_1 Flavodoxin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.360 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1i1oA00
2V9CA 3N3AC 3OJWA 1CZOA 4ESEA 2RG1A 6NULA 1C7FA 1SQSA 2M6SA 2A5LA 3EDOA 3K20A 3NFRA 3HA2A 3U7RA 1ZWKA 1SG0A 3FNIA 2WC1A 1OBVA 1QHEA 1KBQA 1T5BA 1X77A 2BMVA 3B6IA 3GAMA 4GR9A 4NLLA 4QOIA 1J9ZA 4CF6A 4PTZA 2R97A 3NLLA 2GSWA 3ES9A 4D02A 4Y7CA 2FZVA 3O73A 3D7NA 5F51A 2Q9UA 3F6RA 3W78A 2X2PA 1XT6A 4YAFA 1V4BA 1BVYF 2QX8A 5B3KA 1YCGA 3NHUA 2FDXA 1YKGA 1YCFA 4U7GA 3S2YA 3ZHOA 4C0XA 3R6WA 5LJIA 3GFRA 4ZVLA 1YRHA 1WSWA 1QBGA 1RLJA 1XI2A 1ZWLA 2AMJA 4LA4A 5LMCA 3NHWA 1D04A 1FUEA 2HNAA 2X2OA 5EAIA 1J8QA 1VMEA 3HR4A 4C14A 2Z9CA 1AKVA 5NLLA 4DILA 1AKWA 3SVLA 1QRDA 1CZRA 3OX1A 2KLBA 4Y9UA 3OX3A 4GI5A 1AKQA 2QWXA 1AHNA 1I1OA 1RLIA 3KAPA 1D4AA 4ZVKA 1AKTA 1F4PA 5JROA 5LLDA 2FX2A 2MT9A 3QE2A 3NHFA 3UXEA 5A4KA 2ARKA 5FX2A 1XYVA 5F4BA 4YAOA 4QODA 4BMPB 3F6SA 4H2DA 1CZLA 3NHPA 2FOXA 4C0WA 1AZLA 2M6RA 1WSBA 3QFRA 1YOBA 4ICIA 4J8PA 1YCHA 4N82A 2XOEA 3O2NA 4QOJA 5LJLA 3W7AA 4M0CA 1DX9A 3F90A 2V5VA 5NULA 1QR2A 4U7HA 1OFVA 1FX1A 2QMZA 2Z9DA 2MWMA 1AG9A 1FLVA 3FX2A 4N65A 4BMOB 3B6MA 4N9QA 3NHSA 2D5IA 1CZUA 3FVWA 4LAFA 4R81A 1H66A 1RTTA 2QX6A 4XDHA 5ULLA 3W79A 1H69A 4QOFA 3L9XA 4PU0A 2B3DA 2Z98A 1ZX1A 3N3BC 1KBOA 1JA0A 3TEMA 1NNI1 3OVMA 2V5UA 4GQIA 2N1MA 1XYYA 4NULA 4CETA 4C76A 5EMNA 4Y9RA 5FA6A 1CZHA 4HS4A 2R96A 3NHKA 5LBUA 5FUQA 4U7FA 4H6PA 2MTBA 3N39C 2QX9A 4YALA 2QX4A 1J9EA 2HPVA 4FGLA 2MOKA 4PTYA 2XODA 4YAUA 5F12A 2FAXA 3KAQA 3TZBA 3GFQA 3B6JA 3UXHA 3FJOA 2BPOA 1T0IA 1DXQA 2KQUA 2QMYA 4LTDA 2Z9BA 3OX2A 5LBTA 3U7IA 3OWXA 4XDGA 1AMOA 3K1YA 3RPEA 2FZ5A 2BF4A 1TIKA 1RCFA 2OHJA 1FVXA 3ESYA 4FX2A 3G5MA 5BUCA 5B3LA 3JSXA 3ESXA 3ESZA 2OHIA 3KLBA 1B1CA 3F2VA 3LT5A 3NHJA 4HEQA 1FLNA 4QOEA 2BN4A 4DIKA 1FLAA 3NHYA 3OWHA 2OYSA 4OXXA 4S24A 4F8YA 1J9GA 1TLLA 1BU5A 2F1OA 2BZSA 1AKRA 1OBOA 3QFCA 1GG5A 4QOGA 4YAWA 2ZKIA 5TGZA 5LVAA 3GFSA 1YDGA 4LTNA 3B6KA 1E5DA 3OJXA 3TE7A 4ZVNA 4DY4A 2Q62A 1FTGA 2FLVA 1C7EA 4FGKA 4QOHA 2QR2A 1CZNA 1D03A 2FCRA 4ZVMA 3HLYA 3W77A 3KEGA 2HNBA 3L9WA 1CZKA 2W5UA 1JA1A 2FVXA 3NHRA 3P0RA 3EYWA 3NHLA 3FW1A 4LTMA 1FLDA 1DXOA 5EA2A 4YQEA 2OHHA 4FGJA 3LCMA 1AKUA
chains in the Genus database with same CATH superfamily
3N3AC 2P68A 5DM2A 3ZV4A 4TS9A 2J41A 4BV2A 3CF4G 3ZCUA 4ZWNA 4DLWA 3LC7O 3Q0TA 1B6TA 2X5XA 4JH0A 3W9SA 1KVSA 3D6HA 2HX1A 3HJNA 1TI7A 1VYTA 4HDOB 5TS2A 1IM2A 1JQLB 1ZW6A 1RKXA 2QN7A 2JIMA 1KEPA 3VUFA 1W2GA 3H9QA 1VPEA 2BT4A 5DYNA 2Q9UA 3TAUA 5TQ2A 2CNWA 5E9AA 1U8ZA 3QELA 4K6HA 4V38A 4F6RA 2AXNA 3HJAA 2I2BA 3C5HA 2D3WA 1QBGA 1U0FA 2PX5A 2VTVA 3KKNA 4IIBA 4AJ1A 5D6NA 3UB2A 3BILA 5EWLB 3KKZA 4B85A 4X71A 4O3MA 4HNGA 4KAJA 1SG6A 3U48A 3ZE6A 4TMTA 1F51E 1C3VA 5CEEA 1XD8A 1E18A 1QHIA 3WI7A 3HMQA 4Y67A 4BLRA 3ZE2B 4F3CA 2OCDA 1KY5A 5A03A 4GOOD 3PRHA 5EIAA 1VL8A 4RY2A 2P27A 3BRQA 4RW0A 5IJXA 4YLYA 3CLRD 3BT7A 4KRGA 1NX9A 2Y67A 2BRUA 3FCCA 3ICVA 1I3CA 3MLAA 1ECGA 1ZRSA 1MQ8B 1ZBDA 1NP6A 2V6FA 4YJFB 2XUIA 3R7WA 5HUQA 4QUJA 5BV1A 1EFUA 3H11B 1CJBA 4JYMA 2ODNA 2V98A 2RK3A 5BVGB 3PDJA 4G4IA 5DK4A 2G1PA 2GKSA 3QITA 4FEAA 5PNTA 2QXUA 3TL2A 4WBNA 3HU5A 3RYFA 5FWAA 2BI8A 4YJFA 4RD3A 2ZR9A 3WLFA 1WUKS 2YVKA 1KTIA 1I3OA 1PG2A 2JGMA 3MW8A 1DTWA 2IYZA 2WEKA 3DZDA 4AIRA 4AZ0B 3KR9A 5LIPA 1XTIA 3PXGA 1SVIA 3CPHA 3M4JA 4DARA 1AX9A 1Q7EA 3FDZB 3I8OA 2CL7X 4D3ZA 4E22A 2XYRA 4M0PA 5BN4A 1U90A 2BKEA 4URUR 1G3RA 5IC5A 2Q7XA 5EIBD 2RHHA 1NP7A 3GAFA 2JCBA 4HQKA 5B5SA 3ZV3A 5JFTA 3ZVKA 1EFVA 4OBBA 3HDYA 2Y92A 4BKRA 3QF4A 3K3PA 1W25A 2QX9A 2ZAIA 1J9EA 2CF6A 3QUBA 2IV2X 2G9NA 3V46A 4JN6B 1YF3A 2IIPA 4GW3A 4BTEA 1B2LA 1SCNE 1EK0A 2EERA 4GSLA 4MWEA 3QWIA 3H7IA 4TL7A 4YY3B 1HL3A 4ODIA 4IV5A 4KE8A 4AMBA 4QX6A 3OTOB 1RCTE 5HIKA 2NACA 2FR8C 4HL6A 1PU2A 2G9RA 3T0GA 1W36C 1R9MA 3DEAA 2VZ8A 4LOIA 1J0AA 3F2VA 1S3FA 5FWXA 1KHTA 3R75A 3QPAA 1Q15A 2ZYRA 1RAIA 1ZOOA 1F0NA 1P2VA 1MTOA 7ADHA 2X8BA 4YAWA 1PZXA 2I3BA 2I7DA 2B36A 5BRJA 3DBOB 2CLCX 1XRPA 2DT5A 1Q0UA 1Z37A 2R8ZA 3MTDA 3OZVA 2W2LD 4FE7A 1R4AA 1GG9A 1Q17A 2PJZA 4Q66C 1JX6A 1M2WA 3V34A 5GJBA 1G4AE 3FSEA 3OWOA 4BLPA 3KZKA 5ALHA 2Q5OA 4CQMB 2CZGA 4M46A 5K7SA 3A6GA 4YX9A 3ETLA 3NJRA 3CW2A 3OH8A 3TLAA 3HP7A 3HZHA 4QUHA 3CPEA 2QXTA 1X1QA 3I9KA 4RK1A 4KYUA 2QLFA 4HH4A 2V9PA 3O8OA 4ZYYA 1PNOA 2QJFA 5EVJA 1PGQA 3ZXSA 1KAOA 3QFTA 4FIDA 2VNKA 2E37A 3UW3A 3ONDA 3KPUA 2UZ4A 5K8LA 5CA0A 2BGIA 2JCVA 1YS6A 3S44A 2WM2A 2CE7A 2QG9A 1XLTC 4D9BA 5IZCC 2RC6A 5JH7A 4M0MA 3TG8A 2BGJA 4DDMA 4ZVUA 1RQRA 4GI1A 2PGAA 1W0CA 2ZE8A 2MMCA 1ZD2P 4G2TA 5EZSA 2OOSA 2P1DA 5AW0A 5ENDA 3WGZA 1NBHA 1PT8A 4TMWA 4D57A 2X5NA 3PC7A 4AQDA 1E60A 2GRJA 3S1AB 1SKQA 2ZVQX 3QKTA 2FQWA 4EUEA 3NNDA 1YDEA 2XMRA 2OXIA 3TRDA 1ONOA 1R5OA 3H2JA 4NHEA 1ZM2A 1HDOA 4P5EA 2AD1A 1H05A 1I2DA 2HU7A 2OOKA 3INTA 2IW1A 4V39A 1ZINA 5DN6A 4A2PA 3S8YA 3NBAA 5SYAA 5BN4B 5EE5B 2XUPA 3EXG2 3MAGA 4LQLA 1YDHA 1GZUA 4L9WA 2HPZA 3R7BA 1OFIA 5I7SA 1P8AA 4IICA 3TLGA 1UBTS 6PFKA 2W0MA 5IT0A 1QR2A 3VHXA 3VSCA 4RTLA 4MYHA 2J3MA 4MDFA 4D4KA 3WA7A 2UZ3A 5AP9A 1Y4SA 2LKDA 3LPLA 2Q5EA 4DJ5X 2D2EA 2HFJA 4FSDA 1O8CA 3E4DA 2AFHE 2QVCA 5EHZA 5MHTA 1W4LA 3IE2A 4C6TB 3PSHA 3DC2A 2G0TA 1AGPA 4PLTA 4DBLC 2FZEA 4TZ6A 4HFMA 2YHIA 5T8KA 1XMVA 1X1AA 4ERXA 2H31A 4GC9A 3HB9A 3D6JA 3RUCA 4OB7A 1O4WA 3G3EA 4G07A 4Z4IA 2FNAA 2R96A 3VC1A 5KPDA 4PXYA 5C1PA 4AO8A 4GRIA 4CR8A 2A1UA 2FZLA 2G63A 3K1AB 4NBLA 2C4TA 5B1EA 5LD2C 2MSEB 4Q7QA 2CLIB 4QDJA 5FLEX 1WV0A 5FTLA 4DDKA 2YMLA 1O6ZA 2D5AA 4LBWA 5HE9A 5CHYA 2Q6KA 2Y1OA 3N5KA 2Y1CA 3B1XA 3PK0A 4N54A 1PJ8A 4EVRA 4QAQA 2C31A 1E2BA 5TR9A 3KU1A 1I32A 2D4HA 3PXEA 5JI3E 2CFSA 4N5IX 3K30A 1FJGB 1XB2A 3IPCA 3VI4B 2HZBA 4XWWA 2IX3A 1XDSA 2Q5HA 3EVCA 3KYDB 1NZJA 2E4YA 4INAA 4JJAA 3EXHC 1M73E 3C6ZA 5IKPA 4PO1A 4OHFA 4QG7A 3W2GA 4HZGA 5JFOA 1GNPA 4KNWA 2ZB7A 1PLJA 3TX2A 4TVSA 4PSCA 4DQDA 4EG0A 1YFJA 2GPYA 4UUPA 1QIMA 1RQLA 4QSMA 4FT2A 1EFHA 2C7OA 1RM4A 3O47A 3UOAB 1O96B 4RCZA 3LCMA 5AUOB 1Z2AA 4PHCA 2PX4A 4XRGA 5AMXA 4BP8A 1HG1A 1K4YA 3KOWA 3N7UA 4F38A 2C9ZA 4RPJA 1FUKA 4O4HA 3K4PA 5CFPA 1VQ1A 1FFEA 1ZC3A 1TTTA 2GSWA 2UZAA 4D02A 1UEIA 4PRLA 4G01B 3WGVA 4DNXA 2H2IA 3IPLA 3SIWA 1GFZA 1Q12A 3I9JA 5IH7A 1ECCA 3GLFE 1F0PA 3NHUA 2PXHA 2X0DA 2XMBA 2WD7A 2GK7A 2VDOB 4JD5A 3OCVA 3TTXA 1EWRA 4QLBA 3AEYA 2WUVA 4LSZA 3E84A 3KSAC 4BNTA 3ELYA 4MWBA 1F5NA 1RI5A 1U1CA 4EYSA 1JAXA 4G0UA 3QPVA 3A58B 5TMDA 1NOKA 2Z9CA 4MPRA 3DLAA 4K0RA 4QNRA 4TYMA 3HO8A 1EUYA 4CT4B 3HNPA 4TYQA 1YO6A 1S3SA 4LZZA 2PUEA 1N9GA 2AE1A 4GEGA 3FKSD 3L0IB 3VYSB 4N5DA 4CCWA 1QGUB 4IFIA 4PYQA 4A4DA 2BSAA 3N0TA 3UUFA 3MPUA 3GMSA 1ZW1A 4YO7A 1YR2A 3OAAD 4Z8XA 1CUIA 2HPAA 2YZ7A 1Z4NA 2JLBA 4P92A 1Q7RA 1KZHA 2O2CA 4JJZA 3NWOA 4HHEA 5AI8A 3WB1A 3HC7A 1YIOA 1X7WB 1Q0ZA 5NULA 3U44B 2QRVA 3K9WA 2G7MC 4K3UA 1SZJG 2BMWA 4C4OA 1MZVA 1WCIB 2R2AA 2XXAB 4LC0A 1K7FB 2WYOA 3EBOA 3GEIA 3PXCX 1COZA 4EJ2A 3EGVA 1H93A 1XZPA 4AK9A 2RB5A 3HNOA 1MVOA 1V9LA 1XPJA 1GNVA 1Y33E 2D1TA 3NNSA 4IQFA 4JL5A 2Z8ZA 4GM1A 4DSZA 3BBPA 4H1TA 3VZPA 2XB9A 1EXDA 4QBIA 1FJHA 5LMZA 4GOMD 1VMKA 3JQ7A 3KJZA 4JB8A 4DCMA 2WJPA 2EFJA 3B5JA 5K6TA 4WASA 2O8FA 3EQZA 4LSMA 2VRBA 5AI9A 5G41A 1YR9A 5AQEA 3EWNA 1BDBA 4I46A 1SVSA 4O4JA 1C0KA 1WIWA 1E8MA 4EHIA 4ND3A 3C87A 4TS1A 4G5YA 1Y37A 2FPGA 2O3TA 2W2TA 4L0CA 3UAVA 4BP9A 4F45A 1PV1A 1IJBA 1NDHA 1XK7A 3V7YA 3VJMA 2IH5A 1I9GA 1GCAA 1I0ZA 4F86A 1TADA 4QFMA 4ZI2A 1IPEA 1JNYA 1TXGA 1WOYA 2OFWA 1JHYA 1G64A 2VTDA 3JQEA 4KO1S 5ARDA 4S1PA 5FHQA 1DTWB 5BSUA 2R8RA 3TLKA 4BVAA 3DNPA 5ED4A 4PLWA 1A27A 3AR6A 4DQKA 5JJKA 1T43A 2QYOA 1E2MA 4P4SB 5KS2A 3EC1A 4J4TA 4RGVA 2Q5JA 4B33A 1SR8A 1A4XA 5C9ZA 3DL4A 3IPYA 3QBDA 1M54A 1UF9A 2QTCA 2N47A 3TKLA 4Y6GB 3E9QA 3U6KA 2B21A 1RRPA 4W1RA 4YJKA 5IASA 4JCCA 5I7RA 4DSOA 2JCSA 1VJ0A 2NZYA 3SHOA 4BNIA 1B00A 1VJTA 4I1RA 1J70A 3LL4A 3P2EA 4UAUA 4YR9A 2CVPA 2NYUA 1SVWA 5FYQA 2IRWA 2WAAA 3FZEA 4HQ0A 3NRBA 3WL5A 3UC5A 2DLDA 2Q1SA 4V0NA 4L3WA 3UWKA 3MG9A 1PWHA 4OHXA 3GOHA 3RRNA 4ZYVA 2PWAA 2H4YA 1IVYA 1I51A 3SBOA 2YWDA 1QS0B 3GJ7A 5KC9A 1TU0A 1HURA 2WAMA 3E7DA 2HWYA 1EEHA 1NXOA 1D5WA 3FNFA 3I4LA 4GR4A 2OTCA 4AFNA 1MX3A 2V7QA 3M4ZA 4ZARA 4PTZA 4ZT2A 5SZKB 5JRDS 1IOVA 2O8CB 2P1RA 3R7FA 1M1NB 2Y6UA 2V74B 3O73A 1N2ZA 2YDXA 3ZDYB 1HL7A 3ZGXA 3ELBA 4UTRA 2A0FA 2BM0A 3JRWA 5BORA 1Z8FA 1U1DA 1NGSA 2V0NA 3Q7TA 3WFIA 4RENA 1JDSA 3I6IA 1DQRA 3PQ3A 2YWHA 4RSMA 2UYYA 1S2OA 5DJ5A 1VE3A 4MCAA 1AKVA 2JNWA 1CUFA 1NI4B 1JYEA 2XX3A 3KSMA 3CZAA 4Y9UA 4LBVA 2AA3A 1MN6A 3NH6A 1Y98A 4X1KB 3TIVA 2VF2A 2YYAA 3ICWA 1G7RA 1T2UA 1R74A 2FW0A 4FFLA 1U5AA 4P58A 1I8TA 4IBOA 5CM2Z 2A5YB 3Q6MA 4B9AA 4FYXA 3A0RB 2QAJA 3T7KA 5KBYA 3UK2A 1BVHA 4PZAA 3JPYA 1YTUA 3S2EA 1JQAA 1M6YA 4MLPA 4WJLA 2ZYHA 3S1SA 1ZD5A 2D7CA 2FN7A 2H7YA 2R65A 2WTNA 2PGDA 1KR5A 2WF9A 5EMKA 2WYHA 1R0ZA 1VA5A 3RAJA 5JD5A 4P36A 4Q18A 1M0TA 3G6WA 3WYCA 4G86A 1F4LA 4MYSA 3FYTA 2WD8A 4DQ0A 5A62A 4ZTUB 1T0PA 4RE6A 4JB0A 5JCOC 2VTBB 3IEVA 2VQSA 4RDHA 3CRW1 3ILXA 3QM1A 4YEDA 4PU0A 121PA 1SCDA 1GNTA 1MNAA 3HGMA 3IALA 1A2BA 2PBLA 4LJ4A 5G3ZA 4E14A 2F3QA 5M34A 4MQUA 1B26A 1Z5PA 1GRQA 2H7CA 2B92A 4I4LA 2QX7A 2OGWA 3ADCA 5KSYA 1ESCA 1BMDA 1OIVA 2H17A 2OFXA 3EASA 2NZ2A 2W6JA 2XD9A 3B3JA 2W6ZA 3W6NA 1AA6A 3FSRA 4MV7A 2VDNB 3P20A 3D8TA 4RV9A 4EELA 1XVIA 2JGFA 4MGIR 4YLGA 2D5LA 2FE4A 4YCDA 2XVZA 3O93A 5D7BA 3WYDA 2UXBB 2QAIA 3RFUA 1JQEA 1Z28A 5AK5A 5BQ5A 3FHCB 1MXHA 4UUNA 5BWBA 3WAJA 4AF6A 5HM8A 3ZHYA 3HXTA 2ZR7A 5EIWA 2QZSA 1ABBA 4EUNA 3T3MB 3P9IA 3ROKA 4UNSA 5KVAA 2HRZA 4R98A 1ZLYA 3EVZA 2F3UA 3LS2A 2RHWA 4HNAA 4CQLA 1R0BA 2VAVA 4KN8A 2ZJAA 1NT4A 4LWQA 4OD0A 3GJ0A 4QUEA 5ESDA 5FOTA 3X1KA 5TVGA 3KYCB 6GPBA 3OQNA 3L5KA 3SZGA 3H4MA 4OP3A 5FO0A 1YJ8A 1A0OA 4MYRA 3L7LA 1QUEA 4DMUB 1P2SA 2G88A 4KBFA 4O4JB 1NV9A 1OZFA 2OMKA 4UDYX 1EH5A 1T5SA 1YJ5A 2ODTX 3ULKA 1ZS9A 1ARZA 2PKYX 3PEWA 1KIAA 4E4TA 3H1TA 2W2VA 3NVMB 2NO9A 3JAWA 3VO8A 4G4GA 1XDZA 5EJGA 3Q8MA 4ZJUA 4RSRA 3WZLA 4DVGA 4EGFA 1IBLB 1N75A 1RI2A 1G8AA 3FWNA 3N2IA 3C7TA 3I83A 2H65A 3QNUA 3QYPA 4MSUA 1DJOA 4B3JA 1GU7A 3DBIA 3FNIA 3BG5A 1R9GA 2WC1A 1ADBA 3KV1A 3WLPA 4E5UA 5KYTA 4DJDC 1NXPA 3VH1A 2AQIA 3BQ9A 4GS5A 4Z0HO 4DQXA 1UJMA 3MJDA 3Q3JB 2ID4A 2B9VA 4YRLA 3EDYA 3SY8A 3KHKA 4DJEC 5FPPA 1PUJA 1TVMA 3V8MA 4JBXA 5LQAA 3LXXA 3JTEA 2ILTA 2XVXA 4Y2VA 1V1MB 4O02B 4Q1AA 4TMXA 4B83A 4ACAA 3MTIA 3H3FA 2C7RA 1O96A 1XAGA 3Q2KA 3TIFA 5K8TA 3CF6R 3EIXA 3QBEA 4TMYA 3C15C 4JMPA 1BHSA 4HWRA 1U2GC 1UJ2A 1OREA 3UB4A 1EGVB 4TSFD 3QBVA 4TYNA 3N2NA 4TRRA 1RZRD 2GYUA 1MB3A 1CKEA 2BMEA 5HGJA 4DCNA 4C07A 5JSFA 3BEOA 4OPMA 1AZLA 1PWXA 3H5AA 3QMWA 4IDGA 4J6EA 4DRXB 4ZHQB 3GJZA 4GKKB 1ZVMA 4KRYA 3D02A 5ERXA 5TXGA 4TTRA 3THWA 5HKKD 3KHUA 5EJAA 3OQMA 5B6PA 1CQZA 4N65A 4YP1A 4YH1A 1ATIA 2FFAA 2FLWA 4GT1A 4JI4B 3A70A 1LI7A 4Y2TA 3OO1A 3W79A 3CLHA 1P33A 4LOKA 2ROQA 4JB2A 4INJA 4YRIA 4ZVQA 2YV4A 4R3NA 1D6JA 4DV6B 2QUBA 1UP4A 2CB9A 2FSFA 5I8WA 1LGYA 1XQYA 3OTGA 3GN2A 3MMZA 3FSGA 2XH8A 3HV0A 5AOVA 5EZ6B 3HABA 1GL3A 4QREA 4BFTA 2JAXA 1QM5A 4QECA 1V0JA 2OAP1 3MWDA 3V2IA 1ZGZA 1RRVA 4J7CA 3UUGA 3WY9A 3EIUA 3A31A 1G2OA 2HC9A 4AIIA 2RE8A 2OXRA 4PY2A 2QTWB 5AKJA 1ZONA 1YRWA 4CG3A 1DJMA 3U7JA 2NTJA 4HJXA 2XKBA 1PW5A 3L6DA 4IHQA 1THGA 3S2IA 4BFWA 3ZIAD 4F93B 1JT2A 3AZQA 3UWSA 4BJ6A 5FWDA 3R5JA 1EVEA 2J5RA 4ZI7A 3PE3A 2VSOA 2F43A 1G5QA 3D5QA 2VSNA 4V0SA 1YHNA 3U1VA 2XWPA 1W5TA 3ZV7A 1FNSA 3UAYA 1ZMOA 4C0BA 4LX0A 4LPKA 3UUWA 3WDLA 4TKLA 2RH8A 4V24A 4CMCA 2NPIA 1UZMA 2QQ5A 2HMTA 5K0TA 2WTMA 4WOJA 5CA0B 3N8IA 2ZRNA 1P0MA 2ZU6A 4TLBA 1JSCA 1KK2A 2II6A 4S2EA 2OC4A 4ZV4A 1OWOA 4U5XA 4Y1GA 3W4KA 3DVLA 1BU8A 4XIGS 1DDOA 2C97A 5BMOA 3UMRA 2V1XA 4IYJA 4BU1A 4C03A 5F2EA 1H1TA 3P2IA 2QN2A 3LVFO 3QPDA 4LNUA 1HDCA 3AFNA 3SXJA 4FR2A 2Z1NA 4MV9A 4F91B 3ICEA 3KXLA 2ECQA 1K8RA 1QO0A 3HN7A 3N6XA 3OHMA 4MO2A 3PUKA 3ZCXA 3C8HA 2O2IA 4F1KA 1G3QA 1SELA 1XXHE 3EFHA 3ZWQA 4EG4A 1SMKA 4GE3A 4FHEA 5E7MA 5JDCA 5JMWA 4EO9A 2DBRA 1CP3A 2OBLA 2ZBPA 4BX9A 1I4EB 2H2GA 1U8TA 4BOYA 3BWEA 3MHPA 3W2FA 1XTZA 1CFJA 3FRHA 3VPGA 2YFKA 3P0HA 1HT1E 4HLQB 2UUCB 3NHWA 1XCMA 3RS9A 2TMGA 3H75A 3MCUA 5JJIA 3WL7A 5K0CA 1LC0A 3I0NA 4FNAA 4JT2A 4EX6A 2H08A 3VV2A 1OI2A 3S4YA 3GEPA 1ADCA 4YR7A 4WXYB 2Q99A 4JNKA 3IQDB 1K88A 1EUCA 4I6JA 1U4OA 2R5FA 2WUWE 1GKKA 2YVQA 2JA2A 3N5CA 1I80A 4JL6A 3SVZA 4XA8A 4P8RA 1IQPA 4MROA 4N6NA 1X74A 5CT6A 3U1TA 1FSPA 1AN0A 1EPUA 1MQ9A 1QHHB 3MMPA 3EZ2A 3THRA 3USZA 5CT5A 2GK4A 5JSUA 3M5DA 2H16A 4FQ8A 3RRMA 3URMA 4AY5A 4EUKA 1ZOSA 5HNKA 2Q9BA 3TLZA 3UV6A 4BMOB 3KSBC 1QV9A 4EEZA 3W2EA 3C3CA 4V1CI 3RK0A 4DWVA 5JNWA 1J1IA 5GJVC 1UFRA 3TVTA 3WGGA 4DPLA 1HOTA 4BEWA 4GMFA 4DCSA 4D0LB 3E1GA 4H35A 2B35A 4PVDA 4WAUA 3TR5A 3I5AA 3PD7A 1ZN2A 4M1SA 6REQB 4XD7D 2BEJA 1GZVA 2PUTA 1F8UA 2QSUA 3GK3A 1D2GA 1O95C 4C76A 4CETA 2Y6VA 1P9NA 4LV6A 4EARA 1V9CA 4B3FX 3EG9A 1NQVA 3MHTA 2J5BA 1AXRA 2VJOA 3LBIA 4AF7A 4CKCA 4F2PA 3AXSA 1EVKA 1V16B 3HA3A 3LPNA 3H5RA 4EYEA 2WOJA 4W8HA 2V5AA 3FMPB 1ZN9A 2VK1A 2GPNA 4NDZA 3E9NA 2IT1A 1TO2E 4O2LA 1DO8A 1ES9A 3JRXA 4EF5A 3M3HA 3QVVA 1MB0A 4LMBA 4R4JA 4DHWA 1F1BA 1R0YA 3RAFC 3PDIA 1V37A 1WZIA 3FD8A 3G2OA 4DA9A 4JGIA 1PGPA 3MIIA 5DRYA 1C2YA 2FP4B 3W6OA 5BSVA 5JZMA 3DT8A 2J9YB 2PVPA 3R74A 1HDZA 4S1TA 4ENUA 4ESVA 1TTQB 1PG5A 4KH1A 2ORWA 3BD7A 3N9IA 1Z06A 1R27A 3GARA 3PHIA 3BFJA 3O8NA 4MPPA 2PH1A 1SQ5A 2WHEA 3AFGA 4MS3B 4RA9A 3M1YA 4TT3D 3RSFA 2P9FA 4ZZ2A 4BNVA 5HFNA 5JISA 5KREA 4Y6QA 5CDTA 2F1RA 4TYWA 1RP7A 2QR2A 3ZWDA 3OE1A 1J5PA 1PSZA 3ORRA 4BZXA 4HDRB 4CIBA 2WJYA 2FSVA 4EPVA 4D3YA 3P9NA 4PLYA 3MNFA 2IHVA 2D2XA 2HEIA 1EGMB 1IUOA 2FEXA 1IHUA 2A5JA 2W2QA 2ZJ1A 3DA8A 3OX4A 3QU4A 4L8GA 4ZO6A 4E07A 5A4AA 4GYKA 4RL4A 3SQNA 5J40A 4I55A 4JUCA 3HBMA 4EBFA 1HT0A 1W4RA 2FW1A 1MBZA 3EPRA 4G24A 5DNUA 3HJFA 4HTFB 2WIGA 4RACA 2YWRA 1W48A 3GGJA 3GJ6A 4GLLA 1W581 4B3SB 1F6WA 1T9BA 3G17A 2JW5A 4U6QA 5FPQA 2GN0A 4HCJA 4JR0A 2PKRA 4FE4A 4H7DA 5J3JA 2WUDA 5AUQA 2ZE6A 4J0IA 1MRZA 1B23P 2GJ9A 3VKVA 3BRWA 3E27A 1ZD1A 5H1YA 4E6EA 3A3YA 4ZCQA 1GLGA 3OE4A 3R5KA 4TZTA 3DWEX 1SIUA 2QM7A 1WNTA 5IWCA 3C3JA 1YQGA 4O2RA 1SKUA 5HBGA 2OZKA 3BJRA 1G3UA 4O5OA 2CHFA 4DLYA 2DERA 1PI3A 1FQKA 3KL4A 5AXBA 1KF0A 2PSEA 3VU9A 1VI5A 3BERA 5HDBB 3MGGA 4L6CA 1KFJB 5DM60 1XTSA 2FZCA 1E0SA 4JFAA 1V3VA 4H17A 4S1WA 4BLQA 3SJBA 4PPQA 1P4AA 3EWAA 3QLUA 3T06B 4B43A 3DPIA 2J85A 4N0QA 2SICE 5TGDA 2O7QA 1GILA 3TZQA 3LTEA 4JNCA 2OBMA 3IDFA 3QZUA 2Q45A 4ER7A 2FVYA 5BVHB 1WW3A 3RJ5A 1U0EA 4JLVA 5JQGF 1V6SA 1T34A 2A1UB 3A32A 3D1LA 3EIEA 1PDWA 2IFTA 3HM2A 3LDAA 1DEXA 3CC8A 3LF2A 2IW3A 3KYBA 4LS3A 2DSTA 1HKHA 4BECA 1UXJA 4H7IA 1H9CA 1R8JA 2AJ8A 1KI7A 1UBSB 2QI9F 3CJRA 4ZGWA 3KJNA 1T2DA 1YQEA 1A8IA 4O0LA 4KAFA 2HA7A 2Z04A 3A9TA 1D2MA 3P0EA 5AXCA 1BVRA 2GA8A 1G6HA 4LDQA 5F7OA 2QR5A 2W2PA 1NVUQ 1NHWA 3BF7A 3OEYA 3T38A 5A3QA 1E1QD 3T1HB 2V7WA 4TROA 5ARCA 2IV3A 3U3JA 2VA9A 1BW9B 1H0HA 4QXQA 1TGYA 4YIHA 4H7PA 1EP3B 1POXA 3UPUA 2GCEA 2BEVB 2VHWA 1AQYA 2AI1A 3PNKA 1R0WA 4OAOA 2PZEA 3I2HA 3IAUA 4N12A 3DAOA 4OQXA 3AFOA 4A73A 2P65A 1EK6A 3PNPA 4WZAE 4AW9A 3O84A 3PWSA 5B3LA 1JI0A 1T2FA 1ETHA 3M6FA 4MVJA 4PG4A 3VR1A 4OQLA 1N5LA 1LLQA 1NVAA 3B6EA 2CBZA 4BVEA 1BHQ1 2INGX 2OXFA 5GONB 2E1RA 2D62A 2RCNA 1Y3BE 4OMFG 2Q8QA 1KE2A 4EW2A 5JCJD 3M6AA 3F9RA 3CVWA 1FU7A 2VRNA 4FDTA 1CTQA 3V4SA 1CE8A 1SOVA 3DB2A 1K6MA 4LOLA 4J03A 2QR3A 2NZJA 3OEEA 4O2BF 3WLSA 4B3IA 2VRWA 5A3JA 4W5TA 1Q1ZA 1AKMA 2FWBA 2EKDA 3EIQA 4P2BA 4UM9D 2QLBA 3L02A 2V9CA 4EGAA 4PYLA 2QQEA 3PDHA 2HMUA 1RR6A 2DY0A 3WO1A 1JKJB 3M70A 1HF3A 2P2NA 3B20A 2PUFA 3B1WA 1Z5NA 3B1FA 4TQGA 3CONA 4O2BA 1Y4ZA 2ZW9A 3NC4A 5B4TA 3JQFA 5I4BA 1W85A 4GPBA 1KJYA 4WDQA 2V6IA 3DCNA 3VR5H 5IF9A 2Q3FA 3HCBA 4LOJA 3C2QA 1V26A 4IXDA 4DT1B 3A25A 1BXRA 2IF0A 1K7CA 3DE3X 4L15A 2QG6A 3GGOA 4EHLA 1RW4A 2J87A 3NWBA 1A8UA 1HFKA 1TX4B 1UPXA 1P91A 1ISFA 5AW1A 1SBIA 1O6BA 4CIAA 2JJ1D 4Q4AA 3HYLA 3AZOA 4XQEA 3QF4B 3L6EA 5BSWA 2ZR8A 3R0VA 4J9UE 4DTIA 2LNDA 2P9TA 1MNQA 1P1IA 1OZ0A 4ONEA 1YK1A 4FTWA 2YY6A 1Z18A 1MDBA 4U3JA 3WLTA 3HUTA 3OIFA 2CMFA 2RARA 4GLJA 4DR7B 3L6BA 3Q11A 3S40A 2A0YA 3GJRA 3IBCA 1JLLB 3LFTA 4FCWA 2FOXA 2JDID 4I5GA 1RLTA 1QIDA 1YZFA 4INOA 1G5HA 3UHOA 2DWPA 1AURA 3F97A 5DHQA 3GG2A 4FE3A 2WHPB 4MCIA 4BLTA 3SJAA 3VRHA 5DNWA 2DB3A 1JEDA 4TLAA 3N7AA 2ZLBA 4JI6B 1I2MA 3P9SA 3VFDA 5SZIA 2P8JA 1WMDA 4NYMR 1EM8B 2F3SA 4PZEA 4N40A 2OWDA 3ETGA 2NGRA 4EKEA 1NXXA 3VKGA 1IQ0A 4L2IA 1V4NA 4N3NA 1VLLA 3AI3A 3RAPR 4L3OA 5A1TA 3COJA 4W5OA 4UMFA 1P7ZA 4FLFA 2A3RA 3C6KA 4YQFA 5ADWA 1F2DA 4RF3A 5C35A 1OBFO 2Z2KA 1A4IA 3LCCA 5T4FA 4NIMA 1JZQA 3FJ1A 4UULA 2ZJFA 3TUJC 4BRSA 5EJEA 2WMDA 2Z3VA 1G8MA 1Y8ZA 2HHLA 2OCKA 2NU7A 4UBKA 4D9CA 3KQOA 1F14A 1N2IA 3D3WB 2HIGA 2VUSA 3BIFA 2OAGA 3QUCA 4YPOA 3KIPA 1TB4A 4IQ4A 4DW8A 1X2BA 2IOHA 1XZCA 4FBGA 2QRLA 2PKQO 1BH2A 3VSBA 4TN1A 1G20A 2ZR0A 1SVOA 2BZGA 3SKXA 2WTAA 2LE0A 4DIKA 1HC7A 2JLYA 3IB6A 2JFFA 1ONPA 4PTLA 1RC8A 1B6GA 3MINA 5IVDA 5IDQA 1D2AA 1YHZA 1OOEA 1Y4UA 1VTKA 4YYEA 5MN5A 1MO6A 4LF7B 4G0XA 3H9CA 4IZIA 4UASA 4L02A 3K6SB 3ZVMA 1ZK4A 4OI2A 1Z82A 4PAQA 4JX8A 1QWOA 4QDTA 2ZRQA 3FHLA 3V9PA 1M0WA 4XFJA 5K20A 1XCOA 4XW2A 2X77A 2XZTA 1IN7A 1E3IA 1SC4A 1E6CA 5F64A 2OHHA 1VECA 3IIJA 1C3JA 3RYCA 4EYOA 1NJGA 2PQMA 4DBLE 1F4VA 2IIBA 4PO9A 4PBRA 4FUQA 1B76A 2ZAMA 2J9ZB 2B7BA 3JATA 5EN4A 3G0CA 2VRCD 2JAWA 1T1EA 3INGA 5DV9A 3KDAA 1CIJA 3VGPA 5KI6A 4DV3B 1A5TA 3SYRA 1IZ9A 1S7GA 3ZZMA 1TA0A 1A8QA 1PLKA 5THXA 4AS3A 5HOQA 3ED5A 3FG9A 1YJAA 4UOZA 1HYBA 4ND5A 2Z57A 4EHHA 3UHFA 3K0CC 5AOAA 2FPOA 4LC9A 3VQTA 2XE7A 2V4MA 4Z4GA 4MGHA 3BCSA 3OIWA 5ALSA 3LWDA 4D56A 4HDQB 1DKRA 4OJQA 4QQFA 1BSVA 2HIMA 3KZMA 5CXSA 3KYJB 2QHXA 2XKAA 5E6SB 1H2RS 4QXRA 2X7HA 3PUHA 1DQZA 1GPNA 4H1UA 2QD5A 5IRCD 3JQ7B 3KWLA 3O38A 4P5PA 2V4UA 2C2OA 3IAAA 4ZQIA 3UTCA 4XDZA 4JC5A 2EJTA 5B1IA 1QPGA 5EKDA 3G0BA 1C7ZA 1YE5A 4RTKA 1I7DA 2F6RA 3BFPA 4Q3LA 4M7WA 4B48A 3KQHA 2IYSA 1W29A 3MJSA 1LB1B 1TQ6A 3DEHA 1XTJA 2GEJA 1GKIA 3HUUA 1PAUA 1YFZA 2I0FA 4TXMA 4CKWB 2AVDA 1RKQA 4EZIA 1DTSA 5IFKA 2IE8A 1KZ4A 1NW5A 1ZXBA 2Q8NA 3TH5A 1F8FA 3ROGA 5JUWA 3AJAA 1USKA 4L9SA 1NDUA 2DYKA 5LKAA 3TIIA 1TO6A 4XDHA 5IEBA 2WPDD 5JYCA 1GU0A 2ZJ3A 4M8LA 3SYKA 4RL6A 3VDRA 1SPXA 4JT4A 3KAJA 1EE1A 2HRBA 2IP4A 1E3WA 1E2PA 2I29A 3HB4X 1B3RA 2GVZC 1WP9A 3B3AA 2P9ZA 2C7BA 3GP3A 2EX0A 3QLVA 1PL8A 3S3TA 3SXUA 5ITZA 1LJ8A 4S04A 3IIMA 1GEGA 4A2WA 4ZYXA 4DXAA 1K68A 4J29A 3RBZA 3TQFA 2P6OA 5EXPA 3K0FB 2BFCB 1ZGBA 3D0QA 4Q9DA 2JFQA 5ITSA 2QSYA 1AMNA 4F9EA 5IMBA 1WF3A 2VIIA 2HGSA 1WABA 1MOZA 2FETA 2AOTA 4Z86A 1VA4A 4MK4A 2QW1A 5CW1A 3F1LA 1P75A 4WBNF 4LXHA 1M75A 5YASA 1IBMB 1PQUA 2QAGA 1P80A 2ATIA 3DS8A 3I2YX 9GPBA 3U7QB 4A27A 2Y76A 1HO3A 2GBGA 4D9MA 5AVTA 4O4HB 3ESZA 5BPFA 5L53A 1UT6A 4HAVA 1ZCJA 3BIWA 4G3XA 3PNQA 4WLVA 3RVQA 2K7FA 1NNSA 2XBLA 2I4OA 2JHCA 1LTKA 3BMQA 3UG6A 3SC2B 2PKEA 3G82C 3VYTB 2Y0DA 4E31A 4EJMA 3E35A 1JDPA 4Q7MB 2CVQA 1MR3F 3ANXA 5CLLA 1ENPA 2H54A 4LE0A 4RWEA 5K3AA 2ZIFA 5E4JA 4ARZA 3VC7A 1W0JD 4A91A 2O2YA 1P60A 2NX2A 3MLBA 3VHRA 5B58T 1DXOA 2Q1UA 5D5QA 2MSNA 2HZ7A 1S2NA 4EKNB 4FYKA 4MQ4A 1M10A 2QVBA 3BKWA 1JI3A 3ISTA 1BDMA 1I7NA 3NFRA 1Z45A 3BJEA 4EKIA 2HV8A 4UVIA 1E8NA 2FJPA 2ATXA 3ZV6A 3WRYC 2LVBA 1KO7A 3GAMA 1PDVA 1AGYA 1GNRA 1I10A 1V48A 3DLIA 4V2IA 4BLWA 4P54A 1YHYA 5TARA 1P0QA 2GEBA 2EFDB 1QJCA 1P7PA 3VVCA 1QLHA 1VPLA 5E9WA 1QFYA 2VHVA 3B38A 3AY3A 3CR8A 4KSYA 5ICEA 4DLRA 1KYWA 1MAWA 3RU7A 4U0JA 4UTVA 2ZYWX 1JHXA 1QFSA 3LHIA 1ZWLA 4UHHA 1TYCA 3EUEA 4J0FA 4OQPA 4PGHA 3IAXA 2HSJA 4NMHA 2QMUA 3KQMA 5CT9A 4WEOA 1QFXA 1TM3E 3OMXA 4TX1A 4L4SA 4OHBA 3T12A 4MUFA 1RXEA 3T4PA 3VDMA 1L5VA 5B7NA 1MJNA 2XDAA 4QGGA 1WV1A 2VBGA 2NAFA 2V3VA 5AI0A 4NJOA 5KSZA 2AZXA 3WKCA 4GPTA 1NW8A 2CY0A 1J2EA 2DQSA 2OHGA 3AL3A 3VZSA 3MRXA 4DLZA 3LQ1A 4YRPA 3RSLA 1TZCA 1G5PA 4YQZA 2BBSA 2GPAA 4YT8A 2ZBVA 4K88A 5C8XA 5U4XA 1QGZA 3OZBA 4G23A 3V7WA 8ABPA 4HWOA 1HZZA 5BN5B 4OM7A 3SZRA 5CA1B 5HUHA 1V47A 2CXSA 1GGEA 4MAAA 2GD6A 5AHWA 1EAMA 2QMHA 4XM0A 2EFCB 3SOPA 1D8AA 1GV0A 1VIMA 4NFHA 3PYMA 1QGOA 5CFOA 4EJSC 1B6RA 1S2MA 1TJPB 1ZM4A 2ZIGA 3EMKA 5KO2A 1X80B 1TVEA 2G40A 3CF0A 4ISCA 1I01A 4P3XA 1U9CA 2IX9A 3H1GA 1UDBA 1NUTA 4N9WA 2LDBA 1VKRA 4ZEMA 1J07A 1XYYA 3KXIA 2J31A 3VVLA 2OBYA 4F7DA 1Y6QA 4BB6A 3WAGA 3AR5A 3IRVA 3LDHA 4HNHA 2WICA 3LQFA 3O3OB 4M8KA 2AEJA 1Z7GA 4RDIA 3RJMA 1VBMA 1R8QA 1LVGA 4OBEA 2G3YA 1OLUB 3ROZA 3D8SA 5IU6A 1WHSA 3GVPA 2R6JA 2HIHA 5K0FA 4LF6B 4Q4JB 3K2IA 3ANTA 5IAAA 3FYHA 3ENWA 4KDEA 4ARIA 2XE8A 4MS4A 3KR0A 4DWJA 1U8AA 3BVPA 1TIBA 5DWQA 3ZQUA 2RCYA 4HUTA 4UTZA 5DCUA 1KRHA 1PF7E 4OFWA 2PUCA 3HFGA 3TVYA 1AZTA 3IOCA 2X1HA 2EBHX 1CIVA 1FLNA 3LUBA 1HG0A 1E1QA 4YDHB 5TQ0B 5C4MA 1L1FA 4CGZA 1DXHA 2I33A 2YZMA 4XFDA 5JPCA 2GJ4A 2C07A 4KI7A 1T9AA 3I0ZA 2EOAA 5JDCC 1O0CA 4RD1A 4Z7OB 1XG5A 1A72A 3A2MA 3LUHA 4LTNA 1EFKA 4PCVA 4UBLA 2H2WA 5TDHA 1RXUA 3OG9A 4FOPA 3FCSB 4X61A 4ZVNA 4H4DA 1Z36A 3I76A 5JCJA 3ZC3A 5FUWA 2B7LA 3ER6A 2DWUA 2YVLA 4G25A 4IDHA 4OHKA 4CM4B 1YZTA 1JR3D 3GRYA 1QKJA 4MB2A 4DR2B 1NYTA 1CQXA 1DFHA 1K06A 2GB4A 2RAVA 2VO1A 1N1EA 5L6MB 1RZ3A 4BNZA 1Q7CA 5DLDA 1HV8A 2F90A 2O7NA 3FXAA 3FCAA 2NSHA 2PH5A 2FPLA 1XZAA 3H0CA 2FJUA 2XUHA 1JFFB 3FTNA 3RHFA 4CF6A 3TX6A 1XNJA 2POCA 1QQ7A 4ND7A 4M1EA 5KUTA 1WQ1R 1L4UA 2WE8A 2Y1WA 3D59A 1M76A 2M2IA 1GTVA 2YNMD 1JG7A 2ABWA 2Q49A 1G3MA 2QJTA 1EVIA 1VKJA 4I1OA 2GRUA 2NTNA 4K9NA 5A4DA 5EE1A 1KR2A 3GMTA 5FT9A 4RF5A 2CHEA 1CR4A 1G66A 1CUDA 3RD5A 4E70A 2BTEA 4OMDA 1ST3A 2HO4A 3GPIA 3S7ZA 3B60A 4MICA 4BZWA 4D3XA 2A2ZA 4YMIA 2AW3A 4DL9A 1FNNA 2CDAA 2ZYAA 4REOA 1PFQA 2D2IA 5FBHA 2PL9A 1A5SB 4FKBA 4M60A 3TTVA 3R77A 5LC1A 3ROEA 3MD0A 1LH0A 2GBIA 4W8OA 1RLOA 1SHTX 2VPZA 1U0HC 3GZNB 1JWBB 4HFRA 4P7KA 3TJZA 1W8IA 3IHTA 1YFLA 3QV2A 4RTJA 1XTPA 1GYQA 5BW6B 3FETA 1CVIA 2JHGA 2LWIA 4Y6LA 3IUQA 4I1UA 3MQFA 3D8NA 1WDKA 4MV1A 1RIFA 1M8JA 2GK3A 4V02A 4AMYA 2FUNB 2XQJA 5CXXA 9MHTA 2C3OA 2AG0A 1C1DB 2NG1A 1XD9A 2WKPA 5D7NA 5JS6A 3NTRA 4UVEA 5D3MA 1XNQB 3IOBA 1QIKA 3R4VA 4YI5A 3W5DA 4EGSA 3T1OA 2G80A 2DWOA 3HZRA 2CLLB 4EPWA 2IK8A 3PIRA 3W1WA 3ZGZA 3DZIA 2ETXA 3AI2A 1LW6E 5ILQA 2B37A 3K8OE 1DKUA 3MCWA 5EMNA 1U7PA 3TRJA 2OEPA 4I50F 4PICA 1IHDA 2BBWA 4MQFB 2HEGA 4KRFA 3J7TA 5FYDA 1T9DA 2VNHA 4EGCB 3RRFA 2OV1A 4ER6A 5JEEA 2N75A 1HYEA 1Y7TA 3EZ6A 5J2TA 1THMA 3IKJA 2X7JA 2GA9A 1RI4A 5AW7A 1XDUA 1B42A 1PQPA 3O75A 1KAHA 1S89A 2HCJB 2IKQA 3C3YA 5KNBH 2FZ5A 1XWWA 2BFFA 1CQIB 2G6BA 1K0UA 1I33A 3FNQA 3SLKA 2ECKA 3DV2A 1AB6A 1UXKA 2JGJA 3ESXA 3H2HA 4MVJD 1F3LA 1C0PA 3CY6A 3TSOA 2H9IA 4WOPA 4O4LB 5AFSA 3LC1O 2BEWB 2XMGA 4DIFA 1JG6A 1LSOA 2ODQA 4HAIA 3LFHA 2HLPA 1ZM3A 4LXIA 4JV5B 3S70A 1U0NA 1CW2B 2BP7B 2QGFA 4HH3C 5GVRA 1RWXA 3NNNA 1YWGO 1NPYA 4KK3A 4LE1A 5FHRA 1V1RA 3TEJA 1Z83A 1X9HA 4OA5A 3TCXB 3DOEA 3KDSE 1QX4A 1RHKA 3RK1A 1UC8A 1HNNA 3BICA 4KE7A 3HXMA 2ZJ2A 2GD2A 3R7AA 1T9HA 4M22A 4GOXA 1O97C 3TZHA 4BCCA 1P7CA 4LXGA 1MEOA 1DIGA 2VCYA 3CBQA 4KZKA 2R87A 3JZDA 1IOLA 2WE7A 4L8WB 1PEDA 3ANYB 4MR9B 5EHNA 2PMEA 3T7JA 5I9IA 3OZXA 3HLTA 3NEPX 4I1YA 3W5VA 4NCXA 5I51A 3QVWA 2K6GA 4WZZA 2VATA 4F8JA 3CG0A 4NFLA 4BRUA 3N2LA 3BGDA 4K9OA 4LPSA 3EPPA 4C4RA 5KWEA 1Y8CA 1TA9A 1H42A 1IB0A 3O9VA 5AKGA 5B3JA 3KQUA 3BGOS 2WV9A 4JODA 1IATA 1YGYA 4JQCA 1KU6A 2C92A 1WSWA 2FFHA 4L4ZA 1QO7A 4DE5A 1U0GA 1FY2A 4EFNA 4CF5A 1PR1A 1FYWA 3WK8A 5BR8B 2BH9A 1G9XA 3RVLA 4LUCA 4YC7A 3O0DA 4DGSA 4UD2A 1E5QA 1JJBA 4CF4A 3OD1A 2G5GX 5ADHA 5EZ5A 3PNOA 3UATA 4BV9A 3B70A 4LF5B 4ZAZA 4AP5A 4TKUA 5FJIA 3ESRA 4P38A 4RS3A 2D6FA 4EYKA 2OCXA 3LV8A 1OKKA 3MAAC 4WT7A 3T3GA 2DR3A 5JU6A 1NU8A 2P9JA 1BMFD 4TSFA 3GJ4A 1LX6A 2PE5A 3OT5A 2H4ZA 4NU8X 3G2NA 3WIDA 4EY5A 3AM5A 3ZWNA 1CNFA 1E7MA 2VP6A 3LG2A 3WGHA 1DCTA 3QFRA 3IMCA 3D7RA 2QVYX 3SSNA 3G8DA 4JZYA 3DD5A 2FPGB 3GWZA 2RONA 5K6RA 1P4HA 2J33A 3BQNB 4M4SA 1DO2A 3FA2A 1PS0A 4KXUA 2HKIA 2CLHB 5TLSA 3NVKI 1BRTA 4M9QA 4DV0B 3HO6A 5CGZA 2CJWB 2R4UA 3DZFA 1OH7A 3D3EA 1R4MA 4HB4A 3U17A 4F04A 5JVDB 2NU6B 4ZKEA 5BT8A 1H8ED 4IXWA 4DYHA 1R6XA 4DLPA 2CXTA 3W6UA 1PTJA 5HZKA 2DKOA 4O29A 1U2GA 3E22B 4QDUA 2QRPA 1S3GA 1YV9A 2G70A 4LY6A 3WL4A 4ND8B 3BJIC 3KQLA 1XC7A 5E1DA 2REQB 3OM0A 4RSGA 1Q1AA 2OA0A 3UH0A 4Z99A 3EXHA 3CB2A 3QU9A 4MW2A 5K6AA 1I5OA 3O8QB 4EHAA 4R1QA 4ZRMA 1E2EA 4KQHA 3NR2A 1U2EA 4HNAB 4EHBA 2RK4A 5HHTA 2I4NA 1NNLA 3DPSA 3TZBA 2BZ0A 4J7UA 2ECFA 2HCTA 2XPCA 1V5EA 3KALA 2PL3A 3UMSA 2PWYA 5T6MA 2IHJA 2QS9A 1XBTA 1S8OA 4C9BA 4MCHA 4RKWA 4UE6A 4W5HA 2BM9A 1ELOA 4BO7A 3HKEA 2XLBA 4WZBE 5GMOA 5LOVB 3ZY5A 3AERA 5FNVF 5F3RA 2HV9A 1TKCA 5FOVA 1GTL1 3ZS8A 5BUSA 2ZI5A 2W6IA 1JAIA 4R1MA 1DQYA 4X3PA 2IHKA 2O20A 5DEOA 3DV9A 2I5PO 4KLRA 3NDPA 4NC9A 4X9XA 5FL3A 2AFIE 2O7RA 2KE5A 3RVJA 4EVIA 4FFMA 1EJ6A 1HORA 1KAEA 3GI1A 1K3TA 3GRPA 2XJ9A 5BNFA 3PHCA 4JLKA 3V2UA 1CZNA 3EDCA 2DETA 1EP2B 1G8PA 2CXQA 2HN9A 2JF0A 3E6AA 5A7FA 1YKFA 2G4VA 3DDNA 1MX5A 1L7PA 4M37A 3RTGA 3W8FA 4ZCRA 4NV3A 2ZYSA 1M6EX 1GJRA 3EDOA 4L5JA 4ND2A 4Y2HA 3N0VA 3VMFA 2ZRCA 4AJJA 3CVVA 2F8SA 2IQ5A 4FOLA 1ZVVA 4F72A 1BXZA 2YBDA 3EAQA 4L85A 2PZAA 2QRNA 2RGGA 3QXHA 4Z2YA 4PRYA 4QASA 4WD3A 2ZDHA 3TAXA 4ZVTA 2ZITA 3TNJA 3ZWMA 3CFYA 1JFLA 3CH6A 1A9TA 3ISVA 1ZP6A 1X1TA 4MI9A 1XT6A 4RXTA 1FJ2A 1BVYF 1SO8A 4LJKA 4YJ3B 5DHPA 5K8IA 3ZXUB 3QMMA 1QORA 2GO1A 4I5EA 3SFZA 1YQQA 1JJAA 1U9IA 1LPPA 1L8AA 2VHYA 4O08A 2EYQA 4G9GA 4PGMA 4Q1FA 4L51A 4WLNA 3JQGA 1R6DA 4UDXX 5IT4A 5L3SA 1WDLA 2YXDA 1KEEB 2AZMA 2ONKA 2I8LA 2IOFA 4I19A 3RWBA 3W7BA 4B4WA 4B84A 5JYBA 3U61B 4BXOB 1N7IA 5GJWC 2QWXA 1JVBA 2P77A 3G2HA 1Z0DA 3MYRA 4FW9A 3UB3A 1AUXA 4AROA 2OXCA 2QTBA 4CHGA 3D6VA 2HQOA 3F3MA 5F4BA 1KORA 3KKMA 1Y34E 3U13A 5L7WA 3P4UA 6ABPA 4IJKA 3WLAA 3AF0A 4YBRA 2HXGA 1KJNA 1KAMA 1Y5IA 3LZCA 4MVWA 1GM5A 5HIIA 1A1VA 1ISPA 1TAHA 3MQ4A 1Z7EA 1XZDA 3O2NA 1QMPA 4CEIA 3KPJA 3E2MA 3BMOB 3UCEA 4M9CA 3DUFA 1IEQA 1Z47A 1MV8A 3A27A 1JSXA 1NFQA 2DBQA 3FAZA 1MO4A 5KQPA 3LE8A 3EMVA 3O4JA 4L28A 5BNIA 4JXZA 5IJAA 2ZJ6A 4HJRA 4ENRA 4KGVA 4LC1A 4MRVA 3O6VA 3L9XA 2NVOA 4IX9A 1A4RA 1N3YA 1AGXA 1H2HA 2FDRA 2Q2VA 1EDDA 3JD2A 3AUKA 3PWTA 3V1MA 3WBBA 1PS9A 3ABQB 4L4RA 3OZFA 1RRKA 2QNBA 5HPYB 4NXMB 5FF9A 3KB2A 3L8YA 4NMLA 5KQSA 1GCIA 1XEFA 1E6EA 2PT6A 2ZBQA 1SC3A 2FP3A 3E0QA 3DGFC 4PX3A 2MOKA 1GADO 1SBHA 3OE7D 3QEAZ 1A5ZA 2F8TA 5C5CA 3QYJA 5CDSA 2OV6A 3GLHA 1H3FA 4A1OA 2HK9A 1PQYA 1VJGA 1VKHA 2O2HA 5GONF 2X9LA 4CCYB 5KOYA 3QEKA 4RA6A 1BE6A 4JQOA 4PXSA 1FP4A 4M9UA 3DFKA 5BYKA 1W85B 2FZGA 2H1VA 3IT0A 4B3BA 5IM4F 2AOWA 1JAYA 2W6JD 4FYYA 1OTYA 5C0OE 4C5BA 4X3OA 4ZK6A 5IS2A 1CV2A 2LTAA 1DPFA 3IQXA 3NKLA 2PKXA 3T1YB 4LNUB 4EHFA 3PKJA 1N32B 2I87A 2F3TA 2C5SA 4F9FA 3DR3A 3Q12A 1F9AA 1VMAA 2BHTA 4FFDA 1A82A 1QGED 4ZP1A 3UUEA 1T0UA 3MTGA 4WCDA 2FMFA 1BXRB 1NQUA 2FN3A 2G25A 4N8SA 3U4QA 3GRUA 3IVRA 3KEGA 4DDVA 4XJTA 1VSVA 1C30A 2GK6A 2WHXA 4NE7A 2XQFA 5G0WA 3DCJA 1KQOA 2X6RA 3GRAA 1NUPA 1XRMA 5JHGB 1SCJA 5EJ2A 4HLCA 4OJTA 4MWSA 4FZJA 5JNUA 1HDYA 3Q98A 2HYDA 2I1QA 3E53A 4EY7A 4BV8A 2X8JA 5GOTA 5IM5A 4H0CA 4LRTB 2VYND 3PC3A 1IJEA 1SCKA 4QGHA 1IG0A 2X5JO 4PVCA 2WSBA 1Z62A 4TUYA 2PKCA 1HMYA 5F52A 1KOFA 1SHKA 5M04A 2XZLA 1H6AA 3OF2A 1AO3A 1BN6A 2RH4A 4YCLA 3S2GA 5IDVA 2D4AA 4G1UC 5KSOA 4E6PA 1RSZA 3QKRB 1EWYA 1M2NA 4PCUA 1QHXA 2Q3DA 1IUNA 1EQ2A 2GFIA 2P4UA 3KJEA 5H9VA 2ZPUA 4O2AF 4BQEA 3FZGA 4G84A 3I3OA 3UJHA 1BC5A 1VIYA 3PWZA 3LRTA 4PG5A 3RM3A 3ZDDA 4WCFB 2Z8YM 4WY5A 4B4VA 5FV7A 3NHZA 1G2QA 3E81A 1C1XB 1AKTA 1NF9A 1AHHA 2G9UA 2R8PA 2VJCA 4QFCA 5AXAA 3TQSA 3ZR4B 1R37A 2AZTA 3WGQA 5JBQA 5JI2E 5K3EA 1HLDA 2ZJ5A 4UPDA 2QRUA 4N76A 1QONA 3B5IA 3QLVC 1XYVA 1WS6A 1F9EA 1YTLA 1HXHA 1S2GA 5C8YA 3I9V1 2ZIEA 4BBAA 1Y3FE 5D51S 1JHPA 2PZKA 3DE1X 3TR6A 1JS1X 2NT3A 4A0GA 3MZ0A 1ESZA 1HZZC 1OWPA 2C4UA 2R1ZA 2NYRA 1DX9A 4D8VA 2JLCA 3K8ZA 4M6WB 4NQRA 5ALOA 1WUYA 1OX4A 4R2WA 2OHOA 1X8XA 1QYVA 2PSFA 2X9QA 3NASA 2Y4OA 4IVNA 4DCGA 2O8FB 1N6HA 2ORYA 2P9CA 3AERB 1BEZA 2FMXA 3ENNA 1KI3A 3WIBA 4HG2A 1U98A 1YJCA 3ADKA 4NYIQ 1JPVA 3CEJA 3K72B 2P6PA 1YIDA 4P08A 5IBRA 3RT9A 5DM70 4XUEA 2IPNA 2Y0CA 1KQNA 4QFBA 3L7YA 3L93A 4QEKA 2FPIA 2HNKA 2Z3ZA 1ZU5A 1NYRA 1P9OA 2N1MA 2Z4RA 4L07A 4WJZA 1CJCA 1TU4A 1WZUA 2P2SA 3IT3A 1MAVA 3A37A 4JLMA 4JT9A 3BH7A 3IS3A 4OB8A 1SXQA 4Z1MD 2YRXA 2ET6A 1FQWA 1GR1A 4MWDA 4XXHA 5K3OA 2RAPA 3DJYA 2G77B 2ZM6B 2ZBGA 1Y42X 2N0SA 1E1YA 3BWXA 4UBMA 3VZQA 3L0CA 5AD1A 3IEXA 2HH9A 4QGAA 2EZTA 5FO1A 5KOIA 2BONA 2PS9A 3FDXA 1C30B 1EA5A 4CCAA 4FT4A 1P7YA 2IDZA 2RHRA 3PTZA 1OT3A 5TIIA 3RLFA 3ZIAA 3R9XB 1XIVA 1TIKA 1YBHA 1P6QA 3G7SA 2BGRA 4IDCA 4X8HA 2OP1A 3OEWA 1ZD9A 4D99A 5KOJB 4K3VA 3ET5A 2WVAA 1KI1A 4AN1A 1G17A 3TZLA 4QVIA 4TYYA 2JFWA 1FP1D 3CB4A 4A23A 4OK5A 1VCHA 3THSA 3L4BC 1I3LA 5KWSA 2WFMA 2OUIA 1MVNA 3WK7A 4HQ6A 1E9DA 2CZQA 2FGJA 4RTNA 1MW8X 1ZRNA 3EH1A 3GFSA 1M34B 4UJ3A 1BZYA 1EVZA 2AOUB 1KRWA 3L2OB 4N0MA 1UC5B 4ND4A 1VSTA 2EEPA 3AHHA 4CYMA 4N48A 3GJ3A 1T26A 4PC3A 3BXHA 1NV8A 4UDNA 2EG9A 1RYBA 2FPRA 2XMPA 3G5AA 4X90A 1W7AA 1GZ3A 2O6HA 1GNLA 4R16A 4UC0A 4KREA 2Q2NA 1UKYA 3E5MA 4PCLA 4Q15A 3WYEA 4D8TA 5A9RA 1RRCA 5JDIC 4BTVA 1C9JA 4RVSA 3CLUD 2PZ8A 4OOFA 3TQCA 1UP6A 2CEKA 8LDHA 3Q3EA 1LLFA 1XKQA 1JQDA 2K5UA 2H1RA 1E7QA 1NMZA 4ZO9A 4C2TA 4QPNA 1W1IA 3BD9A 1Q74A 4J75A 3HKDA 1NBIA 4U6SA 1KI2A 3FCEA 4GIBA 5F9MA 1MGOA 4ITRC 3V6MA 1IIBA 1MUUA 3OQVA 4U3JB 2Y8EA 2WHYA 5EJMA 4E5PA 2A1IA 5KC8A 1UMDB 3GLUA 5MF6A 2AMYA 4P80A 1IY1A 4EY6A 1F6DA 3H6GA 3ZS9A 5LQDA 1X8LA 2IXFA 4HAZA 1ZNZA 4WKBA 3TVDA 4DN6A 3RREA 4Y6SA 3WP1B 4YJHB 5GOZA 3CKLA 5JMOA 4G26A 1D6NA 1T5OA 3KAPA 1SCAA 5JROA 3K70D 4PQGA 4GLOA 4QARA 3F46A 4E3WA 4CMIB 1OLSA 3S2ZA 3GL9A 3SEQA 3OTIA 5MFPA 2C8KA 5C37A 1RDFA 1RNLA 2IIQA 3NATA 1OGYA 3WJAA 1DCFA 3DO5A 3N58A 2CXXA 1MRSA 2BYTA 1FBTA 2YZKA 3SD7A 2VP9A 4Z4QA 4Z4EA 1Z13A 1GA6A 4MGZR 4TKVA 1BS2A 3ILYA 4P5DA 1P6UA 4GD3Q 3OLWA 3OJFA 1RHUA 3LGSA 1B14A 1Y1LA 5JAIA 2HCBA 4H7HA 1M2GA 3BPSA 3U31A 4K9QA 1EM6A 3BYZA 3FX2A 1WD5A 5FWXB 2Y2UA 1KEEA 1VCNA 2V59A 4IIHA 3G9TA 5JLJA 3NTVA 3QVKA 5E1OA 4DY6A 1J25A 2GXUA 5EXDA 4FCTA 3NETA 3H9UA 4QVGA 1KBOA 2AC7A 2DOKA 3Q5DA 4RTOA 1S02A 4JHLA 1TZJA 2HQBA 3D6TB 3ROPA 2VJNA 3PEEA 1JSRA 3OJ0A 1BMQA 4AN0A 1UC9A 1AD2A 4ETNA 4DIBA 1UBGA 4BB0A 1VLMA 4FI3C 4QTXA 4HVLA 1B74A 1KJQA 1MH1A 2GM5A 2QL7A 1NFFA 5A71A 3VU1A 2Q2WA 3ZDXB 5HIAA 3NAMA 2OESA 5EESA 1S8FA 2C8LA 1GPAA 5KWJA 3KR2A 5I9MA 3GUYA 4BO0A 3F7TA 1LDGA 1OJLA 1TQ2A 2EL9A 2G82A 1H2AS 3HHPA 4OREX 3TQHA 3A1DA 2Z9BA 4ZJYA 3OWXA 1RWWA 1SXGA 3QVGB 5T4HA 2BLNA 5JW6A 2PAFA 4XGKA 2F1KA 1I0IA 1T5DX 1L4LA 1Z4LA 3A06A 7YASA 4JYZA 2O14A 2R7NA 2PD3A 3U3OA 3RYIB 1UBUS 4JELA 2C3PA 4OK3A 1I7LA 2V65A 1AUQA 2C99A 3Q6NA 3AVVA 1A9XA 2QORA 1QS0A 5KKNB 3A9UA 1A5AB 1I30A 3IPXA 4XYBA 3V42A 1J8FA 1P5FA 3N87A 1ZH6A 2H4JA 3OM9A 3QKRA 4HKTA 1FYFA 3IIKA 1UOEA 3MM4A 1GNSA 4I9NA 3UJBA 3FCXA 2QN3A 2IP2A 4PAGA 3SNKA 2H6EA 5JFGA 1OYVA 1VHQA 3U39A 1IWPB 2RGNC 2XBUA 3IEIA 3P0RA 4LWZA 3UV7A 4YRZA 4AJKA 1E0JA 2EZUA 5I9SA 3P0IA 3WNVA 1M3SA 3Q0EA 5DBOA 3IE1A 2WM9B 1USVA 4DDWA 2M6SA 4QYIA 2VNIA 2FSUA 1RE1A 3EA5A 4P3NA 3A11A 4NPCA 3RIHA 2JFNA 1XA3A 5TQVA 3PFIA 4PN7A 3GLTA 1YVEI 1EZ1A 1IBSA 1F20A 1Q14A 3PENA 1D9ZA 2PO5A 1O08A 2D74A 3AOEC 3WGUA 1XMOB 2DR0A 1W2HA 3C85A 3DFIA 4IIUA 5IN5A 1Z5ZA 3IX7A 4UBJA 3WDSA 4H1WA 5HTOA 2GD0A 2G6TA 1TZMA 2WDZA 1X13A 3C43A 4ILKA 4M9RA 4O4IB 5J2UB 3CINA 4C1NA 1LPOA 4NZPA 3GOQA 3UV3A 4DZRA 1L4BA 4OQNA 4H60A 4U7WA 2F00A 3A1WA 4LJ5A 1I13A 2Q0QA 4URHA 1AQNA 2ATEA 3L6UA 5HFJA 2CV2A 2HW8A 5G0TA 4N47A 1XWIA 3TCNA 4UUMA 3ZDAA 1BVUA 1MOSA 1WEHA 3UGTA 5TV2A 3I4FA 1HDIA 5CLFA 4TRMA 5ALJA 4NBSA 5KOHB 3BCRA 3C3AA 5LDHA 3ON5A 2DCUA 1V41E 1AKYA 3PE4A 3H17A 4BFZA 3BXGA 3LU1A 2FY8A 2NV0A 1I6LA 4FUTA 4ZXFA 5IH3A 1N5KA 2B2XA 4MNTA 1NKSA 3ADDA 1ZY2A 1QF7A 2WSIA 3OKPA 4IINA 6YASA 2EQAA 3CEMA 4X63A 1LPSA 1BS1A 4KR9A 4H3HB 4J2HA 4X93A 2WLTA 2ECOA 3ANLA 2AG1A 3V7UA 1KTVA 1M1YA 4NYMQ 5KYVA 3JQBA 5LYYA 3P71T 4NPHA 4TN5A 4UUAA 1D4OA 5ECWA 5KMGB 2CXUA 4YK7A 4MUKA 1KJJA 2HWXA 4L5BA 5JCPA 3F6EX 2HRQA 1DPGA 5JOQA 2NVUB 5DM4A 1RJFA 1PQWA 2ZP1A 4LSWA 4BVJA 5LQCA 3N28A 3NBZC 4N0DA 3C0KA 4UQOA 5TJ9A 5JATA 2TRSB 4GKBA 1M6NA 1M74A 3USES 4CM9D 4FGSA 1GSHA 2J45A 4R1UA 5B3JC 3K1TA 3KLOA 2YNMC 1YBFA 4NK4A 5AJHA 2UVDA 4BFSA 5FLKA 4P83A 4TT3A 2RC5A 1L7OA 4KLAA 5FJJA 2WF7A 3SX2A 5TJHA 1I94B 3CJQA 4M1KA 1P74A 5JSZB 2WNHA 1IXKA 2RI6A 4UNPA 4X94A 1Q3TA 4G67A 4AF8A 3ITNA 2IUYA 1XHLA 5AVJA 2CYBA 4FMDF 3JQ8A 1KWKA 2CDNA 4LYYA 5AHOA 4HX5A 3WWCA 1SUEA 1EFTA 2IOYA 5CR9A 3PT5A 1VDZA 4EI7A 2BFDA 3B53X 2H9AA 3LLUA 4DNQA 2A0WA 1KQGA 2JK0A 5LR6A 3T9FA 5AW8A 3QJ5A 1G16A 3KB1A 5CDYA 1J9GA 4QELA 3KVVA 5A4MS 2RB4A 1C9MA 3E5RA 3NOQA 2Q0XA 4X3CA 2RFLA 1YK0A 4ME6A 5TPZD 1RE0A 3ZWCA 1SIWA 4A1FA 2VQDA 1ZOIA 3PFKA 4FSXA 5E3JA 4C4ZA 1GGNA 3P2OA 3TGWA 4IZHA 1NULA 4IDOA 2RKWA 4C04A 4CIXA 1X7ZA 1KS2A 1BGVA 1SQFA 4GVXA 4YRFA 1R4NA 2CNNA 3UK7A 4F6CA 3EGEA 2YUTA 2H07A 3H86A 1KMMA 3PHJA 4PIVA 1Z17A 4V0RA 4OHZA 4YJ2A 3GC6A 5TF4A 2JAPA 5C5DA 1L1RA 1T5LA 1MF7A 2OP0A 1NKTA 2PMBA 5K3CA 1NBME 4YCNA 1CZOA 4NFSA 4PNHA 3HB1A 2YN4A 2OXTA 2PEYA 3ZI7A 5KQMA 1G8JA 5KNLA 1QUFA 1QRTA 1H4SA 1CUYA 4UAVA 2P9HA 4LGMA 1QC5B 1QHHA 3UBMA 3OTWA 4Q3KA 1EJBA 5DMHA 5KVQA 4XWTA 3TXYA 1E5XA 3LXRA 4QBKA 3S8EA 1YGPA 2BR3A 4DMHA 2P5SA 1E0AA 3CLTD 2VZ0A 5DYIA 4L72A 1XEXB 4PR0A 4J1TC 3IMEA 4TTSA 3S1LA 3RYHA 4GMKA 4JGBA 3SQLA 4GEKA 3HDVA 5FOXA 1CRZA 4NMXB 4EB6A 1UDCA 4F6LA 1TAUA 3HEMA 3ORSA 4AY4A 4HRXA 1H85A 3AK4A 5L7YA 3IEUA 5E6UA 4NOKA 5MN6A 1U2ZA 4PGAA 3HR4A 1YQXA 2XSZD 1Y6JA 3IQEA 2IYUA 4LRQA 3R5HA 1C7QA 1EFLA 2B2NA 2E0IA 3BXEA 4MEAA 4QYMA 1MVLA 5FBZA 3AI1A 4V1CA 3QVMA 3IFSA 3OPNA 4MDEA 5EFOA 2C83A 3G89A 3P5BA 3R20A 1B15A 1AGRA 2X41A 4IO0A 4LXTA 4PZ0A 2EIXA 4W6ZA 5FAXA 3RBXA 4BAUA 4JC8A 4UXHA 2VNJA 1QDUA 2ID9A 4JLOA 2IH2A 1TW2A 1TCBA 1AU9A 3DMNA 1MO3A 5EYPB 2Y1FA 2NSLA 1YB6A 4A9AA 5AVXA 1SKAA 4ICIA 4FFNA 2BGUA 1P61B 2X8WA 5FI5A 3ORYA 4GR5A 4E51A 3USCS 1FFCA 4BQQA 2D0DA 4N8EA 3IESA 4F5ZA 3FBTA 1L2TA 1RFGE 1XRRA 4R0NA 2LBPA 1J6UA 2JHPA 3A3OA 1M5TA 4IMIB 4AWAA 1JDVA 2Y1GA 1PJLA 3OE5A 3B48A 4EA7A 5JBIA 5WRFA 3QE0A 4OXIA 2GVNA 4KODA 1WU8A 5CLHA 4S2UA 1XRJA 2V0CA 3LX5A 2GDJA 4QRDA 5LP6B 4BQRA 2Z08A 3UJ6A 4RIHA 4RPIA 1KKLA 2P69A 3GBVA 4L7VA 4Q82A 5LQUA 3N39C 1EHIA 1JDJA 4IIDA 5DH9A 5FTWA 1ENYA 4OHYA 2P2YA 3WLRA 4D26A 4ZO8A 3L6OO 1D9XA 2M1ZA 4K6OA 1YDMA 5F12A 3BWVA 2R84A 4KACA 2P3QA 1V95A 3IV6A 4B32A 3H6KA 4D97A 1N92A 2HYIC 1ZR2A 3R6GA 1V7PC 4P34A 1QK5A 1P0PA 4EX7A 4OGGA 4M9SA 4CM4A 1M1NA 3W3AD 4XSVA 3ND5A 3N8GA 3AHCA 2Q6VA 3WLLA 4YRBA 3GFTA 4J1NA 4UEJA 3T5DA 1YD7A 2C7VA 3CZPA 1CUAA 3GEGA 3A1CA 1ODSA 4IEIA 4MYUA 4C6HA 3R2JA 1SHJA 4FFSA 4US1R 1KK1A 1O5OA 3KV3O 4L22A 4TL8A 5AR1A 3AY6A 4J0GA 1XU4A 3OFJA 3KSZO 1ZNXA 1D03A 4L16A 4L7QA 4MLDA 2JFYA 2OVBA 3L43A 2B4RO 4GI2A 3KXPA 5FPKA 5CNIA 1DAHA 3KC2A 1KEKA 3EYWA 4I4IA 3ROXA 1J5EB 1US8A 4Z3KA 4TLCA 1YKSA 1N0IA 1FPQA 3W3AA 4ZYWA 5IANA 4WOBA 3FOEC 4EY3A 3QNMA 4FYMA 5BYAA 1C7FA 1FFSA 1QJ4A 3O1JC 5IX8A 4OIFA 3VR4A 1CJSA 3OZSA 1R9JA 3KS9A 3M4XA 3VR4D 1M67A 1VYUA 2OPBA 2PGOA 1H0SA 3JQAD 3GLHE 1ZGAA 2HAEA 2W2LA 1A9OA 3HUDA 3B3QA 3UM9A 3GLRA 1NJ8A 2CHGA 1A9RA 1TJYA 5K3SA 3IEMA 3HJRA 1GZ5A 4KI0A 1KO1A 4CQMD 1ZL2A 1RWVA 2OZEA 3GMDA 3LT4A 3MJFA 3LUPA 4HAUA 4UHFA 1KP3A 2JHFA 4A03A 3C3EA 2GAAA 4LXUA 1E9BA 2B5VA 3EZYA 3JD1A 4IVRA 4RU1A 2KBEA 3LSTA 1H4TA 5CB6A 4MQEA 1H2BA 5CYPA 5AKIA 2P5TB 5ARBA 4IDFA 1R64A 5BN5A 2QUIA 2Z0MA 3WV5A 1X9GA 3G1UA 5E2IA 1A04A 1VJ1A 2EDCA 2NZWA 4IRMA 4F6RB 1KZYC 1PYGA 4K1LA 2JLUA 1AE1A 1HE5A 5CCEA 2VP0A 1PT9A 2OCPA 3E18A 3ZH2A 1TJ3A 4YCBA 2F3RA 3V4OA 5CDFE 3DLCA 4N82A 1SM4A 2WAOA 4Q6WA 4Q12A 1DG9A 4S35A 1T3LA 5DTRA 4D4LA 4BQFA 3C6XA 3BXFA 1JTVA 1TLTA 2ZRDA 3EZGA 3CO0S 4XI9A 2XZPA 4IS3A 5C46F 2M98A 1IQUA 4LJAA 2FWMX 4IAOA 5FLYA 5ADUS 2NOAA 4C7KA 1C8BA 2V97A 3CXUA 2PIAA 4RKRA 4W1SA 3SZMA 1T2NA 1ML3A 1BG6A 1MORA 1UK9A 2O7VA 3VSEA 1PSWA 2GTIA 2VI5A 1JA0A 2C8VA 5JQGB 2H5EA 2I66A 2NIPA 2O52A 2FQ1A 4ZT7A 4MEBA 3U0VA 3A0UA 1PR2A 3CEAA 3RFVA 5ALXA 1M7HA 1HQDA 3VR5A 1EHYA 4CLHA 3C7DB 4MS3A 4Q01A 4RA9B 4YRCA 4A7PA 2WMOB 3IXQA 4R01A 3KQSA 2IZZA 1MEJA 1ZK2A 2DKNA 1C41A 1GDHA 1X7WA 4OXNA 1KO4A 2RHDA 4Q39A 2A6PA 4E13A 4YRQA 4R2HA 5JXHA 3I9V6 3CJTA 2D5BA 1ESDA 2FZKA 2P2ZA 4QHSA 1BYIA 4YJ2F 2VSFA 2DBYA 2YJ5A 3PE6A 4GU5A 2J07A 4Q9JA 1WAMA 2ETVA 1TPYA 2OV4A 2PS3A 4XDGA 5H9WA 3RPEA 1N5DA 3K9BA 2DEUA 2W2KB 5LP6C 1ISIA 3GCXA 5JZ9A 1N6KA 5JALA 2VUIB 5HDQA 2YXEA 2XAAA 3IAEA 3KLBA 2YWXA 5DX1A 4CFYA 5D85A 2B4QA 1T9ZA 4BQIA 5F9HA 4ZVOA 2FHPA 1DAEA 1AXEA 4HLDA 3U3RA 3V7FA 5JSQA 3IBTA 1XGKA 3UPDA 1FMJA 1VBFA 4HAOA 4F2DA 3HDGA 1JE0A 2CMHA 3UJ9A 3RHZA 4B6FA 4YAKA 2PSDA 3I37X 1WUHS 1EK2A 2QPAA 5AW4A 1GIAA 2A7XA 4MQBA 3GA5A 1SXJC 4ZQBA 1UAGA 3ZY6A 4F1JA 3EXFA 1NR1A 3PEUA 4REQA 5CX1A 3AG5A 3AV0B 3KWFA 4WFJA 3HM9A 2POQX 1MU0A 4D44A 3GDOA 3CGGA 4LTMA 5AWFC 2HSGA 2QVLA 5LZ2A 3FNBA 1X1BA 2Q1TA 1XVVA 3BQMB 3V8QA 3U80A 4KR2A 2AG8A 3GWGA 1VLQA 4H4CA 1N7HA 1UZAA 3WBKA 4ARCA 2Y71A 1L8LA 3HA2A 5FPSA 1YU9A 1QO0D 3M49A 3OUZA 4QOIA 4YDRA 4D3DA 2Q2OA 5AYVA 3F98A 2NAPA 3LP5A 5DXFA 1CS0A 5IPFA 3DMTC 3KEOA 5DM1A 1Q3KA 3LVBA 2BIFA 4HLNA 3OBIA 4KQ6A 2C9BA 4CIYA 5CVEA 4F1WA 1FNBA 2QTTA 1S4QA 5L95A 3LF1A 3HVJA 4JP2A 2O06A 3I9LA 3T3HA 3NAGA 4EGJA 2QQGA 2GJSA 4J91A 3WZ2A 2NU8A 4DV5B 2XDQA 4S0XA 2NUTA 2CK3D 1MKYA 4R2LA 1NBOA 1HFEL 3P45A 3OIVA 1NN3A 3L7AA 4AZWA 1PUXA 1MOQA 2EZ9A 2QZJA 5B6JA 1Z2DA 1KE1A 4IJ6A 4ND8A 2LV8A 3VR2A 3S55A 5IK2D 4NEHB 2OFFA 4PYKA 2XCSB 3CEHA 1Z0KA 2FRXA 1DRUA 2AV6A 4BO6A 3KOMA 1SEVA 1UXGA 4DLXA 2GJAA 3PQEA 3G8AA 3DFUA 4HDSB 5HBRA 3DQQA 5IAOA 3ZH9B 2O8EB 4JDUA 1X2EA 3WGYA 1M2EA 3CN9A 2ZTVA 1X92A 3DLBA 1KDRA 4R51A 3SF0A 2H8GA 2IEIA 4RD0A 4RZ2A 2ZULA 3BXOA 3KZNA 2WOOA 1DZ3A 3NCTA 3L1UA 2Q1YA 4LJSA 5KTRA 3F6CA 2BH2A 3DTTA 2DHCA 1T3HA 1U3CA 5FIUA 3GJXC 3MRSA 3WIEA 3QE3A 2CLFB 2RHOA 4I50B 4U2EA 3HYRA 1V7QA 5LDGA 1ZX1A 4OTZA 1OBCA 4BNWA 3QEMA 1C9DB 3FLBA 3L1IA 3L4BA 4GQIA 4HRYA 1WB6A 5KDLA 3DMPA 4RETA 4BIIA 1ZUD1 2PX3A 2XWQA 4NF2A 4RDXA 3I5XA 5GZ3A 3Q8LA 1G6OA 2X19A 2DUWA 2ZB2A 3CZRA 1AZSC 2WNSA 5GM1A 2VPPA 3SR4A 4LI3X 1H0KA 4EFDA 4RQUA 4RY9A 1WB5A 1E2FA 1RMQA 2YMMA 3QPWA 4QHTA 1XEWX 3FTDA 1G21A 3KWJA 5ANRB 5KNCD 4LHVA 3AEZA 3LXMA 1HTBA 5HOEA 5DCYA 2I9PA 5KNBA 2QROA 2GTHA 4PE5B 1FS6A 4LDRA 1FX0B 1Q0QA 4E5NA 4R54A 2QP3A 3C16C 4FS3A 3AEQA 3K96A 3SMVA 1OWNA 4CG2A 3G7NA 1KJWA 2WG0A 5CH3A 1ZGCA 1NW7A 2NO6A 4ES6A 1NVTA 2Z5VA 1M33A 3EUAA 3CUKA 3PUIA 4OHWA 1LJLA 2W6ID 3A2NA 4KXVA 3WJ1A 1GG5A 5BO5A 2ZKIA 4XKJA 5J43A 1P1CA 2P35A 1REQB 2IU3A 3NJ8A 1HEIA 4I5DA 4A15A 4DC1A 4K87A 4UNIA 5FPTA 2B99A 1Z8DA 1NJFA 1A71A 1IXYA 2WSSD 4HV4A 4OYRA 1SD2A 2PUVA 5CVDA 3ODGA 1OFHA 2HJHA 4PLZA 4EG1A 1XCLA 2FWRA 2G17A 4I2VA 2C5GA 4RJIA 3NKFA 3DGEC 1FLDA 3L1KA 2IPOA 5TMBA 1JWLA 3NX4A 1RAAA 3FMGA 3NG1A 3O83A 3TRKA 1BQ4A 3BHNA 1PWEA 3RDPA 1E1MA 1Y7LA 4NZMA 3VMMA 3JQGB 5MGBA 3OZUA 2F55A 2BEKA 1PN3A 1TZKA 3HQ4O 2XTZA 2E1PA 2BHRA 3HZZA 4JLSA 3F6PA 1OA0A 3ITEA 4WKPA 3VV3A 3ZNOA 1KA9H 2HMWA 3OF3A 3AB3A 5JRZA 1ZJZA 1GG2A 3AHJA 3H2KA 1XCBA 1RQXA 3K2QA 3IHKA 3FTEA 1TMGE 1UADA 5EE0A 4KKVA 4A0QA 4B2IA 1FMFA 5G3YA 5TE9A 4O0MA 1RJ9B 4ER3A 1XPUA 3HCAA 1XD2A 5DM0A 1JYSA 2FUG1 3VDQA 3VC3A 4ZOEA 1Q7TA 1PW7A 2P11A 1J2UA 5CBKA 4FKMA 1RWMA 3FNRA 5AUNB 3FVTA 1M8KA 2I8AA 3VOTA 5FUBA 1XVUA 3HCDA 2DM6A 2XADA 5B36A 3UGJA 2P7HA 3HBFA 2WHPA 1B2RA 1T4BA 4G4SP 1TYZA 2ZIUB 5DX8A 5JANA 1NN0A 4PZZA 3BTSA 3BFKA 4URFA 1EGAA 1N4AA 4XQ0A 4RY0A 4EDFA 1H1LB 2NPOA 1ISJA 1R7RA 2QVGA 3RROA 1E2GA 4H2DA 3SGLA 4BE7B 2QLTA 3GA0A 3HBNA 3WRWA 1CF9A 5DYYA 5JADA 1XLWA 3V4PB 5JPIA 3SF8B 1RQPA 5LJLA 4K86A 3BMCB 2YWBA 2ZRAA 2CMDA 1BW9A 4PC2A 4R8VA 3NDJA 1OI4A 3M9LA 3AOGA 4PNZA 5JS2A 3F3KA 3CX7A 4L1KA 1E1CA 1JLMA 3F47A 4GF5A 1QE3A 1WHTB 3V8RA 2R6GA 2NPFA 4EVQA 4QPPA 4UDOA 1PJSA 1T9GS 4AXXA 3LVRE 3UA3A 1DC6A 4ZJZA 4YAEA 2B8EA 1XZIA 3NQ41 1CXZA 1C1YA 4BNDA 5L4NA 1GPLA 3UK0A 4F96A 3HMKA 2ODEA 2VOJA 4LRWA 4MP6A 3O8DA 2EEZA 3RS8A 1ORIA 1L8QA 2J6BA 2X76A 4YJGB 3NBMA 3QYAA 1XLTA 3HU3A 4B6SA 2X8JB 3A4YA 4IDPA 4B7AA 4OI4A 3MUFA 5ENZA 3I1FA 4AJ2A 4BKQA 3PL1A 4JCOA 1A8PA 5T3YA 1EE2A 1CF4A 1CERA 3DZ8A 5JY1A 3JYPA 3H6HA 1LBSA 1I24A 4J1QA 4U7PB 2LUOA 4G97A 1ZSNA 1NDQA 1Y8QB 5FL7A 3K1YA 4UXJA 3CCBA 4S05A 1ZIDA 2V45A 5CFZA 3AF2A 2YHSA 3FYUB 3HKCB 1XMPA 1GRCA 1T1JA 2WJIA 4C4AA 1OTXA 4J0CA 5FTKA 3HO1A 2O2JA 1C5KA 1BIFA 2OYSA 1P62B 2EP7A 3HCWA 3T3PB 1ZJWA 1P0IA 4M2LA 1NWHA 2PVCA 1QG0A 1Y3IA 4RK6A 4F9TA 3IULA 4FBMA 4H7FA 2R5WA 1E5DA 2QNIA 1DRW