1I1OA

Room temperature crystal structure flavodoxin d. vulgaris mutant y98h at 2.0 ang. resolution
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
147
structure length
147
Chain Sequence
b'AKALIVYGSTTGNTEYTAETIARELADAGYEVDSRDAASVEAGGLFEGFDLVLLGCSTWGDDSIELQDDFIPLFDSLEETGAQGRKVACFGCGDSSHEYFCGAVDAIEEKLKNLGAEIVQDGLRIDGDPRAARDDIVGWAHDVRGAI'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords FLAVODOXIN
publication title Structures and comparison of the Y98H (2.0 A) and Y98W (1.5 A) mutants of flavodoxin (Desulfovibrio vulgaris).
pubmed doi rcsb
source organism Desulfovibrio vulgaris
molecule tags Electron transport
total genus 49
structure length 147
sequence length 147
ec nomenclature
pdb deposition date 2001-02-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00258 Flavodoxin_1 Flavodoxin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.360 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1i1oA00
1TIKA 2OYSA 3EYWA 3O2NA 3FVWA 3KLBA 1CZNA 2WC1A 5LLDA 4Y9RA 3RPEA 2FCRA 3GAMA 1D04A 3NHJA 4QOJA 1KBOA 1CZUA 4Y7CA 2V9CA 1JA0A 1AKRA 1FUEA 3HLYA 3B6IA 2FAXA 1D03A 3KEGA 1QRDA 1QBGA 4YAWA 3NHSA 4M0CA 1YCGA 2KLBA 1XT6A 5JROA 2B3DA 1FLDA 5B3KA 1ZWLA 3ESXA 3NHUA 4PTYA 1AG9A 2M6RA 1GG5A 1CZRA 1VMEA 3B6MA 4C76A 1TLLA 2XOEA 4Y9UA 4C0XA 3W79A 3F2VA 1I1OA 3OX3A 3OWXA 1YCFA 1QR2A 2MWMA 1V4BA 4H6PA 5LBTA 1DXQA 1YKGA 3D7NA 2Z9DA 3F90A 3LCMA 4N9QA 4D02A 4DILA 1E5DA 4S24A 1JA1A 3UXEA 1OBVA 1DX9A 4YAFA 2ZKIA 4FGLA 2D5IA 2A5LA 1AKTA 1AKQA 2V5VA 4BMOB 1CZKA 1B1CA 1X77A 4LTNA 4QOIA 1NNI1 5BUCA 3OWHA 3OJWA 1YCHA 3N3BC 5FA6A 3F6RA 1WSBA 1C7EA 4NLLA 4BMPB 1CZLA 1DXOA 2FZVA 4ZVKA 3OVMA 1BVYF 3GFSA 5FX2A 4ESEA 3G5MA 4GR9A 3TE7A 3W77A 4CETA 3ZHOA 2OHHA 2HNBA 2FLVA 4DIKA 1YOBA 4U7HA 1J9ZA 1RLJA 2N1MA 3EDOA 3ES9A 1XYVA 2MOKA 1T5BA 1AMOA 2MTBA 4N65A 5F51A 1BU5A 4QOHA 1RLIA 2GSWA 3B6JA 3GFQA 1FX1A 1SQSA 3ESYA 4FX2A 3U7IA 3NHFA 3OX1A 1OFVA 3QE2A 2BMVA 3R6WA 3N3AC 3HR4A 3FW1A 3FX2A 3OX2A 3JSXA 5F4BA 4CF6A 2BPOA 5LMCA 2QWXA 1RCFA 3LT5A 1KBQA 3TZBA 3QFCA 1J9EA 1FVXA 3L9WA 1AZLA 2Z9BA 4ZVMA 2ARKA 3NHRA 3FNIA 5LBUA 1J8QA 4FGJA 2Z98A 1F4PA 1D4AA 4HEQA 3N39C 4XDGA 3NFRA 4ZVNA 3NHLA 1FLAA 3K1YA 1C7FA 1YRHA 4GI5A 4QODA 4YALA 1OBOA 4QOEA 2Z9CA 1AKWA 3NHPA 1H66A 3NHYA 5FUQA 2FX2A 3S2YA 4YAOA 4YQEA 4GQIA 2QX8A 2AMJA 4YAUA 2Q62A 1YDGA 4R81A 3HA2A 1T0IA 1FLVA 4C14A 4ICIA 2Q9UA 2XODA 3NHKA 2MT9A 2QMZA 3K20A 1QHEA 3KAQA 5EAIA 4PTZA 3W7AA 3OJXA 4LAFA 1SG0A 3O73A 2V5UA 5EA2A 1XI2A 2BF4A 2F1OA 2QX9A 3NLLA 3B6KA 2FVXA 3ESZA 3KAPA 2FZ5A 3NHWA 4OXXA 5NULA 3F6SA 2X2PA 2KQUA 1CZHA 2HNAA 4J8PA 3TEMA 5LJLA 4QOGA 3W78A 2QMYA 4ZVLA 4U7FA 5NLLA 2R96A 5TGZA 6NULA 2QR2A 5ULLA 1H69A 2FOXA 4H2DA 3U7RA 3L9XA 5A4KA 5F12A 4NULA 2OHJA 4PU0A 1ZWKA 5EMNA 4XDHA 2BN4A 2RG1A 2X2OA 4LTMA 2HPVA 4N82A 4LA4A 4F8YA 5LJIA 5LVAA 1RTTA 1ZX1A 2FDXA 2QX6A 2QX4A 2R97A 4QOFA 1AKUA 3QFRA 4LTDA 3FJOA 4FGKA 4C0WA 1WSWA 4U7GA 2M6SA 1AKVA 1FTGA 2OHIA 5B3LA 3P0RA 3UXHA 1CZOA 4DY4A 3GFRA 1XYYA 1J9GA 4HS4A 1FLNA 3SVLA 2W5UA 1AHNA 2BZSA
chains in the Genus database with same CATH superfamily
5ALKA 1R66A 2XE8A 1Y9AA 2XY4A 4Y2PA 1QFSA 5EEGA 2DBYA 2VA9A 3BXZA 4K9RA 5KHOC 1AV6A 5G40A 2ZIEA 1TXGA 4MVJH 3IB3A 4RF2A 1ZYUA 2GK7A 4JVNA 1DS6A 5KYUA 2IS1A 1C1YA 3NEAA 4DIBA 1ZMOA 4U7WA 4DT1B 5CPFA 3GLGA 5BQPA 1YV9A 3CTPA 5KOHB 2JHPA 3C6KA 3S55A 2E48A 4TMWA 4D0RA 1WXQA 3O4JA 1F1JA 3PUZA 3THSA 3IRUA 3UT5B 4GIBA 5HE8A 5A9SB 2XDAA 2VF5X 2J0QA 3X1YA 3DCNA 3HCRA 4FKZA 4UBIA 4DA8A 3C14C 2OVBA 4NZZA 1DBIA 3I9FA 1SCDA 2R8ZA 3M5WA 3OZXA 2EL9A 1XXHA 2TS1A 2XHZA 3CKLA 2G67A 4KNVA 1K6EA 3F5DA 5DIFA 4QYXA 4DM3A 4YRSA 5G4LA 5A7FA 2J6CA 1FZTA 4LQCA 3ZVMA 4RZSA 2F67A 4B2IA 3EZ7A 3IKTA 1ULAA 1QTIA 2IJGX 3EA0A 3LQFA 1XE3A 2ZVJA 3A1NA 5EI5A 1P9WA 2AYYA 1MB3A 3BMNA 3FSJX 2B3TA 1PFVA 1WPRA 1VP3A 1Z33A 2F8MA 3B51X 4HS9A 2CBXA 5FTNA 3T61A 1Q0UA 3ER8A 1RMQA 3N8GA 4GECA 4QUHA 4A27A 4F6LA 4I9HA 2IOQA 4HZUA 4OTZA 2OFFA 2HLDD 2XE7A 2YH2A 1SIWA 4EPXA 2Z3WA 4L07A 1NIPA 1X7WA 3N2GB 3G2MA 3TFWA 3W2TA 3MT8A 5C51B 2ZYUX 4YP9A 3AI1A 3LQRA 3T1NA 5LQDA 2B83A 2WIKA 4FT4A 1BC5A 1TCVA 4WXRA 1XSEA 5B6JA 3DE7X 4Q4LA 4AKHA 1A2KC 1K5HA 1WB6A 3E1KA 4MDFA 1IY9A 4TN5A 4YAIA 3GBSA 3TKLA 3ONNA 3W5CA 1S1CA 1BWPA 2Y0CA 4A2CA 4EI7A 1XFAA 3FLAA 2P9FA 3CLRC 3MMZA 5K3SA 4DNPA 3D7LA 2AW5A 2IXBA 5U4QA 3VR3A 3GN1A 4K6FA 5JAMA 1SEPA 2QJTA 2GCOB 3KU4A 3STXA 1F2TB 1DV2A 1UQRA 1QG0A 1ZOOA 4UD2A 2HCRA 3STWA 1UP7A 1JLLB 1VPEA 2BGKA 4UU1A 3RUDA 4CMKA 2JW5A 2WD8A 2CL0X 2O7NA 5BQXA 2OBBA 5AM5A 3A2NA 4Q21A 1P62B 1Z7YA 3N0VA 3PRKE 2NM0A 1KE1A 5JVDF 4E51A 2IU3A 2W2OA 5ALHA 2YFQA 2WWWA 3CH4B 2D59A 5DMHA 3T95A 2A7QA 3JPYA 4GMKA 4Q01A 1V41E 5ECWA 1I1OA 2HMYB 1H5QA 3ZQKA 1KP9A 3IDZA 3A36A 3AQ4A 1V96A 4ZD6A 2BT4A 3DHYA 3U7EB 4UZSA 4B9AA 4X97A 4UCFA 1V4BA 3W5UA 4A0QA 1RQGA 1DXQA 1AA6A 3BC1A 3BG5A 1N6HA 4UULA 4AKSA 4C3ZA 3F90A 1QDUA 1G5QA 3DZFA 2H2DA 3K0CA 3PNPA 4X0EA 4RD4A 3MNFA 5KX5F 3ORFA 1UBHS 2FQYA 3I9KA 1NLZA 3BE4A 2YXPX 1F17A 3PQ6A 4ZCIA 7GPBA 2ZJBA 1QK3A 4HYEA 5JZVA 1TAHA 4FCWA 3OLZA 3H04A 4TMVA 2E6UX 5E9AA 1H4TA 2I3BA 2D6FA 3DEHA 3WLTA 4M88A 5CGQB 1DX9A 1M2WA 2H4FA 2RAFA 2VF2A 1DC4A 1KH2A 3TOXA 4TXNA 2GUWA 1A1VA 3IMCA 1L3BA 4R1MA 3T3EA 2J6HA 3DMTA 4W1SA 4MV5A 3UMBA 3LIPA 4MS1B 3QIAA 3QEKA 5B1IA 1FVHA 2HCJB 1B1CA 1T3SA 1BHQ1 3KJNA 5JOQA 1HKUA 1RWQA 1JZQA 1YBMA 1DDIA 4G5YA 4QXOA 1U9IC 2NYRA 4UMVA 4WFIA 3NHBA 3V8PA 3W4IA 2MDTA 1Y6FA 2HA5A 4HZGA 3T3MB 4B74A 2C59A 4NMLA 3PNQA 1BW9A 4S1NA 4L3OA 4TTAA 5J4KA 1IBKB 2ZYVX 2CXXA 3F98A 2YINC 2FV8A 5CM9C 2DBVO 3Q3IA 2ZXUA 1SUWA 3NDPA 2C2OA 2H51A 1ONSA 1RRMA 1Z0FA 5KEIA 5DM4A 3VKGA 3RHTA 4GMGA 4H4DA 4BO2A 2JH3A 1XZKA 3OVMA 1H0HA 4ZIRA 3G2PA 2FSPA 1CJCA 2QHXA 3HVHA 2HMSA 2Q9BA 3GRKA 4ZGGA 4KVZA 4PRLA 2ZJYA 3FG9A 4LXHA 3S2SA 4CMIB 3TE7A 3KSRA 2HHHB 1E3MA 4K05A 4KOEC 4WLEA 1QH8A 2CZGA 2OHHA 5JLAA 1LS6A 1YB5A 3UCXA 2H0RA 5F76A 3KOXA 4GG1A 4JI6B 5EJ2A 2QT1A 4TVSA 5ERGB 2G71A 2XT0A 2O19A 4OJQA 5GGXA 2WYIA 1N7GA 4LC1A 3N8IA 5KBYA 5EJMA 1AMOA 1PV1A 1O97C 1QJ4A 2BHRA 2DTDA 3BWXA 1JDTA 4JSTA 4JIMA 4OHCA 1SULA 1LBQA 5HXAA 3GELA 1NJFA 1K97A 2XMCA 3UWOA 2JFWA 4UQPA 4UHFA 1UFKA 3L4EA 1YZNA 1RLIA 4A15A 4Y7DA 3S2FA 2ORYA 4TZ0A 2XNDA 1ZD5A 1HT1E 1JL3A 4PZZA 4Z8YA 4GHWA 3AM5A 4F6RB 3K6SB 1ISHA 1FFCA 3WLEA 4P84A 3VGJA 3KQHA 2FKAA 4KO1S 3JZFA 1QIDA 4EO9A 4FQ5A 4XEUA 4HAXA 3E9RA 4OHRA 5J4LA 3ZDCA 3I9NA 4UBOA 1VECA 4RE5A 4ZYWA 1D2HA 3S70A 2F59A 1W5TA 2FW6A 4LVCA 3QE2A 1WF3A 4I50B 2CF6A 3ZJ4A 1OOEA 2DLDA 4NFSA 2FWAA 3IDSA 4IKOA 3HGQA 4YX9A 3AG5A 3IKJA 3IODA 3QOXA 4DQKA 3D8TA 5JSZB 1I30A 4UAGA 3DBHA 3LGXA 1HF3A 5BWNA 4JT2A 4Y67A 8ABPA 3FYUC 5TMDA 4YH1A 5JZSA 4HYQA 2QSZA 3R44A 4XWOA 4DYHA 2D5AA 4FHZA 1EDZA 4N6NA 3C4JA 1P39A 4J0DA 1OH7A 5DEIA 5F78A 3W34A 1IG3A 1KEWA 2NU8B 1G7TA 1GCAA 3QF7A 5I7RA 3KZMA 2IF2A 2W43A 3QLUC 4R1UA 4DXAA 3BXHA 1K98A 5LQAA 5A6SB 5EE9A 3WP0A 1E61A 3NC4A 4E5YA 3LL7A 3MZ0A 1KZHA 3T38A 2C96A 4G97A 5DCYA 4UBJA 1YQWA 3O1IC 3KPUA 4I5GA 5DTQA 2BFAA 2QRGA 2V55B 3NEPX 4E5PA 1WUYA 4MA0A 5C8VA 2Q46A 4AUMA 2H17A 1JHYA 2R8EA 1G7RA 1Y0BA 3KJHA 3D5EA 5F3WB 1MB0A 1JP7A 5DKFA 1V0JA 5GJWC 3CJRA 5GJBA 5FR1A 4UMDA 2CZQA 1RXWA 1CJKC 1YZHA 5K09A 3COWA 1IB6A 2PX3A 4JFAA 3WK8A 2IYPA 2ZQ5A 1K89A 4DF3A 1HSOA 2DQ4A 5DHSA 4ZCRA 1T13A 4R98A 2PKXA 1MDBA 3SLRA 1P0FA 3NATA 4PRKA 5BR4A 4GOJA 1TKRA 3NHLA 1FLAA 3K1YA 4JLNA 3VU9B 1V3QE 1QYDA 5GJVC 1T1IA 2EW8A 1KYVA 5F1YA 1IXSB 5E3HA 3LRTA 4RAOA 2IWRA 3C7TA 5TR9A 4JVMA 1B26A 1RABA 2Y1EA 3CNNA 2O3TA 3IVCA 3P4XA 4UE2A 1PFGA 1DJQA 4WK0B 1ACLA 3H16A 1XVTA 1MORA 2OZPA 3N5CA 2MR6A 4PF1A 5KO2A 4YPFA 3P9QA 4NJEB 3D02A 2QTTA 3OLWA 2D62A 3TMKA 4FHFA 3GIWA 4Y2GA 3D1LA 2JGJA 4L75A 6REQB 3ETHA 2AJDA 2P0YA 3LT4A 3PEUA 4NBRA 3PPIA 3DFIA 5ALJA 3RSOA 2QGFA 4DKXA 3BULA 1GADO 4IW3B 4OYHA 4Z7NB 1C7IA 4ND3A 4LOJA 3AF5A 5KTNA 3Q7IA 2I6FA 1GD1O 3CVJA 3VVLA 2OZLA 3QLJA 4D9KA 5DX1A 1T9KA 5K3FB 4OQEA 1A72A 1BYIA 1CY4A 2HTFA 1YH3A 1Z82A 4Z99A 1SOVA 2Z04A 4KN5A 5HW0A 1HUQA 2QX8A 3NPAA 3UJ3X 3B1XA 3E82A 4MGZR 3W5VA 2Q49A 3NBUA 1UXOA 3AUSA 4JLPA 3M70A 4UBLA 3BPSA 4R81A 2JGMA 3R8FA 1UM9A 4XPIB 2ZYGA 3HABA 3MPOA 5G0SA 5EHNA 1AK1A 2OPBA 3OEEA 4HFJA 3ZW8A 1B6GA 5HQ3A 4EQZA 1XCGB 2Y2VA 2WJHA 5C1OA 5GOZA 1XRPA 3JYPA 1NI3A 1E2LA 1MW9X 2I03A 3EZYA 4HO1X 3TQQA 1Q7BA 2I7DA 1OWNA 1ENYA 1JHXA 2F8LA 3OQJA 4FE4A 4F5DA 5DLQC 4O5OA 3VU8A 1AKNA 3M49A 3WGHA 4IHJA 3B3QA 1XTIA 5IRCD 2C7VA 3EMVA 2V7TA 3G5TA 1BX3A 1Y9DA 2PA3A 2JI6A 3MGAA 4G41A 1FDIA 3C3EA 4J16A 1XDBA 2PZMA 1WZCA 4Q05A 1KP2A 1XTSA 3NEYA 2R2GA 5BQOA 4NXNB 5A5GA 2ZU6A 2EQ5A 2NSDA 3R76A 1AXRA 3VOSA 5CEJA 3SBOA 3Q4GA 1T2CA 4ZCSA 1YK0A 3LQKA 5HFNA 1G21B 3CS3A 2A1UB 4P0QB 4XVQA 4WNYA 2ZYIA 1RT9A 4Z3DA 3DZKA 2XB8A 3E5MA 2CEKA 2IXDA 3TDKA 2B4QA 4RHFA 1KMMA 3D8NA 4GLLA 3RJ9A 4N39A 2ZS7A 2FVXA 3B1ZA 3D8SA 4I5DA 4A9AA 4D6PA 4R2LA 1WW3A 1WEKA 2GN9A 1MRZA 2ASVA 3N0WA 4PCLA 3L4SO 5KSPA 4F8EA 5KWVA 1VBMA 1J0AA 1HK7A 1NMSA 1SR8A 2XWBF 1G8YA 1QC5B 3G9ZA 3L7BA 5LLTA 1YMUA 1DJMA 4RK5A 1Y3IA 3NNSA 3ZNPA 1XNJA 3F6SA 1H1TA 2I65A 3GI1A 1T9CA 4FWTA 1I7LA 2HN9A 2H18A 2Y1DA 4R1PA 3CNBA 1PNQA 3ABOB 3HCFA 3K0AB 3W78A 2XITA 3N2ZB 1N77A 1GN9A 4G0XA 1X2BA 2P0EA 3IUMA 4IWNA 3DYIA 2OESA 5CB8A 2BBWA 1W25A 2ZWOA 2Y0BA 2ILVA 4PINA 4DYDA 4JLKA 3PEWA 3F3SA 5CK5A 2G1KA 2DPXA 1F5SA 2VUHB 3E15A 3FUCA 3GRZA 3WIDA 1O77A 2YOGA 3OPXA 4R9UC 3QBEA 5JIBA 4RA9B 4WA7A 5EIXA 1F1BA 2FW0A 4HWGA 1PL6A 3RE1A 5A03A 5K5EA 3LVRE 3UW1A 3TTWA 2PGXA 1C0PA 3LI2A 3HP1A 1NI4A 5CBPA 2PO7A 2J0UA 5BT8A 4ALKA 3OZIA 5H9WA 3N59A 2NVUB 3ZBUA 3Q3HA 3WHKA 2HSEA 1OLUB 3KSMA 2H63A 5E6UA 3CPJB 5DBOA 4G0PA 3WAGA 1YA4A 4RCYA 4YRTA 3V4VB 1UDRA 3H84A 3OKPA 3N58A 3ZHXA 1E6EA 4FDMA 1JEQB 2ZT5A 4YNBA 3ZY3A 3WDSA 5CITA 4MAFA 3K9GA 1H05A 4JT8A 2A6PA 4M1TA 3U3RA 4BU0A 1OB2A 5EJGA 1CNEA 1U8AA 3G0HA 1KJIA 4L6AA 4FSDA 4WBSA 1YJCA 1J5PA 1H8HD 1OXTA 3VYWA 1XVIA 1E2QA 5D7BA 3E58A 3LZDA 3OPYA 4HEA6 3DW1X 1GOTA 2QT9A 3T3HA 3WV5A 4ZAXA 1PHRA 3GX1A 4R2KA 1UXGA 3M3HA 1IZYA 4H08A 4W63A 2NUAB 4RLHA 2JD1A 3HN7A 5ITVA 5JI2E 3JWEA 5E7QA 1FNCA 4EPVA 1DKRA 2PHZA 1TU4A 3MW8A 2C2YA 2B99A 3QFRA 5M3BA 2YWEA 1F7UA 2DKFA 2O0LA 1PRYA 4GWLA 3D64A 1KE2A 3RABA 4L5IA 4GKVA 4GMXA 4PC6A 1Z5WA 3H18A 4PCVA 5BW8A 3CVYA 1EYZA 1FTYA 2ZJ2A 2PNFA 1JR6A 3UFXA 4WASA 3PR3A 3ET5A 3CVWA 2Q5EA 1YULA 1GVNB 1KFJB 3LPAA 2AVNA 3OIVA 4LZAA 2G40A 3C6MA 5BNFA 1BDJA 1LK0A 2XV1A 2YC4C 1WPQA 2YR0A 3A2MA 1XP5A 3AC0A 3Q3GE 4HN4B 2PBLA 4JQSA 3FLEA 2QPTA 1GPBA 1XHLA 3WGZA 1APBA 4D82A 5A4AA 1E4VA 4B4KA 1NRXA 4QULA 3AVWA 2NZYA 2BBSA 3SIXA 4NXMB 1H93A 1RI2A 3AF3A 2J87A 3EUEA 1P77A 2R2AA 2QG4A 3KWJA 3LOPA 5K8UA 3S8MA 1FIUA 1X7ZB 3TJZA 4C01A 1TIKA 1MOSA 1OFUA 1QV9A 4B84A 1L7RA 3F7NA 3L01A 2ZE6A 4XB2A 2WFZA 3DA8A 4GZ5A 5DOVA 2CXHA 3RVPA 3TIGA 3ZE7A 2X9LA 1OHHA 1VHJA 1YHNA 2YQ5A 4G25A 1SKQA 1RZRA 1X2EA 1EEXB 3E7XA 5CX1A 2NX2A 2YBEA 3B1JA 3OMLA 1TZJA 4IWYA 4PZCA 2ZIAA 1CY6A 1T0PA 4J03A 3V8VA 4DCPA 1BS2A 3RRZA 4TV9F 2ZIWB 3CLVA 4WK2B 3W6NA 3V9AA 4R6WA 1M83A 4FDVA 4B7XA 5L7WA 1XPRA 1JS1X 3OIUA 3T15A 1YR6A 1G20E 4MGYR 4F5WA 4NS4A 1TQ8A 2QUKA 3T1OA 2GZHA 3F6BX 4TXHA 2DF8A 1USWA 1YZFA 2BGUA 3KVRA 1Z5NA 4NZYA 3LK7A 4ESHA 2OFXA 1UAYA 3OJEA 5ITWA 4CTOA 2FXVA 5F5NA 1QF9A 2FK7A 3FMPB 4X9XA 3T9EA 3UKDA 4CZ2A 1XMVA 2ESRA 4ZQCB 3WLKX 2K5UA 3ZXIA 1SPBS 4OB7A 4EA6A 3H11B 4N5NA 3OCWA 1W1UA 2DMRA 2PXHA 4IPTA 3W6PA 1EFKA 3BTUA 3B5EA 3H9CA 4DL9A 3V33A 3W5JA 3VR6H 1FFXA 4GOKA 3CCFA 2EW2A 4JU9A 3B8HA 3HGMA 2IYYA 3R3WA 3DDCA 1EE1A 1WF6A 3A6EA 1E0SA 4H6XA 4YACA 4XQ0A 1VL8A 5IH7A 3ZDAA 3MQ4A 3REFA 3GDFA 3G0BA 5GGYA 1NFFA 3K6KA 4J0HA 1I6MA 3FWPA 3ZHUA 1PUIA 4ZI5A 4IL5A 3T94A 4BWGA 1M74A 5BVGA 1KGDA 1P4JA 2ADMA 2ZUBA 3HWSA 3M6LA 4NIMA 5TVKA 2XEXA 3Q11A 4ZP1A 2JFVA 2UVQA 4KYVA 3VPFA 5KYUB 4CE6A 3F97A 1F2DA 5DCLA 1D6MA 1SB9A 2Z30A 2OO5A 1JFRA 1QYIA 1RLUA 2ZB7A 1V5FA 3BQNB 5EEHA 3RAJA 1X8XA 4UAVA 3F5SA 3L7DA 2EX0A 1HDXA 4OHUA 5ALLA 4H0NA 2JAQA 3VYSB 5GIPE 5C80A 2XOEA 5TS3A 3WA7A 3ZLUA 2UU9B 1LV7A 3TPCA 3ZY5A 5JS2A 3ZV3A 1P2GA 5JLJA 1W36B 4ZTUB 3HFSA 5EFOA 4Q3KA 1B15A 2J3QA 1SU8A 4DLZA 2CHFA 4B80A 3DAPA 4AZ3A 1XXHB 1Y1LA 4H3HB 1G2PA 5EXDA 3S1LA 1CULC 2NYUA 5J1SB 1FJHA 2IE8A 4DIDA 3ANMA 3ND9A 5DW3A 4R8MA 1OGJA 2GI4A 2QQ5A 3BMNB 1GFSA 1Z0ZA 2HQBA 4Q66C 4Z0PA 3UMSA 5K0GA 2ASEA 4R1LA 4XGIA 3DUFA 4DC1A 1OMOA 3DT9A 1WMBA 4FBGA 4F4DA 4TMFA 4HUTA 4FUQA 4HZUB 1O94D 1R8XA 2ZRDA 1EVEA 4DIUA 3I4FA 2GQ0A 1Q0QA 3THRA 3R6GA 2DM6A 4RIHA 5JSKA 3RUAA 1C8VB 1X7WB 2JZCA 2P2DA 3OE7A 1CUZA 4JQZA 1E9CA 2QL6A 3G0CA 1SAYA 3PFHA 4YP1A 3TD9A 3MWGA 3AUAA 3MMNA 3TR5A 1VE5A 3O92A 4D43A 4URVR 3RRNA 4BVLA 5MFPA 2GJKA 3H2ZA 1FSFA 1DJLA 3TOSA 4XA8A 3O0DA 4JBNA 2DR0A 3P1JA 2P90A 1PJLA 3BB4A 3UJBA 3ZS9A 4BVGA 1OASA 5BRJA 1E1CA 2QVCA 3QYAA 5B3JC 3C8ZA 4YIHA 1NVMB 1P9LA 2IQIA 3QUQA 5G0UA 3QLEA 1LLUA 2A14A 4FR2A 3FKSD 2N42A 1GPWB 3H5RA 1V2HE 1FEZA 3IAM1 5F2EA 2GBLA 4W6ZA 1XD2A 4BEVA 2FPPA 4EIWA 3PKIA 3O9MA 1AX9A 3DDHA 5LN1A 3MD9A 2VJPA 5FA6A 2G6BA 2CJWA 3U39A 1LPSA 1W2WB 1E9EA 3IUPA 2FZWA 2PM8A 1C7EA 1Z16A 4GW3A 1WUKS 2KM1A 1GNRA 3K8OE 2J9GA 4KSCA 1LVUA 1YE3A 1DXOA 3TOCA 4Q7QA 1KYIA 2RHDA 1OAKA 2WWTA 2CFOA 4LDPA 1E77A 5D85A 2QP4A 3ZQ6A 1NN5A 1C50A 3FPGA 4Q82A 1B2RA 4K6CA 3FTCA 1N2SA 3I6MA 4I1SA 1I0ZA 1FZQA 4BS9A 1UCFA 3IQWA 3MS2A 2QSYA 1H6CA 2CDCA 3MAAC 4ETMA 5CFZA 4FOLA 3N05A 3QEAZ 2A30A 4FOOA 4LGMA 4FSXA 4LYYA 4IDDA 2BMFA 1P6UA 4DV6B 2FHPA 4N0EA 3FFWA 3GFVA 1O9BA 3S2EA 5JBQA 1D2EA 4KRXA 2BJVA 1JKJA 1Z0DA 3DCYA 1RLJA 4XARA 1ISRA 1T5BA 4BO7A 4KQ6A 1HDIA 1QWOA 1ZOLA 3GDOA 1DAPA 4IOMA 4EKIA 3EIFA 1P2SA 3AOEA 1OWMA 2Q6TA 3LGSA 4QDOA 1QH9A 2H4JA 3DLTA 3M83A 2B4TO 3KYJB 5AXDA 2O4UX 3MVEA 1M2NA 4MQEA 2WTXA 3Q88A 1R6AA 1TQ2A 5EMKA 3AZPA 5EWMA 4FI3F 3LHFA 3SZUA 1ADCA 3JAMA 4AKTA 1PCXA 5AM0A 2P4HX 3SOPA 4AKIA 1FX1A 5AI0A 3QQPA 5K8LA 3RBXA 2BRUA 1URPA 1MG5A 3BZWA 4J1TA 3FDIA 1NTOA 1SQSA 1GKUB 2GPBA 3EGCA 2R8BA 3B60A 3F6CA 2BGMA 3JAWA 3LUKA 3OTIA 3TOVA 4QECA 3UK6A 5KTTA 2FU5C 4MXDA 1OFVA 3N7AA 1IZ0A 3RU7A 3DT8A 4MKRA 1N2EA 3IAUA 2H1OA 5K0LA 1J5XA 5ENZA 1ZRMA 3F71A 1BW9B 1RI4A 1W1WA 1XZMA 4H7FA 4X91A 5F9MA 3BWDD 1U9YA 4QUBA 4CN8A 2ZSAA 3ANSA 3W04A 1N2IA 1OLSA 3FFXA 1GV0A 2B4RO 4LE1A 4TRJA 3M6AA 2OQVA 5A5VA 3LPDA 5LP6A 3DD5A 3RF6A 5EUCA 1WTAA 1Z2DA 3GGSA 4O0LA 2AMVA 3BGSA 1SGWA 4L4YA 1RVDA 2F9FA 3F0TA 4ZIRB 5KVQA 1W8DA 2J4CA 2WOOA 1QIEA 2CY0A 3VPAA 3WIBA 3LT5A 1XAIA 4QTZA 3SJ7A 1KBQA 2P4QA 3U4QA 1K8QA 4M2LA 3TZBA 2VZ9A 3QFCA 5AMXA 5KYYB 3DNPA 2IOYA 2VTKA 1M54A 3BIXA 1IUKA 2BDTA 4RKEA 2XCTB 1QH8B 2RONA 5JAUA 1UOPA 1A76A 1NVWQ 5EQJB 3ZHTA 1IVYA 1LU9A 4M1MA 4WZBA 1XQ1A 5I7EA 4JYMA 4Q4HA 2QYOA 4DV0B 2XYHA 5J47A 5K99A 2J0EA 5IJZA 4YJ3A 1VLQA 3MTEA 4LK2A 2O2JA 1J97A 3G8AA 4DBZA 5C1PA 1T2DA 3OLQA 4MZDA 4XDZA 2GDJA 4MROA 1V16A 4D9MA 2LP4Y 2L0XA 5P8WA 5IKXA 3R9WA 1PDWA 5ICFA 1RTKA 2ILTA 1DJNA 2JIZD 3DV0B 3EWSA 4D56A 1B16A 2V9ZA 5LQUA 4MGKR 5H1YA 2C4NA 4FFBA 2CL6X 1PFYA 2OUKA 1U5CA 3NNNA 1ESCA 2NWQA 5HIJA 1G66A 3H5TA 3HJRA 5C81A 1A9XA 5DGTA 1IEWA 4OI1A 1GAEO 1XIVA 4IXMA 4F1KA 3SC3A 3W8FA 1X1RA 3BFXA 4IIVA 4MP8A 4RV9A 5AW5A 2CB0A 3MWKA 4L1KA 3ZCPA 3SX4A 1FQWA 2XZPA 4HKTA 3FJ1A 2G70A 3RREA 3WI7A 3ZBPA 1TUEA 2E1PA 3NWBA 3TSCA 5TIIA 4NPAA 4HP8A 4ODIA 3QI2A 1LRKA 4WKOA 2QL9A 3HO1A 2Q5CA 4NESA 2VCYA 2Y6UA 3BD6A 2OPHA 1YB2A 1EWYA 1CJBA 3VKHA 5K05A 2EOAA 2V03A 1V9CA 5E8RA 3ZUPA 3KXPA 4N3CA 2G7MC 2IYRA 2KBEA 3DBHB 4O0MA 1E2BA 1UH5A 2WHQA 3MAGA 5JS1A 3T06B 4XWKA 1KNXA 2V3VA 3AONB 2QRKA 4ENSA 1N5JA 1J4AA 1JZSA 4X93A 3PVCA 4GM1A 2WYOA 5H02A 5G1PA 2AR9A 3CU5A 3T52A 5BV7A 1BSVA 2ODEA 5DX8A 4MB2A 3NM6B 4QQKA 1VQ1A 4GMDA 3TXXA 1B7GO 1RS0A 3NR2A 1QFJA 1NP7A 1DP4A 4YECA 1L5VA 2JBAA 4XIFA 4FFPA 4ZYYA 3LM8A 3RLFA 4EYEA 2I8AA 4JC8A 2X8AA 1M5UA 4JL8A 4MUBA 1YJ5A 2AR7A 1HE5A 5AW3A 2C58A 1VL1A 2FI1A 2PUAA 1TJPB 2XZLA 5JDIC 4EG1A 1XLWA 3ANTA 3H0CA 1VLLA 4A0FA 2FX3A 3WMGA 3NHKA 2RK3A 5HCNA 4AYXA 3EDYA 3VR2A 2ATIA 4L9WA 1KARA 4ZYUA 3SJBA 4XWAA 3KEOA 4O33A 2X0DA 3O5AA 4TYWA 1DFHA 1HO3A 4BBAA 3OF5A 1RZUA 3FE2A 1RWXA 1MQAA 2IF0A 1JQ5A 3H0EA 3OZ7A 4JJEA 1SXJB 4V0RA 4BWFB 3KT3A 1T8UA 4N0DA 1NBHA 1V35A 2X9NA 3FNEA 3OT4A 4UM8B 4ZOQI 3L1UA 1M7HA 2W58A 4WK6A 1FC0A 4P92A 3WLRA 1V11A 3EUFA 1E66A 1XZEA 1OBCA 1TZMA 4F1JA 1ZESA 1YBVA 1IOZA 1I4EB 2FG7C 1R0XA 4HH4A 3E9YA 1NXVA 4D6YA 3BSFA 2AV6A 2LE0A 4MVJA 4RK4A 3ICVA 1FL9A 2GD1O 3MFQA 1WBDA 1UPBA 2HLNA 3ZZ0A 1TJ5A 4UW9A 4EKNB 5K0FA 5ED4A 5IJ9A 3ESZA 1NLMA 1XG5A 5D3MA 4ER3A 2SECE 2V7QA 2ZBDA 3MOSA 3BKXA 5B6PA 2J33A 4EHHA 3IEUA 4HLUA 3QXJA 1N5LA 1NJ5A 3ICCA 1OUMA 2OZLB 1JNXX 2WMOB 3G85A 2RHOA 3PHCA 3ETLA 4IZ6A 4OFXA 4PLFA 4RXUA 1QX3A 4YI3A 2FEOA 3EWIA 1JDJA 1FUKA 2Z2IA 4GPAA 4PAMA 2KQUA 4J8PA 2RB5A 3HYNA 2C77A 3FDJA 4KLRA 1XRRA 1X74A 1FS5A 1O9HA 4KLZA 2ODPA 4ANFA 4EI8A 1QIHA 2J31A 2R6CA 1K6XA 1UM9B 1EJ2A 5EQTA 5FYDA 4X61A 3MOGA 4KGVA 2PH7A 4BMZA 1A9SA 5ULLA 2WM9B 5HQ3B 2C3UA 1SU6A 2ZBEA 3QQ5A 4GM4A 5CXSA 3TQFA 2EIHA 3N2LA 1HL3A 2C03A 2QD1A 3D6JA 4IJVA 3HVJA 3U7RA 1CHDA 3ONFA 4AZSA 3RKUA 2ZVPX 3NXKA 4PFJA 3WLAA 3P2MA 1N9GB 1G1MA 4IHJB 1C4XA 1M1YE 4ZU1X 3RK1A 3UM9A 2RJNA 3K9WA 4CG3A 1Z8FA 3VC3A 5PNTA 4OHPA 5BWBA 2DSTA 3NH6A 4K0RA 2WMYA 3K53A 1HBJA 5LOVB 2OFWA 4KTVE 4A8JA 1V1JA 4I66A 4OXYA 2DPGA 3VC1A 3LCJA 1A96A 2IHZA 5LB2A 1E79A 1F3LA 2QENA 4HK4A 4JJ6A 5I8WA 1O6GA 2EJVA 3QIVA 1XCJA 1MT3A 3KCQA 1M5TA 2CXOA 1KZ1A 3C98A 1Z4KA 3BXFA 2C82A 3OFSA 4Z0TA 3MB5A 1T4CA 4UHJA 3VDRA 3TDNA 1RSZA 2A5GA 5JZMA 2I1LA 2HZBA 4ZJUA 5LDHA 3KEQA 3IOEA 4BFZA 3TLBA 3TM5A 1L8QA 2QR5A 4G23A 1PQWA 1UBMS 3GDGA 3AUJB 3DF9A 2D7CA 3R2JA 3ZLBA 4LJKA 3I1FA 4GKAA 5CLQA 3O9VA 5KDOA 2X8BA 4H31A 1D2RA 4PRYA 5AHKA 3L4KA 1JAZA 1RLMA 2CMKA 4NMWA 4F2GA 1YRQA 3NQ41 3VSDA 3AL0C 4I8XA 1Q3KA 1O89A 3IBTA 3QRWA 2OBNA 2DB3A 2QLBA 4FGSA 1L7VC 1FTGA 4G5SA 5HCIA 6Q21A 2Z57A 3Q1KA 4ZI7F 5IVIA 4YJKA 1A9RA 2YBDA 4PV7A 1NHGA 3QVJA 4TTQA 1JIJA 1USKA 2QD2A 2VYQA 2LCQA 1ZUD1 4RS3A 4E7PA 5M04A 2ZJ6A 2VDUE 2OZEA 1B4DA 3E4DA 3D0OA 4KIWA 3FA2A 1NOKA 1U7XA 3K9FC 5JADA 4DQDA 4OMFG 5AKYA 3TF5A 2WU8A 1XROA 3G17A 5JSYA 2ATXA 3U3KA 1AUPA 3TG8A 3HXMA 1JSRA 1J06A 4LXQA 1NI4B 5CBPB 4DLVA 4EEXA 1Z5ZA 2J0UB 721PA 1SKYE 2GAJA 4OQDA 4WAUA 4PNEA 1JN0A 2JF0A 2Q28A 1A71A 5E6UB 5A0TA 4JB8A 3NAMA 2ZPAA 3PQFA 3LC0A 5FDFA 2QN7A 4EW1A 2JH8A 1FYXA 2BR3A 4ALMA 1PUJA 3NHZA 2GF2A 3HADA 3U4IA 3VXKA 3J81A 4B76A 2A33A 1EXDA 2J30A 2DTXA 1AB6A 5DHUA 5FNZA 5JCOC 1AM4D 1X1EA 3GLRA 1JILA 1ZIDA 1WB9A 2RGRA 1UFRA 3DE4X 3RS7A 1JGTA 1NU6A 1SXJC 2A0FA 2Y1LA 3GZJA 2E37A 3OPYB 2YZNA 4KWIA 2ZI6A 1Q91A 1RWBA 2JFUA 3A9RA 4QTTB 2EERA 3T7DA 1LDYA 3EPPA 3L8DA 4M8SA 2G83A 1HFJA 2A5YB 1VG0B 5HHTA 1U9CA 3DP9A 5K0CA 3SQWA 1W581 1POXA 3R9IA 2C3MA 1G6HA 1Q0RA 3G89A 1W4RA 4NHEA 5FO1A 1I7PA 2B6NA 2P8JA 3GG2A 2I91A 1LX7A 1KZ4A 4L9RA 4KGDA 4GPEA 3BWBA 1DAMA 1YS2X 3GC6A 4MMZB 3QV2A 4E31A 4CCYA 4EHIA 4HPXB 3PZBA 1MPTA 2GDZA 5DN9A 4DC9A 1N36B 2G9UA 3PLAE 4F5ZA 4UPEA 4LY6A 1GPNA 4OD0A 2Z5LA 4UHEA 1W1IA 2FEKA 2GVZC 2R79A 2GZSA 1NVBA 2P62A 2XDYA 3C3JA 2EZTA 4LRXA 1R12A 1Y8RA 4TL8A 4HN2A 4YI5A 3RS5A 3UFXB 2PWYA 3VOTA 4E11A 3ZGNA 4QGBA 3BORA 1WZ2A 3JWIA 2IELA 3C3BA 1JI0A 3EAFA 4PHFA 1XN4A 3LV8A 1D6JA 1KVRA 2Z6UA 2P27A 2XMGA 3JXEA 1C41A 2A67A 3KQVA 3NV9A 2R5WA 2OG1A 2WQ6A 4DR3B 5E1BA 1NDUA 3FOCA 3CISA 4JSYA 1ECJA 4OLJA 2CHGA 2J7PA 3C39A 4G4IA 4CEIA 1V5WA 1CQJA 1E5QA 1Z0JA 2Q1XA 2C5FA 2P4UA 1ADYA 4GOMD 4ZCPA 2QTVA 4NTZA 5DM0A 1XRMA 2GSDA 4LJ7A 2WSIA 4KE8A 2FQXA 1S3SA 3QSGA 5TQ0A 5J9FA 1CEXA 1YS7A 3UC9A 2IEIA 4WXMA 2Z5GA 3KJFA 1W2HA 1J8VA 3ORYA 1P2UA 3SF8A 4CIDA 3SE7A 1N6IA 3OHSX 4TZTA 2J3DA 1ZS9A 2B36A 1Z8HA 1RYBA 2Y4OA 5CX1B 1WXGA 4DLWA 4Q3BA 4DJTA 3C3YA 3F1LA 1FXWF 2NO1A 5AWFC 4F72A 2WYHA 5DI9A 1GR0A 1C1HA 4BIMA 1CEYA 3N28A 1RXIA 4D8VA 3LOUA 2JVJA 3WNCA 1RBMA 3DD1A 3UMMA 3OIGA 3A2KA 4JHLA 1X1BA 2W6CX 3DBLA 1PEDA 1XZAA 1VSVA 3R3YA 4GLBA 1I24A 1SBNE 3OWXA 4CKCA 1RP1A 2F2TA 3ESDA 3QMWA 4RZ3A 3E3MA 4MPDA 1T9GS 3II6X 3OPQA 1X7GA 3AM4A 1GA1A 3I1YA 2ZWMA 1RM0A 4CRWB 2C8LA 5JUWA 1G8GA 4OJMX 1IDN1 4BQSA 3DE6X 2ACWA 1YUBA 2VJCA 4LX8A 2WHYA 4EYKA 2GEUA 2RGCA 3DLHA 3OD1A 4RJ2A 4ER0A 4M38A 2OEPA 3DSRA 4KWTA 5EXPA 4ZU6X 5CB4A 3NIFB 4KV9A 1NBMD 1Z5UA 3AM1A 1YDFA 3H2JA 3B52X 4CG0A 3PJFA 1Y9JA 1YQXA 4I9NA 4NYIR 2WJAA 1FFXB 1FRQA 2CMFA 2PXCA 2QM7A 3D9QX 1JXOA 1TEHA 5B7NA 2A5LA 2QLNA 1ONBA 2FW8A 2ZTVA 2JGLA 3MCVA 2CLSA 2GD6A 1SZCA 1UMDA 3C7DB 3JVVA 3NP9A 3Q2IA 4FEEA 4GQBA 5DK6A 2IEBA 3SM9A 2VJKA 3IA2A 3SGLA 3L7JA 1TM3E 5BVGB 4EHKA 1MO4A 4LNHA 2YQZA 2X8LA 3K35A 1N0HA 4HWKA 4AMBA 1XZIA 2APJA 1P29A 1DBVO 3LY7A 4G01B 4TS9A 3OJWA 1GA4A 4BRSA 1XZGA 3WYBA 1ADBA 1YDEA 3HCAA 4Q12A 2I33A 1JQBA 3IAM6 4A16A 1ZZGA 4BMPB 1VJ1A 4BRWA 1E0AA 3W4KA 3AEZA 1IVNA 1U99A 2QN2A 3S1SA 3KQUA 1TTHA 2RGDA 5EZSA 2ZPUA 2BGIA 4J07A 3VVBA 1E5LA 4FOPA 3NOOA 5HM6A 4RESA 2LVBA 4AZ3B 3NWJA 4PZPA 4LECA 4R31A 2RBKA 1JDSA 1R7RA 5JXJA 2O1EA 4G9BA 3K2BA 2CD7A 1M2HA 4YMHA 5BSHA 3A0UA 5LSAA 4JI5B 5BXYA 3BMOA 4MLZA 1PL7A 3JRWA 1O95C 1XJCA 3DUFB 3K4PA 4Q16A 2UZ4A 4LZWA 4OU5A 3JQQA 1L1QA 1ETUA 1L5RA 1SBIA 3CZRA 4L6IA 1Q50A 3OCUA 3K71B 2PPVA 4OAPA 1GTMA 2AUTA 2WIDA 2YYSA 4FC7A 4HNGA 1IHYA 1RKBA 2D4HA 4YP5A 1GGHA 3ILVA 2XVAA 1KMIY 3GT7A 3PQ4A 4B6EA 2PPLA 2PCJA 4PAOA 1G6KA 5EZQA 2M2IA 4BGDA 1S9DA 2RHTA 3DBIA 5IM5A 5JXGA 3O8CA 1QKJA 3COPA 1QP4A 3IOYA 1XKQA 1RZ3A 2ZRMA 3GFQA 3HG7A 1Q5PA 2OE2A 5HWSA 3OPVA 4QXRA 2W70A 3W3AH 3ZZMA 1PLLA 1W0JA 4Z2YA 1H8EA 2H5IA 1CS4C 1HC7A 3HXLA 3FDFA 3OUZA 4LV5B 4A8TA 3ON5A 1E1CB 2GXQA 3GL9A 4O1HA 3NHFA 3EQ2A 1Y6RA 1LBEA 3RSFA 1T9GR 4F4CA 1NBAA 3H87A 3JS5A 4JWKA 1U0BB 2J6IA 2XGJA 3JALA 1D3AA 2P6PA 1XD2B 4FHCA 2FPPB 4N7MA 3Q7SA 4BO6A 2D13A 4H6VA 2W48A 2H08A 2IDJA 2EFHB 2QRVA 5CYPA 2QRZA 2ZG6A 4JJAA 3FX2A 4F21A 5GVRA 1FVFA 1W4CA 2CCJA 3AW8A 3H5VA 4K1XA 5E3IA 3IELA 2ERXA 4KI0A 4I1PA 3IIJA 4KQJA 5CR9A 4PGHA 5LMCA 3SG0A 3A6JA 4N48A 1YONA 2IYVA 4REMA 2ZBVA 1WDMA 2XOKA 1MEOA 3ABIA 2Y1KA 2W37A 1W85A 1GJRA 1EVKA 3CZCA 3O75A 1X7DA 1NULA 4URZR 3QSYA 4AF7A 3DXZA 1NDQA 3KLOA 5FIUA 5LOVF 2I3ZA 2I6GA 2XGMA 4IVPA 2Z8YM 3GLVA 1YTLA 4FKBA 5BW4A 2DWQA 3LUGA 2PT5A 4Q0MA 4DG8A 3IO3A 2GM5A 1GNQA 2J07A 5CT9A 3HCPA 1YNOA 2BGNA 1EQUA 2IDKA 3KXDA 4XD2A 3FHLA 4A23A 4UHBA 4D96A 3H9QA 4G4JA 4DEVA 2V0GA 3NKVA 2E18A 1J99A 1QQBA 3FNIA 4LYHA 1GSOA 1EK0A 2CDBA 3LZ6A 2PQ0A 3SYRA 1A4XA 2QW0X 3AJRA 3MJSA 4MQEB 5CD9A 3LUHA 5HUHA 2P1DA 2YCBA 1O5OA 1UP4A 3QA3E 2RC5A 3MT9A 1ZIOA 4TWAA 5LD2C 1R0YA 4GSLA 4JCOA 3GD5A 3KUKA 3FYTA 2JAHA 3PHJA 2P30A 3DMFA 1W5AA 1OD6A 4NEGA 3CLTD 4FOTA 5KNDH 2GLUA 4Q6WA 3RS9A 4CVNA 4U00A 3Q41A 2JI8A 5C8XA 2H4HA 4NX2A 3VR5D 2W90A 3T3PB 2JD2A 5JECA 2Q0SA 3K09A 4O4IF 1PG0A 1VYHA 5K1ZA 5A7GA 5IAOA 4Z4EA 2Q3EA 1MUUA 3G5LA 4B73A 3LE8A 5DHTA 2DERA 4AFNA 1A82A 4JXZA 4UUMA 1OLSB 1JDZA 2Z9CA 3VAYA 5JYDA 5BSGA 4D3ZA 1VG8A 3H4TA 3HRHA 4IQ4A 1JKFA 4JH0A 4MIKA 4YRPA 1RYZA 2EU8A 1JHAA 3ZK9A 2F3QA 3OA0A 2X8WA 3QG5A 3EZ6A 4K9MA 2WWVD 5AESA 5B64A 4QYWA 2OVFA 4AUEA 4BFLA 3ITDA 2DBZA 4YEDA 1I7DA 1FU8A 2BI8A 2FSSA 4ARCA 3NXSA 4IYRA 3A9SA 2G0NA 3ENKA 3RGGA 3QELA 2JLAA 3AETA 3U4QB 3L0IB 4QJ4A 1SUFA 1P1JA 2IY8A 1CY7A 3PPXA 3RBVA 1FOEB 2W2MA 4MCJA 4UQLA 2WV7A 1PS8A 2QI9F 3GJZA 4WZBB 3PX7A 2MYPA 1YJ8A 3RSZA 2CYCA 3C5EA 1N0VC 4O29A 3U1TA 4Q4HB 2R7NA 4M4SA 1EWVA 1IRIA 1EAMA 1Q77A 4YJ3B 1KZ6A 3ZWNA 5IAAA 2Q8QA 4F6CA 2F9MA 2GCPA 3ENWA 1FLVA 4BKPA 1VZ3A 3IUNA 3UHJA 3SIWA 2AXPA 1KBZA 2VFAA 4R1TA 4KIFA 3TSYA 5IK2A 3M82A 3OJLA 2BGRA 3C7KA 3DPUA 4J0CA 3RFFA 5KVAA 1TJYA 4IG4A 3BK7A 4J94A 3D4PA 3H5WA 4BRUA 4ENVA 4X6LA 3PS9A 3SHTA 3OWOA 4U3JB 5B5SA 3GQBA 1A9XB 4BO8A 3RUPA 5JATA 1WHTA 4RJKA 4BZXA 1ES9A 1ZJJA 4YT2A 3HJBA 1HFKA 4UM9B 2A88A 3F7MA 3JX9A 3O7MA 2HJSA 2WT4A 4M21A 5D7NA 4BLSA 4CR8A 3ID6C 4GLFA 5HFJA 3SE0A 2A5JA 4F11A 4X71A 1TYZA 1ZOPA 2VYND 4OA5A 1Y3AA 2ZROA 4Y1GA 4ZQGA 1TU3A 4RMIA 5TSDA 2LCFA 1KKLA 3CF6R 4BFTA 3SBDA 5KQSA 2P11A 3D6FA 4NYMQ 5FOQA 2F4VB 1JF8A 1OY1A 3E3NA 4OPMA 2QX9A 4MKXA 3EH1A 5IBQA 3O3OB 2AF3C 4L27A 4DDWA 1Y6GA 5IT9A 5CDTA 4EB6A 3QBTA 4MHOA 2AK3A 1G16A 1A8HA 5G53C 2KS6A 2PNJA 1MZPA 2PKRA 3I2JA 3PBKA 4NENA 5FL3A 4Z86A 5I45A 1QRRA 1NBOA 2H9AA 3WLLA 3ICQB 2JVKA 1WAMA 3H2YA 1GG2A 3IKLA 4TSFD 1IXRC 4NWIA 4F96A 1F9AA 2GN4A 3HGTA 2R6GA 3ZE1B 1XV5A 3GRVA 4JAVC 4NFYA 3RC3A 2JBAB 3UAOA 1PJZA 4DRXA 3QX8A 1SU7A 2AI1A 4AJ1A 3T5CA 4FGZA 1UFQA 3K0KA 4U7FA 4IMPA 3UHPA 1VSQA 3CO5A 4K8RB 1C0KA 4KODA 3TSZA 3K32A 2G5TA 4J0QA 2R7KA 4QNMA 5GTDA 1NBEA 3V4SA 4HI0E 4JYBA 2OB2A 4ZMRA 4AX8A 3TDMA 821PA 3X0DA 1VDMA 3QH4A 4DCSA 4E13A 3CO0S 4Q37A 1EE9A 4WKCA 3PWSA 3E05A 2HWYA 5HRUA 2CKMA 4H1TA 1HL7A 5F7JA 3NDJA 4M8LA 4DCGA 4TMTA 3DHVA 3FMFA 4JUBA 4WT7A 5FWYA 3M81A 2Z8ZA 1JU4A 2Q1WA 4XKJA 3VR6A 2NUBA 2ZSDA 2D2XA 5H3HA 4N18A 2DCMA 1N2HA 4JA0A 4NY1A 1TOAA 5H68A 1PR4A 2GPYA 1V11B 2PGAA 1X0VA 2VHVA 1EX1A 2UZAA 1REQB 3DDOA 2QPAA 4G3XA 3PDUA 4IJUA 1N3IA 5BQ5A 3WB1A 4D0GA 3K70B 1UBCA 2VHUA 3UG6A 4RY8A 1Y1PA 1H9AA 2QB5A 1LJLA 4ECEA 1OAOA 1N6OA 4WA8A 1CEQA 4UHCA 4M1OA 5HDQA 2P2LA 3Q8XB 4PFSA 2ZRCA 1X86B 3HCDA 3CIOA 3GWGA 4B7AA 4B3RB 4EYOA 5IJ9B 3VZCA 1JE1A 5D3MB 4FEGA 1LLQA 3CJTA 1GYQA 2MIIA 2OCKA 1NXTA 1EBBA 1XP8A 3HVKA 3J81k 3ZVKA 2EX1A 4OP2A 1QFXA 1E0JA 3N87A 4FN5A 2P67A 2WM2A 3JSAA 4IIUA 1CDZA 3TLEA 4BASA 2CMHA 3PX3A 2YS6A 3CCCA 4RDXA 2HF2A 1VL5A 3KZCA 1DPFA 1U3TA 4U7GA 1E7MA 1EMDA 2XWPA 2BGTA 4WZAA 2JLYA 4X44A 3VTKA 2O7VA 1UJ2A 1Y9ZA 1IATA 1QRAA 2DPYA 1U0EA 2A35A 2A9OA 5THKA 5L45A 1KDVA 2V59A 4JEIA 1GCIA 1C29B 1HFWA 5SICE 3JAKA 3D7SA 5JQGA 4DCUA 1ZOIA 5KMGA 3B7WA 4I1IA 1UKYA 4EYQA 4WEQA 3KZOA 4Y0NA 1TGVA 1A1SA 1NUHA 4UVHA 3TL3A 3HUEA 2TMYA 5A4DA 2QL7A 3SQDA 1BHO1 1GNPA 2O2XA 4XYLA 1XU9A 1M1XB 1RJFA 3GEGA 1WZUA 4ZQIA 1D7AA 1ZO8A 1L7AA 2Q1SA 3T0IA 4Q9JA 4H0CA 4F3KA 4ARUA 4A8JB 4K8OA 1F4VA 2GT1A 2ZJAA 1ORIA 1NOIA 4NONA 4NOLA 1AGPA 1KZYC 2XX3A 2FLKA 5ILOA 4NOJA 3ZH2A 4S2EA 2YXNA 4WE3A 4YC7A 2TMKA 3LUDA 5DBHX 3FPSA 4EHLA 2RAPA 4DYVA 3OQMA 1OKKA 3L0OA 1T4CB 1VJ0A 3IUBA 4UOQA 4COOA 2GHIA 1FYDA 4IJWA 4JL6A 2O2SA 4U7PB 4YROA 1B2LA 3K96A 5E9QA 4KUGA 4ENWA 2A9KA 5TEWA 1X8JA 4Y18A 3AUXA 5LCXA 2PRIA 3TUJC 1NUAA 1P73A 2P5SA 2NU9A 2A94A 3MUFA 3QNUA 3WVNA 4YAKA 1M7BA 3PWTA 4X3PA 2R47A 5FI3A 3BT7A 2J5RA 3GRAA 4KYUA 2GWRA 3FI0A 3IPYA 1EM6A 2YRFA 4MQ4A 1KU0A 3LCUA 3PNKA 1VIDA 1ZI8A 4OHWA 4Y7CA 4ZDIA 1UWCA 2ZI3A 3KDAA 3Q7QA 4PVCA 4XLLA 3TGPA 3GNLA 3ZI7A 3EBLA 3L79A 3BE5A 4FNMA 4W9RA 3THYA 2O3QA 4UNQA 1CRQA 2R87A 2W6OA 1TIPA 2C1ZA 3LUFA 3CF2A 3OY7A 4S04A 2Y0PA 2EFCB 2WP8J 1YDMA 1MKYA 1M8FA 3FYHA 3NYWA 2IUUA 3OTWA 2BM0A 1BX0A 4TQAA 3NHSA 4M0CA 4BGIA 5T7BA 2I7TA 3IAAA 2YWXA 4XLZA 1AHPA 4ZKDA 1BVHA 4D99A 1XU4A 4O8CA 3MQ2A 5L51A 1PU2A 1Z28A 1D5WA 4Q93A 3ZHQA 4V1CB 5HGXA 4EELA 2GHRA 3L0SA 3KELA 3M1LA 1S2GA 2PUEA 1FU4A 4PPFA 3ZS8A 2ZCUA 2PGIA 1E92A 1O0CA 3WLFA 4F56A 1RWPA 2PSSA 2B20A 3HSYA 4LVOA 2EKQA 1IQRA 3CFYA 3DBVO 4IINA 3LT2A 2SKDA 4NG5A 2EW1A 2ZSIA 3NTLA 5JANA 1X14A 1ICEA 2OG2A 3BL5A 1HYEA 4HGRA 4KXVA 1XNRB 2DLCX 4AUNA 5HVNA 4K6KA 2PANA 1GZHB 4FMDB 4J6FA 2WD7B 2C3OA 3DL7A 3K1ZA 1R37A 4J0JA 2A3NA 2VH2A 5E2BA 1C0LA 1EX7A 2O0JA 3IIEA 4G56A 1GAQA 1X92A 1DG9A 2HK8A 1J23A 2I6TA 3ER6A 1IEVA 3OQ1A 4JELA 3TLXA 1IYZA 3QLVA 1VCIA 2VRCD 4JLMA 2WIAA 4JI1B 3U9LA 4L0MA 1PVDA 3EVGA 2CLHB 1B74A 4NATA 1UXIA 3PLRA 3D4IA 3L41A 4MWDA 2O1SA 2B94A 1MA0A 2X8JB 2NTEA 3PJDA 1FXUA 2HEIA 3ZWYA 4DR1B 4I5FA 3KEFA 2OZKA 1E8MA 3LCMA 3Q40A 4N3BA 3GNSA 1CP3A 1NX9A 4UPDA 5CPBA 3V3KA 4BHTA 4MVJI 3NTXA 1UAGA 2CXQA 4UBKA 2VO1A 2YYZA 1KETA 1I33A 4EY4A 5HFAA 2UXBB 2CB9A 2QRJA 2NO6A 2PK3A 3GXOA 4EAAA 2JFPA 5LR6A 2V3CC 2G1UA 4HX2A 2I99A 3TN7A 3U4DA 4MJ7A 1U4SA 4TS1A 4EF4A 3LH5A 2XKAA 4IXWA 3WK4A 4EHDA 1LCIA 1WDTA 4E32A 4PN7A 4W5TA 4H4EA 3C8HA 1JSZA 1RWVA 3VU9A 1X1DA 4BDTA 5KHAA 1YRBA 3FCAA 4NRDA 2PMEA 3EQZA 2BDEA 1RP7A 1PBNA 5BQFA 3V1YA 4BV9A 3M6FA 1N8NA 4ZV9A 4CEIB 1MJGA 3CBGA 1O9GA 4BMVA 4HMPA 4TS4A 3CPHA 1KP3A 1ODIA 2CD9A 2QTVB 2X13A 3E7FA 3LSTA 4LOAA 4JJ7A 4QOIA 4LWPA 2RK6A 4ZAZA 2IEZA 3RSCA 1KC3A 5TQ0B 3WWCA 4EQ6A 3W3ZB 1ULSA 4G8CA 4L78A 5LXTF 2IZ7A 3W5DA 3LF1A 5EXTA 2X58A 2AFRA 5K4GA 4LHVA 2VPQA 4RYLA 1C8LA 4P7KA 3Q3CA 3W5HA 4A6EA 2XKKA 3GP8A 1GKKA 4O4LA 4WNCA 4C03A 1V5GA 3KKKA 4EGSA 1BKDR 2P9QA 2XUZA 1JSLA 1MC4A 2ATEA 1KEUA 2KPOA 1MQ8B 2VRWA 3IEPA 2A2ZA 3IUYA 4FZ3A 1LDNA 1PJTA 3H7AA 1QUFA 1FXSA 3L0YA 4GI2A 1VBKA 3DBLB 2QBYA 3M5CA 2BZ0A 1E6MA 1J2RA 3UVEA 4EVSA 4Z49A 3PE6A 4CKCB 3OOEA 2VP3A 3Q2OA 5T8KC 3B3AA 3TW8A 1XMOB 3ORRA 4H7KA 1EFCA 1F48A 2A0KA 2FLVA 3ZY2A 1P0MA 2UDPA 4HGPA 1W0KD 2JFZA 4YUZA 4BQEA 3TNYA 1YQ9A 4P4GA 2CLDX 2PKQO 4NFLA 4RZ2A 5H70A 3SNKA 2PH3A 1DDOA 4DWJA 4WFQA 3GDHA 2D1TA 3LPNA 4Z1MD 2CDNA 5F51A 2EYQA 5B4TA 2J9YB 5CB4B 3ZD6A 2EBWA 2RH4A 3DB1A 4JP5A 2P1RA 5F3DA 3A4IA 2GPSA 5DLYA 3V48A 2EGGA 3BWMA 3GRPA 1JEYA 2AFHE 5B4VA 3RVLA 4R2HA 2QTHA 3ROEA 4UTOA 3RVKA 4CL8A 4Z3OA 2H11A 5B53A 5E38A 1WCWA 1DOHA 2CNNA 2FPMA 2JASA 2AOVA 2QM8A 3E5HA 3PNBA 5CGZA 1UMDB 4CFZA 4HH1A 1T5OA 2Q6OA 4LE0A 3RUFA 4DG9A 4MOWA 4KU4A 1YOVA 3U3XA 5A5EA 1F6BA 3WB2A 2FZEA 3LLVA 3PDWA 1C3JA 4B0OA 1NQOA 4OAOA 3PFBA 2UZ1A 1P5ZB 3N8DA 1AS3A 4GYJA 2B9VA 2IEAA 3V4LA 5AR1A 5IMSA 3HR4A 4B3GA 5D3QA 2ACEA 2DE0X 2HEGA 1MH1A 3INRA 3B89A 4XB6B 2YW2A 4ZFNA 2NNLD 1SQGA 4OSOA 5LMUB 4EA9A 4B75A 1MGPA 4IIEA 5KB3A 3LC7O 3RV4A 4AG3A 1Q0LA 2QDKA 4MRAA 4QASA 2QWXA 4V1CI 5CDSA 1ADGA 1V8FA 4D0NA 1RCFA 3B1VA 1T8YA 4XASA 1P2VA 1F3OA 1KEEA 3HLKA 1QG2A 2J3KA 4JMLA 4XUEA 1TTPB 3U4AA 1KJWA 4EPRA 1MQSA 2ABWA 5EWJA 4V2UA 2ONJA 2GPTA 4QLOA 3LKZA 4YAGA 3E5RA 1RXEA 5FB3A 3UJDA 2JRLA 3GQVA 3BMOB 2Z43A 4U0KA 5AHXA 3IMKA 1U0FA 1HWYA 1DC7A 1K66A 4LJ4A 2YL2A 4E88A 1EU1A 1IWOA 1EHCA 1UMCB 4K46A 5IDQA 1LPPA 4BLUA 4U9HS 3NU1A 2Z9BA 3F4LA 1U7TA 3LBYA 4E5NA 1VMDA 3GV0A 1CCWA 2HU8A 2FCAA 2QTRA 4ZARA 5FUXA 4BZZA 1T5IA 2FQWA 2XAUA 3KJXA 4B6GA 5FBQB 3H2IA 2QW8A 4HDCA 1ARZA 1BKYA 1XDSA 5LBUA 2A84A 3GGOA 1A97A 4CM8A 2NTVA 2NZVG 1Y48E 3DR5A 4PY2A 3R7SA 3R6TA 1T3HA 2ZUWA 1N6RA 1BOOA 3QI7A 4G81A 4BDSA 4D4IA 5KOJA 1YZ3A 5C8ZA 1WBBA 2DVMA 2GX6A 1KDRA 3SIPA 2WJZB 5EHGA 1NXOA 1ISPA 3BB1A 3IV7A 2QVLA 4ZZ1A 3MM4A 1Q95A 3KL4A 1HT3A 4N01A 2HLHA 2O8EA 4P35A 2HTEA 3L4BC 2Q50A 3RVJA 1QZUA 4XM0A 3V9PA 4BP3A 2C2XA 4ARAA 2FR8C 3PL5A 4JR1A 2EZ4A 1KJJA 3JALB 3X43A 4XR9A 3HNRA 1KKMA 3E9QA 3D43A 5F2OA 1C8KA 1W88A 2PGDA 4W9NA 2QKYA 4K6HA 4IKEA 3RNOA 3HFGA 3WP1B 1OH5A 3JVEA 2OXEA 3U3JA 1F9EA 4M0FA 5A3JA 2BLNA 2XGSA 3FCCA 2KHZA 3I04A 3L05A 4IG9A 3SCZA 3TGLA 3AX6A 2V7UA 4UU8A 2E4YA 3WR5A 4KE6A 3F9IA 1YU6A 3V1KA 1E3EA 4RC9A 4ZC8A 1A5SB 5LP6F 3TOZA 2AXEA 1NVDA 1X7YA 2FX2A 4HQRA 2OWEA 4EJMA 5F77A 4MW9A 1XU7A 4OY3A 3EXFB 4EL5A 1W85B 2H1WA 1JJAA 1VBFA 2N46A 3CNOA 5JD4A 1GQFA 2HFJA 4KNYA 1KAQA 2I7XA 1JQJC 2CLOB 1TEXA 4YAOA 3BIWA 4EGAA 1ZVKA 1KYTA 4FE7A 1IXKA 1RJGA 2VP9A 3K9NA 4RK6A 1FYVA 1UQTA 4QXMA 1KEKA 5A9TA 3QWFA 3IGFA 3MT7A 1YDGA 3HYSA 3NAQA 3P19A 4X95A 5G0WA 4JP2A 3G8DA 3V34A 5I4KA 4H7IA 4AXXA 3ANXA 3B6ZA 1GUYA 1DWQA 4MUEA 3N76A 2PQ6A 4YJ3F 1H8HA 1Z5VA 3OU6A 1OX4A 3KYDB 5M29A 1MO6A 5HG0A 3V8NA 3GJ8A 2UKDA 1QHXA 3VAZA 1KS9A 2RIPA 4BX3A 4E6PA 2Q0XA 1Q6ZA 4PYNA 1A98A 1XEXA 4AS3A 1E89A 2ZSUA 4C7JA 3TECE 3KSUA 4G0NA 1V45E 3IPCA 4IQ8A 1PQUA 1TGYA 3SSNA 3HDGA 6ABPA 3BDVA 4BQOA 3VC2A 2JB9A 2IXEA 2YCLA 1RBQA 2ZUUA 3MMSA 5DYNA 5LC1A 5L4SA 4JK3A 4QC2A 3E3OA 2L82A 1SXIA 2BBOA 3MK31 3ZLTA 3GLFA 5TVGA 2FRVA 4RFSA 3HBJA 3AIKA 1E9AA 2D00A 3GUZA 4RGQA 3RU9A 4P4SA 3USCS 2XE4A 3GCXA 4O08A 2V6JA 4W5OA 4HAUA 4XQCA 2YIJA 1UBFA 1Z7GA 3RIXA 4EJ6A 1U0LA 3AWDA 2EFDB 3OCJA 2JFFA 4IZHA 3SNHA 4YAJA 3RUCA 3QV1A 3S27A 4BLQA 4ER7A 1A5AB 5TEVA 5MDHA 3QELB 3AETB 4FR0A 3RVNA 2J08A 2E4UA 3TZHA 1DRWA 1DQZA 2A4MA 2HA6A 5IYZA 1HRDA 1Z7BA 3PQ7A 1W7AA 3U16A 1HEYA 2XRMA 4NE2A 1O0BA 2FXIA 3NVMB 4D9EA 3WKDA 3TG2A 2R4UA 4OYYA 4ZEVA 4MQMA 3MSXA 2XD9A 5AHWA 5DN6A 3IE2A 2P2ZA 5C8YF 2R00C 3N86A 2PV0A 5M2QA 1HORA 4BJ1A 1K2VN 1NVFA 1U2QA 3S7TA 2O48X 2ZWPA 1QG4A 3K0BA 3KE8A 2QR2A 4BO5A 5JHGB 2NGRA 2VDRB 4MARA 1O1YA 1PGNA 2AC4A 2X22A 4GBJA 5SYNA 5TQVA 4KPYA 2Z09A 4DPLA 2YICA 1I8TA 2BHLA 1LEHA 1M8GA 1L7MA 1QGUA 1TKCA 3A1SA 1L5NA 2YZMA 3UGTA 2BKUA 3OM1A 4MW4A 2B8TA 4N49A 5I9SA 1T8SA 4I4CA 4D2IA 2WAMA 3OD5A 4DDVA 1A5ZA 2BN4A 2CNWA 5ALYA 1JG3A 1NUTA 2W0MA 1WHTB 4KBYA 2PDAA 2FFQA 3PJEA 4M0MA 2HNKA 1GT6A 1C3EA 2WK1A 4KQKA 4CU5A 4E5MA 4YJ2A 1JLMA 1W87A 3BZBA 2GCEA 3LPLA 1CUUA 1HE1C 3DH0A 3NI2A 4JLUA 3LXMA 1DQSA 3ZJ5A 4Y6OA 1GPUA 4GVPA 5HUQA 5COQA 2VCHA 2X0RA 4HX9A 4RD2A 5E7JA 4G0ZA 4Q03A 2PR7A 4ZV7A 4X6XA 4QQRA 2O23A 3SVTA 2FWPA 1RTTA 1RXSA 2F6RA 2YVLA 1J25A 2VPWA 4ARVA 1STOA 4BPRA 4LXIA 5TX7A 2GCIA 3O8DA 3IEMA 3EPKA 4EB6B 1MHTA 5TJ9A 5MF6A 1FW6A 4CL0A 2RKWA 4BTEA 3GUCA 2JLVA 3TR0A 3D4NA 4BJ3A 3DBRA 4BPBA 4NENB 1YA6A 3I9OA 4PBTA 5CFPA 3ZE8A 5A9RA 1R8SA 3G9XA 3OZUA 1H2YA 3ZWWA 3TQSA 2WJ6A 3FHJA 3BXGA 1JTEA 3KKLA 4J9UE 1S96A 4LY3A 4NI5A 3W2HA 1KO1A 1MX1A 4RVNA 3M34A 3UC5A 1YTUA 4DRXB 4S1TA 3M89A 2FG6C 3STUA 4CIAA 1YVRA 4KWEA 2BFDA 3ZBTA 1Y3DE 2HCTA 4MIEA 4K3UA 3C0KA 4DPKA 2IKQA 4MVJG 2ZBQA 3P0RA 3UHAA 4EY5A 4LZJA 1E20A 4OOFA 3VTZA 3NTUA 1CZOA 1BJKA 2BSXA 4EOGA 1F8FA 4R68A 1E32A 1NE7A 2YNMC 5YASA 3TBKA 1XDUA 4IAOA 4G1UC 3BDIA 4GP6A 4TT3D 3M6IA 1YJAA 1ZGBA 5CH5A 5AYVA 4DDHA 1OYYA 4YB8A 3AK4A 1UPTA 3FLBA 3HV2A 5AI5A 3MIZA 3KPYA 3WGYA 4CPDA 3AFHA 5K8IA 5KYNA 4ZQFA 4KP7A 3GHHA 5A5FA 2ODQA 2RI6A 3HJHA 4E4YA 2XRFA 5B1SA 1UK6A 1GDDA 2X0EA 1FS4A 3D3WA 4S12A 3VNBA 5C5IA 4ZANA 3PL1A 3D2LA 1QE0A 4C4XA 2RIRA 3OZTA 4ZU3A 4IDFA 3TRJA 2Q9AA 4XGQA 2P2NA 4ZEXA 5KIAA 4PZ0A 2DQYA 2PD4A 1GGNA 3BFPA 4AG5A 4WEOA 1MDFA 3HRKA 4R9NA 3KLBA 1AUVA 3LFHA 1XTTA 1U63A 3ERCA 5KVSA 4NCKA 4Z9BA 1OYWA 2OBYA 3MTIA 1CUXA 2PVCA 3KKOA 1J33A 3L02A 3K1JA 1XX6A 2EKBA 1KGSA 2XBUA 1UXHA 2EWWA 5C1DA 5JAQA 1T0JB 4Y9RA 2AX3A 1JFSA 3B1WA 1G60A 1HQCA 2K2QB 3BGWA 4G5OA 4QJIA 2O2GA 4JP1A 5CXXA 5FCDA 2WHEA 4DZRA 2ZSBA 3MYRA 5CHYA 3HU3A 2X86A 3H3FA 4Q4CA 7REQA 1SUIA 3QOFA 1XJWA 4UEWA 4INOA 5IBRA 1GDTA 4J1NA 5IZCA 5LUAA 1E7YA 5DTEA 4EUKA 2GZAA 2JFXA 2Q4TA 4ZYZA 5AW7A 4DCMA 3MUNA 2V9CA 1GAWA 3NIGB 2ZDQA 4G5HA 5EVCA 4OK5A 4WZAB 3TW4A 5JE8A 2Q4EA 2GO1A 4MKHA 3DB2A 4YR7A 4D9HA 2VNJA 3BCRA 5FEMA 1LGYA 4DLBA 1IRXA 2BYTA 3OZWA 2RHRA 1R6VA 5FI5A 1GILA 4US0R 1SUBA 3DL0A 1C4KA 3I1JA 3JAKB 4QU9A 5AUNB 5JQGB 1UP6A 2QUIA 3TH5A 4AO7A 3BGIA 3FKQA 1Q14A 4S1OA 5KMGB 2GPJA 2Z6VA 3KVYA 3GVXA 2ZXEA 3IBFA 2HJ9A 1L3CA 3P2YA 1GZ4A 5JWRA 3DKVA 2DY0A 1D0SA 4M7WA 3IJPA 1GUBA 3F4BA 4LYEA 4AN1A 3KNZA 3LXUX 2GWHA 4LMPA 4CMBA 2GTPA 2DHQA 3DFFA 1QF6A 5L3VA 3IR5A 4HDSA 2Y76A 5IABA 2GH1A 3CVUA 3U44A 4IIFA 2F1RA 2GHQA 3SZ3A 5IKPA 1QH0A 5KYTA 1U5AA 1E2UA 4DR2B 3OBBA 2GNPA 3SMQA 1BAPA 4XEHA 3QK7A 4DMUB 1N3YA 3W3AA 1XD8A 2GF9A 3JW8A 4PIVA 2V6BA 3ZU5A 1IIRA 2AOUA 2ID7A 3EF0A 1OI2A 4L3WA 5D00A 4DLRA 3QWHA 2G17A 2Q4OA 5EIOA 5C46F 2OFPA 4C0XA 4DZTA 9LDTA 4RIIA 5KQMA 1U9JA 3GJ7A 5EJ7A 3W79A 3NCTA 2PJRA 4DCNA 2ANBA 3D2AA 4FMDF 2GEBA 1PO7A 2IE0A 3KTAA 3MTGA 1ULUA 2QYHA 4WI1A 3QA9A 5ITZA 3JQ6A 1UC5B 1A50B 4IJKA 2G63A 2NU9B 1GZDA 3E35A 3PNVA 2WTUA 4QPDA 5FI1B 3NOQA 2WG2A 2ATCA 1QR2A 3IXQA 3OTGA 4QPNA 1KMQA 2I2BA 2VJDA 4LWQA 1PSZA 2GM3A 4Q7JB 1JEAA 3IQDB 3N0RA 3Q72A 4I2VA 4OATA 5LBTA 5CFRA 1WNTA 1QQTA 1KOJA 4KZKA 3RS0A 4D02A 1E5DA 2C5BA 2IHVA 1JR3E 3BJMA 3AI7A 2AL7A 3HJGA 3PVSA 4ALJA 2EKZA 1NPTO 1NF3A 3THYB 2CV2A 2QMEA 1JDPA 3QU7A 3ZD8A 3G2HA 3UMVA 2HQ1A 1JPVA 2V7PA 3HNOA 3R41A 4I1UA 5K2MA 5C5DA 5KTMA 4LXTA 3LL4A 2NNWB 1JIVA 2C3YA 4B31A 1GQQA 3SI7A 2HKIA 1DEXA 4W1PA 1L4EA 4BY9E 3LLMA 3RU2A 4KXQA 3N8NA 1GTJ1 3KIPA 1YJBA 2Q2NA 3B7PA 1FFSA 1JSXA 2BFPA 2Q27A 3L6CA 1WMAA 4YJFB 1XLUA 1Y7TA 3FPLA 5FOWA 1I51A 1EP9A 3CNQS 1EJ6A 3EZNA 1MEEA 1YI8A 1PD0A 9MHTA 2LGJA 2YVAA 1ZFNA 1OREA 2HA3A 3DGFC 1J2UA 2O3JA 2I66A 3PU6A 4JIGA 4PLYA 3ZWQA 2DZDA 4RVDA 4PNPA 2ORWA 1LX6A 1CE8A 1M66A 2OMKA 3GROA 3VZQA 3SC2A 8LDHA 2Q2OA 1PVOA 1WSBA 3MCZA 4MUGA 5L7YA 1G8MA 2AX4A 4IQ0A 4DMHA 3PQ5A 5KNDA 3ADBA 3FR7A 4KTTE 5LIRA 1OGIA 4WKGA 3SYKA 2I9KA 3FTFA 1NMZA 4A82A 5TNXA 4DBVO 3RVMA 1CYDA 3FM9A 3HY6A 4RENA 1VIVA 3L7NA 1Y5LA 1N2ZA 3GOQA 3P9ZA 4EKDA 3G13A 3L3BA 2GBFA 5I4IA 4NECA 2FKNA 4HAOA 3D8BA 2YWCA 3G5MA 4FZ5A 2AG8A 5B58T 3UWKA 4GR9A 2P6UA 4AO8A 1GCGA 2E6KA 3T3GA 1LI7A 1W9MA 1V4VA 2ZT8A 3VISA 4QIHA 2YWDA 4ECAA 4CETA 4CMEC 3U4MA 5DASA 1VA5A 1G5PA 1YOBA 3TIVA 3DFMA 1SCKA 4BAGA 1IK6A 4HNVA 3EMDA 3LG2A 5AM3A 2VAXA 1V95A 2VDPB 4OJNA 1G8AA 1NVXQ 3M2TA 2OLKA 4RVGA 5COBA 2JI4A 3WLIA 5KJ6A 3UKJA 1DPGA 4Y2SA 3REQA 3B36A 1U3UA 1UODA 4MYCA 3TIXB 2HBRA 1R0RE 3GPDG 1D07A 1GPJA 3BAZA 4MYTA 3EC2A 4C3VA 4MDEA 3GRRA 1QZTA 1GNVA 4PR3A 5FL7A 1NN1A 3V1TC 5ER6A 2HD4A 4JEUA 3OEHD 1ZCBA 3SEFA 4EARA 2C5LA 3OTOB 3ZD9A 1U2DC 3BERA 4HLQB 1TO1E 4U2EA 3VFDA 2LKDA 5A3VA 5E7IA 4YQZA 1T6YA 3KZ1E 2XADA 5JH7F 1EZ1A 4UDYX 3LC1O 2KSQA 2X7HA 2IS6A 1RPJA 2GNAA 4DMGA 4EITA 3SOZA 2JKYA 2O07A 2AOWA 4PICA 3A1WA 4C7XA 1WMEA 4G37A 4UE6A 3TI9A 2Z0MA 5JCJD 3GRCA 5DRTA 1E6KA 2BMEA 2NSHA 1NW7A 5CG2A 5H16A 2OLJA 1R16A 2FE4A 2NUPA 3J7TA 4NV1A 4EQ6B 4AY2A 3HBMA 4F3YA 1P80A 1UFVA 1CRZA 2FN4A 2XR1A 5K45A 1CBUA 1BH2A 2AE1A 5K6AC 1LQUA 1U31A 1CD5A 3AR4A 3OZVA 3RVSA 5HS6A 4ZT2A 3TINA 5FTMA 5LZ8A 4W9MC 1PLJA 3A1EA 4NK4A 1GUFA 3PNMA 4HATA 1W5FA 2LR0A 3H2HA 4IJ6A 3HXQA 1QDLB 2QBYB 4MGEA 3ZW7A 4PGAA 3ZH9B 1V5IA 2XUHA 4NZNA 3CGWA 4Q3AA 5C7IO 2QTWB 3VR4D 1UDCA 3TX6A 1YB1A 3U37A 1GTSA 2PWBA 3OI7A 4G1MB 2V3WA 3E6AA 4FBLA 2EF1A 2FE1A 1FNSA 1Z68A 4QREA 5I48A 1O4VA 1R4NA 2OV2A 3MMXA 4ZVSA 4AJ4A 1THMA 3OM0A 2FP3A 3NHRA 1ZICA 3DG9A 1XZFA 1DBPA 2P3SA 3N2YA 3VTFA 3HPRA 4P38A 1JEYB 4QBGB 4EDFA 1KWKA 3OBIA 4V0MA 3S4YA 4LV8B 2M9MA 4J3FA 3DEYX 2FPXA 4TXLA 3I5AA 4CIXA 1D4AA 1WW2A 2Q29A 3AJ8A 4F45A 2H7YA 3QVWA 3GFBA 4L0DA 4HYYA 4QTUB 1ZI6A 3NVAA 3O95A 4TXJA 1KYXA 4KXFB 4WBNF 4BAZA 3SS7X 4OHYA 2OORC 1YOVB 3I37X 4DJDC 3EXG2 3QE0A 3WMRA 1NKTA 1E6WA 4PW0A 2REQA 3ZI0A 3OZGA 4RDIA 2WVAA 1R4ZA 4YIKA 3GMTA 2QI9C 4R3WA 4C5CA 3GJ4A 4FXOA 1IQPA 2UZ1B 4HQKA 3RRXA 3JU3A 4KYTA 5ICCA 4JQYA 1NYQA 3SEZA 4G36A 4NCXA 4RVHA 2MINA 1YGPA 5E4JA 4AMGA 4GICA 3T1TA 4KFRA 1HETA 1PR2A 1E94E 3A1CA 3MTBA 1IWBB 3V6MA 1FFHA 2WTNA 4KVFA 2YY5A 3RG8A 3VZBA 1IDOA 1F6WA 1CUYA 1COZA 1UPUA 1UQUA 2IYAA 3R0ZA 3GJ5A 3WGUA 1YL5A 1UJ4A 1CR6A 4ZKEA 3BD8A 1OXKB 1KEEB 1TQ4A 3D0KA 4LOKA 3T7TA 1KFCB 3C5VA 3CXRA 4YJDA 2VC2B 5EWJB 5IAGA 3KOUA 4P8RA 3FCSB 3NAZA 1SOUA 4YQEA 2ZIUB 3AR7A 4DLNA 4X64B 4PONA 5IF3A 3QF4A 3VNUA 4IZOA 3W6OA 4YAUA 4F8JA 2Q62A 1U1GA 1BMTA 2PUWA 3Q1LA 4OEHA 3UMGA 2EVWX 2ZATA 1EDOA 1WP9A 4HNAA 1HKHA 4LXUA 4ZC1A 2H31A 1AVTA 1E1NA 1WW8A 3OC0A 3OQVA 4BV3A 3T3NA 3ZV7A 4EZEA 5IJAA 2VDNB 5G1NA 1S3FA 3V7YA 3GPLA 4H77A 2FSHA 3R3HA 5EOVA 1OX6A 2LD4A 4HJXA 1RRPA 4M0DA 3W2FA 4CM8B 2OCXA 2ZB2A 4AYWA 1F6DA 4CCWA 3LKBA 4PTZA 1XUOA 3OJFA 5KOJB 2D5LA 4O2AF 1Q7CA 1MF7A 1WG8A 3OJXA 1NVEA 1IY0A 5DNEA 5JJIA 2CNBA 3Q8MA 2C2ZA 4RVSA 3OG9A 3FOEC 4JLBA 4PS1A 3FIJA 1R5BA 3GEMA 1Z3CA 3D1VA 3M4XA 1EVJA 2O2EA 3HDYA 2GZRA 3L0PA 3P0JA 5DP2A 1T4DA 1MX9A 1S01A 2D0IA 4DW8A 4Z4IA 1CQPA 1TM4E 1YE5A 3GPIA 3ZOZA 1NHWA 2PU5A 1IN6A 1W88B 1Y3FE 4FS3A 4FYYA 4L50A 4ENTA 2CW5A 2DRIA 4CCSA 3G1WA 4L3VA 1U2SA 4MQBA 1SUPA 4XIYA 1EGAA 3D4OA 1TCBA 1X42A 3E9DA 3NLLA 2DYKA 2QN1A 3H1TA 4LK3A 4QSMA 4CQMA 1XZHA 4CW7A 4RKFA 1X7YB 1YC2A 3JWPA 3D6HA 5JWHA 1LKZA 2NXEA 5B3AA 4DV7B 3PPYA 4ZTBA 1UKCA 2NTJA 3A4TA 5TARA 5IVPA 4DTCA 1ZVVA 3GHYA 3E8MA 4EMTA 3EVDA 1AC5A 3QYPA 1U7PA 3QFFA 3DPSA 2SNIE 4PBSA 2BEUA 2VDKB 3D31A 1SG6A 1GPH1 3G0IA 3R5TA 4XUGB 5GAJA 2B8JA 4ZVLA 3L0CA 4D8WA 4QG3A 2GCNA 2J09A 3GCWA 2V6GA 5TGZA 1JIQA 1Q0HA 1JHUA 3G2NA 2FWRA 1XK7A 1XVLA 1PEYA 3Q7TA 3WGMA 3FIUA 1HZZA 4EG8A 4BX2A 4NYJR 5B6IA 1YVPA 1KRXA 1IE3A 3ND7A 4RF4A 5CNIA 1IOLA 3VDMA 1JTFA 4BUCA 1H69A 2FOXA 1H0KA 3BGDA 5BW6B 5G0VA 3DKPA 2ZYDA 1QBKC 3WK9A 1OX4B 2HIAA 1PL0A 1QO9A 3TTYA 1XZ8A 4C7VA 3FWKA 5I3CA 3IDOA 2Y05A 1BJTA 3C45A 1BCRA 1QYWA 3OOSA 2GK6A 3OQ6A 3BJRA 4GOND 3DE0X 2OHJA 5T5QA 2CLFB 5E1DA 1H2EA 4U2BA 2ONCA 3LBNA 3VI3B 3VOBA 2IYOA 2JIRA 3IULA 3BXEA 1ZD3A 3FH0A 4WD3A 1G42A 1XZPA 5FEUA 5A4MS 2H0AA 3E7PA 3NT4A 3EXIA 5ECDA 1JUDA 2BE9A 1TTTA 4X60A 1XZLA 2ZITA 5BWLA 1NVAA 1JTVA 4FQ7A 1AKYA 1QIKA 2O2HA 2ODTX 3HL0A 4PCAA 2AZMA 3MWLA 4RFSB 2C9BA 4UVEA 4YFVA 4A91A 4BFYA 3OC6A 5FV4A 5KDLA 4P4SB 4B6PA 2D5CA 2IOHA 5B1EA 4PYIA 3P20A 2XUOA 1F20A 4KMOA 1Z0IA 2V7XA 3SVZA 3IQFA 5I7VA 1RYMA 1VL0A 1N2CE 2CSXA 3EG9A 3V1LA 2RGNA 5K0TA 1C9JA 1EGVB 1NYRA 4D5GA 2VQEB 1C0EA 1AQNA 4B3FX 2XBMA 2QSUA 3KG2A 1HMYA 3HBNA 1YZLA 4EVRA 1B8UA 1S4MA 2NLOA 3LDHA 4FCTA 3DE2X 3TSWA 5IYZB 1E3WA 3RAEC 3CHYA 2ZJ7A 4Y98A 3W05A 1XMJA 2YVKA 4YA6A 4EW3A 4YRDA 2VUTA 2Y1GA 4DLYA 1H6AA 1KJNA 4G1CA 3EAGA 4P4UA 4GVXA 2OHIA 2OXTA 1Y6QA 4OUDA 1RQXA 4MP3A 1B23P 4MCHA 3I73A 1NV9A 3TJMA 1YKFA 1P5RA 1IULA 1RRGA 4DIMA 4RMNA 4EY3A 5BXQC 3VU0A 1FSGA 1K4KA 5SV2A 4BJHB 5C1IA 2LDXA 3FBWA 2B2NA 2LV8A 1QVRA 1I1HA 3MTAA 2FF7A 4BMYA 5L3QA 1QGUB 3CB4A 1EESA 1UL1X 3DT6A 2B1JA 4OBXA 3IIIA 2Y9MB 3ICOA 3L06A 1A7AA 2X9VA 1GGMA 2PS9A 4PCUA 2BZSA 1HLDA 1YBFA 1YL6A 2YN0A 4OUKX 3I92A 3W5BA 3ZJTA 1RZVA 4LDQA 4X41A 3R7NA 2GJ8A 2BVNA 1OT3A 4QHYA 1AUOA 1BHJA 5CH3A 3W6UA 2BONA 5K51A 3OUTA 5IT0A 1KZGB 2CWDA 3EGOA 1P19A 4CXMA 4LQ4A 2IV7A 4AYTA 1U11A 4JT9A 5FPYA 1CS0B 2VHZA 3L1VA 1VJGA 4FFOA 4HC4A 1Y7PA 2E4AA 1Z8DA 4C87A 2L18A 4QSHA 1PK8A 3MWFA 1TQDA