1I27A

Crystal structure of the c-terminal domain of the rap74 subunit of human transcription factor iif (tfiif)
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
73
structure length
73
Chain Sequence
GPLGSGDVQVTEDAVRRYLTRKPMTTKDLLKKFQTKKTGLSSEQTVNVLAQILKRLNPERKMINDKMHFSLKE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords TRANSCRIPTION FACTOR IIF
publication title Crystal structure of the C-terminal domain of the RAP74 subunit of human transcription factor IIF.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription
total genus 19
structure length 73
sequence length 73
ec nomenclature
pdb deposition date 2001-02-07
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 1i27A00
1FX7A 3R61A 2DQRA 4R8HA 5AIQA 3F21A 4A12A 3RTRA 2HTSA 2BYVE 1DPRA 1XCVA 1R58A 3N97A 3F3XA 5DUKA 2Q0OA 3CUOA 1ZRFA 1SFXA 3KP4A 1ZRDA 3M1EA 4XLNF 4ETSA 1IXCA 5BPIA 1XGSA 2O8XA 3I59B 4OOIA 2Z33A 2QLZA 4DQ2A 1W7PA 2ZNYA 3GO5A 2V1DA 2EV5A 2LNBA 4IHTA 4G8XA 4UV9A 1E2XA 2OU2A 1JHFA 1FT9A 5LGTA 3RJPA 1B4AA 1P4XA 4I98B 1IRFA 5LGUA 4PCQA 2VODA 5ICCA 4WK8F 1G3WA 2H6BA 1B9MA 4YFXF 2PMHA 2XKPA 3BJ6A 1YYVA 3K1PA 2IA1A 5FGMA 3I5UA 2Z99A 1RIOH 1BOAA 4BHCA 3J7AO 4UHTA 4CYDA 1BI1A 4MNUA 4AIHA 3SZTA 1Z6TA 1Y0UA 3VEPA 5L3BA 2GIVA 4KYWA 5CVUA 4EJWA 3KCCA 1V4RA 4LLLA 2HYGD 3L9FA 4M9ZA 1FZPB 3LAPA 1BI0A 3ZMSA 4LB5A 4XBFA 1YW7A 3B73A 3CJNA 2QQAA 2P5VA 3ELKA 5J8FA 2A68F 1O7LA 2E7WA 5DV5A 2EWNA 4RAZA 4P9FA 5E17F 3F72A 3LA3A 3TOBA 4B09A 5CVIA 3FM3A 1P6RA 3FXRA 4LLNA 1HSJA 1W5TA 1G3YA 4O5VA 2VBYA 3GZ5A 2OBPA 4MEYF 2ZBKA 3ABUA 3HOTA 2Q8KA 3TOAA 3ULQB 1LDDA 3GVAA 4NB5A 2GA1A 3J81K 2RQPA 4BAYA 4A5MA 1HKSA 3BJOA 1V3FA 2HS5A 3E6MA 1K6OA 2D2WA 1ZG3A 1EH8A 5A2QK 3COAC 1FSEA 3QU3A 2VE9A 1PP8F 1IRGA 1KU3A 1WRJA 1FYMA 3J80K 2BBYA 3CDHA 3IWZA 2IRFG 5BS6A 2Z5UA 1ZH5A 3Q9VA 1TW3A 1TQIA 2A3SA 1EH6A 2VBXA 5BQTA 3MCZA 3ISPA 3C3WA 5FO5A 1ZGAA 4G6DA 2ZCWA 3W6KB 3WE2A 4LG0A 4UNOA 1ZLJA 4R1HA 2H94A 2LDUA 4Q47A 3Q5FA 1S8NA 2IA2A 3T0YA 1RNLA 1R23A 3BDDA 1IXSB 3R0AA 4EJTA 2ZFWA 4BQAA 1DUXC 4I01A 3P7NA 4LMYA 3CO6C 1ZAOA 1H9GA 3FX3A 1D8KA 4CICA 3CLOA 4M71A 1KQ8A 1MKMA 2DK5A 3KETA 1KU2A 2ZMEA 3KP5A 2P4WA 1FC3A 3Q9SA 3IKTA 5IT3A 3P9IA 1ULYA 2XKOA 2DT5A 5L3FA 1HQCA 4PDKA 1R00A 4HX4A 3E5XA 1BBYA 1KQ0A 2QZ8A 3IKVA 3GFIA 5HS8A 4IJAA 4OIRF 3ECHA 4BXUA 2MLKA 2K86A 2R7DA 2V79A 3LWFA 1TTYA 2QYOA 5JFRA 4HV6A 2P6TA 1P2FA 3LFKA 1OYWA 1YIOA 4PGHA 2L3DA 1T0FA 5HS7A 4GO1A 4NQWA 1U78A 3QP5A 1H0MA 1XCBA 1S29A 3G73A 4M6XA 1PDNC 5F64A 3SZPA 3WG9A 3PQKA 1QPMA 1TW2A 5D6EA 2VBWA 5FD5A 4E70A 4ZYDA 3R0JA 4OIQF 2P8TA 1Z1DA 5LRRA 2P7CB 2RGVA 3HRTA 3M8EA 3U9GA 2M30A 3DF8A 1MDMA 5E8IA 2UZKA 1RI7A 4KIGA 4LGWA 3E6DA 4U0WA 1ZHFA 1ONVA 2RDPA 2K4JA 3T8RA 3I4PA 4UVCA 2FQ3A 3D0SA 4WXDA 2LKPA 3N4MA 5D8LB 2YU3A 4KNYA 5ILVA 3WTYC 1D8JA 1IUYA 3VB2A 2FMYA 5ICEA 4Y13A 1FBSA 1I27A 1S7OA 3I59A 5JR3A 2EJRA 3F8NA 4WXCA 1BIBA 3WGHA 1EH7A 4L0ZB 3J81Z 3KP7A 3U2RA 5HLGA 4Q5SF 4CGZA 4OU0A 3ERED 4MHGA 1T39A 2JTVA 1YS6A 2XAHA 2JRTA 4EGYA 5CVJA 1D3YA 5A2QZ 5LLQA 3DXJF 3KP3A 1QNTA 2XV4S 3L09A 2KJBA 1ODDA 2HGCA 4HLXA 5L3DA 4CHUA 4EMSA 3J80Z 2F2EA 5BOXA 2XIGA 3GLXA 4KICA 4RB0A 5BPDA 2X0LA 3DPTA 2W25A 3V8KA 5D4SA 2HEOA 4XSZF 1KU7A 3FMQA 4M9XA 2YSRA 1S6LA 1XB4A 2YX7A 1G3TA 4DNCA 4LJZF 4Z2YA 4AIKA 3ZMTA 2EFPA 2HQNA 4OINF 3EYYA 5AIPA 2C6YA 2ETHA 1JGSA 2BE5F 1LB2A 4HLYA 4NHJA 1YW9A 5JHUA 4BHBA 3CUQB 3I0TA 1LJ9A 1Z91A 2DW4A 1KQ9A 4HZFA 3M7GA 1YFHA 3JTGA 2CG4A 3V7RA 1HW1A 4A5NA 4U0VA 1XMKA 2E7XA 3NQOA 1FLIA 1ON1A 3BPVA 2DAOA 1ZLKA 2CGPA 2NYXA 2ISYA 3RI4A 2GXBA 1U6GA 4HAMA 3LAJA 2RN7A 4HV5A 2KKOA 5LHHA 2VC1A 1Z9CA 1Q1HA 3DKWA 1BC8C 2IA0A 2WTEA 2ACJA 3GFMA 5F1RA 2Y48A 4A2UA 1IAWA 1Z6RA 3RDIA 5HS9A 4P5OA 4EM2A 2EA2A 4KFCA 3K1NA 3O3KA 1UCRA 4OMYA 3T1BA 2STTA 2CQKA 3BROA 2AXLA 4MGRA 2F5EA 4S05A 2PG4A 1G4DA 5EEGA 3JSOA 4O3MA 5FFZA 1DPUA 1SD7A 3HIFA 2FBHA 3DPLC 3WTVC 1ZARA 1ON2A 1SD6A 4TV7A 4MQVA 4RGSA 1ZREA 2FSWA 1QBJA 3GXOA 4FX0A 3TQNA 1LDJA 4JBAA 3K69A 1DP7P 3WGIA 3JW4A 3DEUA 3E5QA 1RUOA 3QPTA 5L3GA 3WTUC 2K27A 1D5VA 3KEQA 2NRAC 2HQRA 2OQRA 4P55A 2PN6A 1KA8A 5DCFA 3TO6A 1FY7A 2OZUA 1JXSA 1IW7F 4HF2A 2RKHA 2FBIA 3RKYA 5DCMB 3V7SA 1YTYA 2FRHA 3V4GA 1KU9A 1SFEA 3F8FA 4GCVA 3ZMDA 4CXFA 4HQMA 3FMRA 4CDGA 4A6DA 2H27A 2RVCA 2EFQA 3WGGA 4KDPA 3MQ0A 4L18B 2M5WA 5KVRA 1G6NA 3HHHA 2DI3A 1IN4A 4ENKA 4G7OF 4U7BA 3KP6A 2A69F 4AIJA 3RYPA 3H3UA 3GF2A 3F22A 3E6BA 4ZH4F 5DUIA 1FYLA 2HWVA 4Y15A 2ZJ2A 3O2PE 2NS0A 2XAJA 4PGGA 2QM3A 4IRGA 2L54A 3I53A 1J0RA 1O3RA 1C0WA 2XAGA 2XHKA 4ESJA 1XGNA 1X3UA 4YIFA 3C1DA 4RAYA 3F23A 1LEBA 4P9UA 2KIMA 2P7VB 3I58A 5CLSA 3OV8A 3HYIA 3GFJA 3IRRA 5D4RA 3QAHA 2LSOA 5DEQA 3F8BA 2YPRA 3VODA 3QPHA 3KE2A 3WTSC 4G7ZF 2QBYB 1YLFA 4A0XA 3RKWA 1T6SA 2VONA 1SMTA 1FNNA 2F5FA 1P4AA 5E1WA 3C18A 4IHSA 2H09A 4L0YB 3BPXA 2MC3A 3BP8A 2FE3A 2RNJA 1TNSA 3EETA 3AAFA 3LSTA 2J5PA 4I0BA 4RS8A 3LQRA 4D0PA 1DDNA 5K5OA 1NHAA 4KT5C 2MH9A 3ZMVA 4ENMA 3ZP5A 3E97A 1B6AA 3WTTC 1VTNC 2VN2A 4MQ9F 5HVQC 2F5CA 2E1CA 4HF0A 5J6XA 1HBXG 2PFBA 3EQLF 4MTEA 1FSHA 5CVRA 1OPCA 1UFMA 3IC7A 2HR3A 3F8CA 4I02A 2ESHA 4HQEA 2X4HA 1ZG1A 1TQPA 3ECOA 1YO5C 4M73A 2DBBA 1OYYA 3GFLA 4G7HF 1USTA 1GXPA 1XSXA 1I1SA 1U5TB 3HRSA 3FZVA 3NRVA 3JTHA 2A6HF 4OIPF 3OOPA 1RUNA 3CTAA 5D6FA 3ROUA 3CUQA 5TJJA 2XASA 1U2WA 4RB1A 5LRSA 3FHZA 5F6FA 1BIAA 1LEAA 3KFWX 5D5VB 1SFUA 3IRQA 4RGRA 3WTZA 1ZRCA 1REPC 2Q2EA 1I1GA 4UVBA 2D1VA 3HTUA 2KIFA 4KUMA 2HOEA 2CWEA 5E18F 3F6VA 2ADUA 4KA4A 2WWYA 5K5QA 4AVPA 4EV0A 4R79A 2L4AA 2DPUA 1F5TA 1IF1A 1LDKB 2GA2A 2FEZA 4GYIA 1USSA 1P92A 1YS7A 2FOKA 4EM1A 1U3EM 3E6CC 2XGXA 2DO7A 2JT1A 3FF5A 2LF7A 4XSXF 4EVIA 1FYKA 3HTSB 2BV6A 2FNAA 4BHPA 1FPQA 2KJCA 2ZKZA 3KP2A 1SAXA 1IXRC 2UWMA 4Y17A 1WI9A 2XROA 1R1TA 3K9TA 2CYYA 2NAZA 1HW5A 1BN5A 3LA7A 4EJOA 1EV7A 2XUBA 3V8JA 3IHUA 1WSUA 4KMUX 2EFNA 3SQNA 2DK8A 2STWA 2FNPA 3WTWC 4FHTA 2UXXA 4HW0A 4ZYGA 1L0OC 5DYMA 4G9YA 1FBUA 1IN7A 2PMUA 2EV6A 3TDZC 5FLXK 1A04A 5FD6A 4LD5A 2IP2A 2XRNA 2ZNZA 2O6GE 5DCMA 4O6JA 2JSCA 1HXDA 3SHFA 2G7UA 3HRMA 3I54A 5ICGA 3FXUA 3FMSA 2K02A 1O3SA 3TDUC 2RC4A 3I64A 2BEOA 2WV0A 4FT8A 3HSEA 5ERIA 5E1ZB 1MJ9A 2MA3A 1JE8A 4S04A 4AD9A 2D45A 4L5IA 4BYYA 1FWZA 2FU4A 1E17A 1O7FA 4HYEA 2QQ9A 2GQQA 2EFOA 3M9AA 4JQFA 2PI0A 3SXYA 1T38A 1AOYA 1HKTA 2JZYA 1QZYA 4KMFA 3TO9A 4RGUA 2DPDA 2CW0F 2BGCA 2B0LA 3RPQA 2HDCA 3F8MA 4EGZA 3E3VA 2PQ8A 4HDVA 2K7LA 2EB7A 2OQGA 3TKYA 2KRFA 1KGSA 2FMLA 3E5UA 1MGTA 2MH2A 3REOA 2A5YB 4BNCA 1SD4A 2W24A 1B1BA 4YG2F 4Q48A 2V1XA 4I2OA 4L9VA 2ELHA 2QBYA 5ED4A 5E1XA 3MFKA 1BC7C 2VT2A 2W57A 1KYZA 1MZBA 4N9IA 3CUQC 5JI6A 2XVCA 2JPBA 1T2KA 2MBFA 1STZA 5LBQA 1YW8A 3S2WA 3RPUA 1UHWA 5IT9K 1LQ1A 1WQ2A 4HX7A 1TNTA 1UB9A 2A07F 2QUFA 4LLGF 2VOOA 4MEXF 3ML6A 3I71A 2VT3A 2ZO4A 2HZTA 4UVAA 2EK5A 1K78A 3HRUA 5DDGA 4HX8A 5LHGA 2MD5A 3V8LA 5K5RA 1W7PD 2Z3YA 4LK0F 4A6EA 3DQVC 1BI2A 2EA4A 4K2EA 4UV8A 3PQJA 5CYVA 3H3ZA 1XMAA 2O03A 3RKXA 3C7JA 2DQLA 4N0BA 3GYHX 5H20A 4ASNA 5DD8A 4HA8A 1ZYRF 2A6EF 1J7KA 1U5TA 2M45A 3DP7A 1OKRA 1MD0A 3ZMUA 2NNYA 2H6CA 3L2CA 3HSRA 1W4MA 4AWXB 2PEXA 4G6QA 3T5XA 5KK1A 3F6OA 4FX4A 1H9TA 4M9SA 2M8EA 5FLXZ 2L01A 3MZYA 1BJAA 4U7DA 2G7HA 2DLLA 4I7HA 3WU0A 2PJPA 2W84A 4RB3C 4YIIA 3U1DA 5HDGA 5LHIA 2QENA 1J5YA 2V9VA 3FM5A 3KEOA 2HYFA 1JHHA 2J5OA 3ZMZA 1R7JA 2W85A 3R6SA 3QU6A 4ESFA 2KIUA 4EQQA 1XSVA 1U8RA 4L9TA 1AWCA 4EM0B 4OMZA 3WE3A 1ZGJA 4WX9A 2JPCA 2OA4A 4U88A 4OIOF 2HTJA 1QO0D 5HLHA 2HFHA 3EDPA 5CJ9A 1P4WA 1XSDA 2O3FA 3ABTA 4ZYHA 2LF8A 3BZ6A 3CO7C 2XAQA 3JSPA 2IT0A 4CZZA 5HLIA 4L5JA 4RB2C 3B02A 4UXNA 1J9IA 3R60A 3TO7A 1CGPA 4YFNF 3GX4X 5ILUA 3IWFA 1KYWA 3BJAA 3DFGA 1ZN2A 1CF7B 4IXAA 1I5ZA 4GXOA 1MJAA 3K0LA 3WTXC 4G94A 5K1YA 3D5LA 1IZ1A 3QP6A 5EEHA 5LEJA 2IVMA 4A0YA 5D8KB 4LK1F 2F5DA 3QOPA 3GZ6A 1K78B 5H6RA 3QRFF 5CVVA 3ZPLA 1K79A 3KZZA 5HOOA 4HDUA 2VC0A 2CO5A 2P5KA 2FBKA 2FA5A 2VE8A 5IT9Z 1HW2A 4KIBA 1WWXA 1XDSA 1F9NA 2M87A 1TQMA 4I09A 1YG2A 3ZQ7A 5AONA 3LQQA 1XGOA 4HBLA 4IRIA 1O57A 1GXQA 4EJUA 1T98A 1W7PB 4I0AA 2R3SA 2IJLA 1SMYF 4MTDA 1BM9A 1GHCA 2V6CA 3JAMK 3ZN0A 2DTRA 5L3EA 1B9NA 2PLYA 3GW2A 2Y0MA 3MEXA 2MLGA 1PUEE 2GAUA 3H92A 4ZZDA 3HUGA 2FXAA 2VXZA 6PAXA 2GZWA 3FXQA 3EUHA 5D5UB 4UUVA 2QWWA 3IL2A 4HF1A 4ZYEA 4GGGA 3KLNA 4N9HA 5HDNA 2D1HA 1OMIA 3MWMA 4B8XA 1F4KA 5FB2A 1Z7UA 4XLPF 4M74A 3GWZA 2O0YA 4ENNA 1HKQA 3MZHA 2ESNA 1XGMA 3RIRA 1O3QA 4WCGA 3ZN1A 1U5TC 1SD5A 2YR2A 3VFZA 3T8TA 4A0ZA 1J59A 5L3CA 2O61A 2CFXA 1LNWA 3TGNA 1QGPA 2YX4A 5JVTA 1BI3A 3WODF 5LGNA 4PZJA 2XAFA 4U0YA 2EV0A 3L00A 1TBXA 1S7AA 5TRDA 2WC2A 3LA2A 4ESBA 3P9KA 1QZZA 2COMA 1ZG5A 4GYGA 4IPAA 1RZ4A 2K4BA 2Y75A 3MAJA 3BWGA 1XD7A 1J75A 1F1ZA 4L9JA 4P96A 1R5GA 1OR7A 3O6BB 1FOKA 1MJBA 5H6QA 2P6SA 2G9WA 2VBZA 4M6YA 2DFIA 3EYIA 4LB6B 5DD4A 4KIFA 4QWQA 4KN7X 1I6XA 2QVOA 5D5WB 1XN7A 1YQAA 4IRHA 3K2ZA 1O3TA 5ICFA 3HSFA 1S3JA 4XRFA 3BY6A 4QLCU 5J8CA 4WF2A 4H0EA 2V1UA 2CSOA 2E1NA 1PP7U 5ILSA 4CO8A 4LG0B 5E8GA 1B59A 3GUDA 1LVAA 1R36A 2L02A 3KZYA 1R1VA 4HOBA 1R22A 2ISZA 4WXHA 4M72A 2P5LC 1J2XA 1FBQA 5HDKA 4L9NA 2M1BA 3NEUA 2OD5A 1R1UA 1QQIA 1L3LA 1R5HA 5FFXA 3FWEA 3M8FA 4IF4A 2ZMEB 3JAMZ 2TDXA 5D5XB 4ENJA 5BMZA 2UXNA 3L7WA 1K7AA 2HKXA 2EFWA 3RYRA 4YFKF 4WWCA 2QQBA 1TLHB 2A61A 4LFUA 1G3SA 1IN8A 2NNNA 2VOPA 3GEZA 5E20A 3G3ZA 3W6JB 1OYIA 2GWRA 2RV8A 1Z05A 2OAZA 2FF4A 2IW5A 4ON0A 1FP2A 3BOQA 3DV8A 3P9CA 2DU9A 2Z9OA 2AS5F 1WKMA 4RGXA 2PBIA 4KN4X 2GXGA 3KLOA 1IN5A 2R7FA 1HSTA 3V7CA 4BH9A 1UHMA 1GVJA 3WU1B 1FP1D 3R4KA 2OZ6A 1CF7A 2HKOA 5LEKA 4F7ZA 4ZZLA 3SFZA 4EJVA 3HOSA 1XDUA 1W5SA 4IVNA 1IN6A 4JK1X 3HHGA 2IPQX 1MDMB 2ZXJA 3K1MA 3VOEA 2L4MA 4Q4ZF 3PFIA
chains in the Genus database with same CATH superfamily
4ZC3A 2WA0A 1FX7A 1MH3A 1TWFJ 2EIJH 3HXLA 3R61A 1F43A 1QPIA 2PMZA 2DQRA 4R8HA 5AIQA 3F21A 4A12A 3RTRA 2HTSA 1GV2A 2BYVE 1PUFA 1DPRA 1XCVA 4AC0A 1YI2I 1R58A 3OYIA 2EBIA 3N97A 3F3XA 5DUKA 2Q0OA 1TWCJ 2LLKA 3CUOA 1ZRFA 1SFXA 3KP4A 2YU9J 1ZRDA 2V26A 3M1EA 2KMUA 4XLNF 3MD2A 4ETSA 3J7AY 1IXCA 5BPIA 2KDOA 5KAFC 2R5ZB 1XGSA 4JP0A 2O8XA 3I59B 2L7ZA 2AHQA 4OOIA 4D7NA 2Z33A 3ZQHA 3HOZJ 2QLZA 1GT0C 4DQ2A 2JK3A 1W7PA 2ZNYA 3GO5A 2V1DA 3H1CA 1VQKI 3S2HJ 4RDUA 2EV5A 2LNBA 3HEFA 4IHTA 1G2HA 4G8XA 3O8HA 4UV9A 1OLTA 2PJRA 1OFCX 3OS0A 1E2XA 2NOJB 1F36A 3H9QA 2OU2A 2VJIA 1JHFA 1H89C 4A3JJ 3QQAA 1OQYA 2M8GX 1FT9A 4AYBA 1X19A 5LGTA 3RJPA 1B4AA 4GRIA 2R7VA 1P4XA 4I98B 1IRFA 4QSHA 2HVRA 5LGUA 4PCQA 2VODA 5ICCA 2LREA 4D5FA 4LG3A 4WK8F 1XS9A 3H9GA 1G3WA 2DA3A 2H6BA 1B9MA 5M5YJ 4BE1A 4YFXF 3CD6I 2PMHA 2K9MA 2B7EA 3TMOA 2XKPA 3IAS2 1OR7C 3BJ6A 4GFBA 1VQ5I 3SEZA 1YYVA 3K1PA 3MVPA 2Y0SA 2IA1A 1IUFA 5FGMA 3I5UA 3SZGA 2Z99A 2DYRH 2L7KA 2M7AA 4DW6A 1RIOH 1BOAA 2AO9A 4BHCA 4UHTA 3J7AO 1HDDC 4CYDA 1ETQA 1BI1A 3IH2A 4LIUA 4MNUA 4AIHA 4F52A 5K7HA 1D0ZA 4HRIA 3SZTA 1Z6TA 1MBEA 1Y0UA 3VEPA 5L3BA 1FJLA 3CC2I 2GIVA 3OYGA 4KYWA 5CVUA 3ZXSA 4EJWA 3KCCA 2E2JJ 2DA1A 3E1SA 1V4RA 1TWAJ 4LLLA 4A3MJ 2HYGD 1RR7A 3E7LA 3L9FA 3CP8A 4M9ZA 3LAPA 1FZPB 1APLC 1BI0A 1I39A 3ZMSA 4XRSA 2MW8A 4LB5A 4XBFA 1YW7A 3B73A 3OL3A 3CJNA 2QQAA 2MFZA 2P5VA 2H8WA 3U21A 2IEKA 2QKLB 3F0CA 4C3JJ 2FX0A 3ELKA 3ERMA 5J8FA 1MNEA 2DJIA 2E2HJ 3CMMA 4RMNA 2EIMH 3Q0VA 2A68F 2KRCA 1O7LA 2E7WA 5H2FC 1VQLI 4FETA 3Q3SA 5DV5A 2BY0A 2EWNA 3K2AA 4RAZA 2F4OB 4P9FA 5E17F 1DQUA 3F72A 3LA3A 3TOBA 1GLNA 2GLOA 4ZTFA 4B09A 4ZTJA 5CVIA 3FM3A 1P6RA 3OS1A 3A0HC 3FXRA 4LLNA 4RA2A 1TL8A 1HSJA 4OWRB 1W5TA 3VYSB 2DTZA 2XSJC 1G3YA 4O5VA 2GXAA 4XMYA 2VBYA 3GZ5A 2OBPA 5GAHJ 1V5EA 4MEYF 1Y0NA 2ZBKA 3ABUA 3OWTA 3KZIC 3HOTA 2VKHA 1EF4A 3QODA 3QYEA 3BTCA 2Q8KA 3TOAA 3ULQB 1LDDA 5IPAA 3GVAA 1S5LC 1WFXA 4NB5A 2GA1A 4D7MA 2RQPA 3H5NA 4BAYA 3J81K 5FRMA 4A5MA 4BS9A 1XTAA 1WZ2A 1HKSA 1YX5A 1BW6A 3BJOA 5C4JJ 1V3FA 1X1AA 2HS5A 4Y33A 3OYLA 1VQNI 3E6MA 5J4YA 4PJMA 1K6OA 4HSRA 4C2UA 2D2WA 1ZG3A 1EH8A 5A2QK 3COAC 1FSEA 3QU3A 2VE9A 1PP8F 1IRGA 1R9TJ 1YHQI 4DZPA 1KU3A 1WRJA 1FYMA 3PSFA 1U0JA 1YE9A 3J80K 2BBYA 3CDHA 1LUJB 3IH3A 3IWZA 2IRFG 5BS6A 1BR4A 2Z5UA 1ZH5A 3Q9VA 1TW3A 1VZ0A 5F0HA 1BR2A 1G8XA 1UG2A 3LSPA 1TQIA 2A3SA 1EH6A 2DODA 2VBXA 5BQTA 3QOEA 3LSJA 2W00A 3OY9A 3MCZA 2K40A 3ISPA 3C3WA 5FO5A 1MSEC 4CUGA 1ZGAA 4G6DA 2V7FA 4BJ5C 4ABZA 4Y4RA 1YX3A 2ZCWA 3G1OA 3W6KB 3OR1C 4LG0A 3WE2A 4UNOA 1ZLJA 2DXIA 4R1HA 2H94A 2LDUA 4Q47A 4A3FJ 3Q5FA 2OJED 2BOLA 3NARA 3GTQJ 1S8NA 1VI0A 3A03A 2IA2A 3ABMH 3T0YA 2HOTA 1RNLA 1R23A 3BDDA 1SC7A 1IXSB 1NK3P 4B3AA 2TCTA 3R0AA 4EJTA 2VKVA 3FBIB 2ZFWA 3FDYA 4BQAA 1DUXC 1B8IA 2HOSA 4I01A 3P7NA 4LMYA 3CO6C 3HOYJ 3W2WA 1ZAOA 1H9GA 3BG3A 3BTJA 3FX3A 3CJTB 4UUTA 1D8KA 4XLCA 4CICA 4C2TA 1IRZA 1MSFC 3VPRA 3CLOA 4M71A 1A31A 1KQ8A 4F91B 1SVMA 1MKMA 2DK5A 3H5RA 3KETA 1KU2A 2ZMEA 3KP5A 2P4WA 1ORKA 4BDZA 1FC3A 1ZKGA 3Q9SA 3IKTA 2ZJRF 2NVTJ 4JYKA 2Y31A 5IT3A 3P9IA 1ULYA 1JUMA 2XKOA 2DT5A 1QA6A 5L3FA 1HQCA 3MKWB 4PDKA 3W3CA 2OCCH 3CCRI 2FJ1A 3LSRA 1R00A 3DTEA 4HX4A 3HGYA 3E5XA 1DU6A 2XB5A 1BBYA 5J1UA 1YJ9I 3I9V2 3W2AA 2DMTA 2LVSA 1KQ0A 2QZ8A 3IKVA 3G4SI 2L9SA 3G1MA 3BG7A 3GFIA 2R7OA 2QSGX 5HS8A 1ACIA 3IH4A 4IL6C 4IJAA 4OIRF 3ECHA 5LFAA 3IV5A 4A3IJ 4BXUA 3S14J 5HODA 2MLKA 2K86A 2R7DA 2V79A 1U9NA 3LWFA 2L5QA 2DMUA 2X6OA 1TTYA 4EATA 3M8JA 2QYOA 5JFRA 3SJMA 4F93B 4HV6A 3DTKA 2P6TA 3QPLA 1P2FA 3LFKA 3GTOJ 1OYWA 1AHDP 3HC7A 1YIOA 2L2OA 4PGHA 2L3DA 1T0FA 5HS7A 4GO1A 5C4XJ 5B1AH 4NQWA 1U78A 3QP5A 1H0MA 1MMAA 4QIWN 2CMPA 1XCBA 2A6TA 5F08A 1S29A 3G73A 4M6XA 1PDNC 4UB8C 5F64A 1SAUA 3SZPA 3WG9A 4B48A 3PQKA 3KYLA 1QPMA 1TW2A 4XRMA 5D6EA 5F1JA 2VBWA 5FD5A 4XORA 2V9PA 1GV5A 1PVEA 3H36A 4E70A 2F48A 4ZYDA 3EUAA 2X6YA 3R0JA 3ASNH 4OIQF 2X85A 1DGRM 5KHDA 3M4OJ 2P8TA 1Z1DA 5LRRA 1QZEA 2P7CB 2KZGA 1VQ6I 2RGVA 3HRTA 3M8EA 3U9GA 2M30A 1X1CA 3DF8A 1MDMA 5E8IA 1OCTC 2DYSH 3EPZA 1E0EA 2UZKA 2LY9A 1RI7A 4KIGA 2LY2A 4LGWA 3E6DA 4U0WA 1ZHFA 1ONVA 2RDPA 4XRSG 1A6IA 2K4JA 3T8RA 1IDZA 3I4PA 4UVCA 2O9LA 2VJ4A 2FQ3A 3D0SA 4WXDA 2LKPA 3DLAA 3N4MA 5D8LB 3BLYA 2YU3A 4KNYA 5ILVA 2OTJI 3WTYC 1NG7A 1D8JA 1IUYA 2EIKH 3VB2A 2FMYA 5ICEA 1VQOI 3VDXA 5J1RA 4Y13A 1YOVB 2R5ZA 4ZDLA 1FBSA 1I27A 1S7OA 3I59A 5JR3A 2EJRA 2HDDA 2H8RA 3F8NA 3MKZA 4UY8I 4WXCA 1BIBA 3WGHA 1EH7A 2LRDA 2WY7Q 2CV1A 4L0ZB 3J81Z 3KP7A 2CU7A 3U2RA 5HLGA 4E7JA 4Q5SF 4CGZA 1QHGA 1XC5A 4OU0A 3ERED 4MHGA 1T39A 4PFOA 5EGOB 4PSWA 3HOVJ 3ZCOA 2E2IJ 2JTVA 1YS6A 2VI6A 2XAHA 2UUZA 4RLFA 2LBFB 2XSDC 2JRTA 2HXIA 4EGYA 3MZ8A 2BHZA 2GOMA 5CVJA 1D3YA 5IOZA 5A2QZ 1LFUP 4II2A 5LLQA 1TP4A 3DXJF 4IEJA 3S3MA 3KP3A 1QNTA 2XV4S 3L09A 2KJBA 1ODDA 2HGCA 2R4GA 4HLXA 5L3DA 3BTLA 3PL8A 4CHUA 2DA5A 4EMSA 3J80Z 2F2EA 5BOXA 2XIGA 3GLXA 4KICA 4XIDA 4RB0A 4CSWA 5BPDA 2KT0A 2NOGA 2X0LA 3ZR8X 3BCAA 2LK2A 3DPTA 4NDLA 2W25A 3V8KA 5D4SA 2HEOA 4OAZA 4XSZF 5JLXA 1KU7A 3FMQA 1ZGWA 5DM6F 4F92B 4M9XA 2YSRA 1S6LA 1XB4A 2YX7A 1G3TA 4DNCA 3JRCA 1B8IB 1RKWA 3OSFA 4ITVA 4LJZF 4Z2YA 4AIKA 3ZMTA 2EFPA 2HQNA 4OINF 3EYYA 5AIPA 2C6YA 2ETHA 1JGSA 2BE5F 1LB2A 4HLYA 4E7SA 1D0XA 1JT0A 4NHJA 1YW9A 5JHUA 1A35A 4QTRA 2FQ4A 4BHBA 3CUQB 3CJQB 3I0TA 1LJ9A 1Z91A 2DW4A 1KQ9A 3OYAA 2OPTA 4HZFA 3M7GA 1YFHA 3JTGA 2CG4A 3V7RA 2KRHA 1HW1A 4RLQA 4A5NA 3ASOH 4U0VA 1XMKA 2E7XA 4IHVA 2HOAA 3NQOA 1ON1A 3BPVA 2DAOA 5B1BH 4KITB 1FLIA 3K4MA 4XLHA 1ZLKA 2CGPA 1NTCA 2NYXA 2ISYA 3LL7A 3RI4A 2GXBA 1FMWA 1FIPA 2VPLA 2Q2EB 4XR6A 5B3SH 1WJBA 3RQIA 1U6GA 2WADA 2Y9YA 2R7RA 4HAMA 4FASD 3LAJA 3KX2A 2MGQA 2RN7A 1GUUA 3J7ZI 5IP9J 5LD2C 4HV5A 2HYJA 2KKOA 3H3VK 5LHHA 2R92J 2EINH 2VC1A 3N05A 1Z9CA 2IGKA 3U1KA 3OOUA 1Q1HA 2ID3A 2BHYA 4BE0A 2DCEA 3CCMI 1K6YA 3OIPA 3DKWA 5M3FJ 3S1NJ 3K4JA 3RPUD 1BC8C 2IA0A 2ZB9A 2WTEA 2ACJA 3PFYA 3GFMA 5F1RA 2ZJQF 5TISC 2Y48A 3NAUA 3X2QH 3ZQIA 4A2UA 4CCJA 1IAWA 1YRNB 1Z6RA 1PJRA 2VXDA 3RDIA 4Z6YA 5HS9A 4P5OA 2ZMEC 2QEXI 2K5CA 1D1CA 4EM2A 2EA2A 2EZKA 3BR2A 3K1NA 4KFCA 1AU7A 2DOFA 3CDLA 3HJEA 3O3KA 1UCRA 3PUBA 4OMYA 3T1BA 2STTA 1YJNI 3LSKA 2CQKA 3BROA 4MFDA 3MKYB 4ZYAA 2AXLA 4MGRA 2F5EA 4S05A 1JI8A 2WAFA 2PG4A 1G4DA 5EEGA 3AG2H 3JSOA 4J19A 3OMYA 4IHWA 3HGGA 1OISA 2MSYA 2WAQN 3BG5A 3UR3C 1T56A 3PJRA 5FJ8J 4DYQA 4J01A 4O3MA 3JRFA 2R5YB 1ETVA 4HNUA 3CC7I 5FFZA 1JKRC 3A01B 1DPUA 3PIPF 2DT7B 1SD7A 3HIFA 3FISA 2DT6A 2FBHA 3KIOA 3DPLC 3WTVC 1ZARA 1WPKA 1ON2A 4DYRA 1SD6A 3VSKA 2ZXHA 3M07A 4Y7NJ 4TV7A 4MQVA 4E7IA 3BG9A 2VB6A 3K4NA 4RGSA 4KT6A 5J3LA 1ZREA 1T0FC 2DA4A 2FSWA 1QBJA 3GXOA 3TW7A 4FX0A 3TQNA 1LDJA 4JBAA 3K69A 2HQ5A 1P7IA 3OR2C 4HPQA 3JRGA 2ECBA 1DP7P 3ZOBA 1X2NA 2O5RA 3WGIA 3JW4A 5DS9A 3DEUA 3E5QA 3K4KA 1RUOA 2X48A 3QPTA 2YS9A 3Q0UA 3HOXJ 5L3GA 3HL2A 3WTUC 2K27A 1D5VA 4A3LJ 4XK4A 3KEQA 2NRAC 2HQRA 2OQRA 4P55A 2PN6A 1SFKA 2VQCA 1KA8A 5DCFA 3TO6A 2XDVA 1FY7A 2OZUA 1JXSA 5KAIC 1IW7F 2MD0A 5HLTA 4HF2A 2RKHA 2FBIA 3RKYA 1RPWA 5DCMB 3V7SA 3V42A 4AM3A 1YTYA 5FKLA 2FRHA 3LMMA 3V4GA 1KU9A 1SFEA 3F8FA 4GCVA 3ZMDA 4CXFA 2HI3A 4HQMA 3FMRA 4CDGA 4A6DA 4HNVA 2P0WA 2H27A 2RVCA 5B66C 2EFQA 4QPOA 4JOMA 1MMNA 3CF2A 3WGGA 4KDPA 3MQ0A 4L18B 1TT5B 2QGUA 2M5WA 1VQ4I 3LSHA 3IP4B 1G6NA 5KVRA 3S8PA 3HHHA 4ZJZA 2DI3A 3OYJA 1IN4A 4ENKA 1BOBA 4G7OF 4U7BA 3KP6A 2A69F 4AIJA 1A36A 3RYPA 3K70C 3HKZN 2DJNA 1B72B 3H3UA 1UELB 2KP6A 3GF2A 3F22A 2MYSA 3E6BA 2JJ7A 2BY2A 3C2BA 4ZH4F 4F55A 3LFUA 5DUIA 5B5EC 4W97A 1FYLA 1SVLA 2HWVA 1BW5A 4Y15A 2ZJ2A 4G6TB 3O2PE 2NS0A 2XAJA 2CH0A 4PGGA 1FMVA 1VF9A 2QM3A 2LR8A 4IRGA 4XN0A 3HOUJ 2L54A 3I53A 1J0RA 1O3RA 1C0WA 2B63J 3UKGA 3HBLA 1A6QA 5GP9A 2XAGA 1U8BA 4XN3A 2XHKA 5KCMA 4ESJA 1XGNA 1X3UA 4YIFA 2JA7J 1FEXA 3JRIA 3C1DA 4RAYA 3F23A 1LEBA 4P9UA 5CPRB 2KIMA 2CV2A 3HDDA 2P7VB 2OV7A 3GTJJ 3I58A 3TP3A 5CLSA 3OV8A 3HYIA 3GFJA 3K7AJ 3IRRA 5D4RA 1MMDA 3QAHA 2LSOA 5DEQA 2OTLI 3F8BA 2E5ZA 3PM1A 4BY7J 1TWHJ 5E3LA 4XOPA 3HB9A 2YPRA 2JA8J 3VODA 5C3EJ 3CLQA 3FXMA 5CQEA 3QPHA 2JVHA 3KE2A 1OCCH 2NS7A 3WTSC 1WVRA 4G7ZF 1MBHA 2EQRA 4GDFA 2QBYB 1YLFA 4A0XA 5E3OA 3RKWA 2ICWG 1T6SA 2CS3A 1Z21A 2HVSA 5CKTA 2G0EA 1Z0XA 2VONA 1SMTA 1FNNA 2F5FA 1W0TA 1P4AA 1R6RA 3ZQLA 1SFOJ 2CW7A 5E1WA 1KZHA 2BY3A 3JRBA 3C18A 4IHSA 2H09A 3LNQA 1OCZH 4L0YB 2H1KA 3BPXA 3BP8A 2QCOA 2FE3A 2MC3A 2RNJA 1R71A 3AL0B 1TNSA 3EETA 3LSTA 4I0BA 2J5PA 5J40A 5EG0B 4RS8A 3AAFA 3LQRA 1VQMI 4BACA 3DKYA 3O8GA 4D0PA 1DDNA 5K5OA 1JTXA 3PO3J 1SANA 3CMAI 1Y1VJ 1NHAA 2CQ7A 4KT5C 2MH9A 3ZMVA 3TL4X 4ENMA 3ZP5A 2M2EA 3E97A 1B6AA 3WTTC 1VTNC 2M0CA 2VN2A 3P5JA 4MQ9F 5HVQC 1IC8A 4M3FA 1NK2P 5EGOA 1WJCA 5GTIC 2F5CA 4BEHB 2E1CA 1UHSA 4HF0A 5J6XA 1HBXG 2BY1A 2LBFA 2AQEA 2PFBA 1XG1A 3LOCA 1OJLA 1DU0A 4EEFG 1VQ9I 2WBMA 3NWSA 2DFHA 3GTGJ 3EQLF 1TC3C 2ZXWH 4HEA2 3BR5A 4MTEA 1FSHA 5CVRA 1QRYA 2LTPA 1OPCA 4CCNA 5C44J 3A2KA 1UFMA 2BVMA 4PFPA 1ZR2A 3IC7A 1T95A 3H9JA 2HR3A 2L7FP 3F8CA 4I02A 3D5RC 2ESHA 4HQEA 2X4HA 4M3DA 1TQPA 3BCBA 3ECOA 1ZG1A 1YO5C 4M73A 5J1YA 2DBBA 1OYYA 1RETA 4CCLA 1IV6A 3GFLA 4G7HF 1USTA 2Y30A 4XICA 1TZLA 4N4NB 4UUSB 1GXPA 2IGOA 5FKMA 1LE8B 3W6VA 1XSXA 1I1SA 1U5TB 3HPGA 3S15J 3HRSA 3FZVA 2A5WA 3NRVA 2BXZA 1T8IA 3JTHA 1K83J 4M3EA 2GM4A 2A6HF 2V1NA 1XMXA 5IYBJ 1OCRH 4OIPF 1W36D 1IDYA 3OOPA 1RUNA 3CTAA 5K7FA 2KL4A 2DFFA 5D6FA 2JQ7A 3ROUA 2E71A 2CW8A 4RM3A 3CUQA 4XOTA 1LPQA 3PO2J 3FXKA 4DZJA 5FKNA 5TJJA 2XASA 1U2WA 2XGDA 3FKJA 5EZGA 4RB1A 1JTYA 5LRSA 4H4KC 4NNJA 1WJFA 3JRAA 4X0GA 1ETYA 3BQYA 3LSGA 3FHZA 5F6FA 1BIAA 2LOOA 5F04A 1LEAA 3BR6A 3KFWX 5D5VB 1SFUA 2JA6J 3IRQA 4RGRA 3KPHA 4OAYA 3WTZA 1ZRCA 1REPC 2Q2EA 1I1GA 2Z2SB 4PJ0C 3W2VA 4UVBA 2D1VA 3HTUA 5HNHA 1QU3A 1YITI 2KIFA 2LD5A 1HC8A 4AUXA 4KUMA 1RKTA 4E7ZA 1HCRA 2HOEA 2CWEA 5E18F 3F6VA 2ADUA 3ABLH 1R5ID 2WB1N 2OCEA 2R0QC 3I56I 2I10A 4KA4A 2WWYA 4XONA 5K5QA 2KIQA 4E7HA 2JVGA 4AVPA 4C3IJ 4EV0A 4R79A 2L4AA 1IJWC 2DPUA 2Y9ZA 1F5TA 1IF1A 2IS2A 2EH3A 4DBQA 1LDKB 2GA2A 2BZTA 4MFEA 1AKHB 3GTMJ 1XX5A 2FEZA 2K85A 4CYCB 4GYIA 1USSA 1P92A 1YS7A 2FOKA 2VKEA 4EM1A 2E60A 1YRNA 4IOCF 3H0GJ 1U3EM 3E6CC 4AIDA 3CQZJ 1RR8C 3GBGA 1LKXA 2X1EA 2XGXA 2DO7A 2JUGA 2JT1A 3FF5A 2X6XA 2LF7A 4XSXF 9ANTA 4EVIA 1FYKA 1BR1A 3HTSB 2BV6A 1MBGA 2FNAA 1X58A 3I55I 4BHPA 1FPQA 2PMZN 4D5CA 2KJCA 2ZKZA 3KP2A 2EILH 2DA6A 1SAXA 3GZNB 1Z77A 1BJZA 4A3GJ 1IXRC 2NXNB 2UWMA 4Y17A 2R5YA 1E3PA 1WI9A 3QWLA 2ME0A 4BQNA 3JREA 3CJRB 4LOCA 3HM5A 3A01A 4LITA 4BDYA 2VLAA 1POGA 3J7YJ 2XROA 1R1TA 4V19K 1ENHA 2RAEA 2IS4A 3K9TA 5FKKA 5F0FA 2CYYA 4AU7A 2R7QA 2NAZA 2XPVA 1HW5A 1BN5A 3LA7A 4EJOA 5IYDJ 1ZTRA 4E6KG 1EV7A 4B3XA 1DGWY 2XUBA 3V8JA 3IHUA 1WSUA 1H88C 1CQTA 1Q1VA 3GMEA 3KEYA 2EFNA 4KMUX 3SQNA 2DK8A 1ZQ3P 2STWA 2FNPA 3WTWC 4FHTA 2UXXA 2NS8A 4HW0A 3ZQGA 2M9HA 4ZYGA 1L0OC 4S0HB 5DYMA 4G9YA 1FBUA 4AYBN 1IN7A 1IRXA 4YELA 1WI3A 2PMUA 1EKEA 2EV6A 2Q1ZB 3TDZC 1M1EB 5FLXK 5EDNA 1A04A 5FD6A 4RAGA 4LD5A 2E1MB 2IP2A 2XRNA 2ZNZA 4JX5A 2O6GE 3FBNB 5DCMA 4O6JA 3SDGA 1QVTA 2JSCA 4XKBA 1HXDA 3PIOF 3S1RJ 4BQOA 3SHFA 3KYDB 2G7UA 3HRMA 3I54A 5ICGA 3RKQA 3D1NI 1MNMC 2Y0SN 2XGCA 3DKXA 3FXUA 2XB0X 2CJJA 3FMSA 2K3FA 2BXYA 2K02A 5HNFA 2DMQA 1AA7A 3TDUC 1O3SA 2W82A 2RC4A 3I64A 2BEOA 1WCMJ 2I5UA 3DBLB 2WV0A 4FT8A 3HSEA 5ERIA 2XF6A 5E1ZB 1MJ9A 2MA3A 4MIMA 2CV0A 1WJ5A 1JE8A 4U87A 3GTKJ 1Y8RB 3WHBA 4ZDOA 1P9QC 4YEJA 4S04A 4PJJA 4AD9A 1MBJA 2D45A 2ZC2A 4FCYA 4L5IA 4BYYA 1FWZA 2Y2ZA 3HG9A 2R93J 2Z1DA 4JX4A 1K61A 1B72A 2FU4A 2Z16A 1E17A 1O7FA 5EYRA 4HYEA 2GOXB 2QQ9A 1X4PA 1G59A 2GQQA 2EFOA 2HQAA 3M9AA 4JQFA 2PI0A 3HUGB 1ETWA 3SXYA 2DOAA 1T38A 1AOYA 1HKTA 3OYMA 2X1CA 2JZYA 1W1WE 3VSLA 1TWGJ 3BC8A 1QZYA 4KMFA 3TO9A 4RGUA 2DPDA 2CW0F 2BGCA 2B0LA 3RPQA 2ELJA 2HDCA 3F8MA 5JHFA 1HF0A 4EGZA 2FUG2 2XRLA 2KPMA 3OSGA 4UB6C 1MIJA 3CCYA 2PQ8A 3E3VA 2K7LA 3Q0WA 1Z3YA 4C3HJ 2EB7A 4HDVA 1LFBA 2OQGA 2W7NA 1N75A 3TKYA 3S1MJ 2KRFA 5J47A 1KGSA 2FMLA 4J00A 3E0JB 3E5UA 1MGTA 1Y1WJ 1S9HA 2MH2A 3BR0A 3REOA 2CUZA 2IGMA 2A5YB 4BNCA 1JKPC 3ZQFA 1SD4A 2W24A 1B1BA 4CA0A 4YG2F 4Q48A 2V1XA 1IG7A 1I3QJ 4I2OA 2JA5J 4L9VA 1Z67A 2PX9A 2ELHA 2M7BA 4DIQA 2QBYA 1FTTA 5ED4A 3AG3H 1ETKA 5E1XA 1UMQA 3MFKA 2IS1A 1BC7C 4C30A 2M34A 2ID6A 2VT2A 2W57A 2VKDA 1ETOA 1KYZA 1MZBA 4AVZA 3JRDA 5KNLA 4FE7A 4N9IA 3TW6A 4PJNA 1HA8A 1N25A 4KJZA 4IKFA 3CUQC 3QPSA 1EJ9A 2ZSHB 1SEUA 5DM7F 1QHHD 4MO7A 5JI6A 3M3YJ 1U9OA 2XVCA 5EG0A 2JPBA 1LVKA 1E3HA 1T2KA 2MBFA 4I6ZA 1STZA 5LBQA 1YW8A 3S2WA 3RPUA 1UHWA 1ZELA 2HPIA 3OYEA 1Y39A 5IT9K 5EF6A 1LQ1A 1WQ2A 1X1DA 4B43A 3A1YA 2K9LA 4HX7A 1TNTA 1UB9A 4NBQA 1XPXA 2A07F 3FXJA 2QUFA 4LLGF 2VOOA 2CUJA 2AXTC 4MEXF 3ML6A 1W5CC 3I71A 2VT3A 4XKCA 2ZO4A 2HZTA 2JSPA 4UVAA 2P81A 3DCFA 3CCUI 2EK5A 2LY1A 3FXOA 4BEHA 1K78A 2XPUA 4A3EJ 4KISA 3HRUA 2UV1A 4HX8A 4XLAA 5DDGA 5FLMJ 3CMEI 5LHGA 2MD5A 3V8LA 3AFHA 2COBA 5K5RA 1W7PD 2CQNA 2Z3YA 4LK0F 2LFBA 4A6EA 1WHUA 4CCMA 1D5YA 5GAGJ 3DQVC 4A3DJ 4F3QA 3H5AA 4NC8A 2LH9A 1BI2A 2EA4A 4K2EA 1SVOA 4UV8A 3PQJA 5CYVA 1X1BA 3H3ZA 1XMAA 2O03A 3RKXA 3C7JA 5FLVA 2DQLA 4IHYA 3SDBA 4N0BA 4ANJA 4M3BA 3GYHX 5H20A 3FK7A 3BT9A 4ASNA 4CZCA 2NVQJ 5DD8A 4HA8A 1GDTA 4B1RA 4UUSA 1ZYRF 4XLEA 3K4CA 4XNFA 1LE8A 2A6EF 2HU9A 2VASA 1J7KA 1U5TA 2AQFA 2M45A 3DP7A 2K9SA 1IO2A 4BXXJ 1YJWI 4PJLA 1OKRA 4A93J 3BZKA 5EJCA 1MD0A 3OIOA 3ZMUA 1IV8A 3M1CA 2NNYA 3BR3A 2CQQA 3FK6A 2H6CA 2QSFX 3L2CA 3HSRA 1W4MA 3IUOA 4N4OB 4IQJA 2ZFUA 3VWBA 4AWXB 4HG2A 5DTDA 2D5VA 2PEXA 4G6QA 3T5XA 5KK1A 1S7EA 1X1PA 4MLOA 4YRVA 3F6OA 1TT0A 4FX4A 1H9TA 4M9SA 2JMWA 2ELKA 2M8EA 3S2DJ 1P7JA 5FLXZ 2L01A 2BVLA 3MZYA 5M3MJ 5JVGF 1BJAA 3DEEA 4U7DA 4C2MJ 4BE2A 2EZIA 2G7HA 2L9NA 1LFPA 1FOWA 1MH4A 2DLLA 3OYHA 1NG6A 4I7HA 3WU0A 2PJPA 2W84A 5FRNA 4BU2A 4RB3C 4YIIA 2F4MB 5HDGA 3U1DA 1HLVA 5LHIA 2QENA 3K10A 1J5YA 2V9VA 3FM5A 1X4OA 3KEOA 2DDAA 2KHMA 2L0KA 3CCEI 1H8AC 2L9VA 2HPMA 2HYFA 1JHHA 2J5OA 3ZMZA 2VUMJ 4LIVA 1R7JA 3AG4H 3VYTB 2JWTA 5IOYA 2W85A 3R6SA 3QU6A 4ESFA 2KIUA 4EQQA 5IP7J 1XSVA 2V9KA 1U8RA 2FOWA 3S32A 4L9TA 1AWCA 4EM0B 4OMZA 3WE3A 2XPWA 4FQGA 1ZGJA 2DA7A 1AKHA 3WG7H 1RESA 2OUMA 4CYCA 4WX9A 2BW3B 1A5JA 4DOZA 2JPCA 2OA4A 4U88A 3OL4A 2LKSA 4OIOF 2HTJA 2NVYJ 3OIQA 2KLOA 1QO0D 3G2BA 2DFEA 5HLHA 2HFHA 3EDPA 3EUKL 5CJ9A 1P4WA 3OS2A 4DYCA 2DMPA 1XSDA 2O3FA 3LSMA 3ABTA 4ZYHA 4BGDA 4I76A 1OCOH 2LF8A 5EZHA 3CCLI 2RQQA 3BZ6A 3CO7C 2XAQA 3JSPA 2IT0A 4M3GA 4CZZA 3PNTA 5HLIA 4L5JA 3S17J 2VJ5A 4NC6A 1GVDA 4BQQA 3L2WA 4RB2C 1MNDA 2NVUB 1Z3XA 3B02A 2KDZA 2LG4A 1VQPI 2Y69H 2RREA 4UXNA 4A3CJ 3C2GA 2M4KA 1J9IA 2QSHX 3R60A 2DDBA 3TO7A 4IZZA 1CGPA 4A3BJ 4YFNF 3GX4X 5ILUA 3IWFA 2V6EA 3S1QJ 2H1LA 1KYWA 1V55H 3BJAA 4IHXA 1WJDA 3CCSI 3DFGA 1ZN2A 2DMNA 3OYCA 2R7XA 5FKOA 3L1PA 1I50J 2O7OA 3DTIA 1CF7B 4IXAA 1I5ZA 2MABA 3HZJA 4GXOA 1MJAA 2EZHA 3DBRB 3K0LA 4G94A 3ZGKA 3WTXC 5JLWA 2R7WA 5K1YA 3D5LA 1IZ1A 3QP6A 4E4HA 3CMYA 3S3OA 1K4SA 3B6CA 5EEHA 5LEJA 2IVMA 3A02A 4A0YA 2QQ8A 5D8KB 4II3A 4LK1F 5M5WJ 2F5DA 3QOPA 4BL0B 3PNVA 1R49A 3GZ6A 3JCUC 5GAEJ 1OCPA 1K78B 5H6RA 2ECCA 1VQ8I 3QRFF 1W0UA 3OYDA 5CVVA 3FXLA 3ZPLA 1K79A 3KZZA 5HOOA 4HDUA 2K9QA 2VC0A 5GPAA 3AKZA 2CO5A 2P5KA 3UNGC 2FBKA 3CESA 2FA5A 2VE8A 5IT9Z 2WAQA 2IGNA 1PUFB 1HW2A 3DPUA 4KIBA 3HOWJ 3DEWA 1WWXA 1XDSA 4B4CA 4A69C 1F9NA 3K4LA 2M87A 2QKMB 1BA5A 2HXOA 4E7LA 3WU2C 4NUBA 3DU5A 1EA3A 4BBSJ 1KONA 1TQMA 2X1DA 4I09A 1YG2A 1BL0A 1V5GA 3H0DA 5M5XJ 2W4SA 3ZQ7A 5AONA 3OYBA 1MMSA 2RNGA 3LQQA 1XGOA 2IXSA 5BNGA 4HBLA 4IRIA 3TP0A 1O57A 1GXQA 5TGTA 5E79C 4IO9F 2YUSA 4EJUA 1T98A 1W7PB 4I0AA 1ITYA 2R3SA 2IJLA 1SMYF 4MTDA 1BM9A 1GHCA 3FKIJ 3AL0C 2V6CA 1R4MB 3ZN0A 4XM3A 3JAMK 4C9YA 2LKXA 1I3AA 2DTRA 5L3EA 1B9NA 2PLYA 1VFCA 3GW2A 2Y0MA 3MEXA 2PJRB 2E5NA 2JN6A 2L9RA 2MLGA 5J4VA 4IOAF 3CZ6A 1JUPA 1PUEE 2GAUA 3H92A 2M0MA 3HUGA 4B44A 4ZZDA 2FXAA 2VXZA 3TBIA 2TRTA 1HOMA 3IAM2 2KQRA 2GBYA 2W48A 4D9JA 6PAXA 2GZWA 3BG6A 4W1UA 3FXQA 2K9NA 2JA2A 2XF7A 1JGGA 3NWTA 3EUHA 3FIWA 5GPCA 5D5UB 3CCQI 4UUVA 4CCKA 2QWWA 2R7ZJ 2I8DA 3IL2A 4HF1A 4ZYEA 2MG4A 4GGGA 3KLNA 4N9HA 3G71I 2EZLA 5HDNA 1WJAA 2X51A 2D1HA 2F6CA 1OMIA 1V54H 4X1EA 3MWMA 1O4XA 2E19A 4B8XA 1F4KA 5FB2A 2XC7A 4XQFA 1UAAA 1Z7UA 4XLPF 1YIJI 4M74A 3GWZA 2O0YA 4ENNA 1HKQA 3MZHA 3VYRB 2ESNA 2FD5A 4NC7A 1XGMA 3RIRA 1O3QA 1ERDA 4WCGA 3HKZA 3L2UA 4A3KJ 2VQLA 4B47A 3ZN1A 1RRJA 1U5TC 1PYVA 4Y3OA 1SD5A 2YR2A 4HNTA 3VFZA 3T8TA 4A0ZA 1FOYA 1J59A 3D5SC 5L3CA 2O61A 2CFXA 1LNWA 2F4IA 3TGNA 1QGPA 2YX4A 5JVTA 2X6WA 1BI3A 2KFDA 2ZSIB 5F27A 1J09A 3WODF 5LGNA 3ABKH 2O8KA 4PZJA 2XAFA 4BJ6C 2VQGA 4U0YA 4D1QA 3I4MJ 4CCOA 3CC4I 2VPRA 3JR9A 2VIXA 4I99C 2EV0A 1Y6IA 3HPHA 3L00A 3H35A 1TBXA 3OYFA 3KYCB 5E3NA 2CFOA 1S7AA 4XKVA 3ONQA 5F0CA 5TRDA 3ZRGA 2WC2A 3LA2A 2XGEA 2ZXIA 2M4GA 3MKLA 4ESBA 3P9KA 3C2HA 3I3LA 3JRHA 2X9DA 1QZZA 4YIRX 2COMA 3A0BC 3S3NA 1ZG5A 3K70D 3MN2A 3G1LA 3PNYA 4GYGA 4IPAA 2KZVA 1RZ4A 2K4BA 3S93A 5IP6A 2V4JC 1N77A 2Y75A 3MAJA 3BWGA 3OYNA 2WY8Q 1XD7A 3F9KA 1J75A 1F1ZA 4L9JA 2IS6A 4P96A 1R5GA 1ETXA 1OR7A 3O6BB 5IYCJ 1MJBA 4XKWA 5EEAA 1FOKA 1I6HJ 5H6QA 4BUPA 2P6SA 1N78A 3A4CA 2G9WA 3CDIA 3GTPJ 2VBZA 4M6YA 2CRGA 2W1OA 2DFIA 4BBRJ 3EYIA 3DU6A 4LB6B 3S16J 3DLLF 5DD4A 3CF5F 4P1WA 4KIFA 4QWQA 1V5FA 1WGXA 1DP3A 3CCJI 3RZDJ 4KN7X 4XL9A 1I6XA 3ESWB 2QVOA 2B9SA 1Y8QB 2L7MP 4PUSA 4E7KA 3QYFA 1S72I 5D5WB 1FIAA 2CUEA 1XN7A 5IY5H 1YQAA 1Y56A 4IRHA 3BQZA 1D1AA 3PSIA 3K2ZA 1O3TA 3QYBA 5ICFA 2E1OA 4V2GA 3HSFA 4JX6A 1S3JA 1QVUA 4IQ4A 4XRFA 2CQXA 3BY6A 4QLCU 5J8CA 2IBDA 1MMGA 4BY1J 2OF7A 4WF2A 4H0EA 2V1UA 3TEDA 3L2QA 3RZOJ 1R4NB 2CSOA 2E1NA 5GTHC 1WH5A 1VQ7I 1PP7U 1IGNA 5ILSA 2XF5A 3K4BA 2E34A 1JUSA 4RM2A 1UJ8A 3SYTA 3GTLJ 4M6VA 4CO8A 2HDWA 3BTIA 1ZK8A 4X6AJ 4LG0B 3ZQQA 5E8GA 2R7SA 1B59A 5E3MA 3GUDA 3OYKA 2HZDA 5K7ZA 1LVAA 1R36A 2L02A 3BR1A 5GADJ 2LP0A 3KZYA 1R1VA 3K6GA 4HOBA 1R22A 2ISZA 4WXHA 4M72A 2P5LC 1J2XA 1X3WB 2VL8A 2LYCA 4FISA 1D1BA 3G6EI 1FBQA 5HDKA 4L9NA 1JT6A 2M1BA 2GIZA 1E3OC 1MBFA 4DGWB 3NEUA 1K4TA 4CH7A 3ZQCA 4PSXA 2JUCA 1R1UA 1QQIA 2EPFA 2OD5A 1L3LA 1R5HA 3FHNA 4G12A 5FFXA 1MW7A 2QF7A 3FWEA 4PK4A 1ZR4A 1UG0A 2K3PA 2ZJPF 2WAEA 3M8FA 4IF4A 2ZMEB 2F5VA 2VJJA 2E35A 3JAMZ 1D0YA 2TDXA 5D5XB 4FE4A 4ENJA 2E1MC 5BMZA 1FOXA 4ZDPA 4V2FA 2UXNA 3L7WA 1K7AA 2HKXA 1T08B 2MC4A 2EFWA 2BW3A 3B6AA 3DWLE 2N8GA 3RYRA 4YFKF 3VYUB 4WWCA 2QQBA 1TLHB 4Y52J 2A61A 2ME6A 3PUFA 2OC6A 4QPQA 2NVXJ 2R7TA 1VNDA 4LFUA 1G3SA 2HNHA 3RCOA 1NH3A 1IN8A 2NNNA 2DA2A 2VOPA 3LSIA 3GEZA 5E20A 4L5EA 3CCVI 3G3ZA 4HSTA 1UZCA 3W6JB 1OYIA 2GWRA 2HVQA 2RV8A 4BJTA 4DJAA 1Z05A 3BZCA 2OAZA 2FF4A 2IW5A 4ON0A 5CQGA 1JJ6C 1FP2A 2WV1A 3L2RA 3MMYB 3BOQA 1WH7A 2QA4I 4RBOA 3DV8A 2DN0A 2R7UA 3SEQA 4DBRA 3P9CA 2DU9A 3AG1H 2Z9OA 2WB1A 3L2VA 1HDPA 1WKMA 2KISA 4RGXA 2AS5F 1JKOC 2XAUA 4RAFA 1JKQC 1JJ8C 2A05A 2PBIA 2GXGA 3KLOA 4KN4X 2VQHA 3WHCA 4NQWB 1IN5A 2R7FA 3RQ4A 1X3ZB 1HSTA 3V7CA 4BH9A 1UHMA 1GVJA 3I4NJ 1X2MA 2IAIA 3WU1B 1FP1D 3R4KA 2OZ6A 1CF7A 3GLLA 3DBHB 2E36A 2JRMA 2HKOA 1Z7LA 3EUHC 2DOEA 5FROA 1WJEA 5LEKA 2LC2A 4F7ZA 4ZZLA 4IX7A 4XLFA 2LMDA 3SFZA 4EJVA 4FTHA 2M3AA 3HOSA 1XDUA 1W5SA 3RSNA 3GCMA 4IVNA 1IN6A 1MBKA 4JK1X 1W36C 3CP2A 3HHGA 2IPQX 1MDMB 2ZXJA 4BXFA 3K1MA 1T33A 3SFIA 1RC9A 3VOEA 2L4MA 4BKXA 4Q4ZF 2CUFA 3PFIA 1FTZA
chains in the Genus database with same CATH topology
1FX7A 3R61A 2DQRA 4R8HA 5AIQA 3F21A 4A12A 3RTRA 2HTSA 2BYVE 1DPRA 1XCVA 1R58A 3N97A 3F3XA 5DUKA 2Q0OA 3CUOA 1ZRFA 1SFXA 3KP4A 1ZRDA 3M1EA 4XLNF 4ETSA 1IXCA 5BPIA 1XGSA 2O8XA 3I59B 4OOIA 2Z33A 2QLZA 4DQ2A 1W7PA 2ZNYA 3GO5A 2V1DA 2EV5A 2LNBA 4IHTA 4G8XA 4UV9A 1E2XA 2OU2A 1JHFA 1FT9A 5LGTA 3RJPA 1B4AA 1P4XA 4I98B 1IRFA 5LGUA 4PCQA 2VODA 5ICCA 4WK8F 1G3WA 2H6BA 1B9MA 4YFXF 2PMHA 2XKPA 3BJ6A 1YYVA 3K1PA 2IA1A 5FGMA 3I5UA 2Z99A 1RIOH 1BOAA 4BHCA 3J7AO 4UHTA 4CYDA 1BI1A 4MNUA 4AIHA 3SZTA 1Z6TA 1Y0UA 3VEPA 5L3BA 2GIVA 4KYWA 5CVUA 4EJWA 3KCCA 1V4RA 4LLLA 2HYGD 3L9FA 4M9ZA 1FZPB 3LAPA 1BI0A 3ZMSA 4LB5A 4XBFA 1YW7A 3B73A 3CJNA 2QQAA 2P5VA 3ELKA 5J8FA 2A68F 1O7LA 2E7WA 5DV5A 2EWNA 4RAZA 4P9FA 5E17F 3F72A 3LA3A 3TOBA 4B09A 5CVIA 3FM3A 1P6RA 3FXRA 4LLNA 1HSJA 1W5TA 1G3YA 4O5VA 2VBYA 3GZ5A 2OBPA 4MEYF 2ZBKA 3ABUA 3HOTA 2Q8KA 3TOAA 3ULQB 1LDDA 3GVAA 4NB5A 2GA1A 3J81K 2RQPA 4BAYA 4A5MA 1HKSA 3BJOA 1V3FA 2HS5A 3E6MA 1K6OA 2D2WA 1ZG3A 1EH8A 5A2QK 3COAC 1FSEA 3QU3A 2VE9A 1PP8F 1IRGA 1KU3A 1WRJA 1FYMA 3J80K 2BBYA 3CDHA 3IWZA 2IRFG 5BS6A 2Z5UA 1ZH5A 3Q9VA 1TW3A 1TQIA 2A3SA 1EH6A 2VBXA 5BQTA 3MCZA 3ISPA 3C3WA 5FO5A 1ZGAA 4G6DA 2ZCWA 3W6KB 3WE2A 4LG0A 4UNOA 1ZLJA 4R1HA 2H94A 2LDUA 4Q47A 3Q5FA 1S8NA 2IA2A 3T0YA 1RNLA 1R23A 3BDDA 1IXSB 3R0AA 4EJTA 2ZFWA 4BQAA 1DUXC 4I01A 3P7NA 4LMYA 3CO6C 1ZAOA 1H9GA 3FX3A 1D8KA 4CICA 3CLOA 4M71A 1KQ8A 1MKMA 2DK5A 3KETA 1KU2A 2ZMEA 3KP5A 2P4WA 1FC3A 3Q9SA 3IKTA 5IT3A 3P9IA 1ULYA 2XKOA 2DT5A 5L3FA 1HQCA 4PDKA 1R00A 4HX4A 3E5XA 1BBYA 1KQ0A 2QZ8A 3IKVA 3GFIA 5HS8A 4IJAA 4OIRF 3ECHA 4BXUA 2MLKA 2K86A 2R7DA 2V79A 3LWFA 1TTYA 2QYOA 5JFRA 4HV6A 2P6TA 1P2FA 3LFKA 1OYWA 1YIOA 4PGHA 2L3DA 1T0FA 5HS7A 4GO1A 4NQWA 1U78A 3QP5A 1H0MA 1XCBA 1S29A 3G73A 4M6XA 1PDNC 5F64A 3SZPA 3WG9A 3PQKA 1QPMA 1TW2A 5D6EA 2VBWA 5FD5A 4E70A 4ZYDA 3R0JA 4OIQF 2P8TA 1Z1DA 5LRRA 2P7CB 2RGVA 3HRTA 3M8EA 3U9GA 2M30A 3DF8A 1MDMA 5E8IA 2UZKA 1RI7A 4KIGA 4LGWA 3E6DA 4U0WA 1ZHFA 1ONVA 2RDPA 2K4JA 3T8RA 3I4PA 4UVCA 2FQ3A 3D0SA 4WXDA 2LKPA 3N4MA 5D8LB 2YU3A 4KNYA 5ILVA 3WTYC 1D8JA 1IUYA 3VB2A 2FMYA 5ICEA 4Y13A 1FBSA 1I27A 1S7OA 3I59A 5JR3A 2EJRA 3F8NA 4WXCA 1BIBA 3WGHA 1EH7A 4L0ZB 3J81Z 3KP7A 3U2RA 5HLGA 4Q5SF 4CGZA 4OU0A 3ERED 4MHGA 1T39A 2JTVA 1YS6A 2XAHA 2JRTA 4EGYA 5CVJA 1D3YA 5A2QZ 5LLQA 3DXJF 3KP3A 1QNTA 2XV4S 3L09A 2KJBA 1ODDA 2HGCA 4HLXA 5L3DA 4CHUA 4EMSA 3J80Z 2F2EA 5BOXA 2XIGA 3GLXA 4KICA 4RB0A 5BPDA 2X0LA 3DPTA 2W25A 3V8KA 5D4SA 2HEOA 4XSZF 1KU7A 3FMQA 4M9XA 2YSRA 1S6LA 1XB4A 2YX7A 1G3TA 4DNCA 4LJZF 4Z2YA 4AIKA 3ZMTA 2EFPA 2HQNA 4OINF 3EYYA 5AIPA 2C6YA 2ETHA 1JGSA 2BE5F 1LB2A 4HLYA 4NHJA 1YW9A 5JHUA 4BHBA 3CUQB 3I0TA 1LJ9A 1Z91A 2DW4A 1KQ9A 4HZFA 3M7GA 1YFHA 3JTGA 2CG4A 3V7RA 1HW1A 4A5NA 4U0VA 1XMKA 2E7XA 3NQOA 1FLIA 1ON1A 3BPVA 2DAOA 1ZLKA 2CGPA 2NYXA 2ISYA 3RI4A 2GXBA 1U6GA 4HAMA 3LAJA 2RN7A 4HV5A 2KKOA 5LHHA 2VC1A 1Z9CA 1Q1HA 3DKWA 1BC8C 2IA0A 2WTEA 2ACJA 3GFMA 5F1RA 2Y48A 4A2UA 1IAWA 1Z6RA 3RDIA 5HS9A 4P5OA 4EM2A 2EA2A 4KFCA 3K1NA 3O3KA 1UCRA 4OMYA 3T1BA 2STTA 2CQKA 3BROA 2AXLA 4MGRA 2F5EA 4S05A 2PG4A 1G4DA 5EEGA 3JSOA 4O3MA 5FFZA 1DPUA 1SD7A 3HIFA 2FBHA 3DPLC 3WTVC 1ZARA 1ON2A 1SD6A 4TV7A 4MQVA 4RGSA 1ZREA 2FSWA 1QBJA 3GXOA 4FX0A 3TQNA 1LDJA 4JBAA 3K69A 1DP7P 3WGIA 3JW4A 3DEUA 3E5QA 1RUOA 3QPTA 5L3GA 3WTUC 2K27A 1D5VA 3KEQA 2NRAC 2HQRA 2OQRA 4P55A 2PN6A 1KA8A 5DCFA 3TO6A 1FY7A 2OZUA 1JXSA 1IW7F 4HF2A 2RKHA 2FBIA 3RKYA 5DCMB 3V7SA 1YTYA 2FRHA 3V4GA 1KU9A 1SFEA 3F8FA 4GCVA 3ZMDA 4CXFA 4HQMA 3FMRA 4CDGA 4A6DA 2H27A 2RVCA 2EFQA 3WGGA 4KDPA 3MQ0A 4L18B 2M5WA 5KVRA 1G6NA 3HHHA 2DI3A 1IN4A 4ENKA 4G7OF 4U7BA 3KP6A 2A69F 4AIJA 3RYPA 3H3UA 3GF2A 3F22A 3E6BA 4ZH4F 5DUIA 1FYLA 2HWVA 4Y15A 2ZJ2A 3O2PE 2NS0A 2XAJA 4PGGA 2QM3A 4IRGA 2L54A 3I53A 1J0RA 1O3RA 1C0WA 2XAGA 2XHKA 4ESJA 1XGNA 1X3UA 4YIFA 3C1DA 4RAYA 3F23A 1LEBA 4P9UA 2KIMA 2P7VB 3I58A 5CLSA 3OV8A 3HYIA 3GFJA 3IRRA 5D4RA 3QAHA 2LSOA 5DEQA 3F8BA 2YPRA 3VODA 3QPHA 3KE2A 3WTSC 4G7ZF 2QBYB 1YLFA 4A0XA 3RKWA 1T6SA 2VONA 1SMTA 1FNNA 2F5FA 1P4AA 5E1WA 3C18A 4IHSA 2H09A 4L0YB 3BPXA 2MC3A 3BP8A 2FE3A 2RNJA 1TNSA 3EETA 3AAFA 3LSTA 2J5PA 4I0BA 4RS8A 3LQRA 4D0PA 1DDNA 5K5OA 1NHAA 4KT5C 2MH9A 3ZMVA 4ENMA 3ZP5A 3E97A 1B6AA 3WTTC 1VTNC 2VN2A 4MQ9F 5HVQC 2F5CA 2E1CA 4HF0A 5J6XA 1HBXG 2PFBA 3EQLF 4MTEA 1FSHA 5CVRA 1OPCA 1UFMA 3IC7A 2HR3A 3F8CA 4I02A 2ESHA 4HQEA 2X4HA 1ZG1A 1TQPA 3ECOA 1YO5C 4M73A 2DBBA 1OYYA 3GFLA 4G7HF 1USTA 1GXPA 1XSXA 1I1SA 1U5TB 3HRSA 3FZVA 3NRVA 3JTHA 2A6HF 4OIPF 3OOPA 1RUNA 3CTAA 5D6FA 3ROUA 3CUQA 5TJJA 2XASA 1U2WA 4RB1A 5LRSA 3FHZA 5F6FA 1BIAA 1LEAA 3KFWX 5D5VB 1SFUA 3IRQA 4RGRA 3WTZA 1ZRCA 1REPC 2Q2EA 1I1GA 4UVBA 2D1VA 3HTUA 2KIFA 4KUMA 2HOEA 2CWEA 5E18F 3F6VA 2ADUA 4KA4A 2WWYA 5K5QA 4AVPA 4EV0A 4R79A 2L4AA 2DPUA 1F5TA 1IF1A 1LDKB 2GA2A 2FEZA 4GYIA 1USSA 1P92A 1YS7A 2FOKA 4EM1A 1U3EM 3E6CC 2XGXA 2DO7A 2JT1A 3FF5A 2LF7A 4XSXF 4EVIA 1FYKA 3HTSB 2BV6A 2FNAA 4BHPA 1FPQA 2KJCA 2ZKZA 3KP2A 1SAXA 1IXRC 2UWMA 4Y17A 1WI9A 2XROA 1R1TA 3K9TA 2CYYA 2NAZA 1HW5A 1BN5A 3LA7A 4EJOA 1EV7A 2XUBA 3V8JA 3IHUA 1WSUA 4KMUX 2EFNA 3SQNA 2DK8A 2STWA 2FNPA 3WTWC 4FHTA 2UXXA 4HW0A 4ZYGA 1L0OC 5DYMA 4G9YA 1FBUA 1IN7A 2PMUA 2EV6A 3TDZC 5FLXK 1A04A 5FD6A 4LD5A 2IP2A 2XRNA 2ZNZA 2O6GE 5DCMA 4O6JA 2JSCA 1HXDA 3SHFA 2G7UA 3HRMA 3I54A 5ICGA 3FXUA 3FMSA 2K02A 1O3SA 3TDUC 2RC4A 3I64A 2BEOA 2WV0A 4FT8A 3HSEA 5ERIA 5E1ZB 1MJ9A 2MA3A 1JE8A 4S04A 4AD9A 2D45A 4L5IA 4BYYA 1FWZA 2FU4A 1E17A 1O7FA 4HYEA 2QQ9A 2GQQA 2EFOA 3M9AA 4JQFA 2PI0A 3SXYA 1T38A 1AOYA 1HKTA 2JZYA 1QZYA 4KMFA 3TO9A 4RGUA 2DPDA 2CW0F 2BGCA 2B0LA 3RPQA 2HDCA 3F8MA 4EGZA 3E3VA 2PQ8A 4HDVA 2K7LA 2EB7A 2OQGA 3TKYA 2KRFA 1KGSA 2FMLA 3E5UA 1MGTA 2MH2A 3REOA 2A5YB 4BNCA 1SD4A 2W24A 1B1BA 4YG2F 4Q48A 2V1XA 4I2OA 4L9VA 2ELHA 2QBYA 5ED4A 5E1XA 3MFKA 1BC7C 2VT2A 2W57A 1KYZA 1MZBA 4N9IA 3CUQC 5JI6A 2XVCA 2JPBA 1T2KA 2MBFA 1STZA 5LBQA 1YW8A 3S2WA 3RPUA 1UHWA 5IT9K 1LQ1A 1WQ2A 4HX7A 1TNTA 1UB9A 2A07F 2QUFA 4LLGF 2VOOA 4MEXF 3ML6A 3I71A 2VT3A 2ZO4A 2HZTA 4UVAA 2EK5A 1K78A 3HRUA 5DDGA 4HX8A 5LHGA 2MD5A 3V8LA 5K5RA 1W7PD 2Z3YA 4LK0F 4A6EA 3DQVC 1BI2A 2EA4A 4K2EA 4UV8A 3PQJA 5CYVA 3H3ZA 1XMAA 2O03A 3RKXA 3C7JA 2DQLA 4N0BA 3GYHX 5H20A 4ASNA 5DD8A 4HA8A 1ZYRF 2A6EF 1J7KA 1U5TA 2M45A 3DP7A 1OKRA 1MD0A 3ZMUA 2NNYA 2H6CA 3L2CA 3HSRA 1W4MA 4AWXB 2PEXA 4G6QA 3T5XA 5KK1A 3F6OA 4FX4A 1H9TA 4M9SA 2M8EA 5FLXZ 2L01A 3MZYA 1BJAA 4U7DA 2G7HA 2DLLA 4I7HA 3WU0A 2PJPA 2W84A 4RB3C 4YIIA 3U1DA 5HDGA 5LHIA 2QENA 1J5YA 2V9VA 3FM5A 3KEOA 2HYFA 1JHHA 2J5OA 3ZMZA 1R7JA 2W85A 3R6SA 3QU6A 4ESFA 2KIUA 4EQQA 1XSVA 1U8RA 4L9TA 1AWCA 4EM0B 4OMZA 3WE3A 1ZGJA 4WX9A 2JPCA 2OA4A 4U88A 4OIOF 2HTJA 1QO0D 5HLHA 2HFHA 3EDPA 5CJ9A 1P4WA 1XSDA 2O3FA 3ABTA 4ZYHA 2LF8A 3BZ6A 3CO7C 2XAQA 3JSPA 2IT0A 4CZZA 5HLIA 4L5JA 4RB2C 3B02A 4UXNA 1J9IA 3R60A 3TO7A 1CGPA 4YFNF 3GX4X 5ILUA 3IWFA 1KYWA 3BJAA 3DFGA 1ZN2A 1CF7B 4IXAA 1I5ZA 4GXOA 1MJAA 3K0LA 3WTXC 4G94A 5K1YA 3D5LA 1IZ1A 3QP6A 5EEHA 5LEJA 2IVMA 4A0YA 5D8KB 4LK1F 2F5DA 3QOPA 3GZ6A 1K78B 5H6RA 3QRFF 5CVVA 3ZPLA 1K79A 3KZZA 5HOOA 4HDUA 2VC0A 2CO5A 2P5KA 2FBKA 2FA5A 2VE8A 5IT9Z 1HW2A 4KIBA 1WWXA 1XDSA 1F9NA 2M87A 1TQMA 4I09A 1YG2A 3ZQ7A 5AONA 3LQQA 1XGOA 4HBLA 4IRIA 1O57A 1GXQA 4EJUA 1T98A 1W7PB 4I0AA 2R3SA 2IJLA 1SMYF 4MTDA 1BM9A 1GHCA 2V6CA 3JAMK 3ZN0A 2DTRA 5L3EA 1B9NA 2PLYA 3GW2A 2Y0MA 3MEXA 2MLGA 1PUEE 2GAUA 3H92A 4ZZDA 3HUGA 2FXAA 2VXZA 6PAXA 2GZWA 3FXQA 3EUHA 5D5UB 4UUVA 2QWWA 3IL2A 4HF1A 4ZYEA 4GGGA 3KLNA 4N9HA 5HDNA 2D1HA 1OMIA 3MWMA 4B8XA 1F4KA 5FB2A 1Z7UA 4XLPF 4M74A 3GWZA 2O0YA 4ENNA 1HKQA 3MZHA 2ESNA 1XGMA 3RIRA 1O3QA 4WCGA 3ZN1A 1U5TC 1SD5A 2YR2A 3VFZA 3T8TA 4A0ZA 1J59A 5L3CA 2O61A 2CFXA 1LNWA 3TGNA 1QGPA 2YX4A 5JVTA 1BI3A 3WODF 5LGNA 4PZJA 2XAFA 4U0YA 2EV0A 3L00A 1TBXA 1S7AA 5TRDA 2WC2A 3LA2A 4ESBA 3P9KA 1QZZA 2COMA 1ZG5A 4GYGA 4IPAA 1RZ4A 2K4BA 2Y75A 3MAJA 3BWGA 1XD7A 1J75A 1F1ZA 4L9JA 4P96A 1R5GA 1OR7A 3O6BB 1FOKA 1MJBA 5H6QA 2P6SA 2G9WA 2VBZA 4M6YA 2DFIA 3EYIA 4LB6B 5DD4A 4KIFA 4QWQA 4KN7X 1I6XA 2QVOA 5D5WB 1XN7A 1YQAA 4IRHA 3K2ZA 1O3TA 5ICFA 3HSFA 1S3JA 4XRFA 3BY6A 4QLCU 5J8CA 4WF2A 4H0EA 2V1UA 2CSOA 2E1NA 1PP7U 5ILSA 4CO8A 4LG0B 5E8GA 1B59A 3GUDA 1LVAA 1R36A 2L02A 3KZYA 1R1VA 4HOBA 1R22A 2ISZA 4WXHA 4M72A 2P5LC 1J2XA 1FBQA 5HDKA 4L9NA 2M1BA 3NEUA 2OD5A 1R1UA 1QQIA 1L3LA 1R5HA 5FFXA 3FWEA 3M8FA 4IF4A 2ZMEB 3JAMZ 2TDXA 5D5XB 4ENJA 5BMZA 2UXNA 3L7WA 1K7AA 2HKXA 2EFWA 3RYRA 4YFKF 4WWCA 2QQBA 1TLHB 2A61A 4LFUA 1G3SA 1IN8A 2NNNA 2VOPA 3GEZA 5E20A 3G3ZA 3W6JB 1OYIA 2GWRA 2RV8A 1Z05A 2OAZA 2FF4A 2IW5A 4ON0A 1FP2A 3BOQA 3DV8A 3P9CA 2DU9A 2Z9OA 2AS5F 1WKMA 4RGXA 2PBIA 4KN4X 2GXGA 3KLOA 1IN5A 2R7FA 1HSTA 3V7CA 4BH9A 1UHMA 1GVJA 3WU1B 1FP1D 3R4KA 2OZ6A 1CF7A 2HKOA 5LEKA 4F7ZA 4ZZLA 3SFZA 4EJVA 3HOSA 1XDUA 1W5SA 4IVNA 1IN6A 4JK1X 3HHGA 2IPQX 1MDMB 2ZXJA 3K1MA 3VOEA 2L4MA 4Q4ZF 3PFIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1FX7 A;  3R61 A;  2DQR A;  4R8H A;  5AIQ A;  3F21 A;  4A12 A;  3RTR A;  2HTS A;  2BYV E;  1DPR A;  1XCV A;  1R58 A;  3N97 A;  3F3X A;  5DUK A;  2Q0O A;  3CUO A;  1ZRF A;  1SFX A;  3KP4 A;  1ZRD A;  3M1E A;  4XLN F;  4ETS A;  1IXC A;  5BPI A;  1XGS A;  2O8X A;  3I59 B;  4OOI A;  2Z33 A;  2QLZ A;  4DQ2 A;  1W7P A;  2ZNY A;  3GO5 A;  2V1D A;  2EV5 A;  2LNB A;  4IHT A;  4G8X A;  4UV9 A;  1E2X A;  2OU2 A;  1JHF A;  1FT9 A;  5LGT A;  3RJP A;  1B4A A;  1P4X A;  4I98 B;  1IRF A;  5LGU A;  4PCQ A;  2VOD A;  5ICC A;  4WK8 F;  1G3W A;  2H6B A;  1B9M A;  4YFX F;  2PMH A;  2XKP A;  3BJ6 A;  1YYV A;  3K1P A;  2IA1 A;  5FGM A;  3I5U A;  2Z99 A;  1RIO H;  1BOA A;  4BHC A;  3J7A O;  4UHT A;  4CYD A;  1BI1 A;  4MNU A;  4AIH A;  3SZT A;  1Z6T A;  1Y0U A;  3VEP A;  5L3B A;  2GIV A;  4KYW A;  5CVU A;  4EJW A;  3KCC A;  1V4R A;  4LLL A;  2HYG D;  3L9F A;  4M9Z A;  1FZP B;  3LAP A;  1BI0 A;  3ZMS A;  4LB5 A;  4XBF A;  1YW7 A;  3B73 A;  3CJN A;  2QQA A;  2P5V A;  3ELK A;  5J8F A;  2A68 F;  1O7L A;  2E7W A;  5DV5 A;  2EWN A;  4RAZ A;  4P9F A;  5E17 F;  3F72 A;  3LA3 A;  3TOB A;  4B09 A;  5CVI A;  3FM3 A;  1P6R A;  3FXR A;  4LLN A;  1HSJ A;  1W5T A;  1G3Y A;  4O5V A;  2VBY A;  3GZ5 A;  2OBP A;  4MEY F;  2ZBK A;  3ABU A;  3HOT A;  2Q8K A;  3TOA A;  3ULQ B;  1LDD A;  3GVA A;  4NB5 A;  2GA1 A;  3J81 K;  2RQP A;  4BAY A;  4A5M A;  1HKS A;  3BJO A;  1V3F A;  2HS5 A;  3E6M A;  1K6O A;  2D2W A;  1ZG3 A;  1EH8 A;  5A2Q K;  3COA C;  1FSE A;  3QU3 A;  2VE9 A;  1PP8 F;  1IRG A;  1KU3 A;  1WRJ A;  1FYM A;  3J80 K;  2BBY A;  3CDH A;  3IWZ A;  2IRF G;  5BS6 A;  2Z5U A;  1ZH5 A;  3Q9V A;  1TW3 A;  1TQI A;  2A3S A;  1EH6 A;  2VBX A;  5BQT A;  3MCZ A;  3ISP A;  3C3W A;  5FO5 A;  1ZGA A;  4G6D A;  2ZCW A;  3W6K B;  3WE2 A;  4LG0 A;  4UNO A;  1ZLJ A;  4R1H A;  2H94 A;  2LDU A;  4Q47 A;  3Q5F A;  1S8N A;  2IA2 A;  3T0Y A;  1RNL A;  1R23 A;  3BDD A;  1IXS B;  3R0A A;  4EJT A;  2ZFW A;  4BQA A;  1DUX C;  4I01 A;  3P7N A;  4LMY A;  3CO6 C;  1ZAO A;  1H9G A;  3FX3 A;  1D8K A;  4CIC A;  3CLO A;  4M71 A;  1KQ8 A;  1MKM A;  2DK5 A;  3KET A;  1KU2 A;  2ZME A;  3KP5 A;  2P4W A;  1FC3 A;  3Q9S A;  3IKT A;  5IT3 A;  3P9I A;  1ULY A;  2XKO A;  2DT5 A;  5L3F A;  1HQC A;  4PDK A;  1R00 A;  4HX4 A;  3E5X A;  1BBY A;  1KQ0 A;  2QZ8 A;  3IKV A;  3GFI A;  5HS8 A;  4IJA A;  4OIR F;  3ECH A;  4BXU A;  2MLK A;  2K86 A;  2R7D A;  2V79 A;  3LWF A;  1TTY A;  2QYO A;  5JFR A;  4HV6 A;  2P6T A;  1P2F A;  3LFK A;  1OYW A;  1YIO A;  4PGH A;  2L3D A;  1T0F A;  5HS7 A;  4GO1 A;  4NQW A;  1U78 A;  3QP5 A;  1H0M A;  1XCB A;  1S29 A;  3G73 A;  4M6X A;  1PDN C;  5F64 A;  3SZP A;  3WG9 A;  3PQK A;  1QPM A;  1TW2 A;  5D6E A;  2VBW A;  5FD5 A;  4E70 A;  4ZYD A;  3R0J A;  4OIQ F;  2P8T A;  1Z1D A;  5LRR A;  2P7C B;  2RGV A;  3HRT A;  3M8E A;  3U9G A;  2M30 A;  3DF8 A;  1MDM A;  5E8I A;  2UZK A;  1RI7 A;  4KIG A;  4LGW A;  3E6D A;  4U0W A;  1ZHF A;  1ONV A;  2RDP A;  2K4J A;  3T8R A;  3I4P A;  4UVC A;  2FQ3 A;  3D0S A;  4WXD A;  2LKP A;  3N4M A;  5D8L B;  2YU3 A;  4KNY A;  5ILV A;  3WTY C;  1D8J A;  1IUY A;  3VB2 A;  2FMY A;  5ICE A;  4Y13 A;  1FBS A;  1I27 A;  1S7O A;  3I59 A;  5JR3 A;  2EJR A;  3F8N A;  4WXC A;  1BIB A;  3WGH A;  1EH7 A;  4L0Z B;  3J81 Z;  3KP7 A;  3U2R A;  5HLG A;  4Q5S F;  4CGZ A;  4OU0 A;  3ERE D;  4MHG A;  1T39 A;  2JTV A;  1YS6 A;  2XAH A;  2JRT A;  4EGY A;  5CVJ A;  1D3Y A;  5A2Q Z;  5LLQ A;  3DXJ F;  3KP3 A;  1QNT A;  2XV4 S;  3L09 A;  2KJB A;  1ODD A;  2HGC A;  4HLX A;  5L3D A;  4CHU A;  4EMS A;  3J80 Z;  2F2E A;  5BOX A;  2XIG A;  3GLX A;  4KIC A;  4RB0 A;  5BPD A;  2X0L A;  3DPT A;  2W25 A;  3V8K A;  5D4S A;  2HEO A;  4XSZ F;  1KU7 A;  3FMQ A;  4M9X A;  2YSR A;  1S6L A;  1XB4 A;  2YX7 A;  1G3T A;  4DNC A;  4LJZ F;  4Z2Y A;  4AIK A;  3ZMT A;  2EFP A;  2HQN A;  4OIN F;  3EYY A;  5AIP A;  2C6Y A;  2ETH A;  1JGS A;  2BE5 F;  1LB2 A;  4HLY A;  4NHJ A;  1YW9 A;  5JHU A;  4BHB A;  3CUQ B;  3I0T A;  1LJ9 A;  1Z91 A;  2DW4 A;  1KQ9 A;  4HZF A;  3M7G A;  1YFH A;  3JTG A;  2CG4 A;  3V7R A;  1HW1 A;  4A5N A;  4U0V A;  1XMK A;  2E7X A;  3NQO A;  1FLI A;  1ON1 A;  3BPV A;  2DAO A;  1ZLK A;  2CGP A;  2NYX A;  2ISY A;  3RI4 A;  2GXB A;  1U6G A;  4HAM A;  3LAJ A;  2RN7 A;  4HV5 A;  2KKO A;  5LHH A;  2VC1 A;  1Z9C A;  1Q1H A;  3DKW A;  1BC8 C;  2IA0 A;  2WTE A;  2ACJ A;  3GFM A;  5F1R A;  2Y48 A;  4A2U A;  1IAW A;  1Z6R A;  3RDI A;  5HS9 A;  4P5O A;  4EM2 A;  2EA2 A;  4KFC A;  3K1N A;  3O3K A;  1UCR A;  4OMY A;  3T1B A;  2STT A;  2CQK A;  3BRO A;  2AXL A;  4MGR A;  2F5E A;  4S05 A;  2PG4 A;  1G4D A;  5EEG A;  3JSO A;  4O3M A;  5FFZ A;  1DPU A;  1SD7 A;  3HIF A;  2FBH A;  3DPL C;  3WTV C;  1ZAR A;  1ON2 A;  1SD6 A;  4TV7 A;  4MQV A;  4RGS A;  1ZRE A;  2FSW A;  1QBJ A;  3GXO A;  4FX0 A;  3TQN A;  1LDJ A;  4JBA A;  3K69 A;  1DP7 P;  3WGI A;  3JW4 A;  3DEU A;  3E5Q A;  1RUO A;  3QPT A;  5L3G A;  3WTU C;  2K27 A;  1D5V A;  3KEQ A;  2NRA C;  2HQR A;  2OQR A;  4P55 A;  2PN6 A;  1KA8 A;  5DCF A;  3TO6 A;  1FY7 A;  2OZU A;  1JXS A;  1IW7 F;  4HF2 A;  2RKH A;  2FBI A;  3RKY A;  5DCM B;  3V7S A;  1YTY A;  2FRH A;  3V4G A;  1KU9 A;  1SFE A;  3F8F A;  4GCV A;  3ZMD A;  4CXF A;  4HQM A;  3FMR A;  4CDG A;  4A6D A;  2H27 A;  2RVC A;  2EFQ A;  3WGG A;  4KDP A;  3MQ0 A;  4L18 B;  2M5W A;  5KVR A;  1G6N A;  3HHH A;  2DI3 A;  1IN4 A;  4ENK A;  4G7O F;  4U7B A;  3KP6 A;  2A69 F;  4AIJ A;  3RYP A;  3H3U A;  3GF2 A;  3F22 A;  3E6B A;  4ZH4 F;  5DUI A;  1FYL A;  2HWV A;  4Y15 A;  2ZJ2 A;  3O2P E;  2NS0 A;  2XAJ A;  4PGG A;  2QM3 A;  4IRG A;  2L54 A;  3I53 A;  1J0R A;  1O3R A;  1C0W A;  2XAG A;  2XHK A;  4ESJ A;  1XGN A;  1X3U A;  4YIF A;  3C1D A;  4RAY A;  3F23 A;  1LEB A;  4P9U A;  2KIM A;  2P7V B;  3I58 A;  5CLS A;  3OV8 A;  3HYI A;  3GFJ A;  3IRR A;  5D4R A;  3QAH A;  2LSO A;  5DEQ A;  3F8B A;  2YPR A;  3VOD A;  3QPH A;  3KE2 A;  3WTS C;  4G7Z F;  2QBY B;  1YLF A;  4A0X A;  3RKW A;  1T6S A;  2VON A;  1SMT A;  1FNN A;  2F5F A;  1P4A A;  5E1W A;  3C18 A;  4IHS A;  2H09 A;  4L0Y B;  3BPX A;  2MC3 A;  3BP8 A;  2FE3 A;  2RNJ A;  1TNS A;  3EET A;  3AAF A;  3LST A;  2J5P A;  4I0B A;  4RS8 A;  3LQR A;  4D0P A;  1DDN A;  5K5O A;  1NHA A;  4KT5 C;  2MH9 A;  3ZMV A;  4ENM A;  3ZP5 A;  3E97 A;  1B6A A;  3WTT C;  1VTN C;  2VN2 A;  4MQ9 F;  5HVQ C;  2F5C A;  2E1C A;  4HF0 A;  5J6X A;  1HBX G;  2PFB A;  3EQL F;  4MTE A;  1FSH A;  5CVR A;  1OPC A;  1UFM A;  3IC7 A;  2HR3 A;  3F8C A;  4I02 A;  2ESH A;  4HQE A;  2X4H A;  1ZG1 A;  1TQP A;  3ECO A;  1YO5 C;  4M73 A;  2DBB A;  1OYY A;  3GFL A;  4G7H F;  1UST A;  1GXP A;  1XSX A;  1I1S A;  1U5T B;  3HRS A;  3FZV A;  3NRV A;  3JTH A;  2A6H F;  4OIP F;  3OOP A;  1RUN A;  3CTA A;  5D6F A;  3ROU A;  3CUQ A;  5TJJ A;  2XAS A;  1U2W A;  4RB1 A;  5LRS A;  3FHZ A;  5F6F A;  1BIA A;  1LEA A;  3KFW X;  5D5V B;  1SFU A;  3IRQ A;  4RGR A;  3WTZ A;  1ZRC A;  1REP C;  2Q2E A;  1I1G A;  4UVB A;  2D1V A;  3HTU A;  2KIF A;  4KUM A;  2HOE A;  2CWE A;  5E18 F;  3F6V A;  2ADU A;  4KA4 A;  2WWY A;  5K5Q A;  4AVP A;  4EV0 A;  4R79 A;  2L4A A;  2DPU A;  1F5T A;  1IF1 A;  1LDK B;  2GA2 A;  2FEZ A;  4GYI A;  1USS A;  1P92 A;  1YS7 A;  2FOK A;  4EM1 A;  1U3E M;  3E6C C;  2XGX A;  2DO7 A;  2JT1 A;  3FF5 A;  2LF7 A;  4XSX F;  4EVI A;  1FYK A;  3HTS B;  2BV6 A;  2FNA A;  4BHP A;  1FPQ A;  2KJC A;  2ZKZ A;  3KP2 A;  1SAX A;  1IXR C;  2UWM A;  4Y17 A;  1WI9 A;  2XRO A;  1R1T A;  3K9T A;  2CYY A;  2NAZ A;  1HW5 A;  1BN5 A;  3LA7 A;  4EJO A;  1EV7 A;  2XUB A;  3V8J A;  3IHU A;  1WSU A;  4KMU X;  2EFN A;  3SQN A;  2DK8 A;  2STW A;  2FNP A;  3WTW C;  4FHT A;  2UXX A;  4HW0 A;  4ZYG A;  1L0O C;  5DYM A;  4G9Y A;  1FBU A;  1IN7 A;  2PMU A;  2EV6 A;  3TDZ C;  5FLX K;  1A04 A;  5FD6 A;  4LD5 A;  2IP2 A;  2XRN A;  2ZNZ A;  2O6G E;  5DCM A;  4O6J A;  2JSC A;  1HXD A;  3SHF A;  2G7U A;  3HRM A;  3I54 A;  5ICG A;  3FXU A;  3FMS A;  2K02 A;  1O3S A;  3TDU C;  2RC4 A;  3I64 A;  2BEO A;  2WV0 A;  4FT8 A;  3HSE A;  5ERI A;  5E1Z B;  1MJ9 A;  2MA3 A;  1JE8 A;  4S04 A;  4AD9 A;  2D45 A;  4L5I A;  4BYY A;  1FWZ A;  2FU4 A;  1E17 A;  1O7F A;  4HYE A;  2QQ9 A;  2GQQ A;  2EFO A;  3M9A A;  4JQF A;  2PI0 A;  3SXY A;  1T38 A;  1AOY A;  1HKT A;  2JZY A;  1QZY A;  4KMF A;  3TO9 A;  4RGU A;  2DPD A;  2CW0 F;  2BGC A;  2B0L A;  3RPQ A;  2HDC A;  3F8M A;  4EGZ A;  3E3V A;  2PQ8 A;  4HDV A;  2K7L A;  2EB7 A;  2OQG A;  3TKY A;  2KRF A;  1KGS A;  2FML A;  3E5U A;  1MGT A;  2MH2 A;  3REO A;  2A5Y B;  4BNC A;  1SD4 A;  2W24 A;  1B1B A;  4YG2 F;  4Q48 A;  2V1X A;  4I2O A;  4L9V A;  2ELH A;  2QBY A;  5ED4 A;  5E1X A;  3MFK A;  1BC7 C;  2VT2 A;  2W57 A;  1KYZ A;  1MZB A;  4N9I A;  3CUQ C;  5JI6 A;  2XVC A;  2JPB A;  1T2K A;  2MBF A;  1STZ A;  5LBQ A;  1YW8 A;  3S2W A;  3RPU A;  1UHW A;  5IT9 K;  1LQ1 A;  1WQ2 A;  4HX7 A;  1TNT A;  1UB9 A;  2A07 F;  2QUF A;  4LLG F;  2VOO A;  4MEX F;  3ML6 A;  3I71 A;  2VT3 A;  2ZO4 A;  2HZT A;  4UVA A;  2EK5 A;  1K78 A;  3HRU A;  5DDG A;  4HX8 A;  5LHG A;  2MD5 A;  3V8L A;  5K5R A;  1W7P D;  2Z3Y A;  4LK0 F;  4A6E A;  3DQV C;  1BI2 A;  2EA4 A;  4K2E A;  4UV8 A;  3PQJ A;  5CYV A;  3H3Z A;  1XMA A;  2O03 A;  3RKX A;  3C7J A;  2DQL A;  4N0B A;  3GYH X;  5H20 A;  4ASN A;  5DD8 A;  4HA8 A;  1ZYR F;  2A6E F;  1J7K A;  1U5T A;  2M45 A;  3DP7 A;  1OKR A;  1MD0 A;  3ZMU A;  2NNY A;  2H6C A;  3L2C A;  3HSR A;  1W4M A;  4AWX B;  2PEX A;  4G6Q A;  3T5X A;  5KK1 A;  3F6O A;  4FX4 A;  1H9T A;  4M9S A;  2M8E A;  5FLX Z;  2L01 A;  3MZY A;  1BJA A;  4U7D A;  2G7H A;  2DLL A;  4I7H A;  3WU0 A;  2PJP A;  2W84 A;  4RB3 C;  4YII A;  3U1D A;  5HDG A;  5LHI A;  2QEN A;  1J5Y A;  2V9V A;  3FM5 A;  3KEO A;  2HYF A;  1JHH A;  2J5O A;  3ZMZ A;  1R7J A;  2W85 A;  3R6S A;  3QU6 A;  4ESF A;  2KIU A;  4EQQ A;  1XSV A;  1U8R A;  4L9T A;  1AWC A;  4EM0 B;  4OMZ A;  3WE3 A;  1ZGJ A;  4WX9 A;  2JPC A;  2OA4 A;  4U88 A;  4OIO F;  2HTJ A;  1QO0 D;  5HLH A;  2HFH A;  3EDP A;  5CJ9 A;  1P4W A;  1XSD A;  2O3F A;  3ABT A;  4ZYH A;  2LF8 A;  3BZ6 A;  3CO7 C;  2XAQ A;  3JSP A;  2IT0 A;  4CZZ A;  5HLI A;  4L5J A;  4RB2 C;  3B02 A;  4UXN A;  1J9I A;  3R60 A;  3TO7 A;  1CGP A;  4YFN F;  3GX4 X;  5ILU A;  3IWF A;  1KYW A;  3BJA A;  3DFG A;  1ZN2 A;  1CF7 B;  4IXA A;  1I5Z A;  4GXO A;  1MJA A;  3K0L A;  3WTX C;  4G94 A;  5K1Y A;  3D5L A;  1IZ1 A;  3QP6 A;  5EEH A;  5LEJ A;  2IVM A;  4A0Y A;  5D8K B;  4LK1 F;  2F5D A;  3QOP A;  3GZ6 A;  1K78 B;  5H6R A;  3QRF F;  5CVV A;  3ZPL A;  1K79 A;  3KZZ A;  5HOO A;  4HDU A;  2VC0 A;  2CO5 A;  2P5K A;  2FBK A;  2FA5 A;  2VE8 A;  5IT9 Z;  1HW2 A;  4KIB A;  1WWX A;  1XDS A;  1F9N A;  2M87 A;  1TQM A;  4I09 A;  1YG2 A;  3ZQ7 A;  5AON A;  3LQQ A;  1XGO A;  4HBL A;  4IRI A;  1O57 A;  1GXQ A;  4EJU A;  1T98 A;  1W7P B;  4I0A A;  2R3S A;  2IJL A;  1SMY F;  4MTD A;  1BM9 A;  1GHC A;  2V6C A;  3JAM K;  3ZN0 A;  2DTR A;  5L3E A;  1B9N A;  2PLY A;  3GW2 A;  2Y0M A;  3MEX A;  2MLG A;  1PUE E;  2GAU A;  3H92 A;  4ZZD A;  3HUG A;  2FXA A;  2VXZ A;  6PAX A;  2GZW A;  3FXQ A;  3EUH A;  5D5U B;  4UUV A;  2QWW A;  3IL2 A;  4HF1 A;  4ZYE A;  4GGG A;  3KLN A;  4N9H A;  5HDN A;  2D1H A;  1OMI A;  3MWM A;  4B8X A;  1F4K A;  5FB2 A;  1Z7U A;  4XLP F;  4M74 A;  3GWZ A;  2O0Y A;  4ENN A;  1HKQ A;  3MZH A;  2ESN A;  1XGM A;  3RIR A;  1O3Q A;  4WCG A;  3ZN1 A;  1U5T C;  1SD5 A;  2YR2 A;  3VFZ A;  3T8T A;  4A0Z A;  1J59 A;  5L3C A;  2O61 A;  2CFX A;  1LNW A;  3TGN A;  1QGP A;  2YX4 A;  5JVT A;  1BI3 A;  3WOD F;  5LGN A;  4PZJ A;  2XAF A;  4U0Y A;  2EV0 A;  3L00 A;  1TBX A;  1S7A A;  5TRD A;  2WC2 A;  3LA2 A;  4ESB A;  3P9K A;  1QZZ A;  2COM A;  1ZG5 A;  4GYG A;  4IPA A;  1RZ4 A;  2K4B A;  2Y75 A;  3MAJ A;  3BWG A;  1XD7 A;  1J75 A;  1F1Z A;  4L9J A;  4P96 A;  1R5G A;  1OR7 A;  3O6B B;  1FOK A;  1MJB A;  5H6Q A;  2P6S A;  2G9W A;  2VBZ A;  4M6Y A;  2DFI A;  3EYI A;  4LB6 B;  5DD4 A;  4KIF A;  4QWQ A;  4KN7 X;  1I6X A;  2QVO A;  5D5W B;  1XN7 A;  1YQA A;  4IRH A;  3K2Z A;  1O3T A;  5ICF A;  3HSF A;  1S3J A;  4XRF A;  3BY6 A;  4QLC U;  5J8C A;  4WF2 A;  4H0E A;  2V1U A;  2CSO A;  2E1N A;  1PP7 U;  5ILS A;  4CO8 A;  4LG0 B;  5E8G A;  1B59 A;  3GUD A;  1LVA A;  1R36 A;  2L02 A;  3KZY A;  1R1V A;  4HOB A;  1R22 A;  2ISZ A;  4WXH A;  4M72 A;  2P5L C;  1J2X A;  1FBQ A;  5HDK A;  4L9N A;  2M1B A;  3NEU A;  2OD5 A;  1R1U A;  1QQI A;  1L3L A;  1R5H A;  5FFX A;  3FWE A;  3M8F A;  4IF4 A;  2ZME B;  3JAM Z;  2TDX A;  5D5X B;  4ENJ A;  5BMZ A;  2UXN A;  3L7W A;  1K7A A;  2HKX A;  2EFW A;  3RYR A;  4YFK F;  4WWC A;  2QQB A;  1TLH B;  2A61 A;  4LFU A;  1G3S A;  1IN8 A;  2NNN A;  2VOP A;  3GEZ A;  5E20 A;  3G3Z A;  3W6J B;  1OYI A;  2GWR A;  2RV8 A;  1Z05 A;  2OAZ A;  2FF4 A;  2IW5 A;  4ON0 A;  1FP2 A;  3BOQ A;  3DV8 A;  3P9C A;  2DU9 A;  2Z9O A;  2AS5 F;  1WKM A;  4RGX A;  2PBI A;  4KN4 X;  2GXG A;  3KLO A;  1IN5 A;  2R7F A;  1HST A;  3V7C A;  4BH9 A;  1UHM A;  1GVJ A;  3WU1 B;  1FP1 D;  3R4K A;  2OZ6 A;  1CF7 A;  2HKO A;  5LEK A;  4F7Z A;  4ZZL A;  3SFZ A;  4EJV A;  3HOS A;  1XDU A;  1W5S A;  4IVN A;  1IN6 A;  4JK1 X;  3HHG A;  2IPQ X;  1MDM B;  2ZXJ A;  3K1M A;  3VOE A;  2L4M A;  4Q4Z F;  3PFI A; 
#chains in the Genus database with same CATH topology
 4ZC3 A;  2WA0 A;  1FX7 A;  1MH3 A;  1TWF J;  2EIJ H;  3HXL A;  3R61 A;  1F43 A;  1QPI A;  2PMZ A;  2DQR A;  4R8H A;  5AIQ A;  3F21 A;  4A12 A;  3RTR A;  2HTS A;  1GV2 A;  2BYV E;  1PUF A;  1DPR A;  1XCV A;  4AC0 A;  1YI2 I;  1R58 A;  3OYI A;  2EBI A;  3N97 A;  3F3X A;  5DUK A;  2Q0O A;  1TWC J;  2LLK A;  3CUO A;  1ZRF A;  1SFX A;  3KP4 A;  2YU9 J;  1ZRD A;  2V26 A;  3M1E A;  2KMU A;  4XLN F;  3MD2 A;  4ETS A;  3J7A Y;  1IXC A;  5BPI A;  2KDO A;  5KAF C;  2R5Z B;  1XGS A;  4JP0 A;  2O8X A;  3I59 B;  2L7Z A;  2AHQ A;  4OOI A;  4D7N A;  2Z33 A;  3ZQH A;  3HOZ J;  2QLZ A;  1GT0 C;  4DQ2 A;  2JK3 A;  1W7P A;  2ZNY A;  3GO5 A;  2V1D A;  3H1C A;  1VQK I;  3S2H J;  4RDU A;  2EV5 A;  2LNB A;  3HEF A;  4IHT A;  1G2H A;  4G8X A;  3O8H A;  4UV9 A;  1OLT A;  2PJR A;  1OFC X;  3OS0 A;  1E2X A;  2NOJ B;  1F36 A;  3H9Q A;  2OU2 A;  2VJI A;  1JHF A;  1H89 C;  4A3J J;  3QQA A;  1OQY A;  2M8G X;  1FT9 A;  4AYB A;  1X19 A;  5LGT A;  3RJP A;  1B4A A;  4GRI A;  2R7V A;  1P4X A;  4I98 B;  1IRF A;  4QSH A;  2HVR A;  5LGU A;  4PCQ A;  2VOD A;  5ICC A;  2LRE A;  4D5F A;  4LG3 A;  4WK8 F;  1XS9 A;  3H9G A;  1G3W A;  2DA3 A;  2H6B A;  1B9M A;  5M5Y J;  4BE1 A;  4YFX F;  3CD6 I;  2PMH A;  2K9M A;  2B7E A;  3TMO A;  2XKP A;  3IAS 2;  1OR7 C;  3BJ6 A;  4GFB A;  1VQ5 I;  3SEZ A;  1YYV A;  3K1P A;  3MVP A;  2Y0S A;  2IA1 A;  1IUF A;  5FGM A;  3I5U A;  3SZG A;  2Z99 A;  2DYR H;  2L7K A;  2M7A A;  4DW6 A;  1RIO H;  1BOA A;  2AO9 A;  4BHC A;  4UHT A;  3J7A O;  1HDD C;  4CYD A;  1ETQ A;  1BI1 A;  3IH2 A;  4LIU A;  4MNU A;  4AIH A;  4F52 A;  5K7H A;  1D0Z A;  4HRI A;  3SZT A;  1Z6T A;  1MBE A;  1Y0U A;  3VEP A;  5L3B A;  1FJL A;  3CC2 I;  2GIV A;  3OYG A;  4KYW A;  5CVU A;  3ZXS A;  4EJW A;  3KCC A;  2E2J J;  2DA1 A;  3E1S A;  1V4R A;  1TWA J;  4LLL A;  4A3M J;  2HYG D;  1RR7 A;  3E7L A;  3L9F A;  3CP8 A;  4M9Z A;  3LAP A;  1FZP B;  1APL C;  1BI0 A;  1I39 A;  3ZMS A;  4XRS A;  2MW8 A;  4LB5 A;  4XBF A;  1YW7 A;  3B73 A;  3OL3 A;  3CJN A;  2QQA A;  2MFZ A;  2P5V A;  2H8W A;  3U21 A;  2IEK A;  2QKL B;  3F0C A;  4C3J J;  2FX0 A;  3ELK A;  3ERM A;  5J8F A;  1MNE A;  2DJI A;  2E2H J;  3CMM A;  4RMN A;  2EIM H;  3Q0V A;  2A68 F;  2KRC A;  1O7L A;  2E7W A;  5H2F C;  1VQL I;  4FET A;  3Q3S A;  5DV5 A;  2BY0 A;  2EWN A;  3K2A A;  4RAZ A;  2F4O B;  4P9F A;  5E17 F;  1DQU A;  3F72 A;  3LA3 A;  3TOB A;  1GLN A;  2GLO A;  4ZTF A;  4B09 A;  4ZTJ A;  5CVI A;  3FM3 A;  1P6R A;  3OS1 A;  3A0H C;  3FXR A;  4LLN A;  4RA2 A;  1TL8 A;  1HSJ A;  4OWR B;  1W5T A;  3VYS B;  2DTZ A;  2XSJ C;  1G3Y A;  4O5V A;  2GXA A;  4XMY A;  2VBY A;  3GZ5 A;  2OBP A;  5GAH J;  1V5E A;  4MEY F;  1Y0N A;  2ZBK A;  3ABU A;  3OWT A;  3KZI C;  3HOT A;  2VKH A;  1EF4 A;  3QOD A;  3QYE A;  3BTC A;  2Q8K A;  3TOA A;  3ULQ B;  1LDD A;  5IPA A;  3GVA A;  1S5L C;  1WFX A;  4NB5 A;  2GA1 A;  4D7M A;  2RQP A;  3H5N A;  4BAY A;  3J81 K;  5FRM A;  4A5M A;  4BS9 A;  1XTA A;  1WZ2 A;  1HKS A;  1YX5 A;  1BW6 A;  3BJO A;  5C4J J;  1V3F A;  1X1A A;  2HS5 A;  4Y33 A;  3OYL A;  1VQN I;  3E6M A;  5J4Y A;  4PJM A;  1K6O A;  4HSR A;  4C2U A;  2D2W A;  1ZG3 A;  1EH8 A;  5A2Q K;  3COA C;  1FSE A;  3QU3 A;  2VE9 A;  1PP8 F;  1IRG A;  1R9T J;  1YHQ I;  4DZP A;  1KU3 A;  1WRJ A;  1FYM A;  3PSF A;  1U0J A;  1YE9 A;  3J80 K;  2BBY A;  3CDH A;  1LUJ B;  3IH3 A;  3IWZ A;  2IRF G;  5BS6 A;  1BR4 A;  2Z5U A;  1ZH5 A;  3Q9V A;  1TW3 A;  1VZ0 A;  5F0H A;  1BR2 A;  1G8X A;  1UG2 A;  3LSP A;  1TQI A;  2A3S A;  1EH6 A;  2DOD A;  2VBX A;  5BQT A;  3QOE A;  3LSJ A;  2W00 A;  3OY9 A;  3MCZ A;  2K40 A;  3ISP A;  3C3W A;  5FO5 A;  1MSE C;  4CUG A;  1ZGA A;  4G6D A;  2V7F A;  4BJ5 C;  4ABZ A;  4Y4R A;  1YX3 A;  2ZCW A;  3G1O A;  3W6K B;  3OR1 C;  4LG0 A;  3WE2 A;  4UNO A;  1ZLJ A;  2DXI A;  4R1H A;  2H94 A;  2LDU A;  4Q47 A;  4A3F J;  3Q5F A;  2OJE D;  2BOL A;  3NAR A;  3GTQ J;  1S8N A;  1VI0 A;  3A03 A;  2IA2 A;  3ABM H;  3T0Y A;  2HOT A;  1RNL A;  1R23 A;  3BDD A;  1SC7 A;  1IXS B;  1NK3 P;  4B3A A;  2TCT A;  3R0A A;  4EJT A;  2VKV A;  3FBI B;  2ZFW A;  3FDY A;  4BQA A;  1DUX C;  1B8I A;  2HOS A;  4I01 A;  3P7N A;  4LMY A;  3CO6 C;  3HOY J;  3W2W A;  1ZAO A;  1H9G A;  3BG3 A;  3BTJ A;  3FX3 A;  3CJT B;  4UUT A;  1D8K A;  4XLC A;  4CIC A;  4C2T A;  1IRZ A;  1MSF C;  3VPR A;  3CLO A;  4M71 A;  1A31 A;  1KQ8 A;  4F91 B;  1SVM A;  1MKM A;  2DK5 A;  3H5R A;  3KET A;  1KU2 A;  2ZME A;  3KP5 A;  2P4W A;  1ORK A;  4BDZ A;  1FC3 A;  1ZKG A;  3Q9S A;  3IKT A;  2ZJR F;  2NVT J;  4JYK A;  2Y31 A;  5IT3 A;  3P9I A;  1ULY A;  1JUM A;  2XKO A;  2DT5 A;  1QA6 A;  5L3F A;  1HQC A;  3MKW B;  4PDK A;  3W3C A;  2OCC H;  3CCR I;  2FJ1 A;  3LSR A;  1R00 A;  3DTE A;  4HX4 A;  3HGY A;  3E5X A;  1DU6 A;  2XB5 A;  1BBY A;  5J1U A;  1YJ9 I;  3I9V 2;  3W2A A;  2DMT A;  2LVS A;  1KQ0 A;  2QZ8 A;  3IKV A;  3G4S I;  2L9S A;  3G1M A;  3BG7 A;  3GFI A;  2R7O A;  2QSG X;  5HS8 A;  1ACI A;  3IH4 A;  4IL6 C;  4IJA A;  4OIR F;  3ECH A;  5LFA A;  3IV5 A;  4A3I J;  4BXU A;  3S14 J;  5HOD A;  2MLK A;  2K86 A;  2R7D A;  2V79 A;  1U9N A;  3LWF A;  2L5Q A;  2DMU A;  2X6O A;  1TTY A;  4EAT A;  3M8J A;  2QYO A;  5JFR A;  3SJM A;  4F93 B;  4HV6 A;  3DTK A;  2P6T A;  3QPL A;  1P2F A;  3LFK A;  3GTO J;  1OYW A;  1AHD P;  3HC7 A;  1YIO A;  2L2O A;  4PGH A;  2L3D A;  1T0F A;  5HS7 A;  4GO1 A;  5C4X J;  5B1A H;  4NQW A;  1U78 A;  3QP5 A;  1H0M A;  1MMA A;  4QIW N;  2CMP A;  1XCB A;  2A6T A;  5F08 A;  1S29 A;  3G73 A;  4M6X A;  1PDN C;  4UB8 C;  5F64 A;  1SAU A;  3SZP A;  3WG9 A;  4B48 A;  3PQK A;  3KYL A;  1QPM A;  1TW2 A;  4XRM A;  5D6E A;  5F1J A;  2VBW A;  5FD5 A;  4XOR A;  2V9P A;  1GV5 A;  1PVE A;  3H36 A;  4E70 A;  2F48 A;  4ZYD A;  3EUA A;  2X6Y A;  3R0J A;  3ASN H;  4OIQ F;  2X85 A;  1DGR M;  5KHD A;  3M4O J;  2P8T A;  1Z1D A;  5LRR A;  1QZE A;  2P7C B;  2KZG A;  1VQ6 I;  2RGV A;  3HRT A;  3M8E A;  3U9G A;  2M30 A;  1X1C A;  3DF8 A;  1MDM A;  5E8I A;  1OCT C;  2DYS H;  3EPZ A;  1E0E A;  2UZK A;  2LY9 A;  1RI7 A;  4KIG A;  2LY2 A;  4LGW A;  3E6D A;  4U0W A;  1ZHF A;  1ONV A;  2RDP A;  4XRS G;  1A6I A;  2K4J A;  3T8R A;  1IDZ A;  3I4P A;  4UVC A;  2O9L A;  2VJ4 A;  2FQ3 A;  3D0S A;  4WXD A;  2LKP A;  3DLA A;  3N4M A;  5D8L B;  3BLY A;  2YU3 A;  4KNY A;  5ILV A;  2OTJ I;  3WTY C;  1NG7 A;  1D8J A;  1IUY A;  2EIK H;  3VB2 A;  2FMY A;  5ICE A;  1VQO I;  3VDX A;  5J1R A;  4Y13 A;  1YOV B;  2R5Z A;  4ZDL A;  1FBS A;  1I27 A;  1S7O A;  3I59 A;  5JR3 A;  2EJR A;  2HDD A;  2H8R A;  3F8N A;  3MKZ A;  4UY8 I;  4WXC A;  1BIB A;  3WGH A;  1EH7 A;  2LRD A;  2WY7 Q;  2CV1 A;  4L0Z B;  3J81 Z;  3KP7 A;  2CU7 A;  3U2R A;  5HLG A;  4E7J A;  4Q5S F;  4CGZ A;  1QHG A;  1XC5 A;  4OU0 A;  3ERE D;  4MHG A;  1T39 A;  4PFO A;  5EGO B;  4PSW A;  3HOV J;  3ZCO A;  2E2I J;  2JTV A;  1YS6 A;  2VI6 A;  2XAH A;  2UUZ A;  4RLF A;  2LBF B;  2XSD C;  2JRT A;  2HXI A;  4EGY A;  3MZ8 A;  2BHZ A;  2GOM A;  5CVJ A;  1D3Y A;  5IOZ A;  5A2Q Z;  1LFU P;  4II2 A;  5LLQ A;  1TP4 A;  3DXJ F;  4IEJ A;  3S3M A;  3KP3 A;  1QNT A;  2XV4 S;  3L09 A;  2KJB A;  1ODD A;  2HGC A;  2R4G A;  4HLX A;  5L3D A;  3BTL A;  3PL8 A;  4CHU A;  2DA5 A;  4EMS A;  3J80 Z;  2F2E A;  5BOX A;  2XIG A;  3GLX A;  4KIC A;  4XID A;  4RB0 A;  4CSW A;  5BPD A;  2KT0 A;  2NOG A;  2X0L A;  3ZR8 X;  3BCA A;  2LK2 A;  3DPT A;  4NDL A;  2W25 A;  3V8K A;  5D4S A;  2HEO A;  4OAZ A;  4XSZ F;  5JLX A;  1KU7 A;  3FMQ A;  1ZGW A;  5DM6 F;  4F92 B;  4M9X A;  2YSR A;  1S6L A;  1XB4 A;  2YX7 A;  1G3T A;  4DNC A;  3JRC A;  1B8I B;  1RKW A;  3OSF A;  4ITV A;  4LJZ F;  4Z2Y A;  4AIK A;  3ZMT A;  2EFP A;  2HQN A;  4OIN F;  3EYY A;  5AIP A;  2C6Y A;  2ETH A;  1JGS A;  2BE5 F;  1LB2 A;  4HLY A;  4E7S A;  1D0X A;  1JT0 A;  4NHJ A;  1YW9 A;  5JHU A;  1A35 A;  4QTR A;  2FQ4 A;  4BHB A;  3CUQ B;  3CJQ B;  3I0T A;  1LJ9 A;  1Z91 A;  2DW4 A;  1KQ9 A;  3OYA A;  2OPT A;  4HZF A;  3M7G A;  1YFH A;  3JTG A;  2CG4 A;  3V7R A;  2KRH A;  1HW1 A;  4RLQ A;  4A5N A;  3ASO H;  4U0V A;  1XMK A;  2E7X A;  4IHV A;  2HOA A;  3NQO A;  1ON1 A;  3BPV A;  2DAO A;  5B1B H;  4KIT B;  1FLI A;  3K4M A;  4XLH A;  1ZLK A;  2CGP A;  1NTC A;  2NYX A;  2ISY A;  3LL7 A;  3RI4 A;  2GXB A;  1FMW A;  1FIP A;  2VPL A;  2Q2E B;  4XR6 A;  5B3S H;  1WJB A;  3RQI A;  1U6G A;  2WAD A;  2Y9Y A;  2R7R A;  4HAM A;  4FAS D;  3LAJ A;  3KX2 A;  2MGQ A;  2RN7 A;  1GUU A;  3J7Z I;  5IP9 J;  5LD2 C;  4HV5 A;  2HYJ A;  2KKO A;  3H3V K;  5LHH A;  2R92 J;  2EIN H;  2VC1 A;  3N05 A;  1Z9C A;  2IGK A;  3U1K A;  3OOU A;  1Q1H A;  2ID3 A;  2BHY A;  4BE0 A;  2DCE A;  3CCM I;  1K6Y A;  3OIP A;  3DKW A;  5M3F J;  3S1N J;  3K4J A;  3RPU D;  1BC8 C;  2IA0 A;  2ZB9 A;  2WTE A;  2ACJ A;  3PFY A;  3GFM A;  5F1R A;  2ZJQ F;  5TIS C;  2Y48 A;  3NAU A;  3X2Q H;  3ZQI A;  4A2U A;  4CCJ A;  1IAW A;  1YRN B;  1Z6R A;  1PJR A;  2VXD A;  3RDI A;  4Z6Y A;  5HS9 A;  4P5O A;  2ZME C;  2QEX I;  2K5C A;  1D1C A;  4EM2 A;  2EA2 A;  2EZK A;  3BR2 A;  3K1N A;  4KFC A;  1AU7 A;  2DOF A;  3CDL A;  3HJE A;  3O3K A;  1UCR A;  3PUB A;  4OMY A;  3T1B A;  2STT A;  1YJN I;  3LSK A;  2CQK A;  3BRO A;  4MFD A;  3MKY B;  4ZYA A;  2AXL A;  4MGR A;  2F5E A;  4S05 A;  1JI8 A;  2WAF A;  2PG4 A;  1G4D A;  5EEG A;  3AG2 H;  3JSO A;  4J19 A;  3OMY A;  4IHW A;  3HGG A;  1OIS A;  2MSY A;  2WAQ N;  3BG5 A;  3UR3 C;  1T56 A;  3PJR A;  5FJ8 J;  4DYQ A;  4J01 A;  4O3M A;  3JRF A;  2R5Y B;  1ETV A;  4HNU A;  3CC7 I;  5FFZ A;  1JKR C;  3A01 B;  1DPU A;  3PIP F;  2DT7 B;  1SD7 A;  3HIF A;  3FIS A;  2DT6 A;  2FBH A;  3KIO A;  3DPL C;  3WTV C;  1ZAR A;  1WPK A;  1ON2 A;  4DYR A;  1SD6 A;  3VSK A;  2ZXH A;  3M07 A;  4Y7N J;  4TV7 A;  4MQV A;  4E7I A;  3BG9 A;  2VB6 A;  3K4N A;  4RGS A;  4KT6 A;  5J3L A;  1ZRE A;  1T0F C;  2DA4 A;  2FSW A;  1QBJ A;  3GXO A;  3TW7 A;  4FX0 A;  3TQN A;  1LDJ A;  4JBA A;  3K69 A;  2HQ5 A;  1P7I A;  3OR2 C;  4HPQ A;  3JRG A;  2ECB A;  1DP7 P;  3ZOB A;  1X2N A;  2O5R A;  3WGI A;  3JW4 A;  5DS9 A;  3DEU A;  3E5Q A;  3K4K A;  1RUO A;  2X48 A;  3QPT A;  2YS9 A;  3Q0U A;  3HOX J;  5L3G A;  3HL2 A;  3WTU C;  2K27 A;  1D5V A;  4A3L J;  4XK4 A;  3KEQ A;  2NRA C;  2HQR A;  2OQR A;  4P55 A;  2PN6 A;  1SFK A;  2VQC A;  1KA8 A;  5DCF A;  3TO6 A;  2XDV A;  1FY7 A;  2OZU A;  1JXS A;  5KAI C;  1IW7 F;  2MD0 A;  5HLT A;  4HF2 A;  2RKH A;  2FBI A;  3RKY A;  1RPW A;  5DCM B;  3V7S A;  3V42 A;  4AM3 A;  1YTY A;  5FKL A;  2FRH A;  3LMM A;  3V4G A;  1KU9 A;  1SFE A;  3F8F A;  4GCV A;  3ZMD A;  4CXF A;  2HI3 A;  4HQM A;  3FMR A;  4CDG A;  4A6D A;  4HNV A;  2P0W A;  2H27 A;  2RVC A;  5B66 C;  2EFQ A;  4QPO A;  4JOM A;  1MMN A;  3CF2 A;  3WGG A;  4KDP A;  3MQ0 A;  4L18 B;  1TT5 B;  2QGU A;  2M5W A;  1VQ4 I;  3LSH A;  3IP4 B;  1G6N A;  5KVR A;  3S8P A;  3HHH A;  4ZJZ A;  2DI3 A;  3OYJ A;  1IN4 A;  4ENK A;  1BOB A;  4G7O F;  4U7B A;  3KP6 A;  2A69 F;  4AIJ A;  1A36 A;  3RYP A;  3K70 C;  3HKZ N;  2DJN A;  1B72 B;  3H3U A;  1UEL B;  2KP6 A;  3GF2 A;  3F22 A;  2MYS A;  3E6B A;  2JJ7 A;  2BY2 A;  3C2B A;  4ZH4 F;  4F55 A;  3LFU A;  5DUI A;  5B5E C;  4W97 A;  1FYL A;  1SVL A;  2HWV A;  1BW5 A;  4Y15 A;  2ZJ2 A;  4G6T B;  3O2P E;  2NS0 A;  2XAJ A;  2CH0 A;  4PGG A;  1FMV A;  1VF9 A;  2QM3 A;  2LR8 A;  4IRG A;  4XN0 A;  3HOU J;  2L54 A;  3I53 A;  1J0R A;  1O3R A;  1C0W A;  2B63 J;  3UKG A;  3HBL A;  1A6Q A;  5GP9 A;  2XAG A;  1U8B A;  4XN3 A;  2XHK A;  5KCM A;  4ESJ A;  1XGN A;  1X3U A;  4YIF A;  2JA7 J;  1FEX A;  3JRI A;  3C1D A;  4RAY A;  3F23 A;  1LEB A;  4P9U A;  5CPR B;  2KIM A;  2CV2 A;  3HDD A;  2P7V B;  2OV7 A;  3GTJ J;  3I58 A;  3TP3 A;  5CLS A;  3OV8 A;  3HYI A;  3GFJ A;  3K7A J;  3IRR A;  5D4R A;  1MMD A;  3QAH A;  2LSO A;  5DEQ A;  2OTL I;  3F8B A;  2E5Z A;  3PM1 A;  4BY7 J;  1TWH J;  5E3L A;  4XOP A;  3HB9 A;  2YPR A;  2JA8 J;  3VOD A;  5C3E J;  3CLQ A;  3FXM A;  5CQE A;  3QPH A;  2JVH A;  3KE2 A;  1OCC H;  2NS7 A;  3WTS C;  1WVR A;  4G7Z F;  1MBH A;  2EQR A;  4GDF A;  2QBY B;  1YLF A;  4A0X A;  5E3O A;  3RKW A;  2ICW G;  1T6S A;  2CS3 A;  1Z21 A;  2HVS A;  5CKT A;  2G0E A;  1Z0X A;  2VON A;  1SMT A;  1FNN A;  2F5F A;  1W0T A;  1P4A A;  1R6R A;  3ZQL A;  1SFO J;  2CW7 A;  5E1W A;  1KZH A;  2BY3 A;  3JRB A;  3C18 A;  4IHS A;  2H09 A;  3LNQ A;  1OCZ H;  4L0Y B;  2H1K A;  3BPX A;  3BP8 A;  2QCO A;  2FE3 A;  2MC3 A;  2RNJ A;  1R71 A;  3AL0 B;  1TNS A;  3EET A;  3LST A;  4I0B A;  2J5P A;  5J40 A;  5EG0 B;  4RS8 A;  3AAF A;  3LQR A;  1VQM I;  4BAC A;  3DKY A;  3O8G A;  4D0P A;  1DDN A;  5K5O A;  1JTX A;  3PO3 J;  1SAN A;  3CMA I;  1Y1V J;  1NHA A;  2CQ7 A;  4KT5 C;  2MH9 A;  3ZMV A;  3TL4 X;  4ENM A;  3ZP5 A;  2M2E A;  3E97 A;  1B6A A;  3WTT C;  1VTN C;  2M0C A;  2VN2 A;  3P5J A;  4MQ9 F;  5HVQ C;  1IC8 A;  4M3F A;  1NK2 P;  5EGO A;  1WJC A;  5GTI C;  2F5C A;  4BEH B;  2E1C A;  1UHS A;  4HF0 A;  5J6X A;  1HBX G;  2BY1 A;  2LBF A;  2AQE A;  2PFB A;  1XG1 A;  3LOC A;  1OJL A;  1DU0 A;  4EEF G;  1VQ9 I;  2WBM A;  3NWS A;  2DFH A;  3GTG J;  3EQL F;  1TC3 C;  2ZXW H;  4HEA 2;  3BR5 A;  4MTE A;  1FSH A;  5CVR A;  1QRY A;  2LTP A;  1OPC A;  4CCN A;  5C44 J;  3A2K A;  1UFM A;  2BVM A;  4PFP A;  1ZR2 A;  3IC7 A;  1T95 A;  3H9J A;  2HR3 A;  2L7F P;  3F8C A;  4I02 A;  3D5R C;  2ESH A;  4HQE A;  2X4H A;  4M3D A;  1TQP A;  3BCB A;  3ECO A;  1ZG1 A;  1YO5 C;  4M73 A;  5J1Y A;  2DBB A;  1OYY A;  1RET A;  4CCL A;  1IV6 A;  3GFL A;  4G7H F;  1UST A;  2Y30 A;  4XIC A;  1TZL A;  4N4N B;  4UUS B;  1GXP A;  2IGO A;  5FKM A;  1LE8 B;  3W6V A;  1XSX A;  1I1S A;  1U5T B;  3HPG A;  3S15 J;  3HRS A;  3FZV A;  2A5W A;  3NRV A;  2BXZ A;  1T8I A;  3JTH A;  1K83 J;  4M3E A;  2GM4 A;  2A6H F;  2V1N A;  1XMX A;  5IYB J;  1OCR H;  4OIP F;  1W36 D;  1IDY A;  3OOP A;  1RUN A;  3CTA A;  5K7F A;  2KL4 A;  2DFF A;  5D6F A;  2JQ7 A;  3ROU A;  2E71 A;  2CW8 A;  4RM3 A;  3CUQ A;  4XOT A;  1LPQ A;  3PO2 J;  3FXK A;  4DZJ A;  5FKN A;  5TJJ A;  2XAS A;  1U2W A;  2XGD A;  3FKJ A;  5EZG A;  4RB1 A;  1JTY A;  5LRS A;  4H4K C;  4NNJ A;  1WJF A;  3JRA A;  4X0G A;  1ETY A;  3BQY A;  3LSG A;  3FHZ A;  5F6F A;  1BIA A;  2LOO A;  5F04 A;  1LEA A;  3BR6 A;  3KFW X;  5D5V B;  1SFU A;  2JA6 J;  3IRQ A;  4RGR A;  3KPH A;  4OAY A;  3WTZ A;  1ZRC A;  1REP C;  2Q2E A;  1I1G A;  2Z2S B;  4PJ0 C;  3W2V A;  4UVB A;  2D1V A;  3HTU A;  5HNH A;  1QU3 A;  1YIT I;  2KIF A;  2LD5 A;  1HC8 A;  4AUX A;  4KUM A;  1RKT A;  4E7Z A;  1HCR A;  2HOE A;  2CWE A;  5E18 F;  3F6V A;  2ADU A;  3ABL H;  1R5I D;  2WB1 N;  2OCE A;  2R0Q C;  3I56 I;  2I10 A;  4KA4 A;  2WWY A;  4XON A;  5K5Q A;  2KIQ A;  4E7H A;  2JVG A;  4AVP A;  4C3I J;  4EV0 A;  4R79 A;  2L4A A;  1IJW C;  2DPU A;  2Y9Z A;  1F5T A;  1IF1 A;  2IS2 A;  2EH3 A;  4DBQ A;  1LDK B;  2GA2 A;  2BZT A;  4MFE A;  1AKH B;  3GTM J;  1XX5 A;  2FEZ A;  2K85 A;  4CYC B;  4GYI A;  1USS A;  1P92 A;  1YS7 A;  2FOK A;  2VKE A;  4EM1 A;  2E60 A;  1YRN A;  4IOC F;  3H0G J;  1U3E M;  3E6C C;  4AID A;  3CQZ J;  1RR8 C;  3GBG A;  1LKX A;  2X1E A;  2XGX A;  2DO7 A;  2JUG A;  2JT1 A;  3FF5 A;  2X6X A;  2LF7 A;  4XSX F;  9ANT A;  4EVI A;  1FYK A;  1BR1 A;  3HTS B;  2BV6 A;  1MBG A;  2FNA A;  1X58 A;  3I55 I;  4BHP A;  1FPQ A;  2PMZ N;  4D5C A;  2KJC A;  2ZKZ A;  3KP2 A;  2EIL H;  2DA6 A;  1SAX A;  3GZN B;  1Z77 A;  1BJZ A;  4A3G J;  1IXR C;  2NXN B;  2UWM A;  4Y17 A;  2R5Y A;  1E3P A;  1WI9 A;  3QWL A;  2ME0 A;  4BQN A;  3JRE A;  3CJR B;  4LOC A;  3HM5 A;  3A01 A;  4LIT A;  4BDY A;  2VLA A;  1POG A;  3J7Y J;  2XRO A;  1R1T A;  4V19 K;  1ENH A;  2RAE A;  2IS4 A;  3K9T A;  5FKK A;  5F0F A;  2CYY A;  4AU7 A;  2R7Q A;  2NAZ A;  2XPV A;  1HW5 A;  1BN5 A;  3LA7 A;  4EJO A;  5IYD J;  1ZTR A;  4E6K G;  1EV7 A;  4B3X A;  1DGW Y;  2XUB A;  3V8J A;  3IHU A;  1WSU A;  1H88 C;  1CQT A;  1Q1V A;  3GME A;  3KEY A;  2EFN A;  4KMU X;  3SQN A;  2DK8 A;  1ZQ3 P;  2STW A;  2FNP A;  3WTW C;  4FHT A;  2UXX A;  2NS8 A;  4HW0 A;  3ZQG A;  2M9H A;  4ZYG A;  1L0O C;  4S0H B;  5DYM A;  4G9Y A;  1FBU A;  4AYB N;  1IN7 A;  1IRX A;  4YEL A;  1WI3 A;  2PMU A;  1EKE A;  2EV6 A;  2Q1Z B;  3TDZ C;  1M1E B;  5FLX K;  5EDN A;  1A04 A;  5FD6 A;  4RAG A;  4LD5 A;  2E1M B;  2IP2 A;  2XRN A;  2ZNZ A;  4JX5 A;  2O6G E;  3FBN B;  5DCM A;  4O6J A;  3SDG A;  1QVT A;  2JSC A;  4XKB A;  1HXD A;  3PIO F;  3S1R J;  4BQO A;  3SHF A;  3KYD B;  2G7U A;  3HRM A;  3I54 A;  5ICG A;  3RKQ A;  3D1N I;  1MNM C;  2Y0S N;  2XGC A;  3DKX A;  3FXU A;  2XB0 X;  2CJJ A;  3FMS A;  2K3F A;  2BXY A;  2K02 A;  5HNF A;  2DMQ A;  1AA7 A;  3TDU C;  1O3S A;  2W82 A;  2RC4 A;  3I64 A;  2BEO A;  1WCM J;  2I5U A;  3DBL B;  2WV0 A;  4FT8 A;  3HSE A;  5ERI A;  2XF6 A;  5E1Z B;  1MJ9 A;  2MA3 A;  4MIM A;  2CV0 A;  1WJ5 A;  1JE8 A;  4U87 A;  3GTK J;  1Y8R B;  3WHB A;  4ZDO A;  1P9Q C;  4YEJ A;  4S04 A;  4PJJ A;  4AD9 A;  1MBJ A;  2D45 A;  2ZC2 A;  4FCY A;  4L5I A;  4BYY A;  1FWZ A;  2Y2Z A;  3HG9 A;  2R93 J;  2Z1D A;  4JX4 A;  1K61 A;  1B72 A;  2FU4 A;  2Z16 A;  1E17 A;  1O7F A;  5EYR A;  4HYE A;  2GOX B;  2QQ9 A;  1X4P A;  1G59 A;  2GQQ A;  2EFO A;  2HQA A;  3M9A A;  4JQF A;  2PI0 A;  3HUG B;  1ETW A;  3SXY A;  2DOA A;  1T38 A;  1AOY A;  1HKT A;  3OYM A;  2X1C A;  2JZY A;  1W1W E;  3VSL A;  1TWG J;  3BC8 A;  1QZY A;  4KMF A;  3TO9 A;  4RGU A;  2DPD A;  2CW0 F;  2BGC A;  2B0L A;  3RPQ A;  2ELJ A;  2HDC A;  3F8M A;  5JHF A;  1HF0 A;  4EGZ A;  2FUG 2;  2XRL A;  2KPM A;  3OSG A;  4UB6 C;  1MIJ A;  3CCY A;  2PQ8 A;  3E3V A;  2K7L A;  3Q0W A;  1Z3Y A;  4C3H J;  2EB7 A;  4HDV A;  1LFB A;  2OQG A;  2W7N A;  1N75 A;  3TKY A;  3S1M J;  2KRF A;  5J47 A;  1KGS A;  2FML A;  4J00 A;  3E0J B;  3E5U A;  1MGT A;  1Y1W J;  1S9H A;  2MH2 A;  3BR0 A;  3REO A;  2CUZ A;  2IGM A;  2A5Y B;  4BNC A;  1JKP C;  3ZQF A;  1SD4 A;  2W24 A;  1B1B A;  4CA0 A;  4YG2 F;  4Q48 A;  2V1X A;  1IG7 A;  1I3Q J;  4I2O A;  2JA5 J;  4L9V A;  1Z67 A;  2PX9 A;  2ELH A;  2M7B A;  4DIQ A;  2QBY A;  1FTT A;  5ED4 A;  3AG3 H;  1ETK A;  5E1X A;  1UMQ A;  3MFK A;  2IS1 A;  1BC7 C;  4C30 A;  2M34 A;  2ID6 A;  2VT2 A;  2W57 A;  2VKD A;  1ETO A;  1KYZ A;  1MZB A;  4AVZ A;  3JRD A;  5KNL A;  4FE7 A;  4N9I A;  3TW6 A;  4PJN A;  1HA8 A;  1N25 A;  4KJZ A;  4IKF A;  3CUQ C;  3QPS A;  1EJ9 A;  2ZSH B;  1SEU A;  5DM7 F;  1QHH D;  4MO7 A;  5JI6 A;  3M3Y J;  1U9O A;  2XVC A;  5EG0 A;  2JPB A;  1LVK A;  1E3H A;  1T2K A;  2MBF A;  4I6Z A;  1STZ A;  5LBQ A;  1YW8 A;  3S2W A;  3RPU A;  1UHW A;  1ZEL A;  2HPI A;  3OYE A;  1Y39 A;  5IT9 K;  5EF6 A;  1LQ1 A;  1WQ2 A;  1X1D A;  4B43 A;  3A1Y A;  2K9L A;  4HX7 A;  1TNT A;  1UB9 A;  4NBQ A;  1XPX A;  2A07 F;  3FXJ A;  2QUF A;  4LLG F;  2VOO A;  2CUJ A;  2AXT C;  4MEX F;  3ML6 A;  1W5C C;  3I71 A;  2VT3 A;  4XKC A;  2ZO4 A;  2HZT A;  2JSP A;  4UVA A;  2P81 A;  3DCF A;  3CCU I;  2EK5 A;  2LY1 A;  3FXO A;  4BEH A;  1K78 A;  2XPU A;  4A3E J;  4KIS A;  3HRU A;  2UV1 A;  4HX8 A;  4XLA A;  5DDG A;  5FLM J;  3CME I;  5LHG A;  2MD5 A;  3V8L A;  3AFH A;  2COB A;  5K5R A;  1W7P D;  2CQN A;  2Z3Y A;  4LK0 F;  2LFB A;  4A6E A;  1WHU A;  4CCM A;  1D5Y A;  5GAG J;  3DQV C;  4A3D J;  4F3Q A;  3H5A A;  4NC8 A;  2LH9 A;  1BI2 A;  2EA4 A;  4K2E A;  1SVO A;  4UV8 A;  3PQJ A;  5CYV A;  1X1B A;  3H3Z A;  1XMA A;  2O03 A;  3RKX A;  3C7J A;  5FLV A;  2DQL A;  4IHY A;  3SDB A;  4N0B A;  4ANJ A;  4M3B A;  3GYH X;  5H20 A;  3FK7 A;  3BT9 A;  4ASN A;  4CZC A;  2NVQ J;  5DD8 A;  4HA8 A;  1GDT A;  4B1R A;  4UUS A;  1ZYR F;  4XLE A;  3K4C A;  4XNF A;  1LE8 A;  2A6E F;  2HU9 A;  2VAS A;  1J7K A;  1U5T A;  2AQF A;  2M45 A;  3DP7 A;  2K9S A;  1IO2 A;  4BXX J;  1YJW I;  4PJL A;  1OKR A;  4A93 J;  3BZK A;  5EJC A;  1MD0 A;  3OIO A;  3ZMU A;  1IV8 A;  3M1C A;  2NNY A;  3BR3 A;  2CQQ A;  3FK6 A;  2H6C A;  2QSF X;  3L2C A;  3HSR A;  1W4M A;  3IUO A;  4N4O B;  4IQJ A;  2ZFU A;  3VWB A;  4AWX B;  4HG2 A;  5DTD A;  2D5V A;  2PEX A;  4G6Q A;  3T5X A;  5KK1 A;  1S7E A;  1X1P A;  4MLO A;  4YRV A;  3F6O A;  1TT0 A;  4FX4 A;  1H9T A;  4M9S A;  2JMW A;  2ELK A;  2M8E A;  3S2D J;  1P7J A;  5FLX Z;  2L01 A;  2BVL A;  3MZY A;  5M3M J;  5JVG F;  1BJA A;  3DEE A;  4U7D A;  4C2M J;  4BE2 A;  2EZI A;  2G7H A;  2L9N A;  1LFP A;  1FOW A;  1MH4 A;  2DLL A;  3OYH A;  1NG6 A;  4I7H A;  3WU0 A;  2PJP A;  2W84 A;  5FRN A;  4BU2 A;  4RB3 C;  4YII A;  2F4M B;  5HDG A;  3U1D A;  1HLV A;  5LHI A;  2QEN A;  3K10 A;  1J5Y A;  2V9V A;  3FM5 A;  1X4O A;  3KEO A;  2DDA A;  2KHM A;  2L0K A;  3CCE I;  1H8A C;  2L9V A;  2HPM A;  2HYF A;  1JHH A;  2J5O A;  3ZMZ A;  2VUM J;  4LIV A;  1R7J A;  3AG4 H;  3VYT B;  2JWT A;  5IOY A;  2W85 A;  3R6S A;  3QU6 A;  4ESF A;  2KIU A;  4EQQ A;  5IP7 J;  1XSV A;  2V9K A;  1U8R A;  2FOW A;  3S32 A;  4L9T A;  1AWC A;  4EM0 B;  4OMZ A;  3WE3 A;  2XPW A;  4FQG A;  1ZGJ A;  2DA7 A;  1AKH A;  3WG7 H;  1RES A;  2OUM A;  4CYC A;  4WX9 A;  2BW3 B;  1A5J A;  4DOZ A;  2JPC A;  2OA4 A;  4U88 A;  3OL4 A;  2LKS A;  4OIO F;  2HTJ A;  2NVY J;  3OIQ A;  2KLO A;  1QO0 D;  3G2B A;  2DFE A;  5HLH A;  2HFH A;  3EDP A;  3EUK L;  5CJ9 A;  1P4W A;  3OS2 A;  4DYC A;  2DMP A;  1XSD A;  2O3F A;  3LSM A;  3ABT A;  4ZYH A;  4BGD A;  4I76 A;  1OCO H;  2LF8 A;  5EZH A;  3CCL I;  2RQQ A;  3BZ6 A;  3CO7 C;  2XAQ A;  3JSP A;  2IT0 A;  4M3G A;  4CZZ A;  3PNT A;  5HLI A;  4L5J A;  3S17 J;  2VJ5 A;  4NC6 A;  1GVD A;  4BQQ A;  3L2W A;  4RB2 C;  1MND A;  2NVU B;  1Z3X A;  3B02 A;  2KDZ A;  2LG4 A;  1VQP I;  2Y69 H;  2RRE A;  4UXN A;  4A3C J;  3C2G A;  2M4K A;  1J9I A;  2QSH X;  3R60 A;  2DDB A;  3TO7 A;  4IZZ A;  1CGP A;  4A3B J;  4YFN F;  3GX4 X;  5ILU A;  3IWF A;  2V6E A;  3S1Q J;  2H1L A;  1KYW A;  1V55 H;  3BJA A;  4IHX A;  1WJD A;  3CCS I;  3DFG A;  1ZN2 A;  2DMN A;  3OYC A;  2R7X A;  5FKO A;  3L1P A;  1I50 J;  2O7O A;  3DTI A;  1CF7 B;  4IXA A;  1I5Z A;  2MAB A;  3HZJ A;  4GXO A;  1MJA A;  2EZH A;  3DBR B;  3K0L A;  4G94 A;  3ZGK A;  3WTX C;  5JLW A;  2R7W A;  5K1Y A;  3D5L A;  1IZ1 A;  3QP6 A;  4E4H A;  3CMY A;  3S3O A;  1K4S A;  3B6C A;  5EEH A;  5LEJ A;  2IVM A;  3A02 A;  4A0Y A;  2QQ8 A;  5D8K B;  4II3 A;  4LK1 F;  5M5W J;  2F5D A;  3QOP A;  4BL0 B;  3PNV A;  1R49 A;  3GZ6 A;  3JCU C;  5GAE J;  1OCP A;  1K78 B;  5H6R A;  2ECC A;  1VQ8 I;  3QRF F;  1W0U A;  3OYD A;  5CVV A;  3FXL A;  3ZPL A;  1K79 A;  3KZZ A;  5HOO A;  4HDU A;  2K9Q A;  2VC0 A;  5GPA A;  3AKZ A;  2CO5 A;  2P5K A;  3UNG C;  2FBK A;  3CES A;  2FA5 A;  2VE8 A;  5IT9 Z;  2WAQ A;  2IGN A;  1PUF B;  1HW2 A;  3DPU A;  4KIB A;  3HOW J;  3DEW A;  1WWX A;  1XDS A;  4B4C A;  4A69 C;  1F9N A;  3K4L A;  2M87 A;  2QKM B;  1BA5 A;  2HXO A;  4E7L A;  3WU2 C;  4NUB A;  3DU5 A;  1EA3 A;  4BBS J;  1KON A;  1TQM A;  2X1D A;  4I09 A;  1YG2 A;  1BL0 A;  1V5G A;  3H0D A;  5M5X J;  2W4S A;  3ZQ7 A;  5AON A;  3OYB A;  1MMS A;  2RNG A;  3LQQ A;  1XGO A;  2IXS A;  5BNG A;  4HBL A;  4IRI A;  3TP0 A;  1O57 A;  1GXQ A;  5TGT A;  5E79 C;  4IO9 F;  2YUS A;  4EJU A;  1T98 A;  1W7P B;  4I0A A;  1ITY A;  2R3S A;  2IJL A;  1SMY F;  4MTD A;  1BM9 A;  1GHC A;  3FKI J;  3AL0 C;  2V6C A;  1R4M B;  3ZN0 A;  4XM3 A;  3JAM K;  4C9Y A;  2LKX A;  1I3A A;  2DTR A;  5L3E A;  1B9N A;  2PLY A;  1VFC A;  3GW2 A;  2Y0M A;  3MEX A;  2PJR B;  2E5N A;  2JN6 A;  2L9R A;  2MLG A;  5J4V A;  4IOA F;  3CZ6 A;  1JUP A;  1PUE E;  2GAU A;  3H92 A;  2M0M A;  3HUG A;  4B44 A;  4ZZD A;  2FXA A;  2VXZ A;  3TBI A;  2TRT A;  1HOM A;  3IAM 2;  2KQR A;  2GBY A;  2W48 A;  4D9J A;  6PAX A;  2GZW A;  3BG6 A;  4W1U A;  3FXQ A;  2K9N A;  2JA2 A;  2XF7 A;  1JGG A;  3NWT A;  3EUH A;  3FIW A;  5GPC A;  5D5U B;  3CCQ I;  4UUV A;  4CCK A;  2QWW A;  2R7Z J;  2I8D A;  3IL2 A;  4HF1 A;  4ZYE A;  2MG4 A;  4GGG A;  3KLN A;  4N9H A;  3G71 I;  2EZL A;  5HDN A;  1WJA A;  2X51 A;  2D1H A;  2F6C A;  1OMI A;  1V54 H;  4X1E A;  3MWM A;  1O4X A;  2E19 A;  4B8X A;  1F4K A;  5FB2 A;  2XC7 A;  4XQF A;  1UAA A;  1Z7U A;  4XLP F;  1YIJ I;  4M74 A;  3GWZ A;  2O0Y A;  4ENN A;  1HKQ A;  3MZH A;  3VYR B;  2ESN A;  2FD5 A;  4NC7 A;  1XGM A;  3RIR A;  1O3Q A;  1ERD A;  4WCG A;  3HKZ A;  3L2U A;  4A3K J;  2VQL A;  4B47 A;  3ZN1 A;  1RRJ A;  1U5T C;  1PYV A;  4Y3O A;  1SD5 A;  2YR2 A;  4HNT A;  3VFZ A;  3T8T A;  4A0Z A;  1FOY A;  1J59 A;  3D5S C;  5L3C A;  2O61 A;  2CFX A;  1LNW A;  2F4I A;  3TGN A;  1QGP A;  2YX4 A;  5JVT A;  2X6W A;  1BI3 A;  2KFD A;  2ZSI B;  5F27 A;  1J09 A;  3WOD F;  5LGN A;  3ABK H;  2O8K A;  4PZJ A;  2XAF A;  4BJ6 C;  2VQG A;  4U0Y A;  4D1Q A;  3I4M J;  4CCO A;  3CC4 I;  2VPR A;  3JR9 A;  2VIX A;  4I99 C;  2EV0 A;  1Y6I A;  3HPH A;  3L00 A;  3H35 A;  1TBX A;  3OYF A;  3KYC B;  5E3N A;  2CFO A;  1S7A A;  4XKV A;  3ONQ A;  5F0C A;  5TRD A;  3ZRG A;  2WC2 A;  3LA2 A;  2XGE A;  2ZXI A;  2M4G A;  3MKL A;  4ESB A;  3P9K A;  3C2H A;  3I3L A;  3JRH A;  2X9D A;  1QZZ A;  4YIR X;  2COM A;  3A0B C;  3S3N A;  1ZG5 A;  3K70 D;  3MN2 A;  3G1L A;  3PNY A;  4GYG A;  4IPA A;  2KZV A;  1RZ4 A;  2K4B A;  3S93 A;  5IP6 A;  2V4J C;  1N77 A;  2Y75 A;  3MAJ A;  3BWG A;  3OYN A;  2WY8 Q;  1XD7 A;  3F9K A;  1J75 A;  1F1Z A;  4L9J A;  2IS6 A;  4P96 A;  1R5G A;  1ETX A;  1OR7 A;  3O6B B;  5IYC J;  1MJB A;  4XKW A;  5EEA A;  1FOK A;  1I6H J;  5H6Q A;  4BUP A;  2P6S A;  1N78 A;  3A4C A;  2G9W A;  3CDI A;  3GTP J;  2VBZ A;  4M6Y A;  2CRG A;  2W1O A;  2DFI A;  4BBR J;  3EYI A;  3DU6 A;  4LB6 B;  3S16 J;  3DLL F;  5DD4 A;  3CF5 F;  4P1W A;  4KIF A;  4QWQ A;  1V5F A;  1WGX A;  1DP3 A;  3CCJ I;  3RZD J;  4KN7 X;  4XL9 A;  1I6X A;  3ESW B;  2QVO A;  2B9S A;  1Y8Q B;  2L7M P;  4PUS A;  4E7K A;  3QYF A;  1S72 I;  5D5W B;  1FIA A;  2CUE A;  1XN7 A;  5IY5 H;  1YQA A;  1Y56 A;  4IRH A;  3BQZ A;  1D1A A;  3PSI A;  3K2Z A;  1O3T A;  3QYB A;  5ICF A;  2E1O A;  4V2G A;  3HSF A;  4JX6 A;  1S3J A;  1QVU A;  4IQ4 A;  4XRF A;  2CQX A;  3BY6 A;  4QLC U;  5J8C A;  2IBD A;  1MMG A;  4BY1 J;  2OF7 A;  4WF2 A;  4H0E A;  2V1U A;  3TED A;  3L2Q A;  3RZO J;  1R4N B;  2CSO A;  2E1N A;  5GTH C;  1WH5 A;  1VQ7 I;  1PP7 U;  1IGN A;  5ILS A;  2XF5 A;  3K4B A;  2E34 A;  1JUS A;  4RM2 A;  1UJ8 A;  3SYT A;  3GTL J;  4M6V A;  4CO8 A;  2HDW A;  3BTI A;  1ZK8 A;  4X6A J;  4LG0 B;  3ZQQ A;  5E8G A;  2R7S A;  1B59 A;  5E3M A;  3GUD A;  3OYK A;  2HZD A;  5K7Z A;  1LVA A;  1R36 A;  2L02 A;  3BR1 A;  5GAD J;  2LP0 A;  3KZY A;  1R1V A;  3K6G A;  4HOB A;  1R22 A;  2ISZ A;  4WXH A;  4M72 A;  2P5L C;  1J2X A;  1X3W B;  2VL8 A;  2LYC A;  4FIS A;  1D1B A;  3G6E I;  1FBQ A;  5HDK A;  4L9N A;  1JT6 A;  2M1B A;  2GIZ A;  1E3O C;  1MBF A;  4DGW B;  3NEU A;  1K4T A;  4CH7 A;  3ZQC A;  4PSX A;  2JUC A;  1R1U A;  1QQI A;  2EPF A;  2OD5 A;  1L3L A;  1R5H A;  3FHN A;  4G12 A;  5FFX A;  1MW7 A;  2QF7 A;  3FWE A;  4PK4 A;  1ZR4 A;  1UG0 A;  2K3P A;  2ZJP F;  2WAE A;  3M8F A;  4IF4 A;  2ZME B;  2F5V A;  2VJJ A;  2E35 A;  3JAM Z;  1D0Y A;  2TDX A;  5D5X B;  4FE4 A;  4ENJ A;  2E1M C;  5BMZ A;  1FOX A;  4ZDP A;  4V2F A;  2UXN A;  3L7W A;  1K7A A;  2HKX A;  1T08 B;  2MC4 A;  2EFW A;  2BW3 A;  3B6A A;  3DWL E;  2N8G A;  3RYR A;  4YFK F;  3VYU B;  4WWC A;  2QQB A;  1TLH B;  4Y52 J;  2A61 A;  2ME6 A;  3PUF A;  2OC6 A;  4QPQ A;  2NVX J;  2R7T A;  1VND A;  4LFU A;  1G3S A;  2HNH A;  3RCO A;  1NH3 A;  1IN8 A;  2NNN A;  2DA2 A;  2VOP A;  3LSI A;  3GEZ A;  5E20 A;  4L5E A;  3CCV I;  3G3Z A;  4HST A;  1UZC A;  3W6J B;  1OYI A;  2GWR A;  2HVQ A;  2RV8 A;  4BJT A;  4DJA A;  1Z05 A;  3BZC A;  2OAZ A;  2FF4 A;  2IW5 A;  4ON0 A;  5CQG A;  1JJ6 C;  1FP2 A;  2WV1 A;  3L2R A;  3MMY B;  3BOQ A;  1WH7 A;  2QA4 I;  4RBO A;  3DV8 A;  2DN0 A;  2R7U A;  3SEQ A;  4DBR A;  3P9C A;  2DU9 A;  3AG1 H;  2Z9O A;  2WB1 A;  3L2V A;  1HDP A;  1WKM A;  2KIS A;  4RGX A;  2AS5 F;  1JKO C;  2XAU A;  4RAF A;  1JKQ C;  1JJ8 C;  2A05 A;  2PBI A;  2GXG A;  3KLO A;  4KN4 X;  2VQH A;  3WHC A;  4NQW B;  1IN5 A;  2R7F A;  3RQ4 A;  1X3Z B;  1HST A;  3V7C A;  4BH9 A;  1UHM A;  1GVJ A;  3I4N J;  1X2M A;  2IAI A;  3WU1 B;  1FP1 D;  3R4K A;  2OZ6 A;  1CF7 A;  3GLL A;  3DBH B;  2E36 A;  2JRM A;  2HKO A;  1Z7L A;  3EUH C;  2DOE A;  5FRO A;  1WJE A;  5LEK A;  2LC2 A;  4F7Z A;  4ZZL A;  4IX7 A;  4XLF A;  2LMD A;  3SFZ A;  4EJV A;  4FTH A;  2M3A A;  3HOS A;  1XDU A;  1W5S A;  3RSN A;  3GCM A;  4IVN A;  1IN6 A;  1MBK A;  4JK1 X;  1W36 C;  3CP2 A;  3HHG A;  2IPQ X;  1MDM B;  2ZXJ A;  4BXF A;  3K1M A;  1T33 A;  3SFI A;  1RC9 A;  3VOE A;  2L4M A;  4BKX A;  4Q4Z F;  2CUF A;  3PFI A;  1FTZ A; 
#chains in the Genus database with same CATH homology
 1FX7 A;  3R61 A;  2DQR A;  4R8H A;  5AIQ A;  3F21 A;  4A12 A;  3RTR A;  2HTS A;  2BYV E;  1DPR A;  1XCV A;  1R58 A;  3N97 A;  3F3X A;  5DUK A;  2Q0O A;  3CUO A;  1ZRF A;  1SFX A;  3KP4 A;  1ZRD A;  3M1E A;  4XLN F;  4ETS A;  1IXC A;  5BPI A;  1XGS A;  2O8X A;  3I59 B;  4OOI A;  2Z33 A;  2QLZ A;  4DQ2 A;  1W7P A;  2ZNY A;  3GO5 A;  2V1D A;  2EV5 A;  2LNB A;  4IHT A;  4G8X A;  4UV9 A;  1E2X A;  2OU2 A;  1JHF A;  1FT9 A;  5LGT A;  3RJP A;  1B4A A;  1P4X A;  4I98 B;  1IRF A;  5LGU A;  4PCQ A;  2VOD A;  5ICC A;  4WK8 F;  1G3W A;  2H6B A;  1B9M A;  4YFX F;  2PMH A;  2XKP A;  3BJ6 A;  1YYV A;  3K1P A;  2IA1 A;  5FGM A;  3I5U A;  2Z99 A;  1RIO H;  1BOA A;  4BHC A;  3J7A O;  4UHT A;  4CYD A;  1BI1 A;  4MNU A;  4AIH A;  3SZT A;  1Z6T A;  1Y0U A;  3VEP A;  5L3B A;  2GIV A;  4KYW A;  5CVU A;  4EJW A;  3KCC A;  1V4R A;  4LLL A;  2HYG D;  3L9F A;  4M9Z A;  1FZP B;  3LAP A;  1BI0 A;  3ZMS A;  4LB5 A;  4XBF A;  1YW7 A;  3B73 A;  3CJN A;  2QQA A;  2P5V A;  3ELK A;  5J8F A;  2A68 F;  1O7L A;  2E7W A;  5DV5 A;  2EWN A;  4RAZ A;  4P9F A;  5E17 F;  3F72 A;  3LA3 A;  3TOB A;  4B09 A;  5CVI A;  3FM3 A;  1P6R A;  3FXR A;  4LLN A;  1HSJ A;  1W5T A;  1G3Y A;  4O5V A;  2VBY A;  3GZ5 A;  2OBP A;  4MEY F;  2ZBK A;  3ABU A;  3HOT A;  2Q8K A;  3TOA A;  3ULQ B;  1LDD A;  3GVA A;  4NB5 A;  2GA1 A;  3J81 K;  2RQP A;  4BAY A;  4A5M A;  1HKS A;  3BJO A;  1V3F A;  2HS5 A;  3E6M A;  1K6O A;  2D2W A;  1ZG3 A;  1EH8 A;  5A2Q K;  3COA C;  1FSE A;  3QU3 A;  2VE9 A;  1PP8 F;  1IRG A;  1KU3 A;  1WRJ A;  1FYM A;  3J80 K;  2BBY A;  3CDH A;  3IWZ A;  2IRF G;  5BS6 A;  2Z5U A;  1ZH5 A;  3Q9V A;  1TW3 A;  1TQI A;  2A3S A;  1EH6 A;  2VBX A;  5BQT A;  3MCZ A;  3ISP A;  3C3W A;  5FO5 A;  1ZGA A;  4G6D A;  2ZCW A;  3W6K B;  3WE2 A;  4LG0 A;  4UNO A;  1ZLJ A;  4R1H A;  2H94 A;  2LDU A;  4Q47 A;  3Q5F A;  1S8N A;  2IA2 A;  3T0Y A;  1RNL A;  1R23 A;  3BDD A;  1IXS B;  3R0A A;  4EJT A;  2ZFW A;  4BQA A;  1DUX C;  4I01 A;  3P7N A;  4LMY A;  3CO6 C;  1ZAO A;  1H9G A;  3FX3 A;  1D8K A;  4CIC A;  3CLO A;  4M71 A;  1KQ8 A;  1MKM A;  2DK5 A;  3KET A;  1KU2 A;  2ZME A;  3KP5 A;  2P4W A;  1FC3 A;  3Q9S A;  3IKT A;  5IT3 A;  3P9I A;  1ULY A;  2XKO A;  2DT5 A;  5L3F A;  1HQC A;  4PDK A;  1R00 A;  4HX4 A;  3E5X A;  1BBY A;  1KQ0 A;  2QZ8 A;  3IKV A;  3GFI A;  5HS8 A;  4IJA A;  4OIR F;  3ECH A;  4BXU A;  2MLK A;  2K86 A;  2R7D A;  2V79 A;  3LWF A;  1TTY A;  2QYO A;  5JFR A;  4HV6 A;  2P6T A;  1P2F A;  3LFK A;  1OYW A;  1YIO A;  4PGH A;  2L3D A;  1T0F A;  5HS7 A;  4GO1 A;  4NQW A;  1U78 A;  3QP5 A;  1H0M A;  1XCB A;  1S29 A;  3G73 A;  4M6X A;  1PDN C;  5F64 A;  3SZP A;  3WG9 A;  3PQK A;  1QPM A;  1TW2 A;  5D6E A;  2VBW A;  5FD5 A;  4E70 A;  4ZYD A;  3R0J A;  4OIQ F;  2P8T A;  1Z1D A;  5LRR A;  2P7C B;  2RGV A;  3HRT A;  3M8E A;  3U9G A;  2M30 A;  3DF8 A;  1MDM A;  5E8I A;  2UZK A;  1RI7 A;  4KIG A;  4LGW A;  3E6D A;  4U0W A;  1ZHF A;  1ONV A;  2RDP A;  2K4J A;  3T8R A;  3I4P A;  4UVC A;  2FQ3 A;  3D0S A;  4WXD A;  2LKP A;  3N4M A;  5D8L B;  2YU3 A;  4KNY A;  5ILV A;  3WTY C;  1D8J A;  1IUY A;  3VB2 A;  2FMY A;  5ICE A;  4Y13 A;  1FBS A;  1I27 A;  1S7O A;  3I59 A;  5JR3 A;  2EJR A;  3F8N A;  4WXC A;  1BIB A;  3WGH A;  1EH7 A;  4L0Z B;  3J81 Z;  3KP7 A;  3U2R A;  5HLG A;  4Q5S F;  4CGZ A;  4OU0 A;  3ERE D;  4MHG A;  1T39 A;  2JTV A;  1YS6 A;  2XAH A;  2JRT A;  4EGY A;  5CVJ A;  1D3Y A;  5A2Q Z;  5LLQ A;  3DXJ F;  3KP3 A;  1QNT A;  2XV4 S;  3L09 A;  2KJB A;  1ODD A;  2HGC A;  4HLX A;  5L3D A;  4CHU A;  4EMS A;  3J80 Z;  2F2E A;  5BOX A;  2XIG A;  3GLX A;  4KIC A;  4RB0 A;  5BPD A;  2X0L A;  3DPT A;  2W25 A;  3V8K A;  5D4S A;  2HEO A;  4XSZ F;  1KU7 A;  3FMQ A;  4M9X A;  2YSR A;  1S6L A;  1XB4 A;  2YX7 A;  1G3T A;  4DNC A;  4LJZ F;  4Z2Y A;  4AIK A;  3ZMT A;  2EFP A;  2HQN A;  4OIN F;  3EYY A;  5AIP A;  2C6Y A;  2ETH A;  1JGS A;  2BE5 F;  1LB2 A;  4HLY A;  4NHJ A;  1YW9 A;  5JHU A;  4BHB A;  3CUQ B;  3I0T A;  1LJ9 A;  1Z91 A;  2DW4 A;  1KQ9 A;  4HZF A;  3M7G A;  1YFH A;  3JTG A;  2CG4 A;  3V7R A;  1HW1 A;  4A5N A;  4U0V A;  1XMK A;  2E7X A;  3NQO A;  1FLI A;  1ON1 A;  3BPV A;  2DAO A;  1ZLK A;  2CGP A;  2NYX A;  2ISY A;  3RI4 A;  2GXB A;  1U6G A;  4HAM A;  3LAJ A;  2RN7 A;  4HV5 A;  2KKO A;  5LHH A;  2VC1 A;  1Z9C A;  1Q1H A;  3DKW A;  1BC8 C;  2IA0 A;  2WTE A;  2ACJ A;  3GFM A;  5F1R A;  2Y48 A;  4A2U A;  1IAW A;  1Z6R A;  3RDI A;  5HS9 A;  4P5O A;  4EM2 A;  2EA2 A;  4KFC A;  3K1N A;  3O3K A;  1UCR A;  4OMY A;  3T1B A;  2STT A;  2CQK A;  3BRO A;  2AXL A;  4MGR A;  2F5E A;  4S05 A;  2PG4 A;  1G4D A;  5EEG A;  3JSO A;  4O3M A;  5FFZ A;  1DPU A;  1SD7 A;  3HIF A;  2FBH A;  3DPL C;  3WTV C;  1ZAR A;  1ON2 A;  1SD6 A;  4TV7 A;  4MQV A;  4RGS A;  1ZRE A;  2FSW A;  1QBJ A;  3GXO A;  4FX0 A;  3TQN A;  1LDJ A;  4JBA A;  3K69 A;  1DP7 P;  3WGI A;  3JW4 A;  3DEU A;  3E5Q A;  1RUO A;  3QPT A;  5L3G A;  3WTU C;  2K27 A;  1D5V A;  3KEQ A;  2NRA C;  2HQR A;  2OQR A;  4P55 A;  2PN6 A;  1KA8 A;  5DCF A;  3TO6 A;  1FY7 A;  2OZU A;  1JXS A;  1IW7 F;  4HF2 A;  2RKH A;  2FBI A;  3RKY A;  5DCM B;  3V7S A;  1YTY A;  2FRH A;  3V4G A;  1KU9 A;  1SFE A;  3F8F A;  4GCV A;  3ZMD A;  4CXF A;  4HQM A;  3FMR A;  4CDG A;  4A6D A;  2H27 A;  2RVC A;  2EFQ A;  3WGG A;  4KDP A;  3MQ0 A;  4L18 B;  2M5W A;  5KVR A;  1G6N A;  3HHH A;  2DI3 A;  1IN4 A;  4ENK A;  4G7O F;  4U7B A;  3KP6 A;  2A69 F;  4AIJ A;  3RYP A;  3H3U A;  3GF2 A;  3F22 A;  3E6B A;  4ZH4 F;  5DUI A;  1FYL A;  2HWV A;  4Y15 A;  2ZJ2 A;  3O2P E;  2NS0 A;  2XAJ A;  4PGG A;  2QM3 A;  4IRG A;  2L54 A;  3I53 A;  1J0R A;  1O3R A;  1C0W A;  2XAG A;  2XHK A;  4ESJ A;  1XGN A;  1X3U A;  4YIF A;  3C1D A;  4RAY A;  3F23 A;  1LEB A;  4P9U A;  2KIM A;  2P7V B;  3I58 A;  5CLS A;  3OV8 A;  3HYI A;  3GFJ A;  3IRR A;  5D4R A;  3QAH A;  2LSO A;  5DEQ A;  3F8B A;  2YPR A;  3VOD A;  3QPH A;  3KE2 A;  3WTS C;  4G7Z F;  2QBY B;  1YLF A;  4A0X A;  3RKW A;  1T6S A;  2VON A;  1SMT A;  1FNN A;  2F5F A;  1P4A A;  5E1W A;  3C18 A;  4IHS A;  2H09 A;  4L0Y B;  3BPX A;  2MC3 A;  3BP8 A;  2FE3 A;  2RNJ A;  1TNS A;  3EET A;  3AAF A;  3LST A;  2J5P A;  4I0B A;  4RS8 A;  3LQR A;  4D0P A;  1DDN A;  5K5O A;  1NHA A;  4KT5 C;  2MH9 A;  3ZMV A;  4ENM A;  3ZP5 A;  3E97 A;  1B6A A;  3WTT C;  1VTN C;  2VN2 A;  4MQ9 F;  5HVQ C;  2F5C A;  2E1C A;  4HF0 A;  5J6X A;  1HBX G;  2PFB A;  3EQL F;  4MTE A;  1FSH A;  5CVR A;  1OPC A;  1UFM A;  3IC7 A;  2HR3 A;  3F8C A;  4I02 A;  2ESH A;  4HQE A;  2X4H A;  1ZG1 A;  1TQP A;  3ECO A;  1YO5 C;  4M73 A;  2DBB A;  1OYY A;  3GFL A;  4G7H F;  1UST A;  1GXP A;  1XSX A;  1I1S A;  1U5T B;  3HRS A;  3FZV A;  3NRV A;  3JTH A;  2A6H F;  4OIP F;  3OOP A;  1RUN A;  3CTA A;  5D6F A;  3ROU A;  3CUQ A;  5TJJ A;  2XAS A;  1U2W A;  4RB1 A;  5LRS A;  3FHZ A;  5F6F A;  1BIA A;  1LEA A;  3KFW X;  5D5V B;  1SFU A;  3IRQ A;  4RGR A;  3WTZ A;  1ZRC A;  1REP C;  2Q2E A;  1I1G A;  4UVB A;  2D1V A;  3HTU A;  2KIF A;  4KUM A;  2HOE A;  2CWE A;  5E18 F;  3F6V A;  2ADU A;  4KA4 A;  2WWY A;  5K5Q A;  4AVP A;  4EV0 A;  4R79 A;  2L4A A;  2DPU A;  1F5T A;  1IF1 A;  1LDK B;  2GA2 A;  2FEZ A;  4GYI A;  1USS A;  1P92 A;  1YS7 A;  2FOK A;  4EM1 A;  1U3E M;  3E6C C;  2XGX A;  2DO7 A;  2JT1 A;  3FF5 A;  2LF7 A;  4XSX F;  4EVI A;  1FYK A;  3HTS B;  2BV6 A;  2FNA A;  4BHP A;  1FPQ A;  2KJC A;  2ZKZ A;  3KP2 A;  1SAX A;  1IXR C;  2UWM A;  4Y17 A;  1WI9 A;  2XRO A;  1R1T A;  3K9T A;  2CYY A;  2NAZ A;  1HW5 A;  1BN5 A;  3LA7 A;  4EJO A;  1EV7 A;  2XUB A;  3V8J A;  3IHU A;  1WSU A;  4KMU X;  2EFN A;  3SQN A;  2DK8 A;  2STW A;  2FNP A;  3WTW C;  4FHT A;  2UXX A;  4HW0 A;  4ZYG A;  1L0O C;  5DYM A;  4G9Y A;  1FBU A;  1IN7 A;  2PMU A;  2EV6 A;  3TDZ C;  5FLX K;  1A04 A;  5FD6 A;  4LD5 A;  2IP2 A;  2XRN A;  2ZNZ A;  2O6G E;  5DCM A;  4O6J A;  2JSC A;  1HXD A;  3SHF A;  2G7U A;  3HRM A;  3I54 A;  5ICG A;  3FXU A;  3FMS A;  2K02 A;  1O3S A;  3TDU C;  2RC4 A;  3I64 A;  2BEO A;  2WV0 A;  4FT8 A;  3HSE A;  5ERI A;  5E1Z B;  1MJ9 A;  2MA3 A;  1JE8 A;  4S04 A;  4AD9 A;  2D45 A;  4L5I A;  4BYY A;  1FWZ A;  2FU4 A;  1E17 A;  1O7F A;  4HYE A;  2QQ9 A;  2GQQ A;  2EFO A;  3M9A A;  4JQF A;  2PI0 A;  3SXY A;  1T38 A;  1AOY A;  1HKT A;  2JZY A;  1QZY A;  4KMF A;  3TO9 A;  4RGU A;  2DPD A;  2CW0 F;  2BGC A;  2B0L A;  3RPQ A;  2HDC A;  3F8M A;  4EGZ A;  3E3V A;  2PQ8 A;  4HDV A;  2K7L A;  2EB7 A;  2OQG A;  3TKY A;  2KRF A;  1KGS A;  2FML A;  3E5U A;  1MGT A;  2MH2 A;  3REO A;  2A5Y B;  4BNC A;  1SD4 A;  2W24 A;  1B1B A;  4YG2 F;  4Q48 A;  2V1X A;  4I2O A;  4L9V A;  2ELH A;  2QBY A;  5ED4 A;  5E1X A;  3MFK A;  1BC7 C;  2VT2 A;  2W57 A;  1KYZ A;  1MZB A;  4N9I A;  3CUQ C;  5JI6 A;  2XVC A;  2JPB A;  1T2K A;  2MBF A;  1STZ A;  5LBQ A;  1YW8 A;  3S2W A;  3RPU A;  1UHW A;  5IT9 K;  1LQ1 A;  1WQ2 A;  4HX7 A;  1TNT A;  1UB9 A;  2A07 F;  2QUF A;  4LLG F;  2VOO A;  4MEX F;  3ML6 A;  3I71 A;  2VT3 A;  2ZO4 A;  2HZT A;  4UVA A;  2EK5 A;  1K78 A;  3HRU A;  5DDG A;  4HX8 A;  5LHG A;  2MD5 A;  3V8L A;  5K5R A;  1W7P D;  2Z3Y A;  4LK0 F;  4A6E A;  3DQV C;  1BI2 A;  2EA4 A;  4K2E A;  4UV8 A;  3PQJ A;  5CYV A;  3H3Z A;  1XMA A;  2O03 A;  3RKX A;  3C7J A;  2DQL A;  4N0B A;  3GYH X;  5H20 A;  4ASN A;  5DD8 A;  4HA8 A;  1ZYR F;  2A6E F;  1J7K A;  1U5T A;  2M45 A;  3DP7 A;  1OKR A;  1MD0 A;  3ZMU A;  2NNY A;  2H6C A;  3L2C A;  3HSR A;  1W4M A;  4AWX B;  2PEX A;  4G6Q A;  3T5X A;  5KK1 A;  3F6O A;  4FX4 A;  1H9T A;  4M9S A;  2M8E A;  5FLX Z;  2L01 A;  3MZY A;  1BJA A;  4U7D A;  2G7H A;  2DLL A;  4I7H A;  3WU0 A;  2PJP A;  2W84 A;  4RB3 C;  4YII A;  3U1D A;  5HDG A;  5LHI A;  2QEN A;  1J5Y A;  2V9V A;  3FM5 A;  3KEO A;  2HYF A;  1JHH A;  2J5O A;  3ZMZ A;  1R7J A;  2W85 A;  3R6S A;  3QU6 A;  4ESF A;  2KIU A;  4EQQ A;  1XSV A;  1U8R A;  4L9T A;  1AWC A;  4EM0 B;  4OMZ A;  3WE3 A;  1ZGJ A;  4WX9 A;  2JPC A;  2OA4 A;  4U88 A;  4OIO F;  2HTJ A;  1QO0 D;  5HLH A;  2HFH A;  3EDP A;  5CJ9 A;  1P4W A;  1XSD A;  2O3F A;  3ABT A;  4ZYH A;  2LF8 A;  3BZ6 A;  3CO7 C;  2XAQ A;  3JSP A;  2IT0 A;  4CZZ A;  5HLI A;  4L5J A;  4RB2 C;  3B02 A;  4UXN A;  1J9I A;  3R60 A;  3TO7 A;  1CGP A;  4YFN F;  3GX4 X;  5ILU A;  3IWF A;  1KYW A;  3BJA A;  3DFG A;  1ZN2 A;  1CF7 B;  4IXA A;  1I5Z A;  4GXO A;  1MJA A;  3K0L A;  3WTX C;  4G94 A;  5K1Y A;  3D5L A;  1IZ1 A;  3QP6 A;  5EEH A;  5LEJ A;  2IVM A;  4A0Y A;  5D8K B;  4LK1 F;  2F5D A;  3QOP A;  3GZ6 A;  1K78 B;  5H6R A;  3QRF F;  5CVV A;  3ZPL A;  1K79 A;  3KZZ A;  5HOO A;  4HDU A;  2VC0 A;  2CO5 A;  2P5K A;  2FBK A;  2FA5 A;  2VE8 A;  5IT9 Z;  1HW2 A;  4KIB A;  1WWX A;  1XDS A;  1F9N A;  2M87 A;  1TQM A;  4I09 A;  1YG2 A;  3ZQ7 A;  5AON A;  3LQQ A;  1XGO A;  4HBL A;  4IRI A;  1O57 A;  1GXQ A;  4EJU A;  1T98 A;  1W7P B;  4I0A A;  2R3S A;  2IJL A;  1SMY F;  4MTD A;  1BM9 A;  1GHC A;  2V6C A;  3JAM K;  3ZN0 A;  2DTR A;  5L3E A;  1B9N A;  2PLY A;  3GW2 A;  2Y0M A;  3MEX A;  2MLG A;  1PUE E;  2GAU A;  3H92 A;  4ZZD A;  3HUG A;  2FXA A;  2VXZ A;  6PAX A;  2GZW A;  3FXQ A;  3EUH A;  5D5U B;  4UUV A;  2QWW A;  3IL2 A;  4HF1 A;  4ZYE A;  4GGG A;  3KLN A;  4N9H A;  5HDN A;  2D1H A;  1OMI A;  3MWM A;  4B8X A;  1F4K A;  5FB2 A;  1Z7U A;  4XLP F;  4M74 A;  3GWZ A;  2O0Y A;  4ENN A;  1HKQ A;  3MZH A;  2ESN A;  1XGM A;  3RIR A;  1O3Q A;  4WCG A;  3ZN1 A;  1U5T C;  1SD5 A;  2YR2 A;  3VFZ A;  3T8T A;  4A0Z A;  1J59 A;  5L3C A;  2O61 A;  2CFX A;  1LNW A;  3TGN A;  1QGP A;  2YX4 A;  5JVT A;  1BI3 A;  3WOD F;  5LGN A;  4PZJ A;  2XAF A;  4U0Y A;  2EV0 A;  3L00 A;  1TBX A;  1S7A A;  5TRD A;  2WC2 A;  3LA2 A;  4ESB A;  3P9K A;  1QZZ A;  2COM A;  1ZG5 A;  4GYG A;  4IPA A;  1RZ4 A;  2K4B A;  2Y75 A;  3MAJ A;  3BWG A;  1XD7 A;  1J75 A;  1F1Z A;  4L9J A;  4P96 A;  1R5G A;  1OR7 A;  3O6B B;  1FOK A;  1MJB A;  5H6Q A;  2P6S A;  2G9W A;  2VBZ A;  4M6Y A;  2DFI A;  3EYI A;  4LB6 B;  5DD4 A;  4KIF A;  4QWQ A;  4KN7 X;  1I6X A;  2QVO A;  5D5W B;  1XN7 A;  1YQA A;  4IRH A;  3K2Z A;  1O3T A;  5ICF A;  3HSF A;  1S3J A;  4XRF A;  3BY6 A;  4QLC U;  5J8C A;  4WF2 A;  4H0E A;  2V1U A;  2CSO A;  2E1N A;  1PP7 U;  5ILS A;  4CO8 A;  4LG0 B;  5E8G A;  1B59 A;  3GUD A;  1LVA A;  1R36 A;  2L02 A;  3KZY A;  1R1V A;  4HOB A;  1R22 A;  2ISZ A;  4WXH A;  4M72 A;  2P5L C;  1J2X A;  1FBQ A;  5HDK A;  4L9N A;  2M1B A;  3NEU A;  2OD5 A;  1R1U A;  1QQI A;  1L3L A;  1R5H A;  5FFX A;  3FWE A;  3M8F A;  4IF4 A;  2ZME B;  3JAM Z;  2TDX A;  5D5X B;  4ENJ A;  5BMZ A;  2UXN A;  3L7W A;  1K7A A;  2HKX A;  2EFW A;  3RYR A;  4YFK F;  4WWC A;  2QQB A;  1TLH B;  2A61 A;  4LFU A;  1G3S A;  1IN8 A;  2NNN A;  2VOP A;  3GEZ A;  5E20 A;  3G3Z A;  3W6J B;  1OYI A;  2GWR A;  2RV8 A;  1Z05 A;  2OAZ A;  2FF4 A;  2IW5 A;  4ON0 A;  1FP2 A;  3BOQ A;  3DV8 A;  3P9C A;  2DU9 A;  2Z9O A;  2AS5 F;  1WKM A;  4RGX A;  2PBI A;  4KN4 X;  2GXG A;  3KLO A;  1IN5 A;  2R7F A;  1HST A;  3V7C A;  4BH9 A;  1UHM A;  1GVJ A;  3WU1 B;  1FP1 D;  3R4K A;  2OZ6 A;  1CF7 A;  2HKO A;  5LEK A;  4F7Z A;  4ZZL A;  3SFZ A;  4EJV A;  3HOS A;  1XDU A;  1W5S A;  4IVN A;  1IN6 A;  4JK1 X;  3HHG A;  2IPQ X;  1MDM B;  2ZXJ A;  3K1M A;  3VOE A;  2L4M A;  4Q4Z F;  3PFI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...