1I3OA

Crystal structure of the complex of xiap-bir2 and caspase 3
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
143
structure length
143
Chain Sequence
SLDNSYKMDYPEMGLCIIINNKNFHKSTGMTSRSGTDVDAANLRETFRNLKYEVRNKNDLTREEIVELMRDVSKEDHSKRSSFVCVLLSHGEEGIIFGTNGPVDLKKITNFFRGDRCRSLTGKPKLFIIQAARGTELDCGIET
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural basis for the inhibition of caspase-3 by XIAP.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Apoptosis
molecule keywords CASPASE 3
total genus 45
structure length 143
sequence length 143
chains with identical sequence C
ec nomenclature ec 3.4.22.56: Caspase-3.
pdb deposition date 2001-02-15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1460 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1i3oA00
3KJQA 1RHRA 4IEFB 4ZVSA 4AWAA 4NOMA 4PS1A 3IBFA 3ITNA 5IAEA 5IAKA 4NBNA 3R7BA 3QNWA 1RWVA 1CVRA 1CP3A 2CNOA 3GJTA 3PD0A 4DCOA 2HBZA 5IC6A 3PCXA 3R6LA 3V55A 1PYOA 2H5IA 4NOKA 2QL5A 2H51A 4AWBA 1GQFA 4ZVOA 4DCJA 4I1PA 5JFTA 2J32A 4IYRA 4EJFA 1RWWA 4QUAA 1PAUA 3V4LA 4JQYA 2Y0BA 3KJNA 3E4CA 1I4EB 3S8EA 2J33A 2FP3A 3DEJA 4I1RA 3D6MA 5LUBA 2C2ZA 3R5JA 4FXOA 1F1JA 3GJSA 1I4OA 3P45A 4FDLA 1RWMA 4ZVTA 1NMSA 3BIJA 1IBCA 4QTXA 3H11B 1NMEA 4QU8A 4QUJA 1K88A 2H65A 5I9BA 4D3XA 5LUAA 2DKOA 4N7MA 3H0EA 2FUNB 3IBCA 4EHNA 2P2CA 3SIRA 5IBCA 2H48A 2XZTA 4JQZA 3SIPA 2H5JA 4DCPA 3DEIA 5IBPA 4EHAA 4QUEA 4QU0A 2C2KA 1RHMA 4HQ0A 4NOLA 2HBYA 2HBRA 4ZVPA 4ZVRA 3EDRA 1I3OA 3H11A 3GJQA 3V4OA 3R7NA 2NN3C 1RHJA 2XYHA 3H1PA 4HVAA 2K7ZA 2FQQA 4D3YA 4N6NA 5IANA 4EHFA 3R5KA 4ZVQA 2CNLA 3K7EA 3R7SA 2C2OA 2J31A 2CJYA 5IC4A 4FEAA 4QUGA 4AW9A 4QUBA 1SC4A 3P4UA 4JR2A 3DEKA 1JXQA 4QULA 2C2MA 4EHKA 2H4YA 4M9RA 4QU9A 3RJMA 4D3ZA 2HBQA 1RHQA 4ZVUA 3H13A 1RHUA 1F9EA 2XYPA 3V3KA 4HQRA 2H4WA 1I51A 5IBRA 2XZDA 5I9TA 3V6LA 1QTNA 1SC1A 4EHHA 1KMCA 1RWXA 4PS0A 4N6OA 2CNNA 4N6GA 1RWPA 1SC3A 3NR2A 1NW9B 1SHJA 2WDPA 4JJ8A 4JR1A 4NBLA 4PRZA 4QUHA 4QUDA 2QLBA 4EHDA 1K86A 4JB8A 3V6MA 4JJ7A 4JJEA 5IARA 1ICEA 2CDRA 2XYGA 1RWOA 4EHLA 1RHKA 4NOJA 4N5DA 1SHLA 3PD1A 5IAJA 3R6GA 2C1EA 4QTYA 4NBKA 2CJXA 5IABA 3KJFA 1BMQA 2Y1LA 3EDQA 4QUIA 4PRYA 2AR9A 1RWNA 4N7JA 4QU5A 4FGUA 3OD5A 4LSZA 2CNKA 3D6FA 3NKFA 4JR0A 5K20A 1RWKA 1QX3A 2QLJA 5LU9A 3UOAB 1RE1A 2QL7A 5H0IA 3S70A 1QDUA 2H54A 3GJRA 3UO8B 2QL9A 5IAGA 5IASA 5LU8A 2J30A 2QLFA 1M72A 1NMQA 1GFWA 3D6HA 3NS7A 3DEHA
chains in the Genus database with same CATH superfamily
2IEZA 4OJMX 4X64B 3OFSA 1NW3A 1DDGA 1QCDA 1VYVA 2WLTA 5I7AA 4FGZA 4TMZA 1TL7C 3W34A 1QP8A 5GM2A 4MUIA 4WSOA 2YHBA 2J5QA 3S40A 2QHXA 4GE0A 3NVDA 4YIKA 1RRKA 2CNOA 4DCOA 4KZPA 4EAAA 3KOWA 1RJFA 1J5XA 4PTZA 3C24A 1J42A 3V5NA 3OU6A 4HAXA 4DA6A 1ZMOA 1YJAA 1AU9A 1X1TA 2GSWA 1DDOA 4L5BA 5DSXA 4M0LA 5H59A 2CXQA 2AZTA 2DWUA 4FCVA 4G0OA 3WQBA 1Q92A 1VL6A 2Y0BA 1R5OA 2PEZA 2PV7A 3DWIA 1CETA 2QR2A 1NVEA 3IQEA 3NGLA 3NXKA 2FW8A 4NU0A 3LVFO 2XGJA 4Q19A 4HHEA 1SG9A 3C4JA 1XMOB 4I66A 4LWZA 3RPEA 2WIFA 3HVKA 4CEJB 3ZVKA 3OZRA 1D2MA 2PXHA 3PB3A 1K6EA 5J2TF 1A82A 3T3HA 4BNFA 1HLFA 1UXOA 5AJYA 5BRJA 1JEYA 1U2DC 2XUGA 2W6OA 1CY1A 1HNZB 4G0NA 4DLWA 3E81A 1UXGA 4YCLA 1NW5A 1X2EA 3L0BA 3LI2A 2FPRA 2PVSA 2MTBA 1OLXA 3KHSA 4LAFA 1NG1A 3L0OA 4XPIB 5L4LA 5TV2A 5G4KB 2O3RA 1I6KA 2FWIA 4LCJA 2C5LA 1JIQA 3FFBA 3L4EA 1PJZA 1CNEA 3QVVA 4Q48A 1JKJA 1VRVA 5L8VA 3C16C 1N3LA 2L69A 1W0JD 3H5AA 2CNLA 4UUPA 4YAEA 3E03A 3IEVA 1VMAA 3IKJA 2BEKA 1Y0BA 1EGQA 1L5LA 4JBHA 3NVMB 4FVTA 1WDKA 4I7EA 3O2SB 2IUEA 1ZNYA 3S27A 4A5SA 2CBGA 2WJJA 4AG5A 4RMGA 1T36B 4WNYA 2IVZA 5BR4A 3LDUA 5EMMA 1ESDA 1YD7A 1ISJA 4EW2A 3AJ9A 2OZVA 2P2GA 1JVNA 5B6IA 4GLOA 1H22A 1KOLA 3W2TA 3WNZA 3A10A 5B64A 3C6XA 5LLSA 2OG1A 2VHQA 3LC7O 1CQIB 1O6ZA 1P4JA 2G7MC 4FEYA 4HEA1 4N6GA 3WX0A 1V8OA 1RTKA 2VVTA 2V6JA 3M5PA 3E35A 1HI9A 4ZKEA 3RHTA 4C4SA 5A4DA 1WV1A 3DKRA 1QG6A 4JAVC 2F7SA 4OLFA 2ZYRA 3G5TA 4FFMA 3O91A 4UVEA 2VXBA 4YJDA 4QZVA 1FMLA 4K3VA 1YZYA 2KYRA 3NU1A 3SXUB 1G2QA 3LTNC 4ESOA 2XTZA 4XFJA 1MX5A 4F45A 5EAIA 3PR3A 4B84A 1RPNA 4NU5A 2QPAA 2RG7A 4DB4A 3CUYA 3OQ6A 3VZCA 2OCXA 4GL2A 5FNVB 2H52A 2YHIB 4TTTS 1YR8A 2JS7A 5D51S 2PSDA 2OWEA 3AB7A 3FPGA 4J0CA 4KPGA 4EI2A 5CK4A 3SBXA 1M72A 4XYEA 5IWAB 2ZWOA 1A9XA 3ZDYB 1E1RD 2QYTA 2HCTA 2Q0XA 2FW0A 5ECDA 5FWYB 4CT4B 5BV7A 3K6KA 3G1WA 2QE6A 4TQ9A 2P9CA 4FBMA 4AWXA 4Z53A 621PA 2DPGA 3LBYA 5LCXA 5EKXA 3EA5A 2HT6A 2I9KA 4K0KB 2G9RA 2PZJA 1A97A 1NP6A 3FTPA 1DTWB 1Y80A 3PUJA 1U0EA 4UE6A 4ZTUB 4XCXA 4LQDA 4LY0A 1O8BA 4A8PA 1USVA 4FOPA 4BO4A 1M2HA 1G98A 3RLFA 1QRRA 1ZCJA 4IGKA 2D7DA 5ECWA 2P2ZA 4FCCA 3H5NA 3FLAA 3K0FA 1BGWA 2I6FA 2HHJA 2CK3A 2ZJ7A 1R0SA 3AHDA 2EXXA 2J67A 3B8HA 1B1AA 3L40A 2HLDD 1LSSA 1K98A 2BMVA 3H11B 5AM0A 3SP1A 5IJZA 4WHMA 2O5EA 3BFVA 2OCYC 3QI2A 3RHZA 1C7FA 5CYGA 2G83A 1OXMA 3AUTA 1KDTA 1QFJA 1X9GA 4QKQA 2V54A 1KSGA 1NXQA 2ZTLA 2KB0A 4JBXA 1T9BA 1B16A 4RTRA 2ZPAA 4OM8A 3BB3A 5C37A 1PWEA 4QAQA 4FZVA 3D9QX 3ELYA 1Y7IA 5GJWC 6LDHA 4W5WA 4HT3B 4BY9E 2WPDA 4PAOA 2J0SA 2OD2A 1GAWA 3EQ2A 2WKSA 1L2TA 3RK4A 1XVVA 3KS9A 3WISA 1M2VB 1SK8A 4LQCA 4KACA 1OZAA 5FWAA 1ZSVA 1RQ2A 4PANA 1Y4SA 4YDSA 4CM1A 1U0JA 2R751 5KTMA 4JJIA 2WHYA 2HI0A 5C34B 4EHJA 4EY3A 5FV4A 4A26A 4LJ6A 1T1GA 1UZNA 3IDFA 3DG9A 4EHKA 4L2IB 3HPQA 5K0SA 3BMOB 3QJ5A 4DMFA 1K66A 2AOWA 3WYAA 3QBTA 1N9GB 1W35A 2Z56A 4YYEA 1KAOA 2OD7A 4BX9A 4YRNA 1NG9A 1O57A 5A5EA 3EZ9A 1M76A 2AN1A 1T5OA 3EZ6A 5D6OA 2Q1SA 1DTSA 1NW6A 1RBZA 3WMWA 4L8VA 2R8BA 3W78A 4LZJA 5BNIA 2GYYA 3QLJA 1FW8A 1WULS 1G8HA 1NVKA 5AQEA 3MJRA 2BFOA 4CLRB 4ETMA 1V3TA 4W5RA 3R7FA 1W48A 5BYAA 1SCUA 1JI3A 3F8SA 3FNHA 2FN7A 1ZSNA 2FCRA 2DAPA 2QGFA 3OU7A 2L42A 2B30A 4GMHA 3SSNA 4DZTA 2PTHA 2OC9A 4WXEA 1ICEA 5H7XA 3EXFA 4QYTA 4OQPA 2QN7A 3SR0A 4E33A 1R0CA 2YYYA 4OSPA 3Q8LA 4E5MA 2VLBA 3X1JA 1MVNA 1G7CA 1KEZA 1XRQA 3VZBA 1WXGA 3ZCPA 1FX0B 5LP6C 4ZYLA 5CX1A 2QTHA 5JAMA 5E95A 3MTEA 3E1GA 4F3NA 1A7JA 2ZB7A 4PTYA 2Y4NA 3D0KA 4GP9A 1NN0A 2HZ7A 1X7YA 2HSJA 5AR1A 3PL1A 4KFCA 1CF2O 4V39A 3JTMA 3PPWA 2IWRA 2UV8A 3D02A 2D4AA 3LSTA 4TLBA 1ZY2A 4TSFD 1WHTA 4EYGA 3NHKA 3W6PA 1P62B 1LNZA 1MDBA 4RACA 2BFFB 4TVBA 3O74A 4XB6B 1NYLA 4I1YA 1PK9A 3ABOB 3GC6A 4KAXA 4ENTA 1BE0A 1AVTA 2G82A 4XD7A 1UBHS 3V1TC 1JHZA 6NULA 2V98A 3FW1A 10MHA 1DRVA 1YDGA 2GXAA 1BVYF 1JLLB 3Q85A 5EJ9A 3UPUA 1UBUS 2DFNA 3N58A 3G5UA 3M6XA 1YTLA 1YOBA 1ZA1A 3I34X 3NX4A 3NWJA 4ISBA 1OE0A 3O1HB 3DMTC 4V1CB 1NFQA 2HXYA 2CD9A 5ENDA 3V1MA 4M1SA 4DL9A 2Q41A 2EWWA 2M32A 4PZYA 4D02A 4PG4A 5GIPE 1CXZA 3OMWA 1H6BA 3GBSA 4WI1A 5CB4B 2CLFB 2Z8XA 5FHRA 1EVQA 3M83A 4H59A 5I3ZA 1N1GA 4D74A 1QYCA 4R05A 3ORRA 4W9NC 2QI9F 1SBIA 2Z8YA 5LA6F 4DY4A 3L84A 3SY8A 4ZZ2A 1YR6A 3IPLA 3U80A 3BWYA 3A04A 3CRW1 2HM7A 3EHEA 3LC2O 1KO5A 1JILA 3A1CA 3WGHA 3EVEA 3F6YA 3OZXA 3RSHA 2VDWB 2WWVD 3MCVA 4GLJA 7GPBA 1R27A 1AURA 3WO0A 2GWHA 1YL7A 2PZBA 3QMVA 4NG4A 1DC6A 1HV8A 3AF4A 1QYVA 2YZ2A 3LFUA 3TSCA 3O3NB 4YT5A 1DWOA 3LU1A 4I9NA 3V8QA 5LIPA 1X94A 2EHDA 3IODA 1UINA 5I51A 4MKGA 3PXDA 3S2EA 3NM5A 2RBGA 2WT9A 2ALJA 1GXSB 1JE0A 1ARZA 1LK0A 3BK1A 4NDNE 3FH0A 3WLJA 4YMVA 1K5PA 5C52B 2ZRIA 4IQ0A 2I7VA 1CY8A 1QUFA 1H94A 4NWIA 4E1AA 3ROMA 3V32A 1SKAA 4B76A 2KQUA 4BATA 4FZ5A 5JJ5A 5IX8A 3B5JA 3EJWA 1N5LA 3PNSA 1WNFA 4QU9A 4YI5A 1PR2A 1T3GA 1UC4B 1UFKA 2F2TA 4JBGA 3EY4A 5JQWA 4UVDA 3U5TA 5LOVB 3WA6A 2QSJA 5LSAA 1RYEA 2IITA 2XZDA 3NWPA 3ZCRA 3EH2A 4YRPA 4BFVA 5JAUA 1MAWA 3VZPA 3NM6B 2QRVA 4FONA 4PCAA 4L0MA 3ZE9A 4IMJB 2XWSA 4UM8B 2ENUA 2JLVA 2EJCA 4C4RA 4QUDA 3G2HA 3BH7A 1QNFA 1A2QA 1IWPB 4LYEA 4BQSA 4EABA 2RDMA 1QGOA 4WFKA 4UNIA 4DDKA 1BGXT 1LBTA 1IXYA 1HA3A 3TX6A 1UWVA 5FLYA 1EE2A 1QFMA 4OK6A 4JUFA 4RJJA 5G4KA 2QRHA 3IOEA 4IFIA 3HJNA 4LE1A 5KJFA 1D9XA 2C29D 3DWEX 1K2WA 3IP6A 4QUIA 4ZAGA 3WI7A 4UFPA 1S0UA 4JY7A 4NR0A 4QSMA 1DU4A 1L5OA 1QV6A 3U62A 5LU9A 2JF0A 1XZKA 3B1WA 1XJ0A 2R1UA 4TXHA 4ZRMA 2BBWA 4ER0A 4V02A 4FB4A 3CX3A 4P4NA 1RRPA 4Q3NA 4D79A 1LWOA 1OXTA 2P1RA 3IDQA 3F9RA 3OZEA 1Z0AA 3C8MA 2V0CA 3D7SA 1M0WA 3N8HA 4IO1A 4Z8XA 5MN4A 1E3SA 2BJHA 3F1LA 3H3JA 5KJ6A 2A4MA 3ZQKA 4ZVSA 4QO8A 1OREA 3TMKA 1X77A 2J9ZB 3LXUX 4OYRA 3L7MA 3GMIA 1E0AA 4H2DA 2ZXEA 3KQHA 2JJ1D 4MB6A 4PGFA 1U8XX 2CBZA 2Q3DA 4HFMA 1CDZA 3F1KA 1KRXA 2UUOA 3C3XA 4EW1A 3G6KA 1OGJA 3ZNQA 4D5EA 2Z2JA 2OM2A 5HCIA 1A4XA 3GMDA 3WHKA 5K8CA 2RK4A 4JLDA 5AKEA 4P2BA 3EPHA 1KAQA 4KFRA 5HDQA 3SXUA 4AP5A 3ZHTA 3ADCA 2AZMA 4BO2A 1ZJ6A 221PA 4DCMA 1TU4A 4YJGB 3CRQA 4ZPXA 5JVDB 3PIRA 4M1EA 4DV0B 4MV3A 5HZHA 3A4IA 3ANSA 4NFLA 1G6HA 1L1QA 2FSHA 2VDKB 1Z35A 1GEGA 4F93B 1EG2A 4YRSA 4CETA 2QMHA 4FD2A 1LLDA 3NHPA 1LS6A 1G60A 2AOXA 4O4HB 4C05A 5KUTA 1RCUA 3WLKX 1PL0A 3G1UA 1GPJA 2PUGA 1MXHA 5EJEA 3RUEA 1I3OA 1NSYA 2B6NA 4IZ6A 1T1RA 4HZIA 1DFHA 4XM1A 2CDBA 2J5KA 3JRNA 3L79A 2OBNA 1B3RA 5AM2A 1QC5A 4IOKA 1CUHA 1QUEA 1T2CA 2M6RA 3A6LA 2FUEA 4NY1A 4GOMD 4Y6GB 3DVRX 2IIPA 3GLRA 3PDJA 4BBAA 8OHMA 1U7WA 3F73A 2WNSA 1UAAA 2YINC 4U3JA 1G1AA 1K7FB 2R6JA 4WN3A 4C76A 1Z6YA 3UHJA 2OHGA 2YJTD 4MR9B 4UUMA 3WG9A 1A4IA 2HB6A 2WJ3A 1M8PA 1R4MB 3MXTA 4K03A 4MKXA 5AWFC 3WNCA 1OT5A 2IA5A 5FUWA 5G1PA 2C4UA 5AJXA 1Q1GA 4NH4A 3M2PA 3JWJA 1G8SA 5HP4A 1T5SA 3EGVA 4HQRA 1MU0A 4M86A 3SVLA 3OX4A 5J4VA 1MGOA 4U02A 1PL6A 1G63A 1WG8A 3NAMA 4TMYA 1IRIA 3U0BA 1HFKA 1RVV1 3TLAA 1A2OA 3U17A 1G9XA 3DOJA 4ZYZA 4AJIA 1UKYA 1U3TA 1VI2A 3E3AA 3STUA 1VQ1A 1WZIA 2O6HA 3GLIA 3L1VA 4MGIR 3B48A 3HS3A 1OYWA 2Z83A 2QMQA 4ARCA 4AKEA 3OBIA 2ZWAA 3WQRA 3STHA 5BWCA 3K96A 3R5HA 4KBYA 3EA4A 2JCGA 2PDAA 5BXYA 4ZZ0A 5M7EA 3QJGA 2JJMA 2Q6TA 3U4QB 4DWOA 2AD1A 1ZGJA 3LY8A 4P82A 5KBYA 3RRMA 3KALA 4N7RA 3ASVA 1NF8A 5SV2A 5KQGA 1R88A 2ZB8A 5LQRA 2A59A 2X5JO 3NKFA 3TTSA 1ECBA 3N5CA 1HO3A 3GMSA 5HX7A 5IM5A 5LLTA 3U1TA 5A62A 1QDUA 3AFHA 2A5FA 4HR7A 1VMKA 4AKHA 4LXYA 3IEMA 2C88A 4IG9A 2A58A 4RGVA 3H7AA 4EFMA 4B3MB 4ODIA 3VGPA 2ZYAA 3HXKA 1NVDA 3OZDA 4FS3A 1QP4A 3DGFC 3D7NA 1ZGGA 3GFSA 1NX6A 1P0MA 3GV0A 3LYUA 5EEGA 3L8EA 4YRJA 5L3VA 5KQSA 4MUKA 1UJ5A 4MW5A 2I2DA 2P2YA 4O2BF 4UU0A 2HUPA 4BX8A 4MPPA 2OBFA 3OZCA 1J1UA 2YZKA 3K6RA 5J47A 1MEOA 1XPJA 4AJHA 1TXGA 3FDZA 4RGYA 2B4RO 3N05A 4B6PA 2GMWA 3CLTD 4IYJA 4ZOLA 4ZC1A 1T4CB 2JAXA 4QYWA 1ZJYA 1PDOA 1RLUA 4ZAYA 1CUEA 1PCXA 3EZLA 3SZOA 5BUSA 5BORA 1SBQA 3EXFB 2QJWA 3RU7A 1HMYA 1I2MA 3E2PA 4MUFA 5E6SB 2JFQA 5BO5A 3RKUA 2X0JA 1TAGA 2HU5A 1M2OB 1PYGA 2VYCA 2YQ5A 5J1TB 3ZE8A 4RTJA 2P41A 3F0TA 1X8XA 5CNJA 4JLMA 2Y67A 2E2WA 1FSZA 1XJQA 2AFRA 3LYLA 5T3UA 1R5NA 4GEGA 4O5AA 1XLTC 3G1TA 4L5JA 4MWSA 1D0SA 5I7SA 4DKJA 1N78A 4IV0A 5JPIA 1X7YB 1TT5A 3I9FA 2CJWB 1XCPA 1MO3A 2H1CA 3UH0A 1XA4A 4B82A 1YL5A 2BOVA 5GIOE 1WPQA 4ARIA 3AOEC 4YJ3B 1XTIA 3ICWA 3NTUA 3DZDA 4J76A 2OHJA 2WIJA 1NUPA 2PKWA 3C1UA 4GVLA 5B3AA 4ARSA 1CUCA 4ZVRA 3P9ZA 4GR4A 4BP8A 3TVDA 4JV5B 4D6XA 4ME6A 5F77A 1THGA 3VZDA 5B1DA 2XYHA 1RQNA 2QZ4A 3SNKA 1Z39A 3BJRA 3HXPA 4F21A 3TIFA 4PZCA 3ZKWA 5HKKD 4JODA 4B87A 4PGMA 2LR0A 3DL2A 4RO0A 3RC7A 1FDUA 1E0DA 4TM8A 1UPBA 1VLMA 3EQ9A 1JLHA 3MBKA 4EMUA 1GLVA 4S1VA 4KI0A 3F3KA 4P31A 1KDYA 1TUGA 1RFGE 3OZFA 4H7PA 4GE3A 3NHUA 2PBFA 3LHFA 4P0PB 1M67A 4QRDA 1KY3A 1HDEA 4NATA 1NR5A 3CF2A 4ID3A 4B2LA 3OA0A 3NW9A 4L9RA 3OEHD 2GBLA 3NUQA 3QUSA 3TNJA 3HP4A 2YZMA 3M3HA 4PEVA 2O59A 1JEQA 2EJBA 1ISSA 1T35A 1MIOB 2EV9A 1SIOA 1XO1A 1NQ5A 1XNJA 3R5XA 4IWYA 2RGWA 4LGYA 2P2SA 3SX0A 4DOMA 4ZJZA 3TECE 1GAEO 4I36A 2ZYIA 4RYDA 1H9BA 3ROXA 4FKMA 1DEKA 3BS4A 1CW2B 2WYWA 3WFIA 3RVQA 2WP8J 4TGLA 4KK3A 4NEHB 2O23A 3WGKA 1DOAA 2GPYA 2PEYA 4CN8A 1X8KA 4ATNA 4JN6B 2XKJE 2GRAA 4GRIA 1I1OA 4DXDA 4YBRA 3PCTA 1Z8HA 3PJGA 2HREA 3CZPA 4L8YA 4KE8A 2JJ8A 5ES4B 1JR3D 4XWTA 1RLTA 1H0SA 3NWBA 4EQ6A 2VDUE 3FE2A 5J5AA 1KTIA 1ONSA 1S8AA 4DCCA 3RIGA 2OAP1 2P1ZA 2R7LA 4ZGBA 1Y1SA 4Z51A 5BR7A 1P4AA 6YASA 1QYXA 2BKAA 4MRAA 4OGLA 2CHEA 5C4MA 2PANA 4TZ6A 4TLEA 2OEPA 2ZYTX 2PGAA 3FBGA 4WH0A 3HA2A 3CSDA 3N59A 1NMYA 2ZXUA 2ZXFA 3V46A 2ZM6B 4R8RA 4DG5A 1ZJ5A 4LF5B 1AXGA 2ZJFA 4RLHA 3ZHXA 5M5BA 1MXFA 3MD9A 5BYBA 3EMDA 3PXUA 4L16A 4TTVA 4DIBA 5THXA 4L28A 2FRVA 2WSIA 1R3UA 1Y5LA 4D6YA 4DN6A 4B8ZA 3O8RA 1BCSA 3DZJA 3KQKA 2PXAA 5HZKA 1POXA 1W1WA 1ZIYA 3DZFA 1I1NA 4I50B 3TTWA 2H1WA 4CT5A 1XTUA 3KLPX 3THWA 3AVUA 4ZVNA 2F43B 3HABA 2FOIA 4YT8A 4GGPA 1BFUA 1CDOA 2LRHA 2MSDB 2F4VB 2ZSEA 4C87A 2OC4A 2VOEA 5DTMA 4FIZA 2XUPA 4AKGA 3T1OA 1EEXB 3N76A 4DV6B 1B8PA 4YO8A 1DV2A 1L5ZA 1PKXA 4OAPA 3OURA 1DG1G 1V9CA 3FKJA 3KPJA 2Q3FA 2YOHA 2GETA 3V4ZA 2RCNA 4WK6A 1N9ZA 3KB1A 4PG7A 1RJWA 4B33A 1II8A 4RMNA 4OLBA 4EW6A 4DBLC 1NI4B 4X1YA 1ABBA 3H2BA 2AXQA 2Q6KA 3LHIA 1NJ2A 1UBRS 3HDGA 1IZZA 3B9RA 2ISQA 3D8TA 4FLFA 3ABSB 4A91A 5FLEX 3IMCA 4NE7A 2VF2A 3MWDB 1FNDA 1ZXLA 3H1PA 2I2WA 1EE9A 3HRHA 3FPFA 5KNBH 3EDYA 4UQLA 4NZMA 5KJ1A 2B4TO 2R6GA 2IOHA 1HDZA 1V71A 2YOFA 5JVDF 2UAGA 1VMIA 3G59A 3B8EA 3LHKA 3CVJA 3OCYA 4GOND 4TT8A 1NT4A 1W6RA 5EXPA 4DLSA 3ZUPA 3TLXA 4RVSA 4DJEC 3NH9A 3EEOA 4QUGA 1YA6A 1GNRA 1NUTA 1L4EA 2QVGA 3JQ9A 4PG6A 4FHDA 4AYTA 4QULA 5EIBC 5KCZA 1NN1A 1YOVB 2ZJ2A 2QBYB 3DDCA 2R87A 1XMPA 4HLQB 1WCIB 3A6HA 4R9UC 1CJBA 1L5MA 3HN7A 1E2BA 2ZTMA 3BTUA 2HY7A 4D9EA 2XCOA 2ZVJA 1L7XA 2GPAA 4MEJA 2QRNA 4NULA 1SRQA 1KK3A 3P0FA 4AQ7A 1A95A 4FT2A 2ZI6A 3UICA 1TC2A 4FS8A 1QE3A 1O58A 1QHHA 1WAMA 3JQ8B 2C9BA 3RGGA 1QH8B 5EXEA 4HQNA 4F7WA 2W6IA 5JG7A 4ZHQF 4E2FA 1QVZA 4QELA 2OHIA 1C9DB 1DBVO 3RAPR 3HJHA 3VMFA 2NO4A 4CU2A 3INGA 4ZK2A 4G5YA 5EE9A 2YL2A 3IQDB 2WV7A 3CJQA 4TL7A 1DT5A 4JOCA 4UUBA 4DTIA 2IPAB 3ZV7A 3NHZA 2H0QA 5LA6A 5BV8A 5FA6A 4YTEA 4M0EA 1RXCA 5BXQC 2TMGA 3OQOA 4ZVMA 3RYHA 3GGOA 1U7OA 4RY9A 2D8AA 5HPYB 3IELA 4A6XA 3AXSA 2B25A 5CVVA 3O4IA 1GSHA 5H0IA 4QASA 4OXIA 4RULA 2OQVA 1BU8A 2PS0A 3H19A 5HEKA 4IVNA 3SXPA 1SHZA 1E7YA 3CPHA 3JSXA 4QEKA 3F2VA 4DILA 3SC2A 2AI3A 1T6ZA 2BHLA 1AN9A 3WYBA 4R5HA 2B35A 4C0JA 3HO6A 4Y9RA 2WSYB 2HW8A 1OXUA 1U81A 2IPOA 1P1IA 4OJTA 2R7MA 1M6WA 4WQMA 3M9WA 1KWGA 5JJIA 1LQ2A 2ZWVA 5ALIA 2NVUB 3V8RA 4DYHA 1L8QA 1JIIA 1G1MA 1TMKA 2HYDA 2PRYA 1TVCA 2FR1A 3DUWA 2JCYA 4H35A 3GY0A 1GARA 4M1ZA 1R1DA 1PNQA 3G8YA 2WTMA 4WPGA 4Y3UA 1VJTA 3NBFA 4MCAA 1W1UA 2Y8EA 2QX4A 2GPJA 4YBZA 3QUQA 2ZAMA 4KDRA 5L51A 2F3UA 1P7CA 2CXXA 4P4UA 4PBRA 3LX5A 1XD9A 2X9NA 4OMCA 1PGNA 1HFWA 2FEKA 3CU5A 3STWA 1YQGA 2O1XA 3JR7A 1PT6A 5JBNA 5IVHA 2ZFUA 2A6PA 3ROQA 1PX0A 1XZQA 2IXEA 1WKCA 2XDAA 5BOVA 4KX3A 2FYTA 3S7ZA 4JXXA 1RZRA 1JJAA 4TMVA 4LIPD 1OD6A 4OQXA 5AVOA 3SIPA 3WLLA 4YRZA 3CO0S 1ST2A 3EUAA 1FQJA 3K0AB 7ABPA 1X1EA 2Q3LA 4MGEA 1WQ1R 4PR3A 5TQ0B 5ER9A 1K3TA 3E8XA 4PAQA 2YWDA 5BMVA 2JBAB 3QVJA 1SVOA 3ZE0B 4C7OA 4U5QA 1CYEA 3DDZX 1I4WA 1BMFD 1TJ5A 2FN8A 2X6RA 3KSDO 4GL4A 1ESEA 4MCJA 2QMUA 1FRFS 3LCVB 5FI3A 4KXMA 3COWA 3AESB 2J31A 2AC2A 1YVPA 2XNKA 2PJDA 3HJGA 1DG3A 2Q5HA 3L8ZA 3BTVA 3VYWA 4CG2A 4CUKA 4I6JA 4KDEA 2QUHA 4MQ6A 4MIKA 1Q14A 1LTKA 4EP1A 2H31A 3VYUB 1AKYA 3HK2A 2QRKA 3L18A 4B32A 2A3NA 2JLBA 1Q0RA 4HNUA 2XNHA 1RS0A 5EYPA 1RQRA 2CGEA 3N7AA 1TVEA 2IQIA 2J4FA 1K5DA 2IL1A 2J1LA 3BIOA 5IBRA 1KVUA 1NY6A 1QORA 3P9CA 3AI3A 3CX4A 1SC1A 4LEIA 4PO1A 5ERGB 3R76A 1NF3A 3RCBA 4NECA 2XE7A 2OE2A 2G09A 2MYTA 2FPPB 5IN5A 1ECFA 2QL6A 2IX3A 4FWTA 1AXRA 1YONA 3ECSA 3NBQA 3A05A 3IDSA 1QRSA 2CEKA 2E4YA 3DYIA 3FFWA 4RK1A 4OM7A 4UNRA 5CFNA 3BXEA 1KU6A 2F64A 4ZEXA 3X44A 1SGWA 4TWJA 1ENZA 5CDHA 4CEHA 1DQSA 3SG0A 5EIEA 1ZEMA 4RHUA 1HDIA 1O1YA 3MJSA 1W0KD 3LDFA 3OTIA 4JK3A 2X23A 3JAWA 4GZ5A 3PI6A 5IK2D 1AUQA 1IJEA 1E1MA 2GX6A 3ASUA 3QF7A 2WJGA 4Q39A 3ZKWB 2ODWA 1AUOA 4FYWA 5B4TA 1ZUIA 4RCVA 4W8HA 4D43A 1M0SA 2P9QA 3FSRA 1JU9A 3PV0A 4R9SA 1XWWA 1TQ2A 2VLIA 3CZMA 4UHEA 1RCTE 4KQ1A 4TOIA 2RJ3A 1D6SA 4IXMA 1S3SA 4ND8B 4H6XA 2E37A 2JG3A 1MEEA 3TLMA 3R0JA 5FIUA 3QVSA 4MV0A 2IP1A 3M1AA 2P4EA 5BUCA 4I4NA 4DDWA 2BMDA 4NDAA 4YUVA 1SUEA 1X1SA 2E5WA 4KQGA 3QUCA 4UTVA 1DBIA 5E7IA 3ZWAA 5FOSA 2ADMA 3H1GA 4BFUA 1FTGA 4YVFA 4YAKA 1WVIA 1Z6QA 5FPHA 1V5FA 4ISCA 4ALIA 1DJQA 4QBIA 5L3SB 3W1WA 2ANCA 2AEMA 3DPSA 4GOLD 1I6MA 1LGYA 4A6DA 4B3DA 2C4MA 2QTBA 3GLFB 5FWXB 1GRQA 5TR9A 3FXAA 4JGIA 3VKVA 1NVUQ 2O1EA 4Q82A 4RANA 3BREA 1I2BA 1YDWA 2AWOA 1W94A 2CFCA 2ZDQA 4JBWA 4OQLA 1X74A 4RJKA 5H4GA 2ZUUA 2HLHA 1U0GA 2QVZX 5IW8A 2F1HA 1UQUA 1SOAA 1K7XB 3L8YA 4ZVVA 3W8DA 1BQEA 2UZ4A 4WXRA 4CCYA 5JFGA 4EQ6B 1E3WB 1GFIA 4H0CA 3HM2A 3KR2A 1OROA 4KNVA 3UCEA 3I8SA 2XZTA 3RV3A 3JD4A 1A4RA 3WLPA 5BSUA 2H18A 3TI7A 4P0TA 2BFNA 2OFPA 1TYBE 5AKXA 3RWOA 1TD1A 2XI4A 4Q3AA 2FG5A 2XEXA 2WVHA 3HBFA 3L6RA 2CLLB 2A88A 3NPAA 2VRCD 5DI3A 2IU0A 3WRXA 3ZZ0A 3PR2B 3T0IA 2RJNA 4G1CA 4WMLA 3RG8A 3QUBA 3G2NA 4NCHA 3GGSA 4DQVA 2YZNA 4L9AA 3LL4A 4WLOA 2PMDA 1QGUA 3AVPA 1QIIA 1IG0A 2CFSA 2GD2A 4GYKA 3KWLA 3DAYA 1MPXA 3SS9X 5F12A 4BX2A 4XOIA 3O8QB 3H9BA 1ONBA 3I58A 4HLNA 2OXCA 3I2JA 4OSOA 1BCSB 4QUBA 3PWTA 4F4FA 1M8KA 1T8UA 5AVQA 3K9CA 4WOBA 5EJGA 1X86B 3IRUA 1NXOA 3A9SA 4HFNA 4BMYA 4EA7A 3ZWKA 1IBMB 4MVJE 1LTQA 2WICA 1W88A 4RKWA 1MC5A 3C5VA 1NQAO 3T5PA 3UAYA 2NSLA 3SN6A 5FPKA 2AS0A 2C7GA 1YB4A 1G7SA 3R5SA 5IH3A 4JX8A 2IXDA 2I9PA 2W2TA 3IBTA 1FMJA 1TKBA 1K5GA 2V7EA 5IFKA 1L3BA 1EBUA 3DCJA 1WCXA 1KYVA 4Q6BA 4ZI5A 1R0KA 1M8GA 3GJZA 4UD6A 1ZM4A 1MNQA 4A6PA 4AIRA 1NXTA 2I65A 5IYZA 1Z5NA 1KKLA 5KVVA 3KG2A 4UFNA 4UBOA 2R6FA 1H65A 2A0XA 4NOJA 3V9PA 2Z08A 1JQEA 2YBEA 4LVCA 4PCLA 1PU2A 4GKAA 5AI4A 4EB0A 2BDUA 4HH1A 3AUAA 2ATEA 3UH1A 1EHIA 3H5TA 4NZZA 3OJFA 4GQIA 4DKXA 5H82A 4PNPA 4HUTA 5C32A 3MMPA 4O3FA 3KVRA 1GZ3A 4I4IA 4QYSA 3ENWA 3RUPA 3FTEA 4C4OA 1C0LA 4HLDA 1QHNA 1Q11A 3TL3A 2XB9A 2BZSA 3Q6MA 4Y1EA 1JXOA 4GMGA 1OAOA 3OESA 2DTEA 3SKYA 1NVFA 2XVMA 3BYZA 4L72A 2JGKA 1T9GR 2W2NA 1T0HB 1XXHB 1EGVB 2NZVG 2Q3EA 2WMYA 1WETA 3KWMA 1WCIA 2CYCA 1NXXA 2ZRMA 3L7DA 4HAOA 2X8JB 1T9HA 3OFJA 4X97A 1A71A 4II2A 4K9MA 5AK4A 3SE0A 3WL3A 2BWJA 2X0DA 1TF2A 6REQA 2O07A 1ADBA 4Q47A 1QO0D 2GJ9A 1GG2A 3VR1A 2XCIA 4JASB 4N5HX 2C94A 4DUGA 4LK3A 5CURA 1Z5ZA 3OETA 3V55A 3HKCB 2O3TA 5L6LB 3RAEC 4YAFA 4MVXA 2D2EA 2HA7A 4MV8A 3BERA 4BNTA 3JVDA 4URVR 2O4CA 1DC5A 1L4UA 1Z2NX 3UATA 5AVVA 4RHEA 5LLDA 4XEUA 4Z54A 1N3IA 2FE4A 3FB4A 5DT2A 1TQHA 4B4WA 1JLSA 4Q9JA 1ELOA 3KSAC 5HJ2A 1NOKA 3EEBA 1I4OA 1OIWA 1U2ZA 5EJAA 4B6EA 5HKKA 3A1FA 2ZRQA 3PYLA 16PKA 1MQ9A 1NC3A 3JQAD 2FW7A 2HTEA 1PJAA 4JLOA 1T5TA 5DTIA 3SHWA 1OWPA 4JENA 2OXRA 1N32B 5DI9A 4MZXA 4ZO4A 2OV6A 2LXNA 4OV6B 4RPIA 3GRUA 5ALNA 4EVQA 1AQIA 2PYIA 3IAEA 4HEA6 1TVKB 2IGBA 2ORIA 3EF3A 3AONB 4UUQA 2Q27A 3SQOA 5HR5A 1O96A 1BS1A 3IBSA 3ETEA 4ZQHA 1YB6A 1UFOA 2JIBA 4J0KA 1VBMA 2BGUA 4LMPA 4R6WA 4U9IS 3HY3A 3GJQA 4KKXB 4B3SB 1T13A 3HB1A 4N82A 4XQ9A 5FR1A 2VEDA 3QIAA 3T4UA 2Q1TA 3NFYA 4JP1A 5JQGA 2BW0A 1P45A 1PUXA 4L9SA 4LG1A 2OM6A 4LX0A 3U81A 3PNLA 2JJQA 3K7EA 2JGAA 1X9IA 3QXGA 5F9MA 1W96A 3OM0A 2XJ4A 2NWQA 2R5WA 5AP9A 3FSEA 4Q3KA 3LUKA 3MUNA 1VTKA 3TFWA 2WC1A 1GSOA 4MDHA 3DO8A 2VJAA 4TRRA 2DY1A 2XMRA 1OUMA 4P53A 5ICFA 1LCIA 3WLHA 4GC9A 3LWBA 4L4ZA 1JIVA 4TXMA 3X1YA 2LTAA 1KK0A 3OJEA 2O2EA 2H4JA 3DQZA 4GR9A 4YIHA 1NSFA 4ZT2A 3L4SO 2Y93A 4IBOA 1XF9A 4AS3A 3OKCA 3LUPA 4RIIA 1VBKA 2W2XA 3PVSA 1W4CA 2XAAA 1VFPA 2XUDA 1RYBA 3PJEA 4O2BA 4PVCA 4QYXA 4RMIA 3A11A 2X7JA 5EN4A 3ZGOA 4BWGA 3THXA 2O2DA 5TIIA 1FOEB 1AOXA 3BJEA 3HU5A 2DM6A 2VJOA 3QBJA 4MS3A 1YE8A 2EDCA 1EB9A 4NCXA 5E1BA 5REQB 5AKGA 1T5DX 3O21A 4W9MC 1PSDA 3AL0C 2VPWA 1K68A 4WFQA 1PDVA 3T1VA 4BJ6A 3COJA 1BDIA 1U1IA 4AKIA 2VNHA 3VR0A 3NIFB 2EKZA 5TQ0A 2VJNA 5COBA 1R8YA 2JBAA 5T6MA 5IT9A 4AY3A 2VP0A 1N4DA 1T0IA 3DB1A 1E3LA 1EKXA 4LHXA 5LBUA 2ZWIA 4U9UA 4DLAA 4P4SB 1SKMA 4KJXA 3CUWA 3VNSA 4OHCA 3AESA 2VA8A 13PKA 2GHIA 1NWCA 2AIRA 3ONVA 3TDMA 3L8HA 3MCWA 4K6KA 4ZQIA 1BWPA 3AY0A 4AQYB 1JYFA 1Q2UA 2A0WA 4HGPA 3IP7A 4KLCA 5EHQA 3ZHZA 3I5MA 5J1SB 1ZR4A 3DPIA 1I1QB 3FF1A 4JLBA 3BGIA 1NURA 2CUTA 3JQAB 4BJ3A 3F4BA 3N2EA 3ETNA 4MWEA 4R98A 2QTZA 4KH0A 3UWMA 4DDVA 1SD1A 3A9CA 2HIMA 3O4JA 5C8VA 5EJ6A 4IIXA 4KB5A 3VQTA 1YVEI 1Y5IA 2IE0A 3H1EA 2LE0A 2TMKA 1A69A 4M89A 1NOJA 2ECKA 2J3MA 3C2QA 4HAVA 2P67A 3L7LA 1J24A 1NC1A 3UMGA 8LDHA 4P98A 4YMGA 1ZLYA 2MT9A 4BYMA 1N2HA 1L1RA 3W79A 2P40A 4MWBA 4HH4A 4YACA 5FH9A 4LMBA 1GT91 4ND7A 3THYB 3LQ1A 2MSCB 1JA9A 4NU6A 1IHDA 4LJ4A 4NHOA 4BVBA 1N7HA 4Q9DA 3JX9A 4MYRA 1H2BA 4MI1A 1V7QA 2GAOA 1XL0A 3AXTA 4QQRA 5EQFA 3R8CA 1OLOA 5AHXA 2J9RA 2FN9A 1KU0A 2W6ID 2BIFA 4IV8A 2VF7A 2YHSA 3VNAA 2YR0A 4KLZA 4IJUA 1A5AB 1IVNA 1I2DA 4H7HA 1Q12A 1V16A 2HFJA 4XX0B 4U7PB 3S2GA 2ZUFA 1B23P 2PNFA 4IWXA 3N8DA 3P4XA 3CUUA 3CZ5A 4R2XA 1NVAA 5CVUA 4JSYA 5KAMA 3EB9A 4UU7A 4ZA2A 4CFSA 1H3FA 1F4LA 3GROA 5HQ3B 3IAS1 3QEMB 3AR7A 3WE7A 4K9QA 1QHIA 4OP1A 5DJ5A 3RS7A 1B0UA 1WXEA 3BB1A 3M6WA 1PLKA 1P44A 4GRDA 4JYCA 4LGCA 4OBBA 3BCHA 5EJ8A 5C1DA 2QAGC 2JIZA 3EBLA 4MUNA 1SAYA 3KUUA 5JU6A 4LRUA 1DHTA 5A9SB 5JMTA 1IB6A 1YR7A 1ZJZA 2YV5A 4JEUA 3J80A 2QNIA 4EKEA 4WFJA 4OHVA 2INGX 1OGIA 1P5ZB 2A4KA 1E0KA 1P0IA 1R66A 1YBAA 3CNOA 3H16A 4JYBA 3ADBA 4NZYA 2YWJA 5DK4A 5AVYA 3IPXA 2R0QC 1TZ2A 1A77A 1G8KA 4WZAA 1D6MA 2C00A 1BH6A 3G8BA 3HBJA 1KYIA 3PQ3A 4R3WA 4XUCA 1KOGA 3TOXA 3OOYA 3FUVA 4DHEA 4KPEC 5HCUA 4ZGWA 1VCNA 3DE6X 1BD4A 1NI5A 1UODA 1BC5A 3TUZC 4C4AA 1AGXA 2E6UX 1SQGA 2B61A 3PICA 2P8JA 1KSFX 3GT3A 3GVIA 3RR2A 3HDHA 1JF8A 1FU8A 2G5CA 4LBZA 5EKDA 4BKUA 4JB8A 4GXQA 2QQEA 2QLMA 3CLRD 4EENA 1TADA 1JSCA 4DZZA 4A36A 1BDMA 3EXG2 1T5IA 1NF9A 1JGTA 2W93A 1SUDA 3EVZA 4QM6A 1E60A 1ES9A 1NUSA 1XUOA 2RB5A 5EHGA 2Y1LA 3JAKA 3R5TA 4DR6B 1D4FA 4RA6A 4ARBA 1QGUB 4ICIA 3GLFE 2O3QA 4UTXA 3HB7A 5CPBA 3X43A 3GFBA 5BV1A 1A9SA 1IQPA 1TJYA 2QLJA 4UMFA 1LVGA 2PYDA 1IUKA 3QENA 4RE6A 3S70A 2GPTA 2PR7A 1U0SY 2XUAA 3DE1X 1WDTA 1TQ6A 1KNQA 3TBKA 1QANA 3KOZA 3PU6A 4IJVA 4ZEMA 1W88B 2FQWA 1WWKA 3ZQUA 2DZDA 4LQLA 3M4JA 4BB6A 4MUXA 4GM4A 3FR8A 3KEFA 3KSZO 1YFLA 1FS4A 5JD6A 2D5AA 4E7OA 3CNNA 1MJHA 4U9HS 1JEEA 1Q7RA 3UJHA 2PYZA 1SWVA 3QOFA 1JUDA 3ND6A 4LVNA 3ZVRA 1A4UA 1Q95A 2Z2KA 5L3ZA 3UHAA 1UBLS 1XTBA 1DXHA 1UC5B 4LDNA 4A2CA 4AJEA 2IDKA 3LQ4A 5IU6A 1I14A 2NV0A 2VSQA 4YXWA 2C4VA 2IHUA 2E82A 4BV8A 3K1TA 4D44A 2G76A 2FH5B 2OFWA 2VIIA 3OIDA 4OI0A 2KE5A 4L0CA 1CKEA 4N3BA 3H0CA 2GEUA 2JRLA 4HVTA 2O8DA 1N2OA 2LVBA 3E9RA 1S4QA 3IEIA 3OH8A 5HM6A 1RYNA 4LY9A 1TEHA 4PZUA 1JQDA 4KODA 2JIZD 4JEMA 3WK7A 2J3IA 3CEMA 2EQBA 3KAJA 2FPXA 2C9MA 3S28A 5JHHB 3BGOS 1EYZA 5TE9A 4EHNA 4U2CA 1NV8A 2EFGA 2QD4A 3BTSA 121PA 1XD2B 2VPQA 2GKSA 1QE0A 2C0PA 3B6MA 4CZ2A 4L57A 1AO0A 1ABEA 5ALDA 1NF2A 1L5HA 4BZWA 2I22A 4H6WA 3OKFA 1WHSA 3OSUA 5AM4A 1IY0A 4L3OA 3DNPA 1KRHA 5JDCC 3FPSA 2I1VB 1KZYC 1F8YA 1XHFA 2D06A 4OPMA 3ORYA 2IVFA 3S1LA 4B4VA 1DQYA 4TKVA 3MGKA 1Z4QA 5KTRA 2MINB 3ELBA 3KSRA 4XKJA 3QVWA 4PYNA 2WTEA 1OBVA 2FEMA 1Y7LA 2Z9CA 3O8BA 4FNOA 5ESXA 1UXHA 2AWNA 3UM9A 1N7JA 3OY7A 4IRUB 2H1VA 3TDKA 1ADGA 3GJXC 5FEUA 1OH5A 1NVVQ 3ZHCA 1FXWA 3PHJA 4M9RA 2ZOSA 4P7GA 1E5QA 3IVMA 2YZGA 3VSBA 1JTVA 3H5RA 4UPVA 4BTLA 2YASA 5CFZA 2BGWA 4W99A 3TRJA 1J2JA 3FRIA 3V33A 5CFRA 3DLHA 1T8YA 1LDNA 2Y2VA 3OPYI 1NNUA 3GG2A 2H1OA 3OLXA 1JH8A 1V43A 3FHLA 3IV6A 2RMKA 3O9MA 4PICA 4JD5A 4UTRA 1RAFA 3ABZA 3MIIA 3NIBA 1BE6A 4BFTA 4EHHA 2YWHA 4RJTA 1M8FA 3BMCA 4AY5A 1HT2E 1Z25A 3NCTA 4LBVA 3INTA 1QHFA 3CUSA 3I23A 4Y2TA 4D26A 5BSTA 4D9KA 3V7NA 2C5GA 3LT5A 4FJ2A 2HRRA 5IAAA 3GWGA 1CT9A 4TTQA 1IWOA 2KS6A 1GADO 2Y9PB 3FZGA 4HWPA 4NONA 5CA1B 2C5FA 4GSLA 4CUJA 2GN1A 3OT1A 1XZDA 1OXVA 3UGKA 4BJHB 2P4QA 4D9NA 5FDFA 2ZI9A 1DV1A 2BAGA 1DIOB 4GI3A 3A1WA 5BW8A 1SKYB 2PSJA 5IG2A 1RXSA 2ZWMA 3E1KA 4H31A 4CTOA 3FKQA 1DC8A 1ZBDA 1I5RA 4M55A 4N47A 2HA3A 2XE8A 1ZMRA 1FDSA 4GIBA 4MS1B 3KQUA 4D8VA 4EG5A 3DV9A 1RE1A 4MYHA 3E9MA 3VTFA 4BVFA 5AKYA 2IV7A 4LGVA 1VB5A 1WMSA 2BGIA 1P18A 2D5IA 2FOLA 3WOHA 3WWPA 3KBOA 4EBFA 4HWRA 4TMTA 3WVNA 3SQXA 3EGDA 4M7RA 3T41A 1P19A 2ZIVB 1RHRA 3ND9A 3QXXA 2F55A 2NQTA 3A6PC 5KVCA 3N0TA 4EY7A 5AOCA 1W5SA 3QOYA 4EGJA 1WD7A 3TSOA 5CGZA 3A4VA 1E62A 3LYAA 2W2MA 4MLDA 4BVJA 4LZAA 3KT0A 3HVUA 2M6KA 4CLEA 1JKIA 4Y2RA 3DUFA 4A82A 4WBNB 1ISHA 2OZPA 2Y1CA 4RIGA 2NUAB 4G56A 4MAAA 4OQEA 4Z1MA 3VOSA 3OU2A 3QVLA 1HYBA 4HTFA 2FX2A 1GQQA 1OWMA 5HK8A 3ZD6A 2JLAA 4AP9A 3KB8A 3QRWA 3AO0B 1FTWA 4IQ8A 4Z3DA 2DX7A 1K3UB 1P5RA 1Z36A 4GZ3A 2NO1A 1JFTA 2VDPB 4EJSC 1FFDA 5DGXA 4PINA 2RC6A 3JCZA 1JV2B 4GI1A 1YR9A 4ZOBA 2GPNA 5D01A 5I7WA 2R7AA 1Z82A 1NKTA 3HWSA 4FZJA 3SC3A 1SUPA 1MABB 2EJUA 2TS1A 3DS8A 3LQYA 2VYQA 4MB2A 2PFKA 4TRJA 4XGIA 1X2BA 4TLAA 4KQXA 3RRZA 2F3SA 4QQKA 3D1JA 3RVPA 1GUAA 3LW7A 1BNCA 1QVWA 2Q9BA 2FV8A 2V4UA 2X1LA 3HZOA 4NYJR 4XWAA 5H1YA 5IBQA 3U61B 3ETJA 4EG4A 1BQ4A 2I34A 4OVKA 2VJQA 3BE5A 4GWGA 4IMPA 3RBXA 3I5XA 2CLEB 2NT4A 1RIIA 1CWUA 3GN1A 3RRBA 1P73A 3ME5A 3PC7A 3HJTA 1HLGA 5J4HA 2C97A 1NASA 4N8DA 4KIFA 1U8ZA 5LXTA 1EA5A 2H5EA 3CURA 5JBQA 1M6EX 2AXEA 2QN9A 3CZ4A 3OLVA 4JR2A 4WN9A 5AVXA 5HMLA 2UZ1A 4B40A 2XLCA 2FR8A 4JT8A 2QD1A 3VNUA 4XASA 4DQKA 2UU9B 3RRXA 4CLHA 3E3LA 3A1NA 2OYRA 1P5HA 3N2IA 3I4FA 2G9VA 1Y1QA 3A2NA 2HA0A 4A1OA 2PR2A 2QAIA 3UAZA 1X7HA 4MPDA 4YRIA 2HCBA 4YJ2F 3R0QA 3RFVA 1RACA 4K40A 1M1NA 3M33A 2O2HA 1SVUA 3FMOB 2GF9A 2RGEA 1AKTA 3DKKA 4IH9A 4DUGD 5T67A 3QTLA 3PE4A 5T4FA 1ZD1A 5IH7A 1MOZA 1Y81A 1E4EA 4OA8A 3M6FA 1NDHA 2AT1A 5F1PA 4CLOB 1APBA 5IT0A 1HNXB 1KZ4A 1V1MB 3EVDA 4WZBE 1V16B 4OB6A 1SVKA 4X45A 5U1PA 2C03A 2AZXA 1OXKB 2QIOA 2HV9A 1FL9A 1UZUA 2WABA 3PD1A 3W5UA 3KTDA 5G53C 2WUFA 3Q10A 1YQQA 3DT9A 1JJIA 3LPMA 3GZ4A 4ZTBA 2CK3D 2NNLD 2Z3ZA 4BGVA 1JQLB 1JMVA 1IVSA 3ILXA 1CRQA 2BF7A 3O47A 4OXXA 2WTXA 4GECA 5CIWA 4ONEA 3KT3A 3ZGYA 4D56A 4AL4A 1T6YA 5HG0A 3WP1B 4JLVA 2I62A 3UT0A 1PDWA 3VSEA 1YQDA 3GH1A 3LIIA 2COKA 2EF1A 2A84A 1ZYUA 3IX7A 4MWTA 4C14A 3A31A 1P9LA 2A9JA 3B9PA 3FNQA 1LF0A 1THZA 2IBSA 1YQEA 2GESA 1ZIXA 2ZRNA 1AD2A 1BDJA 1B0AA 2FZVA 2HEGA 3JYOA 1GSAA 4KMSA 4QEDA 4RVFA 1GTZA 3AHHA 3TGWA 4BWYA 4YP1A 5C5EA 1PG5A 4ANFA 3KUCA 1UM8A 1PFVA 3BSFA 4FBLA 2ORYA 2BC9A 2V5AA 3FB1A 1W52X 1CP3A 4UBKA 5E4YA 2WOJA 3LUJA 4CL8A 1C4XA 4TYYA 3QKUA 4OREX 3PXBA 1Z26A 3TCXB 4ESEA 3UHPA 4KIJA 5FTLA 1YZVA 4RNCA 2RHHA 3B7GA 3QKRB 1Z6TA 4MW4A 3R74A 1CQZA 2G1UA 3X1XA 1UZMA 2F3PA 1A8IA 1KJIA 4COOA 4J9VA 3WFZA 3AJ8A 4MRNA 1NT2A 1Z4LA 1EINA 2ZBPA 3IQXA 1J07A 1GRRA 1HQDA 2JKYA 3M5DA 4RGBA 4DXHA 4UHKA 1DJOA 3GU3A 2XUZA 3DBRB 3QJYA 1YIDA 2DP4E 2WJWA 4ZC8A 1FJGB 4IIUA 1W59A 3EH1A 3HFSA 3WHPA 2GZSA 1VXRA 1FQWA 3FJYA 4ZWNA 4H6PA 5C53B 3P9NA 4M1QA 1Z5VA 3IHTA 1JDPA 4S24A 3STYA 1E1YA 3T3MB 1IY1A 1VKRA 3AEYA 2CLDX 4CFYA 2GN6A 1XJCA 3N8NA 2ONYA 4FSHA 1I4DD 2SHKA 4EW3A 4WV3A 4M6WA 1N4AA 2EIXA 4P7JA 1IIBA 3R3HA 2N75A 3PE6A 3W77A 4RS3A 4EKNB 2NU6A 2DUUA 2CNWD 2V7XA 3EZNA 1TO2E 4BZXA 3TNYA 1MO5A 2BVNA 2C9ZA 3H0KA 3Q8KA 1WXHA 3MIZA 4RF4A 1BX1A 1IBSA 2NIPA 1RT9A 2ZBGA 1J33A 3DT8A 5EJ7A 5KVAA 2Y99A 4B6GA 3RBAA 3D8BA 1KOFA 3R6TA 2D3TA 4HQ6A 3UT5A 3FMFA 4E15A 1F51E 1C30A 3X2EA 4EJSA 2HJ9A 2RH5A 1XZGA 2YC2C 3LUCA 1Q0SA 3G2OA 4QQNA 1F6BA 4NE9A 4HNAA 1G8FA 2XKKA 5E6RA 1GDHA 3KFVA 1BXZA 1CX9B 1DKMA 2H57A 2BFWA 1KO4A 1UJMA 4M7PA 4K1XA 1ZGZA 5IJXA 5AW9A 3VI3B 2OD9A 1Z4NA 3U4AA 3W9BA 2P2LA 1LTHR 1W34A 4M9ZA 3WNQA 2Y27A 4B43A 4BQQA 2P65A 2GZ2A 3LFHA 5F4ZA 3MFYA 1JG4A 3VH4A 2NVOA 4L4XA 2X4IA 5SZJA 5I7FA 1XK7A 4IGAA 3SQNA 5GADl 3GDHA 2E7ZA 2AW5A 2R1TA 1E1QA 2WVJA 4NYIR 3FYCA 5F21A 4EYKA 4IUDS 4KAJA 1V7ZA 4I3GA 2GK7A 2SCUA 3E18A 2GUGA 3K1ZA 4U8HA 3TSWA 2O9JA 2PH5A 1LDYA 2Q4EA 4IIYA 1Y3CE 2W6QA 3UENA 1USGA 3BZWA 3ILVA 1CR6A 5IASA 1KRWA 2KHZA 1SUCA 1KP2A 1CDDA 1H42A 3USCS 4CKZA 1M8JA 4PSUA 1Z5UA 5DTRA 4A0GA 1Q15A 3UMCA 1Y1RA 1Y6ZA 1SFRA 2V9CA 3Q3GE 2ERXA 1IHUA 1U7UA 3C5CA 2WF7A 3LSYA 1HTWA 4O4JF 1BEUB 1Z5PA 2HMYB 2IOFK 2WKPA 3E7PA 3QNWA 5F51A 1Z9BA 3WLFA 5LKAA 4RSRA 1S2OA 4FMPA 3SM3A 2ZGVA 3TQRA 3M1IA 1JJFA 4MQFA 5TEVA 3VR2A 4W6ZA 3CRMA 3FF4A 3HDTA 3T5GA 1EXVA 3VKHA 2GBGA 4ZFNA 1I4EB 1V47A 3KJHA 1C0IA 2V6MA 4PBTA 2BHSA 1RP1A 3DR3A 3JZDA 5EQTA 1KS9A 3VV2A 3LMKA 3FUXA 3HJFA 1RC0A 2CJPA 1XQVA 1Q7BA 4JH0A 1RJEA 3K9HA 2I54A 1J2RA 4YCAA 2W8ZA 4JC8A 4NZNA 1GP2A 1A5ZA 3DTNA 1N57A 2HCRA 3ZXYA 2IZ6A 2JC3A 4XYLA 2OP0A 1PW5A 4FFBB 2WMNB 2RKBA 3FYUB 2NU9A 5F7JA 2HWKA 1GTMA 3SIWA 1EA7A 1CQXA 3GZJA 1U28A 2C2KA 4RMHA 2G63A 1P5FA 1G21A 3CNHA 3OY2A 5AW6A 4DWVA 4AS2A 3EYWA 1D2RA 3AY6A 4L3WA 4MLPA 2JK1A 5C8YB 1T9ZA 1XEXA 2W58A 4U2KA 4MP3A 1JFRA 3KXLA 5HBRA 3ELDA 4RWEA 1B73A 2RHCA 1SCNE 3FGZA 3AR4A 2ECPA 1R2QA 4D4HA 5IJ0B 1AKMA 4XJVA 3R2JA 3FHJA 4YMLA 4RL4A 3DEYX 4C0HA 2J3LA 5DTJA 4S05A 1WU8A 3V34A 1SQ6A 2WKQA 3DZIA 1E3EA 2ENWA 2NLOA 4X91A 4FOLA 4JHXA 3ZHBA 3RRJA 4UEOA 2NPOA 4MVJP 5IEBA 4E5DA 3UGTA 5E7QA 2IYSA 1V3QE 2FPOA 4PHFA 2D74A 3UB4A 2HL6A 1X7WB 4M0KA 4BVEA 3LDAA 1W0KA 2IOFA 3G0GA 4GR5A 4IIHA 4BFYA 2W9XA 3BF7A 4M3NA 3HYSA 4PX5A 4WD3A 1OZGA 4LFBB 5JH7B 5D3MA 1VKHA 2H4WA 3IAM6 1U2PA 4QTZA 2A9RA 3IL2A 3QE2A 5K3CA 3INYA 3PXCX 1QXSA 2DCMA 3O8DA 5IDYA 3ULKA 4YPOA 2PE5A 3OPQA 2WZBA 2IUSA 5JIBA 4UPEA 1U63A 3KEGA 3RAGA 3D4BA 4F91B 2W2KB 3ET4A 1XYVA 2VPPA 4IVPA 1UEXC 1S02A 1YZQA 4HGNA 5IN4A 3BD8A 4EJMA 3H1TA 2VHYA 1C0EA 2VUTA 3KUDA 3A26A 1MX9A 4LE0A 4PRYA 4WESA 1T4MA 4E51A 4BO7A 4R9NA 3T9EA 1BX3A 2BHNA 4PFSA 5ITSA 4HDQB 1PFGA 1ZXBA 3JARA 4OHPA 4H7JA 4JR0A 3ZQ4A 4BEBA 1UMKA 4EECA 5A6VA 2BFCB 2WMDA 2JGNA 3T0FA 3DDHA 2QD3A 2Y1DA 3IERA 1UDBA 2R8EA 3CB2A 4D97A 5DXFA 5B1YA 4QNNA 1J1IA 1FDTA 1E6EA 1V1RB 4KXUA 1DIGA 1SVIA 2EFCB 2ZJ0A 3IOMA 3IULA 5DISB 4BVLA 1PJSA 2ODEA 3K05A 2WQ7A 2DYKA 4RFSA 1RM4A 4G5SA 3BN3A 3KKLA 3BTOA 2XWQA 4L1KA 3TIXB 3VVCA 1G66A 2J6BA 1MB0A 3E22A 1QTQA 3U2QA 4FN5A 7REQB 8MHTA 1PYOA 3OZSA 1U7HA 1TPZA 1WEHA 3AETA 1NBOA 2ZATA 4DE5A 2J9FA 1WU7A 4KIWA 5ALZA 3R44A 1PVOA 1O97D 3N75A 5AOVA 1GAQA 1ZWLA 4YUWA 4BLQA 5AVWA 1D03A 3E4CA 3CJTA 3EC7A 1Q2XA 1E2FA 2H1IA 1WXWA 5KTOA 4N54A 2J87A 2RI0A 3A1DA 1U9ZA 1F06A 3HCAA 3M6IA 4A92A 5ANRB 3TW4A 3FOFC 2PLFA 5EEHA 3SU8A 1AX9A 2IZ0A 2PBLA 1IATA 4G9GA 3BHJA 1JKXA 4R1OA 4CV0A 3PEWA 4EO7A 1FJXA 5J3JA 1B26A 1QSGA 2VJMB 3EG9B 4KRFA 2G70A 1O94A 4WFIA 3W04A 5T8KC 4L5IA 5DYNA 1C1HA 4M2LA 1QQTA 1EI9A 2ZJBA 1GA4A 3IKVA 1ESMA 1QFSA 1J8QA 2HBYA 1M6NA 4G0MA 4ZT6A 1HEUA 1E1RA 3B9BA 3G23A 4KQKA 3PPVA 3OPYB 1TQ8A 3H75A 5KHAA 4QJBA 1YK0A 2IUTA 1LNSA 2BBTA 3FMVA 3ZG6A 4P54A 3VDRA 1NBIA 4DLYA 2BELA 3OZVA 1QHXA 3G0BA 4IJKA 1DIAA 3B7WA 1PK7A 4I5GA 3BMNB 4IUCS 4QL3A 3W6OA 3WAGA 4I5FA 4QJ5A 4ZYTA 4U2EA 1Q6ZA 5CAEA 4Z4QA 2E3JA 4KMMA 3THOA 3H4VA 5IHPA 1KMQA 3GK3A 5CNIA 3HJCA 2JCBA 2UUAB 3TW0A 5C9ZA 1DOHA 3F5DA 1HOTA 3X1MA 3KKKA 4BBPA 5KTYA 3KT6A 5BNWA 2BTQB 3DBRA 3DKIA 4TUYB 3MMZA 1YZLA 2E89A 3I30X 3QBDA 3A1EA 2AF3C 3CGGA 3UXEA 1SIUA 3GVHA 1B6TA 2QMZA 3TOVA 1UBJS 1LDMA 4NEGA 3UFXB 1U28C 4MW6A 5TX7A 3UQYS 4Q1DA 1AQJA 1GNQA 2XZOA 2QLBA 3VO1A 4ZI7F 5CXUA 3KWFA 5DGIA 421PA 5MHTA 2XDWA 3CEJA 2FLWA 4CRWB 1T0UA 2NUBA 5LQUA 3T35A 1VSBA 1ISPA 3TCNA 4Z9XA 1E1CB 1IONA 2XX3A 4TXLA 3H2SA 3ZLJA 1UBTS 4LHEA 5I9LA 3T61A 1IN1A 3AY7A 2A1TR 5GZ3A 5DCLA 4KR3A 3FNEA 3TGLA 4ZICA 4REQB 2AFHB 4O4IB 2QN8A 1G16A 1ZAKA 1KPHA 3RSCA 3UWPA 1E5XA 5CPFA 4AP6A 2EATA 1DG9A 3WDSA 3VKGA 3HQ4O 3ESDA 3WK5A 4BNMA 2AZ4A 3AQIA 3F6RA 4JUDX 2JCSA 1ORHA 4Q00A 3LWNA 4XTRA 1D1TA 5LBIA 2B78A 1DBQA 3I1JA 1SXJA 1LFAA 2J30A 4AJKA 4C06A 2XOXA 3T34A 3OQBA 3FCSB 5JFOA 4EHIA 4WLNA 1NIPA 3HJUA 1NLYA 5BUZA 3PEVA 2P35A 4H18A 1AUPA 1ZL0A 2HJGA 3D64A 5CDSA 1J0CA 3Q6NA 3SR3A 4QVIA 2D1FA 3FJ1A 3LK6A 2W70A 2GD1O 4H9GA 4CIWA 2L17A 2ZBDA 5KCMA 1UZLA 4R2LA 4UHHA 5CLFA 4K1LA 4JI1B 3ONWA 4M49A 4RBNA 2ZSDA 3OF5A 4FN4A 5L6MB 1NNEA 2C98A 2ZQZA 2D59A 3M6UA 4IM7A 3PCRB 4DLRA 1C14A 2G28A 1MC1A 3PR1A 1WQ4A 3V2HA 2PSHA 4F0JA 2QUIA 2DBZA 3KELA 4QNRA 1XMIA 2AX4A 3IPYA 4FK8A 4H60A 5JCXA 1HUQA 2UZ3A 521PA 2YWEA 1J8DA 1F3OA 4BC0A 2NUPB 3OTGA 3PC2A 5K3DA 5HKAA 2IYOA 1FFXB 3A1TA 5I9BA 4O02B 3RVRA 1K88A 1XXLA 3WWZA 3UPTA 1QV7A 4RZ3A 4M0MA 1GKIA 3HBLA 1NBWB 3DMFA 4B45A 2IHJA 4D4KA 1F0PA 4H16A 2FR8C 4G65A 4Q66C 3H05A 1IJBA 3BDVA 3OKAA 1T2EA 2G08A 2J3JA 3QU9A 4UZEA 5ALTA 1XLVA 3T1NA 2REXB 4D0GA 1KJJA 3G2QA 3H4MA 5KTSA 4XIGS 2VRNA 2Q8PA 4ETIA 5KNBD 1O5TA 2FTKE 5ALHA 5F23A 5IAOA 2Z9DA 1L7AA 2XT0A 1VJRA 3CEPB 4F2PA 1O6CA 2XY4A 3AR2A 1AO3A 1M0EA 1X8JA 1XN1A 2RHRA 4DIEA 1XZFA 4ZOCA 3ZGZA 3J81A 2ZJ1A 3DR5A 5B1EA 4HDMB 5IANA 2FPUA 2XTMA 2WUWE 2EGGA 2FRDC 5CCXA 2DUNA 3IDZA 3OZTA 1ZM9A 2BGNA 2YJ6A 3K4QA 1GAXA 4D42A 5BQ3A 3SFTA 5T3YA 1X1CA 2PIDA 1FIUA 1QVAA 3EVCA 2QQGA 2IZOA 1MO4A 4Q9IA 5JO9A 4UOEA 2IYQA 3DTVB 1ZGAA 2NSJA 3G2KA 4LRYA 2OORA 2E4ZA 4TZKA 1BE1A 4BCBA 4L5CA 1Z6ZA 2O1SA 4ITVA 3ICQB 4IIDA 4OIMA 3O8NA 1QTRA 4RFLA 4C4YA 5AESA 1J8MF 4GH5A 2O06A 2HHHB 4PS0A 5I7EA 1D2EA 2V6FA 4HBGA 4X90A 2CL0X 2V59A 4R51A 4C3ZA 3FYUA 4HN4B 2NU9B 5CW2A 1CFJA 3Q9UA 1DRKA 3GUUA 2HMSA 3N2ZB 3QVKA 4X20B 3SI7A 5EIXA 1T6XA 4OU5A 2GILA 2AN5A 1G21B 1XCLA 2ZE7A 3K0HA 3L7YA 3O7MA 1BW9A 3LNTA 3G7NA 4X7RA 4BMNA 1TYEB 4LRXA 1ODFA 1Q83A 4B2YA 4W9RA 2M6SA 3NNDA 1AHHA 1PJ3A 2IYXA 2PT5A 2QVCA 1NV9A 3AIKA 4MVJA 3ZR4B 5AVUA 5MGBA 1LKZA 4HX2A 2IKQA 5IJ0A 3D6FA 3FFXA 3NTXA 3NALA 4KV7A 1GQRA 2V0GA 2WNHA 3AH8A 3AF1A 3IJRA 5IUNC 4RD2A 4YP0A 3KQQA 1E3DA 4H7FA 2OYSA 3CZCA 4IDEA 2JLWA 3OQNA 2IXTA 3ONEA 4G89A 3RTCA 1Y4DE 4IJ5A 1P8AA 1WEKA 1TF7A 2HSEA 4LHZA 3HCPA 3VPFA 3WOVA 3OMLA 1COWD 1AZSC 1HZZA 4KSBA 1TCCA 5JH7A 3NFRA 2VDNB 4AG3A 2F6RA 4MUYA 4UASA 4IOLA 5ULLA 2Z9BA 2VT7A 4CG0A 1EDDA 1JS1X 4Z0TA 2EAUA 3GCZA 4B34A 3GR6A 2ON6A 3CY6A 3H18A 3HA3A 3HO1A 4MOWA 1DRUA 1JWBB 4M54A 3QPUA 2CT8A 1ATZA 2SKDA 3LT2A 4OY3A 1V4BA 2WUDA 2RGCA 2Q9AA 5BN5B 1FXUA 5DYWA 3D6MA 2AR0A 1E7RA 2W7TA 2P9YA 2JLSA 4R1LA 1GGVA 2XE4A 3OQPA 5IMBA 2IUUA 5IPFA 1PWYE 1UT5A 2F59A 2PZAA 1DGQA 3K92A 5JRDS 1CZNA 3OM9A 1N34B 4DYVA 1OA0A 3O2JA 2CZCA 5TNXA 5KI6A 4CYMA 4IDPA 1VLZA 3JARB 3F5SA 1F1BA 3OMXA 3ICVA 1GCGA 1NMZA 4HYQA 4FR5A 1ODJA 1T8SA 4HLCA 3ZBUA 4CV2A 3ZXIA 4KQJA 2XRYA 4CHTA 1ZJJA 3RWBA 3GAFA 4YQFA 4QOIA 1R9NA 3UMFA 3K2IA 3IH5A 1C7JA 2OP1A 3K1AA 1AJEA 1LD3A 1V2HE 3MZ0A 1NAHA 3EARA 3O83A 4M4SA 1IEVA 1V1RA 3AL2A 1EJ2A 1L4MA 4M8KA 3WRXC 5KMGB 4AO8A 4FE3A 4GHWA 5F4BA 4B1FA 4AYWA 4HD8A 1XTKA 2CC2A 2SNIE 2XPCA 1FTNA 2AJTA 3BIFA 2E21A 3CN9A 3D6AA 5FT9A 2H29A 1JEDA 3BBPA 3KLNA 4OLHA 4RL6A 5H5JA 3GJ4A 3M82A 3E22B 4OL9A 3RKSA 4EO9A 5LYJB 4ROSA 2GK6A 3O82A 4E12A 1GNSA 1PN3A 2QU8A 5KJCA 1M75A 3AETB 2W6JA 7MDHA 5F64A 4EF4A 3ZJVA 1LK7A 4QTUB 1JQBA 4PYLA 2C2MA 4IXDA 3QEBZ 2MCFA 4QIHA 1T34A 1D1PA 4JUIA 3KQLA 3BSYA 1YC2A 3ZHUA 2V7PA 3IHLA 1KK1A 4HL6A 4DEVA 3P97A 3KO8A 2W71A 4URYR 4ALNA 2Y92A 2CXRA 3KOYA 1GQSA 2VO1A 1E2EA 4FJ1A 5DCWA 3M81A 4B7UA 4CM8A 1I8TA 1QGAA 2UDPA 3ZCTA 2P27A 3CBGA 3LLCA 3FKSA 4GEKA 1A9ZA 1XEWX 1PHPA 3LV8A 5BVGA 1CNMA 3C7DB 5JC1A 2BH9A 3PA8A 2VJMA 3AUJB 1WUTA 3EG9A 2AVDA 2AB0A 1G20B 3DV0B 4RE5A 3R9IA 4FCTA 4OUDB 3ZY5A 2AKEA 5JNTA 4WEOA 4AD8A 2A7XA 3PKIA 4EMTA 2PM8A 3GZTB 1XJ5A 1YKSA 1TJPB 2COUA 4NU8X 4OL0A 1KEVA 1GGEA 1E79D 5AQ1A 3LP5A 5BVHB 1MUUA 1JIJA 4EMSA 1N5MA 1KVQA 2QK4A 1MX1A 3GBPA 4N7JA 1XCJA 3ZLBA 3EULA 2JLRA 4F1WA 3J81k 3CZ9A 4KWCA 2XNJA 5AK3A 1L8LA 4FYHA 2ONJA 4CM4A 3T15A 5ITZB 2GDZA 4KXNA 4YGYA 5I5EA 4JJAA 3L3BA 2X77A 1A7KA 4FMDF 4CWAA 4JBNA 3E23A 1DUIA 4JDUA 2C2HA 1OKKA 2VHUA 2RI1A 4MR8B 5EWMA 1P2VA 5DBGA 1FMFA 2ZRGA 4OHUA 4OFZA 1EM8B 5F33A 1EWKA 2H1RA 3BG5A 3MOSA 3P0HA 1VJ1A 4LCBA 1NWHA 3VR6H 2R5NA 4IY1A 2OV4A 3FPKA 4X62B 4NBRA 4KL8S 2ECQA 1KBZA 3U9SA 5J4LA 3QPAA 5FTNA 4WDRA 3WBFA 3AUFA 3PGKA 1AS2A 1MGPA 5EJ5A 4AJLA 2WTUA 1U0NA 1FYFA 3WGMA 1YDHA 3DZ8A 5CHEA 4BMPB 3L6DA 3EPPA 3RC2A 4XVUA 2YS7A 3OT5A 3PUIA 2YWGA 2IWHA 3AVOA 5JD4A 1W8IA 1VIVA 3HCFA 1NONA 3CVYA 2DLDA 4B3JA 4GZMA 1TPYA 2GJ4A 2J6IA 5A06A 2XZLA 1PBNA 4LZPA 3MCUA 1SHUX 3DFFA 3HI6A 3K9NA 1FYWA 5E1OA 3TD2A 4N0QA 3AM1A 1FLAA 2WFLB 1R4ZA 2NYRA 3H8WA 3IPRA 1GGKA 2O8FB 3OD1A 3TL6A 3NDBB 3MOIA 1WQ3A 2Q49A 4GRAA 1O89A 1W85A 5EESA 4ZV4A 1Y8QB 1U7XA 1QFYA 3TLEA 1BDHA 1AS0A 1DB3A 2ACVA 1AC5A 2ZIGA 3CISA 1QF7A 2GAIA 2H4ZA 4PO8A 3VBCA 4YWHA 3WIDA 3VR5D 4E7PA 4HGZA 3ER9A 1YB7A 1XRPA 1F8GA 4PF1A 4PG8A 1W19A 5FADA 5IZ4A 4TV8B 2Z8ZA 1HWYA 2JFBA 3IAFA 2C2OA 2JDIA 3CXRA 1BRMA 1EP3B 2AE1A 4CM7A 2E4VA 1D2HA 1DADA 4R81A 1ZUNB 2PGIA 4F06A 4PC7A 2VK1A 2VFAA 1MOQA 3C5HA 3NGMA 4EUHA 2F1OA 5JYBA 3EXAA 2AVNA 2NXJA 2YMPA 1PJLA 4ZVUA 2BJVA 1W36D 2EKLA 1W44A 1DMRA 4RTPA 1T8PA 1IQ0A 3E82A 2H4HA 2NUPA 4Y0NA 3EOAI 2HNKA 2QRQA 5I47A 2ZTHA 4Y7CA 1UJBA 3EMBA 1CG6A 4REMA 3GEMA 3AF3A 4DWJA 1EK5A 1MAHA 1SU8A 2C96A 4EG6A 5ELLA 3RAFC 3H84A 4DIDA 4ENRA 4BEJA 4JJ6A 1U5BB 5TLSA 3WGIA 5F1OA 2HWYA 3CKMA 5HUJA 3I76A 3P7MA 1Y4AE 4WCVA 5JUWA 3TE7A 1HYEA 3Q98A 1RRVA 1A76A 4RU1A 4Q4JB 4EIWA 5LQDA 2O7QA 4X8HA 1M34A 1LQUA 4HS4A 3IT3A 3ZV6A 2D1QA 4F71A 2IYPA 3BWXA 5UKDA 1IUNA 1O9HA 4LSGA 1RI4A 5DKFA 4HDMA 4R41A 2XXAB 1ZU4A 3C8ZA 4P4GA 1U3GA 3FCAA 5LZ7A 2BONA 1A9RA 4RUKA 2ZE8A 5F78A 4PPGA 1H8HA 1N2IA 1H93A 3R3WA 4GPAA 4ZEVA 3KKMA 1QG4A 3I9LA 5C7IO 2QL9A 4E88A 5LNK6 5K6AC 1IFXA 1AKUA 1KA9H 2B9VA 3EXHB 4QDZA 4ZRDA 4UAVA 3RTBA 3VKUA 2OSBA 3L1HA 2FFAA 1WZNA 2R4UA 4AT1A 4B6QA 4I8XA 4W9NA 3BWVA 2BM0A 2C9DA 1F2UB 5EIWA 1ORIA 1X15A 2XVZA 1MV8A 1XE3A 4MA4A 3D4IA 1KFEB 1QBGA 1NR7A 4K9DA 4UTZA 5LZ2A 1ZUHA 2OXFA 1YCDA 5CT5A 3AP1A 3F3SA 4KGXA 3QVGA 4MGYR 4BNKA 4OHOA 3SC4A 1TTHA 1EESA 3EFBA 3RODA 2P4UA 1AQNA 1C8LA 4DANA 1X1RA 3LW8A 4W8OA 4WWHA 5JNSA 4FIDA 3KTAA 4K8RB 5IT4A 4P8RA 4HVCA 2WKRA 3GZNA 1GA6A 1N6LA 2ZYHA 3AVVA 1BW9B 2LW7A 3NH6A 4X5OA 1EWRA 4Q24A 2KBFA 3S8YA 2Z0MA 2GS9A 5TPWA 3TNLA 3GDGA 1CK4A 1BTOA 3PS9A 2ZIZA 4BNDB 3TRIA 1VPWA 5DB4A 3PXAA 3SDBA 2AQKA 2BRUC 2D8MA 1N5OX 2QYOA 2Z4RA 3OUUA 5DNYB 3A3OA 2JFPA 3B7PA 4KNYA 2H2WA 3MTGA 1RAGA 3MLBA 1TEZA 1Z08A 1HT0A 3DFMA 1LDEA 1RSZA 2VG8A 3PITA 4N9QA 4OKSA 5EIBD 4KFUA 5IYZF 3UOGA 3EDRA 3TZQA 1KY5A 1Q6YA 4GUDA 2R65A 4KX5A 2HT1A 1GILA 1Q0UA 2Y0DA 4TTIA 2FMFA 2IV3A 4DXAA 1B41A 1PUJA 2Y3IA 3C6MA 3TQFA 3WJ7A 3WO1A 1YZGA 2DXIA 3KC2A 1IK6A 2V0NA 5FI5A 1J5EB 2VAPA 2RB4A 5EMJA 3ZQ6A 1NNLA 2F67A 2WIAA 1CJSA 2YJNA 3U6KA 1DZ3A 5LIRA 1OFTA 1OB5A 1ACLA 1IOZA 4HJXA 4UQOA 4PWYA 3PEEA 5IFLA 4IL5A 2C7QA 5EE0A 3H9GA 3Q4GA 5AHKA 3TLGA 1B7GO 3OX2A 2AN4A 2DBYA 3HEAA 3KJIA 3AF6A 3JQGA 1BEEA 1KY4A 3REQA 5EZSA 4Y1FA 1CNFA 1JDTA 4KVGA 5HRUA 1LVHA 1WMAA 3HB0A 3D4OA 4X44A 2IH2A 3E05A 1XRSB 2C3PA 2XDQB 3SZGA 2ZROA 1RBMA 4JU9A 2FG7C 4AXXA 4B83A 4DUYB 3IAXA 1CZKA 1XTSA 4PZ0A 4W7SA 2JFUA 2V45A 1XTTA 3H5OA 4JKOA 4CDGA 1L3IA 3IB6A 3PHHA 1RZRD 3RARA 3BBLA 1AK2A 3CV3A 2QT0A 1Y63A 4R8LA 1M7HA 3O8LA 4XAQA 4ZO8A 5A6SB 1Z2EA 1ZG3A 2XHEA 3AFMA 4YY3B 2CZQA 5KMGA 3AM5A 4N5DA 4HXYA 1YRHA 5DT9A 1WMDA 3A1UA 2JVIA 3ETCA 5H70A 5A1TA 4BHTA 1X7GA 4CMIB 1Z73A 5JZMA 1PX2A 5E4FA 4K2HA 2G8NA 4WNAA 3UCFA 1WS6A 2CVFA 5KYXB 1HLDA 5DOVA 3UMJA 4Q15A 5DLEA 4BCCA 4M7OA 3BXHA 5FTWA 1NQVA 4BMOB 1HYGA 1QIGA 1IBLB 1JXAA 4D25A 5AI5A 2JFWA 2VF8A 4A1FA 4C0WA 1FSGA 1QX3A 3ZVMA 3PQ7A 4Y7DA 2B20A 1ZK0A 3OE4A 4RF3A 1VJCA 1XD8A 2QJOA 3QYJA 4M37A 4Z3OA 2BGGA 3MM4A 3CZRA 1SCQA 4MQEA 2A30A 1RWBA 3IDAA 1OAKA 1VECA 1NX9A 1ACMA 3HUUA 4XDHA 3FRHA 4YAOA 5D2CA 2VZ8A 5K4AA 4UVIA 1ENOA 1KR2A 3AFIA 3PRJA 2Q1UA 4FM9A 2HU7A 1FNSA 1VCIA 2IDMA 3AYXB 3BE6A 1V5EA 1UAGA 3CG0A 4YJFA 4RD1A 2C9CA 5BSMA 5TY0A 1OPXA 4EL0A 5K0BA 3WL6A 5E2IA 2X2FA 4H4EA 2CB0A 4KC0A 1LLUA 2V6IA 4ZVOA 2AUNA 2Z58A 1HL3A 1ZKMA 5DLYA 1ULHA 2I6UA 3VNVA 3RS3A 1LFDB 2O0JA 4EQZA 3L93A 4XUGB 4OGFA 5I8WA 1JMKC 1VBNA 2ORED 4P9NA 2ONCA 1EIWA 3BL5A 4UFOA 4RGQA 3RWMB 3BXOA 4GF5A 4FDLA 5K0LA 3J7TA 3WJAA 3WV5A 3TIVA 3FCUB 1OFHA 4Z9YA 5KDOA 4CKCB 2X9VA 5K09A 2NXCA 1YCFA 4CIVA 4JDPA 5ARDA 2JA1A 1VL2A 2QX6A 2XXJA 1P75A 1AMUA 1W5FA 3ZHVA 1R12A 1QH1A 2DTDA 2WHEA 2X15A 4DDUA 1E89A 4Z9FA 4Q3EA 4X6LA 1VIMA 1A9XB 3USZA 5DMXA 1IY8A 3LY9A 4NZ9A 2FEOA 3QVXA 4D4JA 1KS2A 3EXHC 3SMVA 2H4FA 1GGJA 1SCIA 3HCNA 2HJWA 1XKQA 2B1IA 3H1BA 3HP1A 1BKSB 1P0PA 1E2JA 2JNWA 2L18A 3N53A 5K3AA 4PX3A 2JW5A 1EIZA 2QM3A 4HX9A 4J6EA 4KG7A 1Y89A 3NI2A 3NUZA 3WGUA 4R0MA 4FEAA 1Z5OA 4MWOA 1EEHA 2GA8A 2OCGA 4OBWA 4H7EA 2HDNB 3EHDA 4XE5A 5ILOA 2VNAA 1QYWA 3NANA 2PLNA 3JS5A 2ZETA 3DOCA 2GEDA 2ZAIA 3LJKA 4KZKA 1GD1O 2GXUA 2O0LA 1OZFA 3OCCA 3D59A 1L8AA 1QVRA 1ECLA 2XYPA 4ZU3A 1D0IA 1RRMA 2RAUA 2NW6A 4XR9A 4BQPA 4J16C 1EWVA 5CDYA 2F90A 4KXYA 1Q57A 3URMA 3B1XA 3QKSA 2VH2A 5CDTA 2O0HA 4NJEB 3RT7A 3ELUA 1A72A 2YVUA 4JLUA 1HE1C 1U9IA 2QD2A 3ETLA 3KPUA 5DRTA 1SC3A 4HPJB 4I99A 3AC0A 1EZ1A 4MYSA 1K86A 5C1PA 3AR8A 1MTZA 2JLQA 3U48A 2XCQA 3RC9A 4RHTA 3CLTC 1WPRA 3ABRB 1YQWA 5F1KA 2N9UA 2DFKB 2QNBA 1WX1A 4BNHA 1QR6A 1FPQA 3ESBA 5JWRA 4DRXA 3WYFA 2P6PA 1M2VA 2X7XA 3EZFA 1WKVA 3PLRA 5ENVA 5GGYA 3FY4A 5DM60 4D9BA 1GIAA 1P2SA 2I7CA 3BT7A 1TGVA 5CG2A 3T7CA 3PE3A 3PGXA 4BP3A 3CFYA 3EX7C 1ENYA 4TN5A 1BROA 3D5EA 5T4HA 2XODA 2NP7A 1TD9A 4QPCA 2FDXA 1UMBB 5B36A 1B8OA 1D6NA 3K8OE 1LX6A 2BR5A 2ARKA 1ZZEA 3RU9A 3V42A 1T8TA 1L5YA 4JBLA 4ZAFA 2E4UA 4U1RA 3LCCA 4PIVA 1B6SA 2XZPA 1TTQB 4B81A 3RUAA 2ZBEA 1RXUA 3DGEC 1X9HA 5HTKA 3OQIA 2GI4A 5CB0A 4X94A 3AHFA 3QE4A 3VR5A 3LWDA 4GFDA 4GO1A 2JHFA 3ZWQA 1G8GA 2HSWA 3SYTA 4ZV9A 3AZQA 4CLRA 2GBIA 3SF0A 2I2CA 4FDMA 2I7XA 5KYKA 4A8JB 1PL8A 3W9UA 5MFPA 3RYCA 2GKGA 2A5DA 4QPJC 4AWBA 3HNOA 1QGYA 1XN4A 2EG9A 1U5BA 2PQ0A 3K6SB 1E2PA 1DJMA 1VI6A 3UJ6A 5DMHA 1ZS9A 5G02A 3WNBA 2XECA 2E85A 2I8LA 2MSLA 3FR7A 3QELA 1E69A 4Q4JA 4J3NA 1H3NA 5B12A 4RIHA 5KVSA 1Y8ZA 4HAIA 1KMMA 4HN2A 1D1QA 1N75A 2LZ0A 3DXZA 1TZJA 1NE7A 5D5HA 1AG9A 1E0SA 1CUAA 4MWGA 1L6RA 5LQAA 3ID6C 4F3YA 1DOZA 3RRNA 5IM4A 3T12A 5DASA 2O8EB 2BEVA 1DMSA 3R4CA 1SCBA 2DFDA 4LK2A 4C03A 4JI2