1I3QH

Rna polymerase ii crystal form i at 3.1 a resolution
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
145
structure length
133
Chain Sequence
b'SNTLFDDIFQVSEVDPGRYNKVCRIEAASTTQDQCKLTLDINVELFPVAAQDSLTVTIASSLTRSWRPPQAGDRSLADDYDYVMYGTAYKFEEVSKDLIAVYYSFGGLLMRLEGNYRNLNNLKQENAYLLIRR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA-DIRECTED RNA POLYMERASE II LARGEST SUBUNIT
publication title Structural basis of transcription: RNA polymerase II at 2.8 angstrom resolution.
pubmed doi rcsb
molecule tags Transcription
total genus 20
structure length 133
sequence length 145
ec nomenclature
pdb deposition date 2001-02-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF03870 RNA_pol_Rpb8 RNA polymerase Rpb8
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 1i3qH00
4AYBG 1UE1A 4A3EH 3KDFB 3NENA 4IOCA 4JI6L 4JBWA 1QZGA 4DV7Q 3ICEA 1X3FA 1KD1C 4DAYB 3HOXH 3RLNA 3I4MH 1PYBA 4YHHL 3HOWH 2JA6H 4HJ9A 2F4VL 1K3RA 2UUBL 2EXDA 4DNIA 4LF9Q 1NY4A 1CKOA 2YTXA 3HOWG 4JOIA 3HOYG 1UE5A 4DV4Q 4A3LG 2F52A 3ER0A 3I56A 3CW2C 3EBEA 3KF6B 3J80i 2R7ZG 3B6YA 2MNAA 3PO2G 4DAMA 1YJNA 1HNWL 2D0OA 1LM0A 4DV1Q 2E2IH 1Q7YC 2CQOA 1QVCA 2GVBA 5J3BA 3HOVG 5C44H 5LMNQ 3I4OA 1XNRL 4GKJL 4OO1I 3K0XA 2H5XA 5AJ3L 2RHQB 1Q12A 1UEBA 3H0GG 2E5LL 2B63H 3S1NH 2PNHA 2Q2TA 1I6HH 2HT1A 2KCTA 4DKAC 5JEAG 1VQPA 1YI2A 4A3DH 1XMQQ 4B3SQ 1IBKQ 1HNXL 4UY8C 1PH4A 2ID0A 2E2HH 3M9BA 4PZ8A 3OTOL 1CSQA 4RMFA 2AHOB 3I4NG 1YIJA 1IYJB 1K0RA 4OXPA 4WJ4A 2R93H 4P72A 4JI8Q 4NXML 2HHHQ 5GAHC 2VNUD 3G6EA 4OONA 3CXCA 3KLWA 3K7UC 1MIUA 1EQQA 1GKHA 1WJJA 1AE2A 2ALYB 1MJCA 3I2ZA 4NPSA 3J7A5 1HZAA 4UP7A 4X6AH 1L1OC 2VY3A 1HR0W 5IWAQ 4GN5A 3UE1A 1SR3A 4DV5Q 1SN8A 3A0JA 4C2MH 4DV2Q 3HOUH 4IPHA 4X64L 5M5WH 2RF4A 4GNXB 3NELA 5JJIA 2JA7G 4A3MG 1KQSA 2E2JH 1WYDA 4NB3A 5JJLA 4QIWE 3RN2A 2UUCL 1D8LA 3S1MH 1E24A 3PCOB 4C3IH 4KHPQ 1X9NA 3W1GA 2YTVA 5HGQA 3HKZG 3TQYA 2ZM6L 3KDFA 4DR2L 4DV6L 3SGIA 1VQHA 1NTGA 5M3FG 3HOZH 2JA9A 1IL2A 1PV4A 4X66L 2I5MX 3KFUA 3J81i 1FJGQ 1OXXK 2D0PA 2VZAA 2CKZB 4IFDJ 3FKIG 3HFZB 1UE6A 2UUAL 5BR8L 1PH7A 5IP9H 1J5EL 3UE0A 3BJUA 3KF6A 1IBML 1JT8A 3Q8DA 3BU2A 4DR3Q 4NXNL 3HOXG 3I4MG 2JA6G 4L5TA 4A3IH 1G51A 4GLAC 2NVXH 4B3RQ 1V9PA 3H3VH 4BA1I 3M4QA 4P71A 1S3OA 4LFCL 1U5KA 1V43A 1X6OA 4GOPC 4DUZL 3U4ZA 1VQMA 4HIMA 3CPFA 1X56A 5M5YH 3KJOA 4LF4L 4BY7G 1D7QA 1YZ6A 3H3VI 3CCEA 3VDYA 3GTPH 4A3CH 5M5XH 4Y7NH 2NZOA 2JA5H 5LMUQ 4OO1G 2K75A 1HZBA 3G48A 2K52A 3GTJH 1HR0L 4LF8Q 4DUYQ 1RIPA 2GN5A 1N33Q 2NVTH 5K36G 1Z9FA 3RN5A 1N32L 1PH1A 1E7ZA 4PMWA 2VQEQ 4DR7Q 1X3EA 1BVSA 1MKHA 3CQZH 3T1HL 5C0XJ 1EYGA 3D31A 3IRBA 1U0LA 3HKZE 1EQRA 3PUWA 2IHFA 2ZTCA 1KL9A 1PFSA 4AQYL 1S40A 4ME3A 3PO3H 1N36Q 4A3DG 3CCLA 4A3MH 3MXNB 2PI2E 2AWOA 4HJ5A 4DR1Q 5FLXc 4AIMA 4OX9Q 2HQLA 2AKWB 2ATWA 1JB7A 3RZOH 2OQ0A 3RR5A 2R93G 3JAMi 1K9MC 1PH9A 1LTLA 3MEFA 2VQFQ 3J81j 4GNXA 1X55A 1OTCA 3TEHB 2OTJA 4HIDA 4LF5L 4A3JH 1I94Q 3UDFA 1TWAH 1FL0A 2HIXA 4EX5A 1VQ8A 4JBKA 1TWHH 4GN4B 4A3KH 3GTQH 3UDXA 3M85A 3CC7A 4JI7L 4MTNA 4HJ7A 1VS0A 4B3TQ 2EIFA 2JQOA 4GN3B 4LUOA 4GKKQ 2MO1A 4DR5Q 3HOUG 2UXDL 1H95A 4MZ9A 3K7AH 2OQKA 1VQ9A 1A0IA 1YHBA 4DV4L 1VQ7A 4C3HH 3NEMA 3CF5A 4Y52H 3T1YQ 2OCEA 4IPDA 3S2DH 4IFDI 4BY7H 5HY6A 3KF8B 2F3IA 4YCWA 4O0AA 4A76A 4OWWB 3S24A 2GVAA 3HOZG 1X54A 3F1ZA 3UDIA 3S15H 1MJEA 2N3SA 3AQQA 3ERSX 4DR6L 1YHQA 3S14H 3TS2A 4LF7Q 1SLJA 1XNQL 2I5HA 3AYHB 4DR4Q 3S2HH 2FXQA 3AFPA 3GO5A 2OTLA 5IP9G 4QL5A 1TWFH 3K81C 1XMQL 4B3SL 4JI6Q 1OXTA 1OXVA 2D62A 2N8NA 2A1AA 4YCUA 1KRTA 5GAEC 1ASZA 5IY0A 4YHHQ 1K8AC 1HNZL 3D0FA 4JCVE 4A3IG 1DGSA 3LGJA 3GTOH 1VQNA 3PUVA 2Y0SG 1M1KC 1P8LA 2F4VQ 5IYBH 2YTYA 4JI3L 4AYBE 4DV3L 2VL6A 1QVFA 4GOPB 4A3CG 3AFQA 3DM3A 1TWCH 3PUYA 1GO3E 4IPGA 1BBWA 3W1BA 2JA5G 1NE3A 3M4PA 4XTCS 1Q1BA 4JI4L 2JEAI 1AE3A 2PMZE 1HNWQ 4OWXB 1FVIA 5ELOA 2OWOA 2QGQA 1XPRA 4K0KL 3A5ZB 4XIGS 1XNRQ 1WCMH 4GKJQ 1C7YA 2K14A 5AJ3Q 2E5LQ 1SRUA 2WB1G 4O2DA 4BY1H 3S16H 1Y1VH 2B3GA 2K4KA 4GLVB 1QVGA 4B3ML 1QUQB 2ES2A 4P73A 4C3JH 3PO3G 3ULPA 3J81c 1G6PA 1HNXQ 4LF6L 4MNOA 4JYAL 1PH6A 5IP7H 3OTOQ 3PV0A 1B8AA 4LFAL 1EWIA 4PZ6A 1JMCA 4NXMQ 2HIVA 4GS3A 4JG2A 5IYCH 1XMOQ 1VQCA 1WI5A 5IT9c 1TXYA 4HIOA 1Z47A 3K8AA 4FDBA 1Q8KA 2PI2A 4YWKA 5GROA 3CCUA 1TWGH 4L5SA 4A3JG 1E1OA 1I3QH 4DR3L 4DK6C 5C4XH 4A3KG 4X65L 1Q81C 4LFBL 4B3RL 1KC8C 4JI5L 1IZ6A 4X64Q 4IFDG 4A3FH 2NN6I 2A19A 2DUDA 4YY3L 3S17H 2K5HA 2UUCQ 1C9OA 2JK8A 2NZHA 3CCSA 3CC4A 2BA1A 4BBRH 5LMUL 2BH2A 1KIXA 2LSSA 2ZM6Q 2I0QA 1N34L 4DR2Q 1GD7A 1VQEA 4DV6Q 2I5LX 4DPGA 2Z6KC 4HJ8A 1NJIC 4JI0L 4TVAB 1E3PA 3I7FA 1VQGA 2VQEL 1QZHA 1WFQA 4YCVA 3GTGH 4DR7L 1FGUA 4A75A 4P74A 2KHIA 1YBYA 3JC66 4IJHA 3U58A 1YITA 3L2PA 4JV5L 5LMNW 2Q2UA 2ZTEA 3UDGA 2UXBL 4R4QA 2UUAQ 5BR8Q 1HZCA 2YV5A 4DV0Q 2XTIA 4GOPA 1J5EQ 5C3EG 1IBMQ 4BBSH 1EIFA 1JJGA 4NXNQ 1YVCA 4LF5Q 2NVYH 2IX1A 3BZCA 3L0OA 4A3BH 3KOJA 3M3YH 4UP9A 4A4IA 4OWTB 4LFCQ 5IYBG 2WAQG 4X62L 5C0XG 4DUZQ 4LWCA 2AMCB 1A62A 1PH2A 1VQ5A 1K73C 4YWMA 2VUMH 3CCJA 2Q2IA 1QUQA 3G4SA 4JI1Q 2KHJA 4JI2L 1VQLA 4WJ3M 3F2CA 5H1SE 1GM5A 1HR0Q 2PQAB 2JEBI 4L5RC 1Q82C 3GD7A 4DV7L 1N32Q 3ZJYC 4GNXC 1M90C 1WCMG 1KRSA 1NMFA 2VS1A 3W5OA 1N8RC 3RLOA 3T1HQ 3GTMH 2BA0A 3GTLH 2K50A 4BY1G 4JBJA 2JA8H 1Y1VG 3J80c 1G291 1I50H 1XTDA 4PG3A 4R4CA 4AQYQ 1L1OB 3CAMA 3H15A 1KAWA 1S72A 1A8VA 3CD6A 4LF9L 2IY5B 1ASYA 1RL2A 1EOVA 3AEVA 2WFWA 3CCRA 1JJ2A 3PF4A 4H02A 3PIOA 5IP7G 1J6QA 2BH8A 1IBLQ 3TRZA 1B70B 5FLMH 1EIYB 4QGUA 1VQOA 2N78A 4DV1L 1XJVA 5EAYA 4JOIC 3U4VA 5IYCG 1OXSC 1UE7A 1VQ4A 5LMNL 1A63A 1L2FA 4BXXH 1Y14B 4DR4L 1SFOH 2UU9Q 1OXUA 1Q86C 1SMXA 1WOCA 4QJFA 2R92G 1PVOA 3NBHB 2UXCL 2L15A 4BA2I 2MQHA 1K83H 2V1CC 4RG1A 2LXKA 2WAQE 1O7IA 1YJ9A 2NN6G 4DK3C 3ULLA 3S1RH 4KI0A 5C4XG 1IBKL 5C3EH 4JI7Q 4IJLA 4IPCA 5GADC 1YJWA 1CKNB 1VQDA 2UXDQ 2JJQA 3WWVA 4A3FG 4A93H 3PF5A 4JI8L 2HHHL 3M7NA 2UUBQ 2WP8J 1SE8A 3EN2A 5M3MH 3RNUA 3KYHC 4BBRG 3GTKH 3DLLA 5IYDH 1W3SA 1Q1EA 2KCMA 2IX0A 5JEAJ 3PIPA 2R6GA 3CC2A 1CSPA 3K80C 3FHWA 1YHAA 5C0XI 3U50C 1UWVA 4J15A 2CFMA 4UPAA 1PH3A 4DR6Q 2QEXA 1PH8A 2IT1A 5IWAL 4DV5L 1SROA 1XNQQ 4DV2L 2DGYA 1XPUA 2ZJQA 1W2BA 1I5FA 1NBWA 2K5VA 3FP9A 5C4JH 1VQFA 3F2BA 4BBSG 1Y1WH 1GVPA 1P16A 2N49A 1HNZQ 4KHPL 1X65A 3E9IA 3J7ZC 4APVA 2PQAA 4A3BG 2CWAA 2VW9A 2Q2HA 3PUXA 1HJPA 3F2DA 1CUKA 3A5UA 1XMOL 4JI3Q 3A74A 2C35B 4UP8A 1FJGL 4DV3Q 2VUMG 4AH6A 5FJ8H 3L7ZC 4A3GH 1L1OA 3PUZA 4JI4Q 2CCZA 2LXJA 2YU9H 1VQ6A 2R92H 3M4OH 2A8VA 2Y0SE 3I55A 4K0KQ 3TREA 2CWPA 4P75A 3CMEA 1L0WA 1HZ9A 2K5NA 1T9HA 2YYZA 2R7FA 4R1JA 3PSIA 1PH5A 4B3MQ 4LNQA 2JA8G 2E8GA 2R7DA 5JJKA 4LW1A 2MFIA 1BKBA 2RCNA 4R4IA 1R9TH 3STBD 3F8TA 2RHSB 3HOYH 4A3LH 3OYYA 4TQUS 4LF6Q 3CMAA 2AWNA 3OW2A 4JYAQ 2R7ZH 4LFAQ 5GAGC 5FLMG 3PO2H 3E0EA 4GLXA 2WB1E 3G71A 4KHZA 4LF8L 3CP0A 4DUYL 3HKSA 1VQAA 1N33L 3CCVA 2QA4A 3HOVH 1B7YB 2UXCQ 4X66Q 1CKNA 2KBNA 1YEZA 2ASBA 4BXXG 1PYSB 1E22A 3H0GH 4R4TA 4POFA 4A3EG 4DV0L 2B29A 4YWLA 2Z0SA 2ZTDA 4LUVA 5IE8A 3JAMc 4X65Q 1N36L 3STBC 3RZDH 1Q46A 1HH2P 3S1QH 4LFBQ 1C0AA 1KXLA 4DR1L 1LUZA 4JI5Q 4OX9L 3I4NH 3GDEA 1K8GA 4PZ7A 4A93G 4LUZA 2Z6KA 1EUJA 1JJCB 4YY3Q 4HJAA 1N9WA 5M3MG 4JI1L 1VQIA 2VQFL 5GQOA 5IYDG 4LF4Q 1PA6A 2IHEA 1N34Q 2XGTA 1VQJA 2ZJRA 3CCMA 3ULJA 4JI0Q 1I94L 5C44G 4JBMA 5DLQE 4ALPA 4IO9A 1YNXA 4JC0A 1EFWA 5E7NA 2B63G 4JV5Q 2MO0A 1VQKA 1JE5A 4B3TL 1CKMA 4POGA 4IOAA 2UXBQ 1VCIA 4GKKL 4DR5L 4HIKA 4QQBX 3BZKA 3CCQA 2JA7H 3KJPA 1LYLA 2ZJPA 1Y1WG 3TS0A 3T1YL 1IXRA 1IBLL 3EIVA 3PGZA 2NVQH 2EQSA 1BBUA 3CPWA 1XPOA 4KLKA 3RLFA 4X62Q 5M3FH 1KHIA 1V1QA 4QY7A 2JE6I 1PHJA 1AH9A 2KENA 2UU9L 5FJ8G 1NMGA 4EQ5A 1E1TA 3FKIH 4JI2Q 4LF7L 4A3GG 4R4OA 4L5QA 3E9HA 1VQBA 5ELNA 1X3GA
chains in the Genus database with same CATH superfamily
3KK7A 3NENA 4IOCA 1QZGA 2CW0C 4DV7Q 1KD1C 5EBCA 2HDLA 4YHHL 1ICFB 3KLRA 4LF9Q 2K1BA 3SK5A 4F87A 5EPJA 1UE5A 3WOFA 4DV4Q 2F52A 3S14B 2ZXRA 3EBEA 2R7ZG 1RODA 1WD0A 4OO1H 1STGA 1HNWL 2D0OA 1LM0A 2E2IH 1Q7YC 2GVBA 3HOVG 5C3EB 3KBXA 4N9PA 3K0XA 5AJ3L 3S1NH 2QDBA 4KD3A 2N88A 5IT9L 1PFNA 1IBKQ 2E2HH 1O7ZA 1J9OA 2L0CA 1YIJA 1K0RA 1UAPA 4OXPA 2F0LA 3NQTA 4NXML 1B9MA 3OOCA 1JOQA 5DM73 1ZYRD 3CXCA 1WCMB 1VMCA 1EQQA 1WJJA 1Y1VB 4EQOA 2MHVA 4NPSA 3SVMA 1HR0W 1IW7D 1I4PA 5JVH3 4CJ0B 1KABA 4C2MH 4DV2Q 4TKOB 3HOUH 2ZXPA 1L0XB 2L12A 5L37A 2E2JH 1KQSA 3RN2A 1D8LA 2ENBA 3S1MH 4LAAA 1E24A 4LK1C 3NTKA 5HGQA 2F03A 3TQYA 1VQHA 3HOZH 2JA9A 4OL7A 4R8NA 4ZUIA 1OXXK 5C4XB 4DGZA 5DNFA 4K5WA 4NP5A 1ZXTA 3HFZB 3OMGA 1BXTA 2O2LD 1IBML 3S17B 5C4ZA 3Q8DA 4DR3Q 3HOXG 3I4MG 2JA6G 4A3IH 1G51A 4X3KA 5IIFA 4GOPC 4DUZL 3JAME 1VQMA 2DJFC 4HIMA 4BY7G 3HEJA 3H3VI 1CTMA 5LMUQ 2K7VA 4KJOA 2J7ZA 1HZBA 1S5FD 4RAUC 5EJWA 4KKSA 1STEA 5K36G 4DNTB 3M7GA 3EJIA 4PMWA 2VQEQ 4DR7Q 1BVSA 2NVYB 3D31A 1U0LA 3HKZE 1V1OA 4DU9A 1A15A 3AU7A 4A3DG 3MXNB 2AWOA 3V05A 4DR1Q 4OX9Q 1I4HA 5FKAC 3C1FA 3RZOH 1LTID 3RR5A 3QOJA 1Z7TA 1LTLA 4I65A 3C46A 1EY0A 5KEEA 4FO2A 2EYPA 3I70A 3MEHA 3TEHB 1B2TA 3S2HB 1I94Q 3UDFA 5IGBA 1FL0A 1VQ8A 1VF5C 3UDXA 4JI7L 2EJGC 4CDEC 4IZ8A 4DR5Q 1PTOH 4MZ9A 3K7AH 2OQKA 4NMZA 4C3HH 5A35A 4Y52H 1QNKA 4NDXA 1JQYD 1EZ6A 4CGYB 5KNDA 4BY7H 1QILA 4DF7A 4YCWA 4O0AA 4OWWB 2GVAA 4JK1C 1X54A 3S15H 2N3SA 3H3VC 1ESRA 4PMBA 2RDGA 2B2TA 2FXQA 3AFPA 4MTKA 3GO5A 2KUMA 5IP9G 4B3SL 1TWFH 3K81C 4JI6Q 5FO7B 1OXTA 5FK9C 3LGJA 2RKSA 4MIUA 1NR2A 2B2WA 2Y0SG 5IYBH 4OIKA 1ZEQX 1PZKD 4JI3L 3J7AV 3W2DA 3AFQA 1SYEA 1NSNS 1NE3A 2WINB 1AE3A 3MXNA 1KDCA 1PTOD 1LABA 1JOOA 1H9KA 2H1EA 4FF2A 1NNXA 4K0KL 3A5ZB 4KY5A 2K14A 4OHJA 1SRUA 4O2DA 3KLSX 4B3ML 4GLVB 1SE2A 4PQXA 2KCNA 4G57A 3BDOA 4JYAL 5ELFA 1W6KA 1ZYRC 1JMCA 1IYUA 3M4OB 2DN8A 3VYUA 4XQNA 2PI2A 5GROA 3CCUA 3TSSA 1TWGH 4A3JG 4QMGA 1E1OA 2NN6H 1R9TB 3URYA 1Q81C 4LFBL 2EYHA 2RDHA 4X64Q 4IFDG 3TP6A 1PRTB 1CZWA 2K5HA 2NZHA 3CCSA 3E5SA 2FMCA 4PV1C 1KIXA 1GJXA 2F0SA 4Q5VA 4JI0L 3LNNA 3VYRA 1SE3A 3A55A 1WFQA 4YCVA 3EA6A 1YBYA 3VR4A 3BVMA 3L2PA 3EFXD 2ZTEA 2UXBL 3I4NB 3DM1A 4HCSA 4UHVA 1HZCA 2YV5A 1J5EQ 1SNQA 2XTIA 4BBSH 1EIFA 3SDZA 1YVCA 4PNYA 2EVBA 3BZCA 1HFNA 1C8CA 2BDOA 4ILWA 4NW2A 2Q2IA 5LHY1 3I91A 4WJ3M 2SNSA 1GM5A 5JPNC 3ZJYC 4MN3A 1M90C 1UEAB 3GTMH 3GTLH 1N8RC 2JSOA 3OIQA 3T1HQ 3NPPA 3HKZB 2IX1A 3E6ZX 4KV6A 1S72A 3BG3A 1PXUA 3SEBA 1A8VA 4C3JG 5M3FB 2SDFA 2IY5B 1V8QA 3ONAB 1JJ2A 3CCRA 5IP7G 4FP5D 1MD2D 1B1ZA 2QDLA 4ODGA 1J6QA 1SMYD 1B70B 5FLMH 5CV5A 1EIYB 3U4VA 4JOIC 2UU9Q 3A54A 1EWHA 3D4DA 4BA2I 3L3OC 4K8JA 2B2TC 1YJ9A 3S2DB 2IX3A 2RCFA 5GADC 1YJWA 2F0MA 1A3TA 4JI8L 2HHHL 3M7NA 4YIJA 3EN2A 3RNUA 1AN8A 1EZ8A 4BBRG 3DLLA 1Q1EA 2KCMA 2IX0A 5JEAJ 2A68D 2EY6A 3FHWA 1YHAA 2CFMA 2LKVA 4QF4A 5EGTA 1X3PA 1LACA 4DV5L 4OIJA 2E2DC 4DFAA 1XPUA 4IUQA 1I5FA 5C4JH 2R93B 3F2BA 1Y1WH 1P16A 2N49A 1H9MA 3DWAA 4KHPL 4APVA 1F9RA 2VW9A 5IGEA 2D9UA 2B2YC 1B3AA 1CUKA 1PRTF 4DA2A 4UP8A 2VUMG 5FJ8H 3L7ZC 1PTOC 4A3GH 1WTWA 1Y8NB 4C1NK 4FNFA 2BDNA 5EKLA 4HSPA 3I55A 2OXPA 2CWPA 4P75A 3I73A 4C3IB 3RD4A 4CKCA 2JA8G 3PSIA 4KK7A 3OSOA 2KVMA 4R4IA 1DM0B 3OYYA 1D5XC 1QCBD 1F9PA 5GAGC 2WB1E 4LF8L 4DUYL 4MHEA 1TVXA 2QA4A 2K5QA 1F2ZA 1YEZA 4BXXG 2HCIA 3H6MA 1E22A 3QG1A 5HURA 4DV0L 5I6YA 3K0YA 2EY2A 4YWLA 5JEAH 3JAMc 4X65Q 5J39A 3EROA 3STBC 1HXYD 3RZDH 3S1QH 5M5YB 1KXLA 1RTOA 4KJNA 3I90A 5M5XB 1K8GA 4JVZA 2JA5B 1I4RA 4A93G 4LUZA 3VR5A 3ITPA 1XYIA 1AFPA 1EUJA 4YY3Q 4HJAA 3M4YA 4XQQA 1N9WA 2DY7A 1KAAA 1CQFA 2VQFL 5GQOA 3R93A 4ZUJA 5IYDG 1K0SA 1KLGD 2IHEA 2K33A 4QCLA 1LT3D 1DOMA 4XXEA 1LTAD 3QOLA 3PO3B 4FXGC 4IO9A 3TMEA 5E7NA 4A3MB 1WTQA 4IUPA 1CKMA 1CZGA 1JWUD 1VCIA 2DY8A 4GKKL 2JA7H 2CW0D 3KJPA 1LYLA 2IWHA 3MC0B 3NWSA 3T1YL 1XXGA 1IBLL 4B9XA 2NVQH 5EBDA 2EQSA 2IJ0A 1TWHB 3Q24A 1NMGA 4H13C 4JI2Q 4FXKC 1JC7A 1VQBA 4AYBG 1A3UA 5NUCA 4IALA 3U9SA 4DAYB 4HJ9A 4HR7B 4DNIA 1NY4A 3HOYG 2FINB 2J4XA 3J80i 1IKMA 3TP8A 3B6YA 3PO2G 1YJNA 2RVLA 2L11A 1QG7A 2E5LL 2RHQB 4K5VA 3H0GG 1I6HH 1Q8IA 1YI2A 1O7LA 2X6GA 1XMQQ 4UY8C 1HNXL 1F2YA 1I4QA 1DZ1A 3TZUA 3VYSA 4S3SA 1GUGA 3FPPA 4P72A 1STYA 1G2TA 2VNUD 1GHKA 2A68C 3G6EA 2KEEA 1G91A 3K7UC 1GKHA 2F0NA 4BY1B 1X32A 3I2ZA 1MJCA 1Y8PB 4KHVA 3J7A5 1HZAA 1YNNC 4RFBA 5IWAQ 4GN5A 4TSSA 2K04A 1SN8A 3A0JA 5CYUA 5IODA 1JOKA 5M5WH 2RF4A 5JJIA 3BS1A 2P5ZX 4NB3A 3DEPA 1W6JA 4QIWE 2LY7A 4EVOA 2K01A 1X9NA 3W1GA 2YTVA 3JAML 2ZM6L 4DR2L 1ESFA 4RWSC 3SGIA 4DAYA 3NUCA 1ET9A 4X66L 1I3QB 3KFUA 1XX8A 1HPCA 3J81i 1FJGQ 2D0PA 2CKZB 2F0OA 4X3UA 5COYA 3WDNA 3FKIG 5CV7A 5CV8A 1VMPA 1JB3A 5BR8L 4RH6A 4A3FB 1PH7A 5IGDA 1EYAA 2L9HA 1VDZA 2F0GA 2JYOA 2KQ3A 1C48A 4ZK9B 4B3RQ 3H3VH 4BA1I 1WTPA 4P71A 2L5TA 4LFCL 2QF7A 3GTGB 3CPFA 3KJOA 1BF4A 1D7QA 3GTPH 3VDYA 1LT5D 4Y7NH 3R8BA 3MZ5A 4PMCA 2K75A 4OO1G 2WKCA 2K52A 3GTJH 1RIPA 1N33Q 2ICEC 2Z1CA 2NVTH 1E7ZA 2Q8TA 3MTSA 3CQZH 5C0XJ 4A3BB 1EYGA 3CMEA 4AQYL 1YNJC 1S40A 5JPMC 1M8AA 4ME3A 2R3ZA 4K2KA 2SEBD 2PI2E 3BDCA 4AIMA 2SOBA 1EEID 2AKWB 2LS01 2ATWA 4ULLA 3Q0AA 2OQ0A 3G7LA 1HCZA 2XRQD 2F0HA 4LJZC 4KMUC 3J81j 3OWEB 4XQJA 1OTCA 2E75C 1TWAH 3FVQA 1BBXC 4DAVA 3NBIA 1LTTD 4GN4B 4A3KH 3GTQH 3CC7A 4HJ7A 1VS0A 4B3TQ 2EIFA 5ELEA 1I6VC 5FO8B 2MO1A 3HOUG 4DV4L 2NB0A 1VQ7A 2BCOA 4IPDA 2PW5A 4E6IA 1SFOB 3KF8B 2BE5D 1TY2A 4A76A 3FDTA 1SE4A 2XWBB 2ZT9C 3HOZG 1K83B 3N52A 1IL8A 2L1BA 3A8JE 5CV6A 1MJEA 4KN7C 1II3A 3S14H 3W3AA 1G8ZD 4RGMA 1XNQL 4DR4Q 1RDPD 1LLRD 1SNPA 5C6AA 5M9OA 2N8NA 2SNMA 5M3MB 3D6CA 1ASZA 4YHHQ 4A3IG 1DGSA 2I07B 2KECA 1C4QA 1M1KC 1P8LA 4L63B 5C0XH 4KD4A 4DV3L 2VL6A 2PW7A 2M00A 3DM3A 3PUYA 4IPGA 3W1BA 4XTCS 2J0TD 1Q1BA 1VF7A 1HNWQ 1JICA 1EEFD 1A6XA 1WCMH 4HEDA 5AJ3Q 2WACA 1TKWB 1Y1VH 1EQVA 4P73A 2HUGA 1G6PA 4LF6L 4MNOA 1PH6A 1B8AA 4LFAL 2EYLA 2YU9B 1EWIA 1SJHD 4NXMQ 2CH4A 5C5MA 5C4HA 1XMOQ 2F0UA 2B39A 4HIOA 1Z47A 1PMRA 2PMZB 1RCVD 3ZYYX 1SBBB 3I72A 4DR3L 4DK6C 5C4XH 3KF8A 1S5CD 3J7YW 1IZ6A 1A3VA 2R7ZB 1DOLA 5K5PA 2K03A 1HUMA 2A19A 2DUDA 3BVZA 3GP7A 2EE1A 3S17H 4QIWB 2F0JA 4KY7A 1C9OA 2JK8A 4C3HG 3HOVB 2BA1A 5LMUL 1N34L 1GD7A 1VQEA 1NJIC 2Z6KC 1IYVA 2VQEL 1QZHA 4DR7L 1KTKA 1FGUA 1YITA 2KHIA 4JV5L 3U58A 2A74C 3PIO3 1CM9A 1FYCA 2R61A 4R4QA 5I2XA 1R4QB 1IBMQ 1JJGA 1SEBD 1PZJD 2NVYH 1LTRD 4A4IA 1BO0A 2WAQG 5IYBG 4JPBW 4X62L 4DUZQ 1VQ5A 1TS5A 3H91A 4YWMA 1V1PB 3CCJA 4C56C 3G4SA 4JI1Q 2KHJA 3RMHA 3AMUA 5H1SE 2PQAB 1Z6HA 3TDQA 2VS1A 1NMFA 2F0WA 3W5OA 1F2MA 2K50A 3S2HH 3PIP3 3A7LA 1Y69U 3H15A 1I4GA 3CD6A 1EY4A 1CI3M 1RL2A 5G3LF 5CV4A 1ONLA 3PF4A 4U673 2CQAA 3EVQA 3L9AX 2N78A 4DV1L 1STAA 5EAYA 1XJVA 3GQBA 1VQ4A 5LMNL 5BN5A 3SE0A 3HOXB 3I4MB 3HOWB 2JA6B 1SMXA 2QEJC 4QJFA 2R92G 2L15A 2V1CC 5IGCA 1O7IA 2AQ3B 2NN6G 4DK3C 4BY7B 2KJXA 4JI7Q 4ME5A 3Q23A 1CKNB 1U4RA 4HAEA 2UUBQ 2BE5C 1SE8A 2C5CA 3CRLC 1W3SA 1HRJA 2B63B 1ENCA 4FVMA 3K80C 5C0XI 1S4ZA 4J15A 4CKBA 4A3DB 2CHBD 1SYDA 3OHXC 3K57A 2DGYA 4I7ZC 1W2BA 1NBWA 1PDQA 1FGBD 1V1PA 3T56B 4F8MA 1VQFA 4BBSG 1GVPA 2KCCA 2PQAA 2CWAA 2FMMA 3A5UA 3J81E 4JI3Q 5CR3A 4CBVA 2EOTA 2CCZA 1VQ6A 2R92H 3M4OH 5C3WA 1PLFA 1D5ZC 4K0KQ 3TREA 1G6ZA 3HZXA 1U4PA 1T9HA 4R1JA 4B3MQ 5JJKA 1PH5A 4LNQA 1CQVA 4LW1A 2F0KA 1BKBA 2RCNA 1R9TH 3STBD 2RHSB 4A3LH 1J8IA 3OW2A 4JYAQ 2K32A 2TMPA 2A5HA 5FLMG 3O13A 3G71A 1BQQT 2O5IC 3HKSA 2MUYA 3CCVA 1B7YB 1CKNA 1PYSB 2NVXB 4A3EG 2Y0SB 2ZTDA 1N36L 4LFBQ 2WIIB 1Q46A 1HH2P 1C0AA 2EJMA 1IHZA 3I4NH 1BCPB 3A8IE 1T5XD 1JJCB 5JOBA 1VQIA 5D14A 4LF4Q 1PA6A 3R2TA 4ZLTF 4JI0Q 3CCMA 3ULJA 4QB4A 4JBMA 5C44G 4ALPA 4JC0A 3OPOA 4QUFA 5JJZA 4HCEA 2EPBA 3NK9A 2UXBQ 4IUUA 3CKIB 4DN4M 2F0PA 1DYQA 4QQBX 4RA8A 3OWFA 1PRTD 3NSWA 3D4RA 2EZVA 2ZJPA 1Y1WG 2ICIA 3TS0A 4G7ZC 1E2ZA 3PGZA 1BBUA 3CPWA 5KRUA 5M3FH 1CT1D 2G5DA 4XYOA 1F2LA 3K6OA 4QY7A 2EYOA 2JE6I 4A3JB 1AH9A 2EY5A 2UU9L 2AQ1B 5FJ8G 4Z9CB 1E1TA 4A3GG 4RCNA 4LF7L 2F1MA 5ELNA 2Z9HA 1UE1A 5BN4A 3KDFB 4A3EH 4JBWA 2OT2A 4XDXA 3RLNA 4EQNA 1E0BA 3GV6A 2F4VL 4ZKBB 2EXDA 4V0BA 1CKOA 2YTXA 5D65A 3Q22A 3D8GA 2DNCA 4CKEA 3I56A 3KF6B 2Q8RE 2MNAA 2B2WC 3DWQA 5CV9A 1CK1A 1QVCA 1EIHA 1Y8OB 5C44H 1KDBA 3I4OA 1XNRL 4GKJL 2H5XA 1UEBA 1PFMA 1SXTA 3CHBD 3LWUA 4WJWA 3GTOB 3ERQA 2MP1A 1YNND 2HT1A 2KCTA 1VQPA 5JEAG 1WTOA 5IGFA 4PZ8A 3OTOL 4RHRA 1TWCB 4RMFA 2QILA 2F0FA 2R93H 1TU2B 4JI8Q 2HHHQ 4LMQD 1EY5A 4OONA 4R8IA 2Z8LA 3R2IA 1MIUA 1B9NA 3S16B 1AE2A 1PYWD 4C3JB 1ML0D 2B2VA 2Z4HA 4UP7A 4X6AH 2VY3A 3G6JB 2L4NA 5D3DA 2RQXA 3UE1A 5C3XA 4DV5Q 2ZXOA 4DK1A 2PQEA 4GNXB 2JA7G 2MGSA 4A3MG 5JJLA 1WYDA 2F0EA 1K8OA 2UUCL 1WTVA 2D5DA 4C3IH 4KHPQ 2K28A 1O7YA 4BS9A 3HRZC 3MFGA 3KDFA 4DV6L 3QB3A 1BCPF 2N55A 1IL2A 1AEXA 1PV4A 2F0TA 2I5MX 2VZAA 1IKLA 4H44C 1KNEA 4I7AA 3HS0C 2UUAL 3UE0A 3BJUA 3KF6A 1SNDA 4NXNL 4JW0A 3CU7A 3MA2B 3PQIA 4BBRB 4CHTB 1STHA 4GLAC 1V9PA 1YNJD 3M4QA 1SAPA 3TBIB 3K5LA 1STNA 1U5KA 2OF1A 1V43A 4IURA 5EKKA 1X56A 5M5YH 4WORA 5CMDA 3WOEA 4FF1A 3CCEA 4A3CH 3DXJC 5M5XH 3OW7A 2JA5H 4P2CB 4WRDA 1HR0L 5CORA 4LF8Q 4DUYQ 1JR0D 4XT3B 4FF3A 1U9RA 1N32L 5KYIA 2D2CC 2H4OA 3IRBA 3M3YB 1EQRA 1KNAA 1KL9A 1PFSA 2FHTA 3DUZA 1SNCA 3PO3H 1H9JA 3CCLA 4A3MH 2VUMB 1F9SA 1EU3A 5F2DA 1SYFA 3U9OA 3JAMi 3KLSA 3A56A 1M4VA 1PH9A 3N6RA 2VQFQ 3T13A 4GNXA 4TRDA 1RD9D 2JA8B 2OTJA 1I50B 1SDFA 3MXPA 1FNVA 4XYQA 4JBKA 1WTRA 1TWHH 2LMCB 4K5XA 1FR3A 5T1GA 1PRTC 2G9DA 2JQOA 2Z4IA 4LUOA 4GKKQ 2XWJB 2UXDL 2FFKB 1VQ9A 2KHSA 1EY7A 1LV9A 2OCEA 3K5OA 3T1YQ 4IFDI 2PO4A 1DOKA 3IFDA 2F3IA 5E4XA 3OMCA 3S24A 3F1ZA 5A2QE 3AQQA 3ERSX 4DR6L 3NE5B 3S1RB 3TS2A 1EY6A 2L55A 2K5WA 3FRPB 4A93B 2UXCQ 1XMQL 4QL5A 4KKTA 2NBFA 1OXVA 4YCUA 1KRTA 3DEOA 1HNZL 1L0YB 3GTKB 2JN4A 1DONA 1VQNA 4KTAA 1QNUA 3AB9A 4GOPB 2GA4B 2RSOA 1GO3E 1BBWA 4JI4L 5C5LA 2PMZE 4OWXB 2E74C 2OWOA 2QGQA 2HCCA 1XPRA 1RJTA 4XIGS 3P20A 2E5LQ 2WB1G 4BY1H 5EPLA 1QVGA 2B3GA 3DMUA 5ELBA 1QUQB 2ES2A 1TIID 4OGQC 4CDFC 3ULPA 3J81c 1HNXQ 3NTHA 5LL6X 2FJ2A 5E1FA 3CRKC 4AYBB 1D6EC 4JG2A 5IYCH 1BOSA 1HFGA 4J8QA 1VQCA 1WI5A 5IT9c 1XTCD 1Q8KA 1ILQA 1I3QH 3A7AB 2PZWA 4A3KG 2VB2X 1AW7A 3HOYB 4B3RL 4JI5L 2A6HC 3VYTA 5IOCA 4A3FH 3PO2B 1HA5A 2F3WA 3NWTA 1KLUD 3IFTA 1UUPA 3CC4A 2BH2A 2ZM6Q 4DR2Q 1TS4A 3H0GB 4XT1B 2I5LX 4DPGA 2F4IA 3V96A 1E3PA 3I7FA 1VQGA 1MHWC 3GTGH 3MHBA 4F88A 3JC66 3T51B 4IUTA 3UDGA 1BR9A 5BR8Q 1B4OA 4GOPA 4NKLA 5C3EG 1EY8A 4IUNA 1HHVA 4LF5Q 2TSSA 4A3BH 3L0OA 2B8GA 3KOJA 2NUCA 4N9TA 4OWTB 4LFCQ 2NZ1D 1GHJA 5C0XG 4LWCA 2AMCB 5JVG3 1GUNA 1WD1A 1K73C 2KA7A 1GUOA 5FLXE 2O5JC 1QUQA 5ISRA 5ELDA 2EYMA 1EYDA 3F2CA 2G9HD 1Q3LA 4L5RC 1Q82C 4DV7L 4GNXC 1ENFA 1WCMG 1KRSA 1QJOA 3K5MA 3RLOA 2X6LA 1Y1VG 2F3VA 4ZQ3A 1XTDA 4AQYQ 3BYYB 1L1OB 1I4XA 1KAWA 2K5DA 4LF9L 1NR4A 1EY9A 3AEVA 2MPMA 3FKIB 4J1MA 3PMFA 1CA5A 3C1EA 1VQOA 5IGGA 1UE7A 2NWGA 3P1HA 1D1KA 1Y14B 4DR4L 1SFOH 1B3QA 1OXUA 2A6ED 1WOCA 1PVOA 3NBHB 2MQHA 1K83H 3NHHA 5I4DA 2WAQE 1MGSA 5C4XG 3ULLA 2K6AA 5KNCA 4IN3A 5C3EH 1IBKL 3OIPA 4RKBA 2JJQA 2IPKD 4EQPA 2PZTA 3WWVA 3PF5A 2E2IB 3MWYW 1TT2A 2WP8J 5M3MH 2F0DA 3K59A 4G7OC 2HDMA 2B8FA 3J81L 1FD7D 3EQLC 3S1NB 4K2LA 2R6GA 4RGNA 3K5NA 4M1UB 1E2WA 3U50C 1UWVA 1PH3A 2QEXA 4ZAIA 3S9WA 2IT1A 2E2HB 1ENAA 1XNQQ 4DV2L 5EKIA 3FP9A 2K5VA 2F0IA 3ND9A 1DXMA 3PUXA 1XMOL 3A74A 2C35B 3QWNA 3T53B 4DV3Q 1L1OA 1HTPA 4C2MB 3J7AF 2YU9H 3HOUB 4J6HA 2A8VA 2E2JB 2Y0SE 5CBEE 1QE6A 1JORA 3S1MB 5G3LD 2C9OA 1L0WA 2K5NA 2YYZA 1TQOA 2R7FA 2XNAC 2HD3A 2MFIA 3D6WA 3HOZB 1NAPA 1DD2A 4LF6Q 3NBHA 2AWNA 4X3TA 2R7ZH 4LFAQ 1GUWA 5DM63 4KHZA 5CBAE 3CP0A 3SHLA 1VQAA 3HOVH 3NXWA 1TR5A 2KBNA 2ASBA 4RGOS 1MSHA 1U4MA 3RUZA 4A3IB 4FYDA 4POFA 2B29A 1AZPA 1QB5D 3F2UA 3SXHA 3HOWG 4LUVA 4FF4A 4CDCC 2AUJD 4DR1L 1LUZA 4OX9L 3GDEA 5CGKA 2IL8A 3FEWX 1D2BA 4JI1L 5KYLA 1N34Q 2IW3A 2A73B 2A69D 4M8AA 3VA5A 1I94L 5DLQE 4HMIA 3TN2A 2B63G 1SSOA 4JV5Q 2MO0A 4IOAA 3SK6A 4DR5L 3RZOB 3A8KE 3CCQA 2E76C 2KOLA 4K14A 1IXRA 3EIVA 3J80E 4RCOA 1WTXA 1XPOA 4X62Q 1V1QA 1PHJA 2PPBC 4KKUA 5DAUA 3I3CA 4EQ5A 1SYGA 1GUSA 4L5QA 1K3BC 5FO9B 2JXMB 1RHPA 1PTOB 2AHOB 1X3GA 3K7AB 3ICEA 4JI6L 3IKJA 1SNMA 2WKDA 1X3FA 1MBYA 1BNZA 4C3HB 3HOXH 3I4MH 4U68A 1PYBA 3HOWH 2JA6H 1ICWA 5EPKA 2JP1A 2RA4A 4L8JA 1K3RA 2UUBL 4DAPA 1O78A 3K58A 3S15B 4JOIA 4G7HC 4A3LG 3ER0A 1S5ED 3C2PA 2NTTA 3CW2C 1AP0A 4KY6A 5KNBA 1DCZA 1STBA 1R4PB 4DAMA 3FMCA 4DV1Q 2A6EC 2CQOA 5J3BA 1TWFB 3T4AC 5K36H 5LMNQ 4OO1I 1Q12A 2B63H 4N8X1 2PNHA 2Q2TA 4GZYC 4V190 4DKAC 2WAQB 1PZID 3QR8A 2PYKA 4OEMB 4OELB 4RHSA 4B3SQ 4A3DH 1PH4A 2ID0A 3M9BA 1CSQA 3I4NG 2HQEA 4FXDA 1IYJB 3VR3A 4WJ4A 5GAHC 1EIGA 5I9OA 3KLWA 4O1NA 1BUVT 2ALYB 1L1OC 2KEDA 1SR3A 5IT9E 4IPHA 4X64L 2B2YA 2VB3X 3NELA 2BOSA 3MXGA 5D3IB 3PCOB 1KDAA 4ZCKA 1ZKOA 1FNWA 1NUCA 3SR1A 3HKZG 1QOHA 2R92B 1TWGB 1NTGA 2XIWA 5M3FG 1JWMD 4HSVA 3NTIA 3X3NA 4IFDJ 1IW7C 4WFN3 1UE6A 1EQTA 2Z6BA 5IP9H 1J5EL 3I8ZA 1CHPD 1JT8A 2RBMA 3BU2A 4K6DA 5FOBB 4L5TA 2NVXH 2X69A 3LX0A 1OO9B 1S3OA 1GUTA 1X6OA 5E3FA 3U4ZA 4LF4L 2EDGA 1YZ6A 2NZOA 3G48A 2GN5A 1Z9FA 3RN5A 4BBSB 1PH1A 5JAVA 1X3EA 2NYZD 1MKHA 1UNSA 3T1HL 1LTSD 5BN3A 3E0JA 3PUWA 2IHFA 2ZTCA 2RSNA 1PTOF 3HG9A 2PNRC 1N36Q 5I9PA 1HA6A 4HJ5A 5FLXc 2HQLA 3Q6SA 3NQIA 1JB7A 4H7BA 4K6LA 2R93G 1K9MC 5J1ZA 1RKNA 2A69C 4Q0FA 2F0QA 3MEFA 1D5MC 1B50A 5A2QL 3VR2A 2M9VA 3GTMB 3GTLB 1X55A 4HIDA 1EFID 3ND8A 4A3JH 4EX5A 2HIXA 2CVRA 1JE4A 3M85A 4MTNA 4GN3B 1H95A 4IFDH 2XVSA 1A0IA 1BCPD 1YHBA 1B44D 3NEMA 3CF5A 4C3IG 4ID6A 3TP5A 3S2DH 5HY6A 2B2UA 4L6TB 4A3EB 3UDIA 2I46A 3X3MA 1YHQA 1CFMA 4LF7Q 1SLJA 2I5HA 3AYHB 4B9WA 2OTLA 5I2YA 3UI2A 5GAEC 2D62A 2A1AA 5IY0A 1K8AC 3D0FA 4JCVE 3KUPA 3TP7A 3GTOH 3PUVA 2F4VQ 3KBGA 1TS3A 2YTYA 5C44B 2EY1A 4AYBE 1T5EA 3T16A 2WV6D 4UDUC 1QVFA 4A3CG 1TWCH 4EGVA 2JA5G 2JEAI 3M4PA 1RTNA 1CHQD 3IAYA 1FVIA 5ELOA 5C4JB 2VXWA 1Y1WB 1XNRQ 4GKJQ 1C7YA 5I6WA 3DHQA 1JCKB 3S16H 2K4KA 1TS2A 4C3JH 5LL6S 3PO3G 5KIXA 1HQRD 4RGTA 3MVVA 2A6HD 5IP7H 3OTOQ 4A3GB 1X3QA 3PV0A 1EL0A 5ELCA 1E2VA 4PZ6A 2K05A 2HIVA 4GS3A 3VA7A 2RDFA 1TXYA 4C1NI 3K8AA 4FDBA 1SYCA 1DJRD 4N8FA 2QW7A 4YWKA 4L5SA 1ILPA 1LTBD 5KGUA 4X65L 2EYFA 1KC8C 1O80A 3HP3A 2NTSA 2NN6I 4YY3L 1EWCA 3TZDA 2UUCQ 3HGBA 4BBRH 1MSGA 2LSSA 2I0QA 1FNUA 4DV6Q 1D1IA 2EJFC 5FLXL 4HJ8A 3BYTB 4TVAB 2XRSD 4R9WA 2DNEA 4A75A 2XSCA 4P74A 4IJHA 4CDDC 3RZDB 3S1QB 1TY0A 5LMNW 2Q2UA 4O42A 2UUAQ 4CJ2C 4HMJA 4IUVA 1B53A 3MFYA 4DV0Q 4NXNQ 3M3YH 1Q90A 4UP9A 1H9SB 1S5BD 3E3XA 4CJ1B 1A62A 1PH2A 2VUMH 4BWGB 1G2SA 4JI2L 1LT6D 2XN9C 1VQLA 3NP8A 1HR0Q 5DEHA 3P7JA 2JEBI 2JA7B 1F77A 3GD7A 3C3LA 1N32Q 3VR6A 2O4XA 2BA0A 4BY1G 4JBJA 2JA8H 3J80c 4HTHA 1G291 1I50H 4PG3A 4R4CA 2NVQB 3CAMA 2Q8IB 3I4LA 1EU4A 1ASYA 4G4KA 1EOVA 4IQZA 2WFWA 4H02A 1K28A 3PIOA 1U4LA 2EXZA 4UAIA 1GXDC 3V2TA 2BH8A 1IBLQ 3TRZA 4ZRZA 4QGUA 3LWEA 3SK4A 3SK8A 5IYCG 1OXSC 1A63A 1NCVA 1L2FA 4BXXH 2B2UC 1Q86C 1WTHA 2UXCL 4QUCA 1PFBA 1GOZA 2LXKA 4RG1A 3S1RH 4KI0A 1BCPC 2M2LA 3IL8A 4IJLA 4IPCA 1VQDA 2UXDQ 1S5DD 1SMYC 4ABNA 4A3FG 4A93H 1QWYA 3KYHC 3GTKH 5IYDH 1LT4D 3PIPA 3CC2A 1CSPA 1AZQA 2DJGC 1I6HB 4KN4C 1WVLA 4UPAA 4DXGA 4DR6Q 1LTGD 1PH8A 5IWAL 1H9SA 1H9RA 1SROA 1JWSD 5E4WC 2ZJQA 2B2VC 2AUKA 3MAQA 2CH4W 1A2TA 2V4DA 1HNZQ 1EOTA 1X65A 3E9IA 4F7XA 3J7ZC 3H09A 4A3BG 2MJ8A 2Q2HA 1HJPA 3F2DA 3QO2A 1ET6A 2OEOA 1FJGL 4AH6A 1HTLD 3PUZA 4JI4Q 4X3SA 2LXJA 5HGTA 5M5WB 2AQ2B 3FPUB 4HN7A 4ZKCB 1LO5D 1HZ9A 3R3OA 3BDLA 2E8GA 2R7DA 4DNRB 3F8TA 3HOYH 4TQUS 4RKLA 2F0VA 3DWPA 3CMAA 3QIAA 1SNOA 3PO2H 3E0EA 4GLXA 1N33L 4X66Q 2PCFB 2QKIC 1SYBA 1MI2A 3H0GH 4R4TA 3H94A 5AFWA 2Z0SA 5IE8A 4LF5L 1XWEA 5CC4A 3D4WA 4JI5Q 3GTPB 2EYJA 1CA6A 4K8IA 4Y7NB 2PZUA 4PZ7A 3BVGA 1F9QA 2Z6KA 3GTJB 1BDOA 3J80L 1EYCA 2NVTB 1SJED 5M3MG 3BZDB 3GV3A 3CQZB 2WB1B 2XGTA 4ZYSA 1VQJA 2ZJRA 5T1IA 1HQMC 3QJYA 1YNXA 1EFWA 1VQKA 1JE5A 4B3TL 4POGA 5EQ0A 4DK0A 1RF2D 4HIKA 3BZKA 4B08A 3D3RA 1K8MA 4KLKA 3RLFA 2LFNA 4H0LC 1KHIA 2QCPX 1TWAB 5TSSA 2KENA 3P75A 4A3KB 3GTQB 1A2UA 3FKIH 5J22A 4DXFA 4R4OA 3E9HA 3MXUA 1HUNA
chains in the Genus database with same CATH topology
4AYBG 1UE1A 4A3EH 3KDFB 3NENA 4IOCA 4JI6L 4JBWA 1QZGA 4DV7Q 3ICEA 1X3FA 1KD1C 4DAYB 3HOXH 3RLNA 3I4MH 1PYBA 4YHHL 3HOWH 2JA6H 4HJ9A 2F4VL 1K3RA 2UUBL 2EXDA 4DNIA 4LF9Q 1NY4A 1CKOA 2YTXA 3HOWG 4JOIA 3HOYG 1UE5A 4DV4Q 4A3LG 2F52A 3ER0A 3I56A 3CW2C 3EBEA 3KF6B 3J80i 2R7ZG 3B6YA 2MNAA 3PO2G 4DAMA 1YJNA 1HNWL 2D0OA 1LM0A 4DV1Q 2E2IH 1Q7YC 2CQOA 1QVCA 2GVBA 5J3BA 3HOVG 5C44H 5LMNQ 3I4OA 1XNRL 4GKJL 4OO1I 3K0XA 2H5XA 5AJ3L 2RHQB 1Q12A 1UEBA 3H0GG 2E5LL 2B63H 3S1NH 2PNHA 2Q2TA 1I6HH 2HT1A 2KCTA 4DKAC 5JEAG 1VQPA 1YI2A 4A3DH 1XMQQ 4B3SQ 1IBKQ 1HNXL 4UY8C 1PH4A 2ID0A 2E2HH 3M9BA 4PZ8A 3OTOL 1CSQA 4RMFA 2AHOB 3I4NG 1YIJA 1IYJB 1K0RA 4OXPA 4WJ4A 2R93H 4P72A 4JI8Q 4NXML 2HHHQ 5GAHC 2VNUD 3G6EA 4OONA 3CXCA 3KLWA 3K7UC 1MIUA 1EQQA 1GKHA 1WJJA 1AE2A 2ALYB 1MJCA 3I2ZA 4NPSA 3J7A5 1HZAA 4UP7A 4X6AH 1L1OC 2VY3A 1HR0W 5IWAQ 4GN5A 3UE1A 1SR3A 4DV5Q 1SN8A 3A0JA 4C2MH 4DV2Q 3HOUH 4IPHA 4X64L 5M5WH 2RF4A 4GNXB 3NELA 5JJIA 2JA7G 4A3MG 1KQSA 2E2JH 1WYDA 4NB3A 5JJLA 4QIWE 3RN2A 2UUCL 1D8LA 3S1MH 1E24A 3PCOB 4C3IH 4KHPQ 1X9NA 3W1GA 2YTVA 5HGQA 3HKZG 3TQYA 2ZM6L 3KDFA 4DR2L 4DV6L 3SGIA 1VQHA 1NTGA 5M3FG 3HOZH 2JA9A 1IL2A 1PV4A 4X66L 2I5MX 3KFUA 3J81i 1FJGQ 1OXXK 2D0PA 2VZAA 2CKZB 4IFDJ 3FKIG 3HFZB 1UE6A 2UUAL 5BR8L 1PH7A 5IP9H 1J5EL 3UE0A 3BJUA 3KF6A 1IBML 1JT8A 3Q8DA 3BU2A 4DR3Q 4NXNL 3HOXG 3I4MG 2JA6G 4L5TA 4A3IH 1G51A 4GLAC 2NVXH 4B3RQ 1V9PA 3H3VH 4BA1I 3M4QA 4P71A 1S3OA 4LFCL 1U5KA 1V43A 1X6OA 4GOPC 4DUZL 3U4ZA 1VQMA 4HIMA 3CPFA 1X56A 5M5YH 3KJOA 4LF4L 4BY7G 1D7QA 1YZ6A 3H3VI 3CCEA 3VDYA 3GTPH 4A3CH 5M5XH 4Y7NH 2NZOA 2JA5H 5LMUQ 4OO1G 2K75A 1HZBA 3G48A 2K52A 3GTJH 1HR0L 4LF8Q 4DUYQ 1RIPA 2GN5A 1N33Q 2NVTH 5K36G 1Z9FA 3RN5A 1N32L 1PH1A 1E7ZA 4PMWA 2VQEQ 4DR7Q 1X3EA 1BVSA 1MKHA 3CQZH 3T1HL 5C0XJ 1EYGA 3D31A 3IRBA 1U0LA 3HKZE 1EQRA 3PUWA 2IHFA 2ZTCA 1KL9A 1PFSA 4AQYL 1S40A 4ME3A 3PO3H 1N36Q 4A3DG 3CCLA 4A3MH 3MXNB 2PI2E 2AWOA 4HJ5A 4DR1Q 5FLXc 4AIMA 4OX9Q 2HQLA 2AKWB 2ATWA 1JB7A 3RZOH 2OQ0A 3RR5A 2R93G 3JAMi 1K9MC 1PH9A 1LTLA 3MEFA 2VQFQ 3J81j 4GNXA 1X55A 1OTCA 3TEHB 2OTJA 4HIDA 4LF5L 4A3JH 1I94Q 3UDFA 1TWAH 1FL0A 2HIXA 4EX5A 1VQ8A 4JBKA 1TWHH 4GN4B 4A3KH 3GTQH 3UDXA 3M85A 3CC7A 4JI7L 4MTNA 4HJ7A 1VS0A 4B3TQ 2EIFA 2JQOA 4GN3B 4LUOA 4GKKQ 2MO1A 4DR5Q 3HOUG 2UXDL 1H95A 4MZ9A 3K7AH 2OQKA 1VQ9A 1A0IA 1YHBA 4DV4L 1VQ7A 4C3HH 3NEMA 3CF5A 4Y52H 3T1YQ 2OCEA 4IPDA 3S2DH 4IFDI 4BY7H 5HY6A 3KF8B 2F3IA 4YCWA 4O0AA 4A76A 4OWWB 3S24A 2GVAA 3HOZG 1X54A 3F1ZA 3UDIA 3S15H 1MJEA 2N3SA 3AQQA 3ERSX 4DR6L 1YHQA 3S14H 3TS2A 4LF7Q 1SLJA 1XNQL 2I5HA 3AYHB 4DR4Q 3S2HH 2FXQA 3AFPA 3GO5A 2OTLA 5IP9G 4QL5A 1TWFH 3K81C 1XMQL 4B3SL 4JI6Q 1OXTA 1OXVA 2D62A 2N8NA 2A1AA 4YCUA 1KRTA 5GAEC 1ASZA 5IY0A 4YHHQ 1K8AC 1HNZL 3D0FA 4JCVE 4A3IG 1DGSA 3LGJA 3GTOH 1VQNA 3PUVA 2Y0SG 1M1KC 1P8LA 2F4VQ 5IYBH 2YTYA 4JI3L 4AYBE 4DV3L 2VL6A 1QVFA 4GOPB 4A3CG 3AFQA 3DM3A 1TWCH 3PUYA 1GO3E 4IPGA 1BBWA 3W1BA 2JA5G 1NE3A 3M4PA 4XTCS 1Q1BA 4JI4L 2JEAI 1AE3A 2PMZE 1HNWQ 4OWXB 1FVIA 5ELOA 2OWOA 2QGQA 1XPRA 4K0KL 3A5ZB 4XIGS 1XNRQ 1WCMH 4GKJQ 1C7YA 2K14A 5AJ3Q 2E5LQ 1SRUA 2WB1G 4O2DA 4BY1H 3S16H 1Y1VH 2B3GA 2K4KA 4GLVB 1QVGA 4B3ML 1QUQB 2ES2A 4P73A 4C3JH 3PO3G 3ULPA 3J81c 1G6PA 1HNXQ 4LF6L 4MNOA 4JYAL 1PH6A 5IP7H 3OTOQ 3PV0A 1B8AA 4LFAL 1EWIA 4PZ6A 1JMCA 4NXMQ 2HIVA 4GS3A 4JG2A 5IYCH 1XMOQ 1VQCA 1WI5A 5IT9c 1TXYA 4HIOA 1Z47A 3K8AA 4FDBA 1Q8KA 2PI2A 4YWKA 5GROA 3CCUA 1TWGH 4L5SA 4A3JG 1E1OA 1I3QH 4DR3L 4DK6C 5C4XH 4A3KG 4X65L 1Q81C 4LFBL 4B3RL 1KC8C 4JI5L 1IZ6A 4X64Q 4IFDG 4A3FH 2NN6I 2A19A 2DUDA 4YY3L 3S17H 2K5HA 2UUCQ 1C9OA 2JK8A 2NZHA 3CCSA 3CC4A 2BA1A 4BBRH 5LMUL 2BH2A 1KIXA 2LSSA 2ZM6Q 2I0QA 1N34L 4DR2Q 1GD7A 1VQEA 4DV6Q 2I5LX 4DPGA 2Z6KC 4HJ8A 1NJIC 4JI0L 4TVAB 1E3PA 3I7FA 1VQGA 2VQEL 1QZHA 1WFQA 4YCVA 3GTGH 4DR7L 1FGUA 4A75A 4P74A 2KHIA 1YBYA 3JC66 4IJHA 3U58A 1YITA 3L2PA 4JV5L 5LMNW 2Q2UA 2ZTEA 3UDGA 2UXBL 4R4QA 2UUAQ 5BR8Q 1HZCA 2YV5A 4DV0Q 2XTIA 4GOPA 1J5EQ 5C3EG 1IBMQ 4BBSH 1EIFA 1JJGA 4NXNQ 1YVCA 4LF5Q 2NVYH 2IX1A 3BZCA 3L0OA 4A3BH 3KOJA 3M3YH 4UP9A 4A4IA 4OWTB 4LFCQ 5IYBG 2WAQG 4X62L 5C0XG 4DUZQ 4LWCA 2AMCB 1A62A 1PH2A 1VQ5A 1K73C 4YWMA 2VUMH 3CCJA 2Q2IA 1QUQA 3G4SA 4JI1Q 2KHJA 4JI2L 1VQLA 4WJ3M 3F2CA 5H1SE 1GM5A 1HR0Q 2PQAB 2JEBI 4L5RC 1Q82C 3GD7A 4DV7L 1N32Q 3ZJYC 4GNXC 1M90C 1WCMG 1KRSA 1NMFA 2VS1A 3W5OA 1N8RC 3RLOA 3T1HQ 3GTMH 2BA0A 3GTLH 2K50A 4BY1G 4JBJA 2JA8H 1Y1VG 3J80c 1G291 1I50H 1XTDA 4PG3A 4R4CA 4AQYQ 1L1OB 3CAMA 3H15A 1KAWA 1S72A 1A8VA 3CD6A 4LF9L 2IY5B 1ASYA 1RL2A 1EOVA 3AEVA 2WFWA 3CCRA 1JJ2A 3PF4A 4H02A 3PIOA 5IP7G 1J6QA 2BH8A 1IBLQ 3TRZA 1B70B 5FLMH 1EIYB 4QGUA 1VQOA 2N78A 4DV1L 1XJVA 5EAYA 4JOIC 3U4VA 5IYCG 1OXSC 1UE7A 1VQ4A 5LMNL 1A63A 1L2FA 4BXXH 1Y14B 4DR4L 1SFOH 2UU9Q 1OXUA 1Q86C 1SMXA 1WOCA 4QJFA 2R92G 1PVOA 3NBHB 2UXCL 2L15A 4BA2I 2MQHA 1K83H 2V1CC 4RG1A 2LXKA 2WAQE 1O7IA 1YJ9A 2NN6G 4DK3C 3ULLA 3S1RH 4KI0A 5C4XG 1IBKL 5C3EH 4JI7Q 4IJLA 4IPCA 5GADC 1YJWA 1CKNB 1VQDA 2UXDQ 2JJQA 3WWVA 4A3FG 4A93H 3PF5A 4JI8L 2HHHL 3M7NA 2UUBQ 2WP8J 1SE8A 3EN2A 5M3MH 3RNUA 3KYHC 4BBRG 3GTKH 3DLLA 5IYDH 1W3SA 1Q1EA 2KCMA 2IX0A 5JEAJ 3PIPA 2R6GA 3CC2A 1CSPA 3K80C 3FHWA 1YHAA 5C0XI 3U50C 1UWVA 4J15A 2CFMA 4UPAA 1PH3A 4DR6Q 2QEXA 1PH8A 2IT1A 5IWAL 4DV5L 1SROA 1XNQQ 4DV2L 2DGYA 1XPUA 2ZJQA 1W2BA 1I5FA 1NBWA 2K5VA 3FP9A 5C4JH 1VQFA 3F2BA 4BBSG 1Y1WH 1GVPA 1P16A 2N49A 1HNZQ 4KHPL 1X65A 3E9IA 3J7ZC 4APVA 2PQAA 4A3BG 2CWAA 2VW9A 2Q2HA 3PUXA 1HJPA 3F2DA 1CUKA 3A5UA 1XMOL 4JI3Q 3A74A 2C35B 4UP8A 1FJGL 4DV3Q 2VUMG 4AH6A 5FJ8H 3L7ZC 4A3GH 1L1OA 3PUZA 4JI4Q 2CCZA 2LXJA 2YU9H 1VQ6A 2R92H 3M4OH 2A8VA 2Y0SE 3I55A 4K0KQ 3TREA 2CWPA 4P75A 3CMEA 1L0WA 1HZ9A 2K5NA 1T9HA 2YYZA 2R7FA 4R1JA 3PSIA 1PH5A 4B3MQ 4LNQA 2JA8G 2E8GA 2R7DA 5JJKA 4LW1A 2MFIA 1BKBA 2RCNA 4R4IA 1R9TH 3STBD 3F8TA 2RHSB 3HOYH 4A3LH 3OYYA 4TQUS 4LF6Q 3CMAA 2AWNA 3OW2A 4JYAQ 2R7ZH 4LFAQ 5GAGC 5FLMG 3PO2H 3E0EA 4GLXA 2WB1E 3G71A 4KHZA 4LF8L 3CP0A 4DUYL 3HKSA 1VQAA 1N33L 3CCVA 2QA4A 3HOVH 1B7YB 2UXCQ 4X66Q 1CKNA 2KBNA 1YEZA 2ASBA 4BXXG 1PYSB 1E22A 3H0GH 4R4TA 4POFA 4A3EG 4DV0L 2B29A 4YWLA 2Z0SA 2ZTDA 4LUVA 5IE8A 3JAMc 4X65Q 1N36L 3STBC 3RZDH 1Q46A 1HH2P 3S1QH 4LFBQ 1C0AA 1KXLA 4DR1L 1LUZA 4JI5Q 4OX9L 3I4NH 3GDEA 1K8GA 4PZ7A 4A93G 4LUZA 2Z6KA 1EUJA 1JJCB 4YY3Q 4HJAA 1N9WA 5M3MG 4JI1L 1VQIA 2VQFL 5GQOA 5IYDG 4LF4Q 1PA6A 2IHEA 1N34Q 2XGTA 1VQJA 2ZJRA 3CCMA 3ULJA 4JI0Q 1I94L 5C44G 4JBMA 5DLQE 4ALPA 4IO9A 1YNXA 4JC0A 1EFWA 5E7NA 2B63G 4JV5Q 2MO0A 1VQKA 1JE5A 4B3TL 1CKMA 4POGA 4IOAA 2UXBQ 1VCIA 4GKKL 4DR5L 4HIKA 4QQBX 3BZKA 3CCQA 2JA7H 3KJPA 1LYLA 2ZJPA 1Y1WG 3TS0A 3T1YL 1IXRA 1IBLL 3EIVA 3PGZA 2NVQH 2EQSA 1BBUA 3CPWA 1XPOA 4KLKA 3RLFA 4X62Q 5M3FH 1KHIA 1V1QA 4QY7A 2JE6I 1PHJA 1AH9A 2KENA 2UU9L 5FJ8G 1NMGA 4EQ5A 1E1TA 3FKIH 4JI2Q 4LF7L 4A3GG 4R4OA 4L5QA 3E9HA 1VQBA 5ELNA 1X3GA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4AYB G;  1UE1 A;  4A3E H;  3KDF B;  3NEN A;  4IOC A;  4JI6 L;  4JBW A;  1QZG A;  4DV7 Q;  3ICE A;  1X3F A;  1KD1 C;  4DAY B;  3HOX H;  3RLN A;  3I4M H;  1PYB A;  4YHH L;  3HOW H;  2JA6 H;  4HJ9 A;  2F4V L;  1K3R A;  2UUB L;  2EXD A;  4DNI A;  4LF9 Q;  1NY4 A;  1CKO A;  2YTX A;  3HOW G;  4JOI A;  3HOY G;  1UE5 A;  4DV4 Q;  4A3L G;  2F52 A;  3ER0 A;  3I56 A;  3CW2 C;  3EBE A;  3KF6 B;  3J80 i;  2R7Z G;  3B6Y A;  2MNA A;  3PO2 G;  4DAM A;  1YJN A;  1HNW L;  2D0O A;  1LM0 A;  4DV1 Q;  2E2I H;  1Q7Y C;  2CQO A;  1QVC A;  2GVB A;  5J3B A;  3HOV G;  5C44 H;  5LMN Q;  3I4O A;  1XNR L;  4GKJ L;  4OO1 I;  3K0X A;  2H5X A;  5AJ3 L;  2RHQ B;  1Q12 A;  1UEB A;  3H0G G;  2E5L L;  2B63 H;  3S1N H;  2PNH A;  2Q2T A;  1I6H H;  2HT1 A;  2KCT A;  4DKA C;  5JEA G;  1VQP A;  1YI2 A;  4A3D H;  1XMQ Q;  4B3S Q;  1IBK Q;  1HNX L;  4UY8 C;  1PH4 A;  2ID0 A;  2E2H H;  3M9B A;  4PZ8 A;  3OTO L;  1CSQ A;  4RMF A;  2AHO B;  3I4N G;  1YIJ A;  1IYJ B;  1K0R A;  4OXP A;  4WJ4 A;  2R93 H;  4P72 A;  4JI8 Q;  4NXM L;  2HHH Q;  5GAH C;  2VNU D;  3G6E A;  4OON A;  3CXC A;  3KLW A;  3K7U C;  1MIU A;  1EQQ A;  1GKH A;  1WJJ A;  1AE2 A;  2ALY B;  1MJC A;  3I2Z A;  4NPS A;  3J7A 5;  1HZA A;  4UP7 A;  4X6A H;  1L1O C;  2VY3 A;  1HR0 W;  5IWA Q;  4GN5 A;  3UE1 A;  1SR3 A;  4DV5 Q;  1SN8 A;  3A0J A;  4C2M H;  4DV2 Q;  3HOU H;  4IPH A;  4X64 L;  5M5W H;  2RF4 A;  4GNX B;  3NEL A;  5JJI A;  2JA7 G;  4A3M G;  1KQS A;  2E2J H;  1WYD A;  4NB3 A;  5JJL A;  4QIW E;  3RN2 A;  2UUC L;  1D8L A;  3S1M H;  1E24 A;  3PCO B;  4C3I H;  4KHP Q;  1X9N A;  3W1G A;  2YTV A;  5HGQ A;  3HKZ G;  3TQY A;  2ZM6 L;  3KDF A;  4DR2 L;  4DV6 L;  3SGI A;  1VQH A;  1NTG A;  5M3F G;  3HOZ H;  2JA9 A;  1IL2 A;  1PV4 A;  4X66 L;  2I5M X;  3KFU A;  3J81 i;  1FJG Q;  1OXX K;  2D0P A;  2VZA A;  2CKZ B;  4IFD J;  3FKI G;  3HFZ B;  1UE6 A;  2UUA L;  5BR8 L;  1PH7 A;  5IP9 H;  1J5E L;  3UE0 A;  3BJU A;  3KF6 A;  1IBM L;  1JT8 A;  3Q8D A;  3BU2 A;  4DR3 Q;  4NXN L;  3HOX G;  3I4M G;  2JA6 G;  4L5T A;  4A3I H;  1G51 A;  4GLA C;  2NVX H;  4B3R Q;  1V9P A;  3H3V H;  4BA1 I;  3M4Q A;  4P71 A;  1S3O A;  4LFC L;  1U5K A;  1V43 A;  1X6O A;  4GOP C;  4DUZ L;  3U4Z A;  1VQM A;  4HIM A;  3CPF A;  1X56 A;  5M5Y H;  3KJO A;  4LF4 L;  4BY7 G;  1D7Q A;  1YZ6 A;  3H3V I;  3CCE A;  3VDY A;  3GTP H;  4A3C H;  5M5X H;  4Y7N H;  2NZO A;  2JA5 H;  5LMU Q;  4OO1 G;  2K75 A;  1HZB A;  3G48 A;  2K52 A;  3GTJ H;  1HR0 L;  4LF8 Q;  4DUY Q;  1RIP A;  2GN5 A;  1N33 Q;  2NVT H;  5K36 G;  1Z9F A;  3RN5 A;  1N32 L;  1PH1 A;  1E7Z A;  4PMW A;  2VQE Q;  4DR7 Q;  1X3E A;  1BVS A;  1MKH A;  3CQZ H;  3T1H L;  5C0X J;  1EYG A;  3D31 A;  3IRB A;  1U0L A;  3HKZ E;  1EQR A;  3PUW A;  2IHF A;  2ZTC A;  1KL9 A;  1PFS A;  4AQY L;  1S40 A;  4ME3 A;  3PO3 H;  1N36 Q;  4A3D G;  3CCL A;  4A3M H;  3MXN B;  2PI2 E;  2AWO A;  4HJ5 A;  4DR1 Q;  5FLX c;  4AIM A;  4OX9 Q;  2HQL A;  2AKW B;  2ATW A;  1JB7 A;  3RZO H;  2OQ0 A;  3RR5 A;  2R93 G;  3JAM i;  1K9M C;  1PH9 A;  1LTL A;  3MEF A;  2VQF Q;  3J81 j;  4GNX A;  1X55 A;  1OTC A;  3TEH B;  2OTJ A;  4HID A;  4LF5 L;  4A3J H;  1I94 Q;  3UDF A;  1TWA H;  1FL0 A;  2HIX A;  4EX5 A;  1VQ8 A;  4JBK A;  1TWH H;  4GN4 B;  4A3K H;  3GTQ H;  3UDX A;  3M85 A;  3CC7 A;  4JI7 L;  4MTN A;  4HJ7 A;  1VS0 A;  4B3T Q;  2EIF A;  2JQO A;  4GN3 B;  4LUO A;  4GKK Q;  2MO1 A;  4DR5 Q;  3HOU G;  2UXD L;  1H95 A;  4MZ9 A;  3K7A H;  2OQK A;  1VQ9 A;  1A0I A;  1YHB A;  4DV4 L;  1VQ7 A;  4C3H H;  3NEM A;  3CF5 A;  4Y52 H;  3T1Y Q;  2OCE A;  4IPD A;  3S2D H;  4IFD I;  4BY7 H;  5HY6 A;  3KF8 B;  2F3I A;  4YCW A;  4O0A A;  4A76 A;  4OWW B;  3S24 A;  2GVA A;  3HOZ G;  1X54 A;  3F1Z A;  3UDI A;  3S15 H;  1MJE A;  2N3S A;  3AQQ A;  3ERS X;  4DR6 L;  1YHQ A;  3S14 H;  3TS2 A;  4LF7 Q;  1SLJ A;  1XNQ L;  2I5H A;  3AYH B;  4DR4 Q;  3S2H H;  2FXQ A;  3AFP A;  3GO5 A;  2OTL A;  5IP9 G;  4QL5 A;  1TWF H;  3K81 C;  1XMQ L;  4B3S L;  4JI6 Q;  1OXT A;  1OXV A;  2D62 A;  2N8N A;  2A1A A;  4YCU A;  1KRT A;  5GAE C;  1ASZ A;  5IY0 A;  4YHH Q;  1K8A C;  1HNZ L;  3D0F A;  4JCV E;  4A3I G;  1DGS A;  3LGJ A;  3GTO H;  1VQN A;  3PUV A;  2Y0S G;  1M1K C;  1P8L A;  2F4V Q;  5IYB H;  2YTY A;  4JI3 L;  4AYB E;  4DV3 L;  2VL6 A;  1QVF A;  4GOP B;  4A3C G;  3AFQ A;  3DM3 A;  1TWC H;  3PUY A;  1GO3 E;  4IPG A;  1BBW A;  3W1B A;  2JA5 G;  1NE3 A;  3M4P A;  4XTC S;  1Q1B A;  4JI4 L;  2JEA I;  1AE3 A;  2PMZ E;  1HNW Q;  4OWX B;  1FVI A;  5ELO A;  2OWO A;  2QGQ A;  1XPR A;  4K0K L;  3A5Z B;  4XIG S;  1XNR Q;  1WCM H;  4GKJ Q;  1C7Y A;  2K14 A;  5AJ3 Q;  2E5L Q;  1SRU A;  2WB1 G;  4O2D A;  4BY1 H;  3S16 H;  1Y1V H;  2B3G A;  2K4K A;  4GLV B;  1QVG A;  4B3M L;  1QUQ B;  2ES2 A;  4P73 A;  4C3J H;  3PO3 G;  3ULP A;  3J81 c;  1G6P A;  1HNX Q;  4LF6 L;  4MNO A;  4JYA L;  1PH6 A;  5IP7 H;  3OTO Q;  3PV0 A;  1B8A A;  4LFA L;  1EWI A;  4PZ6 A;  1JMC A;  4NXM Q;  2HIV A;  4GS3 A;  4JG2 A;  5IYC H;  1XMO Q;  1VQC A;  1WI5 A;  5IT9 c;  1TXY A;  4HIO A;  1Z47 A;  3K8A A;  4FDB A;  1Q8K A;  2PI2 A;  4YWK A;  5GRO A;  3CCU A;  1TWG H;  4L5S A;  4A3J G;  1E1O A;  1I3Q H;  4DR3 L;  4DK6 C;  5C4X H;  4A3K G;  4X65 L;  1Q81 C;  4LFB L;  4B3R L;  1KC8 C;  4JI5 L;  1IZ6 A;  4X64 Q;  4IFD G;  4A3F H;  2NN6 I;  2A19 A;  2DUD A;  4YY3 L;  3S17 H;  2K5H A;  2UUC Q;  1C9O A;  2JK8 A;  2NZH A;  3CCS A;  3CC4 A;  2BA1 A;  4BBR H;  5LMU L;  2BH2 A;  1KIX A;  2LSS A;  2ZM6 Q;  2I0Q A;  1N34 L;  4DR2 Q;  1GD7 A;  1VQE A;  4DV6 Q;  2I5L X;  4DPG A;  2Z6K C;  4HJ8 A;  1NJI C;  4JI0 L;  4TVA B;  1E3P A;  3I7F A;  1VQG A;  2VQE L;  1QZH A;  1WFQ A;  4YCV A;  3GTG H;  4DR7 L;  1FGU A;  4A75 A;  4P74 A;  2KHI A;  1YBY A;  3JC6 6;  4IJH A;  3U58 A;  1YIT A;  3L2P A;  4JV5 L;  5LMN W;  2Q2U A;  2ZTE A;  3UDG A;  2UXB L;  4R4Q A;  2UUA Q;  5BR8 Q;  1HZC A;  2YV5 A;  4DV0 Q;  2XTI A;  4GOP A;  1J5E Q;  5C3E G;  1IBM Q;  4BBS H;  1EIF A;  1JJG A;  4NXN Q;  1YVC A;  4LF5 Q;  2NVY H;  2IX1 A;  3BZC A;  3L0O A;  4A3B H;  3KOJ A;  3M3Y H;  4UP9 A;  4A4I A;  4OWT B;  4LFC Q;  5IYB G;  2WAQ G;  4X62 L;  5C0X G;  4DUZ Q;  4LWC A;  2AMC B;  1A62 A;  1PH2 A;  1VQ5 A;  1K73 C;  4YWM A;  2VUM H;  3CCJ A;  2Q2I A;  1QUQ A;  3G4S A;  4JI1 Q;  2KHJ A;  4JI2 L;  1VQL A;  4WJ3 M;  3F2C A;  5H1S E;  1GM5 A;  1HR0 Q;  2PQA B;  2JEB I;  4L5R C;  1Q82 C;  3GD7 A;  4DV7 L;  1N32 Q;  3ZJY C;  4GNX C;  1M90 C;  1WCM G;  1KRS A;  1NMF A;  2VS1 A;  3W5O A;  1N8R C;  3RLO A;  3T1H Q;  3GTM H;  2BA0 A;  3GTL H;  2K50 A;  4BY1 G;  4JBJ A;  2JA8 H;  1Y1V G;  3J80 c;  1G29 1;  1I50 H;  1XTD A;  4PG3 A;  4R4C A;  4AQY Q;  1L1O B;  3CAM A;  3H15 A;  1KAW A;  1S72 A;  1A8V A;  3CD6 A;  4LF9 L;  2IY5 B;  1ASY A;  1RL2 A;  1EOV A;  3AEV A;  2WFW A;  3CCR A;  1JJ2 A;  3PF4 A;  4H02 A;  3PIO A;  5IP7 G;  1J6Q A;  2BH8 A;  1IBL Q;  3TRZ A;  1B70 B;  5FLM H;  1EIY B;  4QGU A;  1VQO A;  2N78 A;  4DV1 L;  1XJV A;  5EAY A;  4JOI C;  3U4V A;  5IYC G;  1OXS C;  1UE7 A;  1VQ4 A;  5LMN L;  1A63 A;  1L2F A;  4BXX H;  1Y14 B;  4DR4 L;  1SFO H;  2UU9 Q;  1OXU A;  1Q86 C;  1SMX A;  1WOC A;  4QJF A;  2R92 G;  1PVO A;  3NBH B;  2UXC L;  2L15 A;  4BA2 I;  2MQH A;  1K83 H;  2V1C C;  4RG1 A;  2LXK A;  2WAQ E;  1O7I A;  1YJ9 A;  2NN6 G;  4DK3 C;  3ULL A;  3S1R H;  4KI0 A;  5C4X G;  1IBK L;  5C3E H;  4JI7 Q;  4IJL A;  4IPC A;  5GAD C;  1YJW A;  1CKN B;  1VQD A;  2UXD Q;  2JJQ A;  3WWV A;  4A3F G;  4A93 H;  3PF5 A;  4JI8 L;  2HHH L;  3M7N A;  2UUB Q;  2WP8 J;  1SE8 A;  3EN2 A;  5M3M H;  3RNU A;  3KYH C;  4BBR G;  3GTK H;  3DLL A;  5IYD H;  1W3S A;  1Q1E A;  2KCM A;  2IX0 A;  5JEA J;  3PIP A;  2R6G A;  3CC2 A;  1CSP A;  3K80 C;  3FHW A;  1YHA A;  5C0X I;  3U50 C;  1UWV A;  4J15 A;  2CFM A;  4UPA A;  1PH3 A;  4DR6 Q;  2QEX A;  1PH8 A;  2IT1 A;  5IWA L;  4DV5 L;  1SRO A;  1XNQ Q;  4DV2 L;  2DGY A;  1XPU A;  2ZJQ A;  1W2B A;  1I5F A;  1NBW A;  2K5V A;  3FP9 A;  5C4J H;  1VQF A;  3F2B A;  4BBS G;  1Y1W H;  1GVP A;  1P16 A;  2N49 A;  1HNZ Q;  4KHP L;  1X65 A;  3E9I A;  3J7Z C;  4APV A;  2PQA A;  4A3B G;  2CWA A;  2VW9 A;  2Q2H A;  3PUX A;  1HJP A;  3F2D A;  1CUK A;  3A5U A;  1XMO L;  4JI3 Q;  3A74 A;  2C35 B;  4UP8 A;  1FJG L;  4DV3 Q;  2VUM G;  4AH6 A;  5FJ8 H;  3L7Z C;  4A3G H;  1L1O A;  3PUZ A;  4JI4 Q;  2CCZ A;  2LXJ A;  2YU9 H;  1VQ6 A;  2R92 H;  3M4O H;  2A8V A;  2Y0S E;  3I55 A;  4K0K Q;  3TRE A;  2CWP A;  4P75 A;  3CME A;  1L0W A;  1HZ9 A;  2K5N A;  1T9H A;  2YYZ A;  2R7F A;  4R1J A;  3PSI A;  1PH5 A;  4B3M Q;  4LNQ A;  2JA8 G;  2E8G A;  2R7D A;  5JJK A;  4LW1 A;  2MFI A;  1BKB A;  2RCN A;  4R4I A;  1R9T H;  3STB D;  3F8T A;  2RHS B;  3HOY H;  4A3L H;  3OYY A;  4TQU S;  4LF6 Q;  3CMA A;  2AWN A;  3OW2 A;  4JYA Q;  2R7Z H;  4LFA Q;  5GAG C;  5FLM G;  3PO2 H;  3E0E A;  4GLX A;  2WB1 E;  3G71 A;  4KHZ A;  4LF8 L;  3CP0 A;  4DUY L;  3HKS A;  1VQA A;  1N33 L;  3CCV A;  2QA4 A;  3HOV H;  1B7Y B;  2UXC Q;  4X66 Q;  1CKN A;  2KBN A;  1YEZ A;  2ASB A;  4BXX G;  1PYS B;  1E22 A;  3H0G H;  4R4T A;  4POF A;  4A3E G;  4DV0 L;  2B29 A;  4YWL A;  2Z0S A;  2ZTD A;  4LUV A;  5IE8 A;  3JAM c;  4X65 Q;  1N36 L;  3STB C;  3RZD H;  1Q46 A;  1HH2 P;  3S1Q H;  4LFB Q;  1C0A A;  1KXL A;  4DR1 L;  1LUZ A;  4JI5 Q;  4OX9 L;  3I4N H;  3GDE A;  1K8G A;  4PZ7 A;  4A93 G;  4LUZ A;  2Z6K A;  1EUJ A;  1JJC B;  4YY3 Q;  4HJA A;  1N9W A;  5M3M G;  4JI1 L;  1VQI A;  2VQF L;  5GQO A;  5IYD G;  4LF4 Q;  1PA6 A;  2IHE A;  1N34 Q;  2XGT A;  1VQJ A;  2ZJR A;  3CCM A;  3ULJ A;  4JI0 Q;  1I94 L;  5C44 G;  4JBM A;  5DLQ E;  4ALP A;  4IO9 A;  1YNX A;  4JC0 A;  1EFW A;  5E7N A;  2B63 G;  4JV5 Q;  2MO0 A;  1VQK A;  1JE5 A;  4B3T L;  1CKM A;  4POG A;  4IOA A;  2UXB Q;  1VCI A;  4GKK L;  4DR5 L;  4HIK A;  4QQB X;  3BZK A;  3CCQ A;  2JA7 H;  3KJP A;  1LYL A;  2ZJP A;  1Y1W G;  3TS0 A;  3T1Y L;  1IXR A;  1IBL L;  3EIV A;  3PGZ A;  2NVQ H;  2EQS A;  1BBU A;  3CPW A;  1XPO A;  4KLK A;  3RLF A;  4X62 Q;  5M3F H;  1KHI A;  1V1Q A;  4QY7 A;  2JE6 I;  1PHJ A;  1AH9 A;  2KEN A;  2UU9 L;  5FJ8 G;  1NMG A;  4EQ5 A;  1E1T A;  3FKI H;  4JI2 Q;  4LF7 L;  4A3G G;  4R4O A;  4L5Q A;  3E9H A;  1VQB A;  5ELN A;  1X3G A; 
#chains in the Genus database with same CATH topology
 3KK7 A;  3NEN A;  4IOC A;  1QZG A;  2CW0 C;  4DV7 Q;  1KD1 C;  5EBC A;  2HDL A;  4YHH L;  1ICF B;  3KLR A;  4LF9 Q;  2K1B A;  3SK5 A;  4F87 A;  5EPJ A;  1UE5 A;  3WOF A;  4DV4 Q;  2F52 A;  3S14 B;  2ZXR A;  3EBE A;  2R7Z G;  1ROD A;  1WD0 A;  4OO1 H;  1STG A;  1HNW L;  2D0O A;  1LM0 A;  2E2I H;  1Q7Y C;  2GVB A;  3HOV G;  5C3E B;  3KBX A;  4N9P A;  3K0X A;  5AJ3 L;  3S1N H;  2QDB A;  4KD3 A;  2N88 A;  5IT9 L;  1PFN A;  1IBK Q;  2E2H H;  1O7Z A;  1J9O A;  2L0C A;  1YIJ A;  1K0R A;  1UAP A;  4OXP A;  2F0L A;  3NQT A;  4NXM L;  1B9M A;  3OOC A;  1JOQ A;  5DM7 3;  1ZYR D;  3CXC A;  1WCM B;  1VMC A;  1EQQ A;  1WJJ A;  1Y1V B;  4EQO A;  2MHV A;  4NPS A;  3SVM A;  1HR0 W;  1IW7 D;  1I4P A;  5JVH 3;  4CJ0 B;  1KAB A;  4C2M H;  4DV2 Q;  4TKO B;  3HOU H;  2ZXP A;  1L0X B;  2L12 A;  5L37 A;  2E2J H;  1KQS A;  3RN2 A;  1D8L A;  2ENB A;  3S1M H;  4LAA A;  1E24 A;  4LK1 C;  3NTK A;  5HGQ A;  2F03 A;  3TQY A;  1VQH A;  3HOZ H;  2JA9 A;  4OL7 A;  4R8N A;  4ZUI A;  1OXX K;  5C4X B;  4DGZ A;  5DNF A;  4K5W A;  4NP5 A;  1ZXT A;  3HFZ B;  3OMG A;  1BXT A;  2O2L D;  1IBM L;  3S17 B;  5C4Z A;  3Q8D A;  4DR3 Q;  3HOX G;  3I4M G;  2JA6 G;  4A3I H;  1G51 A;  4X3K A;  5IIF A;  4GOP C;  4DUZ L;  3JAM E;  1VQM A;  2DJF C;  4HIM A;  4BY7 G;  3HEJ A;  3H3V I;  1CTM A;  5LMU Q;  2K7V A;  4KJO A;  2J7Z A;  1HZB A;  1S5F D;  4RAU C;  5EJW A;  4KKS A;  1STE A;  5K36 G;  4DNT B;  3M7G A;  3EJI A;  4PMW A;  2VQE Q;  4DR7 Q;  1BVS A;  2NVY B;  3D31 A;  1U0L A;  3HKZ E;  1V1O A;  4DU9 A;  1A15 A;  3AU7 A;  4A3D G;  3MXN B;  2AWO A;  3V05 A;  4DR1 Q;  4OX9 Q;  1I4H A;  5FKA C;  3C1F A;  3RZO H;  1LTI D;  3RR5 A;  3QOJ A;  1Z7T A;  1LTL A;  4I65 A;  3C46 A;  1EY0 A;  5KEE A;  4FO2 A;  2EYP A;  3I70 A;  3MEH A;  3TEH B;  1B2T A;  3S2H B;  1I94 Q;  3UDF A;  5IGB A;  1FL0 A;  1VQ8 A;  1VF5 C;  3UDX A;  4JI7 L;  2EJG C;  4CDE C;  4IZ8 A;  4DR5 Q;  1PTO H;  4MZ9 A;  3K7A H;  2OQK A;  4NMZ A;  4C3H H;  5A35 A;  4Y52 H;  1QNK A;  4NDX A;  1JQY D;  1EZ6 A;  4CGY B;  5KND A;  4BY7 H;  1QIL A;  4DF7 A;  4YCW A;  4O0A A;  4OWW B;  2GVA A;  4JK1 C;  1X54 A;  3S15 H;  2N3S A;  3H3V C;  1ESR A;  4PMB A;  2RDG A;  2B2T A;  2FXQ A;  3AFP A;  4MTK A;  3GO5 A;  2KUM A;  5IP9 G;  4B3S L;  1TWF H;  3K81 C;  4JI6 Q;  5FO7 B;  1OXT A;  5FK9 C;  3LGJ A;  2RKS A;  4MIU A;  1NR2 A;  2B2W A;  2Y0S G;  5IYB H;  4OIK A;  1ZEQ X;  1PZK D;  4JI3 L;  3J7A V;  3W2D A;  3AFQ A;  1SYE A;  1NSN S;  1NE3 A;  2WIN B;  1AE3 A;  3MXN A;  1KDC A;  1PTO D;  1LAB A;  1JOO A;  1H9K A;  2H1E A;  4FF2 A;  1NNX A;  4K0K L;  3A5Z B;  4KY5 A;  2K14 A;  4OHJ A;  1SRU A;  4O2D A;  3KLS X;  4B3M L;  4GLV B;  1SE2 A;  4PQX A;  2KCN A;  4G57 A;  3BDO A;  4JYA L;  5ELF A;  1W6K A;  1ZYR C;  1JMC A;  1IYU A;  3M4O B;  2DN8 A;  3VYU A;  4XQN A;  2PI2 A;  5GRO A;  3CCU A;  3TSS A;  1TWG H;  4A3J G;  4QMG A;  1E1O A;  2NN6 H;  1R9T B;  3URY A;  1Q81 C;  4LFB L;  2EYH A;  2RDH A;  4X64 Q;  4IFD G;  3TP6 A;  1PRT B;  1CZW A;  2K5H A;  2NZH A;  3CCS A;  3E5S A;  2FMC A;  4PV1 C;  1KIX A;  1GJX A;  2F0S A;  4Q5V A;  4JI0 L;  3LNN A;  3VYR A;  1SE3 A;  3A55 A;  1WFQ A;  4YCV A;  3EA6 A;  1YBY A;  3VR4 A;  3BVM A;  3L2P A;  3EFX D;  2ZTE A;  2UXB L;  3I4N B;  3DM1 A;  4HCS A;  4UHV A;  1HZC A;  2YV5 A;  1J5E Q;  1SNQ A;  2XTI A;  4BBS H;  1EIF A;  3SDZ A;  1YVC A;  4PNY A;  2EVB A;  3BZC A;  1HFN A;  1C8C A;  2BDO A;  4ILW A;  4NW2 A;  2Q2I A;  5LHY 1;  3I91 A;  4WJ3 M;  2SNS A;  1GM5 A;  5JPN C;  3ZJY C;  4MN3 A;  1M90 C;  1UEA B;  3GTM H;  3GTL H;  1N8R C;  2JSO A;  3OIQ A;  3T1H Q;  3NPP A;  3HKZ B;  2IX1 A;  3E6Z X;  4KV6 A;  1S72 A;  3BG3 A;  1PXU A;  3SEB A;  1A8V A;  4C3J G;  5M3F B;  2SDF A;  2IY5 B;  1V8Q A;  3ONA B;  1JJ2 A;  3CCR A;  5IP7 G;  4FP5 D;  1MD2 D;  1B1Z A;  2QDL A;  4ODG A;  1J6Q A;  1SMY D;  1B70 B;  5FLM H;  5CV5 A;  1EIY B;  3U4V A;  4JOI C;  2UU9 Q;  3A54 A;  1EWH A;  3D4D A;  4BA2 I;  3L3O C;  4K8J A;  2B2T C;  1YJ9 A;  3S2D B;  2IX3 A;  2RCF A;  5GAD C;  1YJW A;  2F0M A;  1A3T A;  4JI8 L;  2HHH L;  3M7N A;  4YIJ A;  3EN2 A;  3RNU A;  1AN8 A;  1EZ8 A;  4BBR G;  3DLL A;  1Q1E A;  2KCM A;  2IX0 A;  5JEA J;  2A68 D;  2EY6 A;  3FHW A;  1YHA A;  2CFM A;  2LKV A;  4QF4 A;  5EGT A;  1X3P A;  1LAC A;  4DV5 L;  4OIJ A;  2E2D C;  4DFA A;  1XPU A;  4IUQ A;  1I5F A;  5C4J H;  2R93 B;  3F2B A;  1Y1W H;  1P16 A;  2N49 A;  1H9M A;  3DWA A;  4KHP L;  4APV A;  1F9R A;  2VW9 A;  5IGE A;  2D9U A;  2B2Y C;  1B3A A;  1CUK A;  1PRT F;  4DA2 A;  4UP8 A;  2VUM G;  5FJ8 H;  3L7Z C;  1PTO C;  4A3G H;  1WTW A;  1Y8N B;  4C1N K;  4FNF A;  2BDN A;  5EKL A;  4HSP A;  3I55 A;  2OXP A;  2CWP A;  4P75 A;  3I73 A;  4C3I B;  3RD4 A;  4CKC A;  2JA8 G;  3PSI A;  4KK7 A;  3OSO A;  2KVM A;  4R4I A;  1DM0 B;  3OYY A;  1D5X C;  1QCB D;  1F9P A;  5GAG C;  2WB1 E;  4LF8 L;  4DUY L;  4MHE A;  1TVX A;  2QA4 A;  2K5Q A;  1F2Z A;  1YEZ A;  4BXX G;  2HCI A;  3H6M A;  1E22 A;  3QG1 A;  5HUR A;  4DV0 L;  5I6Y A;  3K0Y A;  2EY2 A;  4YWL A;  5JEA H;  3JAM c;  4X65 Q;  5J39 A;  3ERO A;  3STB C;  1HXY D;  3RZD H;  3S1Q H;  5M5Y B;  1KXL A;  1RTO A;  4KJN A;  3I90 A;  5M5X B;  1K8G A;  4JVZ A;  2JA5 B;  1I4R A;  4A93 G;  4LUZ A;  3VR5 A;  3ITP A;  1XYI A;  1AFP A;  1EUJ A;  4YY3 Q;  4HJA A;  3M4Y A;  4XQQ A;  1N9W A;  2DY7 A;  1KAA A;  1CQF A;  2VQF L;  5GQO A;  3R93 A;  4ZUJ A;  5IYD G;  1K0S A;  1KLG D;  2IHE A;  2K33 A;  4QCL A;  1LT3 D;  1DOM A;  4XXE A;  1LTA D;  3QOL A;  3PO3 B;  4FXG C;  4IO9 A;  3TME A;  5E7N A;  4A3M B;  1WTQ A;  4IUP A;  1CKM A;  1CZG A;  1JWU D;  1VCI A;  2DY8 A;  4GKK L;  2JA7 H;  2CW0 D;  3KJP A;  1LYL A;  2IWH A;  3MC0 B;  3NWS A;  3T1Y L;  1XXG A;  1IBL L;  4B9X A;  2NVQ H;  5EBD A;  2EQS A;  2IJ0 A;  1TWH B;  3Q24 A;  1NMG A;  4H13 C;  4JI2 Q;  4FXK C;  1JC7 A;  1VQB A;  4AYB G;  1A3U A;  5NUC A;  4IAL A;  3U9S A;  4DAY B;  4HJ9 A;  4HR7 B;  4DNI A;  1NY4 A;  3HOY G;  2FIN B;  2J4X A;  3J80 i;  1IKM A;  3TP8 A;  3B6Y A;  3PO2 G;  1YJN A;  2RVL A;  2L11 A;  1QG7 A;  2E5L L;  2RHQ B;  4K5V A;  3H0G G;  1I6H H;  1Q8I A;  1YI2 A;  1O7L A;  2X6G A;  1XMQ Q;  4UY8 C;  1HNX L;  1F2Y A;  1I4Q A;  1DZ1 A;  3TZU A;  3VYS A;  4S3S A;  1GUG A;  3FPP A;  4P72 A;  1STY A;  1G2T A;  2VNU D;  1GHK A;  2A68 C;  3G6E A;  2KEE A;  1G91 A;  3K7U C;  1GKH A;  2F0N A;  4BY1 B;  1X32 A;  3I2Z A;  1MJC A;  1Y8P B;  4KHV A;  3J7A 5;  1HZA A;  1YNN C;  4RFB A;  5IWA Q;  4GN5 A;  4TSS A;  2K04 A;  1SN8 A;  3A0J A;  5CYU A;  5IOD A;  1JOK A;  5M5W H;  2RF4 A;  5JJI A;  3BS1 A;  2P5Z X;  4NB3 A;  3DEP A;  1W6J A;  4QIW E;  2LY7 A;  4EVO A;  2K01 A;  1X9N A;  3W1G A;  2YTV A;  3JAM L;  2ZM6 L;  4DR2 L;  1ESF A;  4RWS C;  3SGI A;  4DAY A;  3NUC A;  1ET9 A;  4X66 L;  1I3Q B;  3KFU A;  1XX8 A;  1HPC A;  3J81 i;  1FJG Q;  2D0P A;  2CKZ B;  2F0O A;  4X3U A;  5COY A;  3WDN A;  3FKI G;  5CV7 A;  5CV8 A;  1VMP A;  1JB3 A;  5BR8 L;  4RH6 A;  4A3F B;  1PH7 A;  5IGD A;  1EYA A;  2L9H A;  1VDZ A;  2F0G A;  2JYO A;  2KQ3 A;  1C48 A;  4ZK9 B;  4B3R Q;  3H3V H;  4BA1 I;  1WTP A;  4P71 A;  2L5T A;  4LFC L;  2QF7 A;  3GTG B;  3CPF A;  3KJO A;  1BF4 A;  1D7Q A;  3GTP H;  3VDY A;  1LT5 D;  4Y7N H;  3R8B A;  3MZ5 A;  4PMC A;  2K75 A;  4OO1 G;  2WKC A;  2K52 A;  3GTJ H;  1RIP A;  1N33 Q;  2ICE C;  2Z1C A;  2NVT H;  1E7Z A;  2Q8T A;  3MTS A;  3CQZ H;  5C0X J;  4A3B B;  1EYG A;  3CME A;  4AQY L;  1YNJ C;  1S40 A;  5JPM C;  1M8A A;  4ME3 A;  2R3Z A;  4K2K A;  2SEB D;  2PI2 E;  3BDC A;  4AIM A;  2SOB A;  1EEI D;  2AKW B;  2LS0 1;  2ATW A;  4ULL A;  3Q0A A;  2OQ0 A;  3G7L A;  1HCZ A;  2XRQ D;  2F0H A;  4LJZ C;  4KMU C;  3J81 j;  3OWE B;  4XQJ A;  1OTC A;  2E75 C;  1TWA H;  3FVQ A;  1BBX C;  4DAV A;  3NBI A;  1LTT D;  4GN4 B;  4A3K H;  3GTQ H;  3CC7 A;  4HJ7 A;  1VS0 A;  4B3T Q;  2EIF A;  5ELE A;  1I6V C;  5FO8 B;  2MO1 A;  3HOU G;  4DV4 L;  2NB0 A;  1VQ7 A;  2BCO A;  4IPD A;  2PW5 A;  4E6I A;  1SFO B;  3KF8 B;  2BE5 D;  1TY2 A;  4A76 A;  3FDT A;  1SE4 A;  2XWB B;  2ZT9 C;  3HOZ G;  1K83 B;  3N52 A;  1IL8 A;  2L1B A;  3A8J E;  5CV6 A;  1MJE A;  4KN7 C;  1II3 A;  3S14 H;  3W3A A;  1G8Z D;  4RGM A;  1XNQ L;  4DR4 Q;  1RDP D;  1LLR D;  1SNP A;  5C6A A;  5M9O A;  2N8N A;  2SNM A;  5M3M B;  3D6C A;  1ASZ A;  4YHH Q;  4A3I G;  1DGS A;  2I07 B;  2KEC A;  1C4Q A;  1M1K C;  1P8L A;  4L63 B;  5C0X H;  4KD4 A;  4DV3 L;  2VL6 A;  2PW7 A;  2M00 A;  3DM3 A;  3PUY A;  4IPG A;  3W1B A;  4XTC S;  2J0T D;  1Q1B A;  1VF7 A;  1HNW Q;  1JIC A;  1EEF D;  1A6X A;  1WCM H;  4HED A;  5AJ3 Q;  2WAC A;  1TKW B;  1Y1V H;  1EQV A;  4P73 A;  2HUG A;  1G6P A;  4LF6 L;  4MNO A;  1PH6 A;  1B8A A;  4LFA L;  2EYL A;  2YU9 B;  1EWI A;  1SJH D;  4NXM Q;  2CH4 A;  5C5M A;  5C4H A;  1XMO Q;  2F0U A;  2B39 A;  4HIO A;  1Z47 A;  1PMR A;  2PMZ B;  1RCV D;  3ZYY X;  1SBB B;  3I72 A;  4DR3 L;  4DK6 C;  5C4X H;  3KF8 A;  1S5C D;  3J7Y W;  1IZ6 A;  1A3V A;  2R7Z B;  1DOL A;  5K5P A;  2K03 A;  1HUM A;  2A19 A;  2DUD A;  3BVZ A;  3GP7 A;  2EE1 A;  3S17 H;  4QIW B;  2F0J A;  4KY7 A;  1C9O A;  2JK8 A;  4C3H G;  3HOV B;  2BA1 A;  5LMU L;  1N34 L;  1GD7 A;  1VQE A;  1NJI C;  2Z6K C;  1IYV A;  2VQE L;  1QZH A;  4DR7 L;  1KTK A;  1FGU A;  1YIT A;  2KHI A;  4JV5 L;  3U58 A;  2A74 C;  3PIO 3;  1CM9 A;  1FYC A;  2R61 A;  4R4Q A;  5I2X A;  1R4Q B;  1IBM Q;  1JJG A;  1SEB D;  1PZJ D;  2NVY H;  1LTR D;  4A4I A;  1BO0 A;  2WAQ G;  5IYB G;  4JPB W;  4X62 L;  4DUZ Q;  1VQ5 A;  1TS5 A;  3H91 A;  4YWM A;  1V1P B;  3CCJ A;  4C56 C;  3G4S A;  4JI1 Q;  2KHJ A;  3RMH A;  3AMU A;  5H1S E;  2PQA B;  1Z6H A;  3TDQ A;  2VS1 A;  1NMF A;  2F0W A;  3W5O A;  1F2M A;  2K50 A;  3S2H H;  3PIP 3;  3A7L A;  1Y69 U;  3H15 A;  1I4G A;  3CD6 A;  1EY4 A;  1CI3 M;  1RL2 A;  5G3L F;  5CV4 A;  1ONL A;  3PF4 A;  4U67 3;  2CQA A;  3EVQ A;  3L9A X;  2N78 A;  4DV1 L;  1STA A;  5EAY A;  1XJV A;  3GQB A;  1VQ4 A;  5LMN L;  5BN5 A;  3SE0 A;  3HOX B;  3I4M B;  3HOW B;  2JA6 B;  1SMX A;  2QEJ C;  4QJF A;  2R92 G;  2L15 A;  2V1C C;  5IGC A;  1O7I A;  2AQ3 B;  2NN6 G;  4DK3 C;  4BY7 B;  2KJX A;  4JI7 Q;  4ME5 A;  3Q23 A;  1CKN B;  1U4R A;  4HAE A;  2UUB Q;  2BE5 C;  1SE8 A;  2C5C A;  3CRL C;  1W3S A;  1HRJ A;  2B63 B;  1ENC A;  4FVM A;  3K80 C;  5C0X I;  1S4Z A;  4J15 A;  4CKB A;  4A3D B;  2CHB D;  1SYD A;  3OHX C;  3K57 A;  2DGY A;  4I7Z C;  1W2B A;  1NBW A;  1PDQ A;  1FGB D;  1V1P A;  3T56 B;  4F8M A;  1VQF A;  4BBS G;  1GVP A;  2KCC A;  2PQA A;  2CWA A;  2FMM A;  3A5U A;  3J81 E;  4JI3 Q;  5CR3 A;  4CBV A;  2EOT A;  2CCZ A;  1VQ6 A;  2R92 H;  3M4O H;  5C3W A;  1PLF A;  1D5Z C;  4K0K Q;  3TRE A;  1G6Z A;  3HZX A;  1U4P A;  1T9H A;  4R1J A;  4B3M Q;  5JJK A;  1PH5 A;  4LNQ A;  1CQV A;  4LW1 A;  2F0K A;  1BKB A;  2RCN A;  1R9T H;  3STB D;  2RHS B;  4A3L H;  1J8I A;  3OW2 A;  4JYA Q;  2K32 A;  2TMP A;  2A5H A;  5FLM G;  3O13 A;  3G71 A;  1BQQ T;  2O5I C;  3HKS A;  2MUY A;  3CCV A;  1B7Y B;  1CKN A;  1PYS B;  2NVX B;  4A3E G;  2Y0S B;  2ZTD A;  1N36 L;  4LFB Q;  2WII B;  1Q46 A;  1HH2 P;  1C0A A;  2EJM A;  1IHZ A;  3I4N H;  1BCP B;  3A8I E;  1T5X D;  1JJC B;  5JOB A;  1VQI A;  5D14 A;  4LF4 Q;  1PA6 A;  3R2T A;  4ZLT F;  4JI0 Q;  3CCM A;  3ULJ A;  4QB4 A;  4JBM A;  5C44 G;  4ALP A;  4JC0 A;  3OPO A;  4QUF A;  5JJZ A;  4HCE A;  2EPB A;  3NK9 A;  2UXB Q;  4IUU A;  3CKI B;  4DN4 M;  2F0P A;  1DYQ A;  4QQB X;  4RA8 A;  3OWF A;  1PRT D;  3NSW A;  3D4R A;  2EZV A;  2ZJP A;  1Y1W G;  2ICI A;  3TS0 A;  4G7Z C;  1E2Z A;  3PGZ A;  1BBU A;  3CPW A;  5KRU A;  5M3F H;  1CT1 D;  2G5D A;  4XYO A;  1F2L A;  3K6O A;  4QY7 A;  2EYO A;  2JE6 I;  4A3J B;  1AH9 A;  2EY5 A;  2UU9 L;  2AQ1 B;  5FJ8 G;  4Z9C B;  1E1T A;  4A3G G;  4RCN A;  4LF7 L;  2F1M A;  5ELN A;  2Z9H A;  1UE1 A;  5BN4 A;  3KDF B;  4A3E H;  4JBW A;  2OT2 A;  4XDX A;  3RLN A;  4EQN A;  1E0B A;  3GV6 A;  2F4V L;  4ZKB B;  2EXD A;  4V0B A;  1CKO A;  2YTX A;  5D65 A;  3Q22 A;  3D8G A;  2DNC A;  4CKE A;  3I56 A;  3KF6 B;  2Q8R E;  2MNA A;  2B2W C;  3DWQ A;  5CV9 A;  1CK1 A;  1QVC A;  1EIH A;  1Y8O B;  5C44 H;  1KDB A;  3I4O A;  1XNR L;  4GKJ L;  2H5X A;  1UEB A;  1PFM A;  1SXT A;  3CHB D;  3LWU A;  4WJW A;  3GTO B;  3ERQ A;  2MP1 A;  1YNN D;  2HT1 A;  2KCT A;  1VQP A;  5JEA G;  1WTO A;  5IGF A;  4PZ8 A;  3OTO L;  4RHR A;  1TWC B;  4RMF A;  2QIL A;  2F0F A;  2R93 H;  1TU2 B;  4JI8 Q;  2HHH Q;  4LMQ D;  1EY5 A;  4OON A;  4R8I A;  2Z8L A;  3R2I A;  1MIU A;  1B9N A;  3S16 B;  1AE2 A;  1PYW D;  4C3J B;  1ML0 D;  2B2V A;  2Z4H A;  4UP7 A;  4X6A H;  2VY3 A;  3G6J B;  2L4N A;  5D3D A;  2RQX A;  3UE1 A;  5C3X A;  4DV5 Q;  2ZXO A;  4DK1 A;  2PQE A;  4GNX B;  2JA7 G;  2MGS A;  4A3M G;  5JJL A;  1WYD A;  2F0E A;  1K8O A;  2UUC L;  1WTV A;  2D5D A;  4C3I H;  4KHP Q;  2K28 A;  1O7Y A;  4BS9 A;  3HRZ C;  3MFG A;  3KDF A;  4DV6 L;  3QB3 A;  1BCP F;  2N55 A;  1IL2 A;  1AEX A;  1PV4 A;  2F0T A;  2I5M X;  2VZA A;  1IKL A;  4H44 C;  1KNE A;  4I7A A;  3HS0 C;  2UUA L;  3UE0 A;  3BJU A;  3KF6 A;  1SND A;  4NXN L;  4JW0 A;  3CU7 A;  3MA2 B;  3PQI A;  4BBR B;  4CHT B;  1STH A;  4GLA C;  1V9P A;  1YNJ D;  3M4Q A;  1SAP A;  3TBI B;  3K5L A;  1STN A;  1U5K A;  2OF1 A;  1V43 A;  4IUR A;  5EKK A;  1X56 A;  5M5Y H;  4WOR A;  5CMD A;  3WOE A;  4FF1 A;  3CCE A;  4A3C H;  3DXJ C;  5M5X H;  3OW7 A;  2JA5 H;  4P2C B;  4WRD A;  1HR0 L;  5COR A;  4LF8 Q;  4DUY Q;  1JR0 D;  4XT3 B;  4FF3 A;  1U9R A;  1N32 L;  5KYI A;  2D2C C;  2H4O A;  3IRB A;  3M3Y B;  1EQR A;  1KNA A;  1KL9 A;  1PFS A;  2FHT A;  3DUZ A;  1SNC A;  3PO3 H;  1H9J A;  3CCL A;  4A3M H;  2VUM B;  1F9S A;  1EU3 A;  5F2D A;  1SYF A;  3U9O A;  3JAM i;  3KLS A;  3A56 A;  1M4V A;  1PH9 A;  3N6R A;  2VQF Q;  3T13 A;  4GNX A;  4TRD A;  1RD9 D;  2JA8 B;  2OTJ A;  1I50 B;  1SDF A;  3MXP A;  1FNV A;  4XYQ A;  4JBK A;  1WTR A;  1TWH H;  2LMC B;  4K5X A;  1FR3 A;  5T1G A;  1PRT C;  2G9D A;  2JQO A;  2Z4I A;  4LUO A;  4GKK Q;  2XWJ B;  2UXD L;  2FFK B;  1VQ9 A;  2KHS A;  1EY7 A;  1LV9 A;  2OCE A;  3K5O A;  3T1Y Q;  4IFD I;  2PO4 A;  1DOK A;  3IFD A;  2F3I A;  5E4X A;  3OMC A;  3S24 A;  3F1Z A;  5A2Q E;  3AQQ A;  3ERS X;  4DR6 L;  3NE5 B;  3S1R B;  3TS2 A;  1EY6 A;  2L55 A;  2K5W A;  3FRP B;  4A93 B;  2UXC Q;  1XMQ L;  4QL5 A;  4KKT A;  2NBF A;  1OXV A;  4YCU A;  1KRT A;  3DEO A;  1HNZ L;  1L0Y B;  3GTK B;  2JN4 A;  1DON A;  1VQN A;  4KTA A;  1QNU A;  3AB9 A;  4GOP B;  2GA4 B;  2RSO A;  1GO3 E;  1BBW A;  4JI4 L;  5C5L A;  2PMZ E;  4OWX B;  2E74 C;  2OWO A;  2QGQ A;  2HCC A;  1XPR A;  1RJT A;  4XIG S;  3P20 A;  2E5L Q;  2WB1 G;  4BY1 H;  5EPL A;  1QVG A;  2B3G A;  3DMU A;  5ELB A;  1QUQ B;  2ES2 A;  1TII D;  4OGQ C;  4CDF C;  3ULP A;  3J81 c;  1HNX Q;  3NTH A;  5LL6 X;  2FJ2 A;  5E1F A;  3CRK C;  4AYB B;  1D6E C;  4JG2 A;  5IYC H;  1BOS A;  1HFG A;  4J8Q A;  1VQC A;  1WI5 A;  5IT9 c;  1XTC D;  1Q8K A;  1ILQ A;  1I3Q H;  3A7A B;  2PZW A;  4A3K G;  2VB2 X;  1AW7 A;  3HOY B;  4B3R L;  4JI5 L;  2A6H C;  3VYT A;  5IOC A;  4A3F H;  3PO2 B;  1HA5 A;  2F3W A;  3NWT A;  1KLU D;  3IFT A;  1UUP A;  3CC4 A;  2BH2 A;  2ZM6 Q;  4DR2 Q;  1TS4 A;  3H0G B;  4XT1 B;  2I5L X;  4DPG A;  2F4I A;  3V96 A;  1E3P A;  3I7F A;  1VQG A;  1MHW C;  3GTG H;  3MHB A;  4F88 A;  3JC6 6;  3T51 B;  4IUT A;  3UDG A;  1BR9 A;  5BR8 Q;  1B4O A;  4GOP A;  4NKL A;  5C3E G;  1EY8 A;  4IUN A;  1HHV A;  4LF5 Q;  2TSS A;  4A3B H;  3L0O A;  2B8G A;  3KOJ A;  2NUC A;  4N9T A;  4OWT B;  4LFC Q;  2NZ1 D;  1GHJ A;  5C0X G;  4LWC A;  2AMC B;  5JVG 3;  1GUN A;  1WD1 A;  1K73 C;  2KA7 A;  1GUO A;  5FLX E;  2O5J C;  1QUQ A;  5ISR A;  5ELD A;  2EYM A;  1EYD A;  3F2C A;  2G9H D;  1Q3L A;  4L5R C;  1Q82 C;  4DV7 L;  4GNX C;  1ENF A;  1WCM G;  1KRS A;  1QJO A;  3K5M A;  3RLO A;  2X6L A;  1Y1V G;  2F3V A;  4ZQ3 A;  1XTD A;  4AQY Q;  3BYY B;  1L1O B;  1I4X A;  1KAW A;  2K5D A;  4LF9 L;  1NR4 A;  1EY9 A;  3AEV A;  2MPM A;  3FKI B;  4J1M A;  3PMF A;  1CA5 A;  3C1E A;  1VQO A;  5IGG A;  1UE7 A;  2NWG A;  3P1H A;  1D1K A;  1Y14 B;  4DR4 L;  1SFO H;  1B3Q A;  1OXU A;  2A6E D;  1WOC A;  1PVO A;  3NBH B;  2MQH A;  1K83 H;  3NHH A;  5I4D A;  2WAQ E;  1MGS A;  5C4X G;  3ULL A;  2K6A A;  5KNC A;  4IN3 A;  5C3E H;  1IBK L;  3OIP A;  4RKB A;  2JJQ A;  2IPK D;  4EQP A;  2PZT A;  3WWV A;  3PF5 A;  2E2I B;  3MWY W;  1TT2 A;  2WP8 J;  5M3M H;  2F0D A;  3K59 A;  4G7O C;  2HDM A;  2B8F A;  3J81 L;  1FD7 D;  3EQL C;  3S1N B;  4K2L A;  2R6G A;  4RGN A;  3K5N A;  4M1U B;  1E2W A;  3U50 C;  1UWV A;  1PH3 A;  2QEX A;  4ZAI A;  3S9W A;  2IT1 A;  2E2H B;  1ENA A;  1XNQ Q;  4DV2 L;  5EKI A;  3FP9 A;  2K5V A;  2F0I A;  3ND9 A;  1DXM A;  3PUX A;  1XMO L;  3A74 A;  2C35 B;  3QWN A;  3T53 B;  4DV3 Q;  1L1O A;  1HTP A;  4C2M B;  3J7A F;  2YU9 H;  3HOU B;  4J6H A;  2A8V A;  2E2J B;  2Y0S E;  5CBE E;  1QE6 A;  1JOR A;  3S1M B;  5G3L D;  2C9O A;  1L0W A;  2K5N A;  2YYZ A;  1TQO A;  2R7F A;  2XNA C;  2HD3 A;  2MFI A;  3D6W A;  3HOZ B;  1NAP A;  1DD2 A;  4LF6 Q;  3NBH A;  2AWN A;  4X3T A;  2R7Z H;  4LFA Q;  1GUW A;  5DM6 3;  4KHZ A;  5CBA E;  3CP0 A;  3SHL A;  1VQA A;  3HOV H;  3NXW A;  1TR5 A;  2KBN A;  2ASB A;  4RGO S;  1MSH A;  1U4M A;  3RUZ A;  4A3I B;  4FYD A;  4POF A;  2B29 A;  1AZP A;  1QB5 D;  3F2U A;  3SXH A;  3HOW G;  4LUV A;  4FF4 A;  4CDC C;  2AUJ D;  4DR1 L;  1LUZ A;  4OX9 L;  3GDE A;  5CGK A;  2IL8 A;  3FEW X;  1D2B A;  4JI1 L;  5KYL A;  1N34 Q;  2IW3 A;  2A73 B;  2A69 D;  4M8A A;  3VA5 A;  1I94 L;  5DLQ E;  4HMI A;  3TN2 A;  2B63 G;  1SSO A;  4JV5 Q;  2MO0 A;  4IOA A;  3SK6 A;  4DR5 L;  3RZO B;  3A8K E;  3CCQ A;  2E76 C;  2KOL A;  4K14 A;  1IXR A;  3EIV A;  3J80 E;  4RCO A;  1WTX A;  1XPO A;  4X62 Q;  1V1Q A;  1PHJ A;  2PPB C;  4KKU A;  5DAU A;  3I3C A;  4EQ5 A;  1SYG A;  1GUS A;  4L5Q A;  1K3B C;  5FO9 B;  2JXM B;  1RHP A;  1PTO B;  2AHO B;  1X3G A;  3K7A B;  3ICE A;  4JI6 L;  3IKJ A;  1SNM A;  2WKD A;  1X3F A;  1MBY A;  1BNZ A;  4C3H B;  3HOX H;  3I4M H;  4U68 A;  1PYB A;  3HOW H;  2JA6 H;  1ICW A;  5EPK A;  2JP1 A;  2RA4 A;  4L8J A;  1K3R A;  2UUB L;  4DAP A;  1O78 A;  3K58 A;  3S15 B;  4JOI A;  4G7H C;  4A3L G;  3ER0 A;  1S5E D;  3C2P A;  2NTT A;  3CW2 C;  1AP0 A;  4KY6 A;  5KNB A;  1DCZ A;  1STB A;  1R4P B;  4DAM A;  3FMC A;  4DV1 Q;  2A6E C;  2CQO A;  5J3B A;  1TWF B;  3T4A C;  5K36 H;  5LMN Q;  4OO1 I;  1Q12 A;  2B63 H;  4N8X 1;  2PNH A;  2Q2T A;  4GZY C;  4V19 0;  4DKA C;  2WAQ B;  1PZI D;  3QR8 A;  2PYK A;  4OEM B;  4OEL B;  4RHS A;  4B3S Q;  4A3D H;  1PH4 A;  2ID0 A;  3M9B A;  1CSQ A;  3I4N G;  2HQE A;  4FXD A;  1IYJ B;  3VR3 A;  4WJ4 A;  5GAH C;  1EIG A;  5I9O A;  3KLW A;  4O1N A;  1BUV T;  2ALY B;  1L1O C;  2KED A;  1SR3 A;  5IT9 E;  4IPH A;  4X64 L;  2B2Y A;  2VB3 X;  3NEL A;  2BOS A;  3MXG A;  5D3I B;  3PCO B;  1KDA A;  4ZCK A;  1ZKO A;  1FNW A;  1NUC A;  3SR1 A;  3HKZ G;  1QOH A;  2R92 B;  1TWG B;  1NTG A;  2XIW A;  5M3F G;  1JWM D;  4HSV A;  3NTI A;  3X3N A;  4IFD J;  1IW7 C;  4WFN 3;  1UE6 A;  1EQT A;  2Z6B A;  5IP9 H;  1J5E L;  3I8Z A;  1CHP D;  1JT8 A;  2RBM A;  3BU2 A;  4K6D A;  5FOB B;  4L5T A;  2NVX H;  2X69 A;  3LX0 A;  1OO9 B;  1S3O A;  1GUT A;  1X6O A;  5E3F A;  3U4Z A;  4LF4 L;  2EDG A;  1YZ6 A;  2NZO A;  3G48 A;  2GN5 A;  1Z9F A;  3RN5 A;  4BBS B;  1PH1 A;  5JAV A;  1X3E A;  2NYZ D;  1MKH A;  1UNS A;  3T1H L;  1LTS D;  5BN3 A;  3E0J A;  3PUW A;  2IHF A;  2ZTC A;  2RSN A;  1PTO F;  3HG9 A;  2PNR C;  1N36 Q;  5I9P A;  1HA6 A;  4HJ5 A;  5FLX c;  2HQL A;  3Q6S A;  3NQI A;  1JB7 A;  4H7B A;  4K6L A;  2R93 G;  1K9M C;  5J1Z A;  1RKN A;  2A69 C;  4Q0F A;  2F0Q A;  3MEF A;  1D5M C;  1B50 A;  5A2Q L;  3VR2 A;  2M9V A;  3GTM B;  3GTL B;  1X55 A;  4HID A;  1EFI D;  3ND8 A;  4A3J H;  4EX5 A;  2HIX A;  2CVR A;  1JE4 A;  3M85 A;  4MTN A;  4GN3 B;  1H95 A;  4IFD H;  2XVS A;  1A0I A;  1BCP D;  1YHB A;  1B44 D;  3NEM A;  3CF5 A;  4C3I G;  4ID6 A;  3TP5 A;  3S2D H;  5HY6 A;  2B2U A;  4L6T B;  4A3E B;  3UDI A;  2I46 A;  3X3M A;  1YHQ A;  1CFM A;  4LF7 Q;  1SLJ A;  2I5H A;  3AYH B;  4B9W A;  2OTL A;  5I2Y A;  3UI2 A;  5GAE C;  2D62 A;  2A1A A;  5IY0 A;  1K8A C;  3D0F A;  4JCV E;  3KUP A;  3TP7 A;  3GTO H;  3PUV A;  2F4V Q;  3KBG A;  1TS3 A;  2YTY A;  5C44 B;  2EY1 A;  4AYB E;  1T5E A;  3T16 A;  2WV6 D;  4UDU C;  1QVF A;  4A3C G;  1TWC H;  4EGV A;  2JA5 G;  2JEA I;  3M4P A;  1RTN A;  1CHQ D;  3IAY A;  1FVI A;  5ELO A;  5C4J B;  2VXW A;  1Y1W B;  1XNR Q;  4GKJ Q;  1C7Y A;  5I6W A;  3DHQ A;  1JCK B;  3S16 H;  2K4K A;  1TS2 A;  4C3J H;  5LL6 S;  3PO3 G;  5KIX A;  1HQR D;  4RGT A;  3MVV A;  2A6H D;  5IP7 H;  3OTO Q;  4A3G B;  1X3Q A;  3PV0 A;  1EL0 A;  5ELC A;  1E2V A;  4PZ6 A;  2K05 A;  2HIV A;  4GS3 A;  3VA7 A;  2RDF A;  1TXY A;  4C1N I;  3K8A A;  4FDB A;  1SYC A;  1DJR D;  4N8F A;  2QW7 A;  4YWK A;  4L5S A;  1ILP A;  1LTB D;  5KGU A;  4X65 L;  2EYF A;  1KC8 C;  1O80 A;  3HP3 A;  2NTS A;  2NN6 I;  4YY3 L;  1EWC A;  3TZD A;  2UUC Q;  3HGB A;  4BBR H;  1MSG A;  2LSS A;  2I0Q A;  1FNU A;  4DV6 Q;  1D1I A;  2EJF C;  5FLX L;  4HJ8 A;  3BYT B;  4TVA B;  2XRS D;  4R9W A;  2DNE A;  4A75 A;  2XSC A;  4P74 A;  4IJH A;  4CDD C;  3RZD B;  3S1Q B;  1TY0 A;  5LMN W;  2Q2U A;  4O42 A;  2UUA Q;  4CJ2 C;  4HMJ A;  4IUV A;  1B53 A;  3MFY A;  4DV0 Q;  4NXN Q;  3M3Y H;  1Q90 A;  4UP9 A;  1H9S B;  1S5B D;  3E3X A;  4CJ1 B;  1A62 A;  1PH2 A;  2VUM H;  4BWG B;  1G2S A;  4JI2 L;  1LT6 D;  2XN9 C;  1VQL A;  3NP8 A;  1HR0 Q;  5DEH A;  3P7J A;  2JEB I;  2JA7 B;  1F77 A;  3GD7 A;  3C3L A;  1N32 Q;  3VR6 A;  2O4X A;  2BA0 A;  4BY1 G;  4JBJ A;  2JA8 H;  3J80 c;  4HTH A;  1G29 1;  1I50 H;  4PG3 A;  4R4C A;  2NVQ B;  3CAM A;  2Q8I B;  3I4L A;  1EU4 A;  1ASY A;  4G4K A;  1EOV A;  4IQZ A;  2WFW A;  4H02 A;  1K28 A;  3PIO A;  1U4L A;  2EXZ A;  4UAI A;  1GXD C;  3V2T A;  2BH8 A;  1IBL Q;  3TRZ A;  4ZRZ A;  4QGU A;  3LWE A;  3SK4 A;  3SK8 A;  5IYC G;  1OXS C;  1A63 A;  1NCV A;  1L2F A;  4BXX H;  2B2U C;  1Q86 C;  1WTH A;  2UXC L;  4QUC A;  1PFB A;  1GOZ A;  2LXK A;  4RG1 A;  3S1R H;  4KI0 A;  1BCP C;  2M2L A;  3IL8 A;  4IJL A;  4IPC A;  1VQD A;  2UXD Q;  1S5D D;  1SMY C;  4ABN A;  4A3F G;  4A93 H;  1QWY A;  3KYH C;  3GTK H;  5IYD H;  1LT4 D;  3PIP A;  3CC2 A;  1CSP A;  1AZQ A;  2DJG C;  1I6H B;  4KN4 C;  1WVL A;  4UPA A;  4DXG A;  4DR6 Q;  1LTG D;  1PH8 A;  5IWA L;  1H9S A;  1H9R A;  1SRO A;  1JWS D;  5E4W C;  2ZJQ A;  2B2V C;  2AUK A;  3MAQ A;  2CH4 W;  1A2T A;  2V4D A;  1HNZ Q;  1EOT A;  1X65 A;  3E9I A;  4F7X A;  3J7Z C;  3H09 A;  4A3B G;  2MJ8 A;  2Q2H A;  1HJP A;  3F2D A;  3QO2 A;  1ET6 A;  2OEO A;  1FJG L;  4AH6 A;  1HTL D;  3PUZ A;  4JI4 Q;  4X3S A;  2LXJ A;  5HGT A;  5M5W B;  2AQ2 B;  3FPU B;  4HN7 A;  4ZKC B;  1LO5 D;  1HZ9 A;  3R3O A;  3BDL A;  2E8G A;  2R7D A;  4DNR B;  3F8T A;  3HOY H;  4TQU S;  4RKL A;  2F0V A;  3DWP A;  3CMA A;  3QIA A;  1SNO A;  3PO2 H;  3E0E A;  4GLX A;  1N33 L;  4X66 Q;  2PCF B;  2QKI C;  1SYB A;  1MI2 A;  3H0G H;  4R4T A;  3H94 A;  5AFW A;  2Z0S A;  5IE8 A;  4LF5 L;  1XWE A;  5CC4 A;  3D4W A;  4JI5 Q;  3GTP B;  2EYJ A;  1CA6 A;  4K8I A;  4Y7N B;  2PZU A;  4PZ7 A;  3BVG A;  1F9Q A;  2Z6K A;  3GTJ B;  1BDO A;  3J80 L;  1EYC A;  2NVT B;  1SJE D;  5M3M G;  3BZD B;  3GV3 A;  3CQZ B;  2WB1 B;  2XGT A;  4ZYS A;  1VQJ A;  2ZJR A;  5T1I A;  1HQM C;  3QJY A;  1YNX A;  1EFW A;  1VQK A;  1JE5 A;  4B3T L;  4POG A;  5EQ0 A;  4DK0 A;  1RF2 D;  4HIK A;  3BZK A;  4B08 A;  3D3R A;  1K8M A;  4KLK A;  3RLF A;  2LFN A;  4H0L C;  1KHI A;  2QCP X;  1TWA B;  5TSS A;  2KEN A;  3P75 A;  4A3K B;  3GTQ B;  1A2U A;  3FKI H;  5J22 A;  4DXF A;  4R4O A;  3E9H A;  3MXU A;  1HUN A; 
#chains in the Genus database with same CATH homology
 4AYB G;  1UE1 A;  4A3E H;  3KDF B;  3NEN A;  4IOC A;  4JI6 L;  4JBW A;  1QZG A;  4DV7 Q;  3ICE A;  1X3F A;  1KD1 C;  4DAY B;  3HOX H;  3RLN A;  3I4M H;  1PYB A;  4YHH L;  3HOW H;  2JA6 H;  4HJ9 A;  2F4V L;  1K3R A;  2UUB L;  2EXD A;  4DNI A;  4LF9 Q;  1NY4 A;  1CKO A;  2YTX A;  3HOW G;  4JOI A;  3HOY G;  1UE5 A;  4DV4 Q;  4A3L G;  2F52 A;  3ER0 A;  3I56 A;  3CW2 C;  3EBE A;  3KF6 B;  3J80 i;  2R7Z G;  3B6Y A;  2MNA A;  3PO2 G;  4DAM A;  1YJN A;  1HNW L;  2D0O A;  1LM0 A;  4DV1 Q;  2E2I H;  1Q7Y C;  2CQO A;  1QVC A;  2GVB A;  5J3B A;  3HOV G;  5C44 H;  5LMN Q;  3I4O A;  1XNR L;  4GKJ L;  4OO1 I;  3K0X A;  2H5X A;  5AJ3 L;  2RHQ B;  1Q12 A;  1UEB A;  3H0G G;  2E5L L;  2B63 H;  3S1N H;  2PNH A;  2Q2T A;  1I6H H;  2HT1 A;  2KCT A;  4DKA C;  5JEA G;  1VQP A;  1YI2 A;  4A3D H;  1XMQ Q;  4B3S Q;  1IBK Q;  1HNX L;  4UY8 C;  1PH4 A;  2ID0 A;  2E2H H;  3M9B A;  4PZ8 A;  3OTO L;  1CSQ A;  4RMF A;  2AHO B;  3I4N G;  1YIJ A;  1IYJ B;  1K0R A;  4OXP A;  4WJ4 A;  2R93 H;  4P72 A;  4JI8 Q;  4NXM L;  2HHH Q;  5GAH C;  2VNU D;  3G6E A;  4OON A;  3CXC A;  3KLW A;  3K7U C;  1MIU A;  1EQQ A;  1GKH A;  1WJJ A;  1AE2 A;  2ALY B;  1MJC A;  3I2Z A;  4NPS A;  3J7A 5;  1HZA A;  4UP7 A;  4X6A H;  1L1O C;  2VY3 A;  1HR0 W;  5IWA Q;  4GN5 A;  3UE1 A;  1SR3 A;  4DV5 Q;  1SN8 A;  3A0J A;  4C2M H;  4DV2 Q;  3HOU H;  4IPH A;  4X64 L;  5M5W H;  2RF4 A;  4GNX B;  3NEL A;  5JJI A;  2JA7 G;  4A3M G;  1KQS A;  2E2J H;  1WYD A;  4NB3 A;  5JJL A;  4QIW E;  3RN2 A;  2UUC L;  1D8L A;  3S1M H;  1E24 A;  3PCO B;  4C3I H;  4KHP Q;  1X9N A;  3W1G A;  2YTV A;  5HGQ A;  3HKZ G;  3TQY A;  2ZM6 L;  3KDF A;  4DR2 L;  4DV6 L;  3SGI A;  1VQH A;  1NTG A;  5M3F G;  3HOZ H;  2JA9 A;  1IL2 A;  1PV4 A;  4X66 L;  2I5M X;  3KFU A;  3J81 i;  1FJG Q;  1OXX K;  2D0P A;  2VZA A;  2CKZ B;  4IFD J;  3FKI G;  3HFZ B;  1UE6 A;  2UUA L;  5BR8 L;  1PH7 A;  5IP9 H;  1J5E L;  3UE0 A;  3BJU A;  3KF6 A;  1IBM L;  1JT8 A;  3Q8D A;  3BU2 A;  4DR3 Q;  4NXN L;  3HOX G;  3I4M G;  2JA6 G;  4L5T A;  4A3I H;  1G51 A;  4GLA C;  2NVX H;  4B3R Q;  1V9P A;  3H3V H;  4BA1 I;  3M4Q A;  4P71 A;  1S3O A;  4LFC L;  1U5K A;  1V43 A;  1X6O A;  4GOP C;  4DUZ L;  3U4Z A;  1VQM A;  4HIM A;  3CPF A;  1X56 A;  5M5Y H;  3KJO A;  4LF4 L;  4BY7 G;  1D7Q A;  1YZ6 A;  3H3V I;  3CCE A;  3VDY A;  3GTP H;  4A3C H;  5M5X H;  4Y7N H;  2NZO A;  2JA5 H;  5LMU Q;  4OO1 G;  2K75 A;  1HZB A;  3G48 A;  2K52 A;  3GTJ H;  1HR0 L;  4LF8 Q;  4DUY Q;  1RIP A;  2GN5 A;  1N33 Q;  2NVT H;  5K36 G;  1Z9F A;  3RN5 A;  1N32 L;  1PH1 A;  1E7Z A;  4PMW A;  2VQE Q;  4DR7 Q;  1X3E A;  1BVS A;  1MKH A;  3CQZ H;  3T1H L;  5C0X J;  1EYG A;  3D31 A;  3IRB A;  1U0L A;  3HKZ E;  1EQR A;  3PUW A;  2IHF A;  2ZTC A;  1KL9 A;  1PFS A;  4AQY L;  1S40 A;  4ME3 A;  3PO3 H;  1N36 Q;  4A3D G;  3CCL A;  4A3M H;  3MXN B;  2PI2 E;  2AWO A;  4HJ5 A;  4DR1 Q;  5FLX c;  4AIM A;  4OX9 Q;  2HQL A;  2AKW B;  2ATW A;  1JB7 A;  3RZO H;  2OQ0 A;  3RR5 A;  2R93 G;  3JAM i;  1K9M C;  1PH9 A;  1LTL A;  3MEF A;  2VQF Q;  3J81 j;  4GNX A;  1X55 A;  1OTC A;  3TEH B;  2OTJ A;  4HID A;  4LF5 L;  4A3J H;  1I94 Q;  3UDF A;  1TWA H;  1FL0 A;  2HIX A;  4EX5 A;  1VQ8 A;  4JBK A;  1TWH H;  4GN4 B;  4A3K H;  3GTQ H;  3UDX A;  3M85 A;  3CC7 A;  4JI7 L;  4MTN A;  4HJ7 A;  1VS0 A;  4B3T Q;  2EIF A;  2JQO A;  4GN3 B;  4LUO A;  4GKK Q;  2MO1 A;  4DR5 Q;  3HOU G;  2UXD L;  1H95 A;  4MZ9 A;  3K7A H;  2OQK A;  1VQ9 A;  1A0I A;  1YHB A;  4DV4 L;  1VQ7 A;  4C3H H;  3NEM A;  3CF5 A;  4Y52 H;  3T1Y Q;  2OCE A;  4IPD A;  3S2D H;  4IFD I;  4BY7 H;  5HY6 A;  3KF8 B;  2F3I A;  4YCW A;  4O0A A;  4A76 A;  4OWW B;  3S24 A;  2GVA A;  3HOZ G;  1X54 A;  3F1Z A;  3UDI A;  3S15 H;  1MJE A;  2N3S A;  3AQQ A;  3ERS X;  4DR6 L;  1YHQ A;  3S14 H;  3TS2 A;  4LF7 Q;  1SLJ A;  1XNQ L;  2I5H A;  3AYH B;  4DR4 Q;  3S2H H;  2FXQ A;  3AFP A;  3GO5 A;  2OTL A;  5IP9 G;  4QL5 A;  1TWF H;  3K81 C;  1XMQ L;  4B3S L;  4JI6 Q;  1OXT A;  1OXV A;  2D62 A;  2N8N A;  2A1A A;  4YCU A;  1KRT A;  5GAE C;  1ASZ A;  5IY0 A;  4YHH Q;  1K8A C;  1HNZ L;  3D0F A;  4JCV E;  4A3I G;  1DGS A;  3LGJ A;  3GTO H;  1VQN A;  3PUV A;  2Y0S G;  1M1K C;  1P8L A;  2F4V Q;  5IYB H;  2YTY A;  4JI3 L;  4AYB E;  4DV3 L;  2VL6 A;  1QVF A;  4GOP B;  4A3C G;  3AFQ A;  3DM3 A;  1TWC H;  3PUY A;  1GO3 E;  4IPG A;  1BBW A;  3W1B A;  2JA5 G;  1NE3 A;  3M4P A;  4XTC S;  1Q1B A;  4JI4 L;  2JEA I;  1AE3 A;  2PMZ E;  1HNW Q;  4OWX B;  1FVI A;  5ELO A;  2OWO A;  2QGQ A;  1XPR A;  4K0K L;  3A5Z B;  4XIG S;  1XNR Q;  1WCM H;  4GKJ Q;  1C7Y A;  2K14 A;  5AJ3 Q;  2E5L Q;  1SRU A;  2WB1 G;  4O2D A;  4BY1 H;  3S16 H;  1Y1V H;  2B3G A;  2K4K A;  4GLV B;  1QVG A;  4B3M L;  1QUQ B;  2ES2 A;  4P73 A;  4C3J H;  3PO3 G;  3ULP A;  3J81 c;  1G6P A;  1HNX Q;  4LF6 L;  4MNO A;  4JYA L;  1PH6 A;  5IP7 H;  3OTO Q;  3PV0 A;  1B8A A;  4LFA L;  1EWI A;  4PZ6 A;  1JMC A;  4NXM Q;  2HIV A;  4GS3 A;  4JG2 A;  5IYC H;  1XMO Q;  1VQC A;  1WI5 A;  5IT9 c;  1TXY A;  4HIO A;  1Z47 A;  3K8A A;  4FDB A;  1Q8K A;  2PI2 A;  4YWK A;  5GRO A;  3CCU A;  1TWG H;  4L5S A;  4A3J G;  1E1O A;  1I3Q H;  4DR3 L;  4DK6 C;  5C4X H;  4A3K G;  4X65 L;  1Q81 C;  4LFB L;  4B3R L;  1KC8 C;  4JI5 L;  1IZ6 A;  4X64 Q;  4IFD G;  4A3F H;  2NN6 I;  2A19 A;  2DUD A;  4YY3 L;  3S17 H;  2K5H A;  2UUC Q;  1C9O A;  2JK8 A;  2NZH A;  3CCS A;  3CC4 A;  2BA1 A;  4BBR H;  5LMU L;  2BH2 A;  1KIX A;  2LSS A;  2ZM6 Q;  2I0Q A;  1N34 L;  4DR2 Q;  1GD7 A;  1VQE A;  4DV6 Q;  2I5L X;  4DPG A;  2Z6K C;  4HJ8 A;  1NJI C;  4JI0 L;  4TVA B;  1E3P A;  3I7F A;  1VQG A;  2VQE L;  1QZH A;  1WFQ A;  4YCV A;  3GTG H;  4DR7 L;  1FGU A;  4A75 A;  4P74 A;  2KHI A;  1YBY A;  3JC6 6;  4IJH A;  3U58 A;  1YIT A;  3L2P A;  4JV5 L;  5LMN W;  2Q2U A;  2ZTE A;  3UDG A;  2UXB L;  4R4Q A;  2UUA Q;  5BR8 Q;  1HZC A;  2YV5 A;  4DV0 Q;  2XTI A;  4GOP A;  1J5E Q;  5C3E G;  1IBM Q;  4BBS H;  1EIF A;  1JJG A;  4NXN Q;  1YVC A;  4LF5 Q;  2NVY H;  2IX1 A;  3BZC A;  3L0O A;  4A3B H;  3KOJ A;  3M3Y H;  4UP9 A;  4A4I A;  4OWT B;  4LFC Q;  5IYB G;  2WAQ G;  4X62 L;  5C0X G;  4DUZ Q;  4LWC A;  2AMC B;  1A62 A;  1PH2 A;  1VQ5 A;  1K73 C;  4YWM A;  2VUM H;  3CCJ A;  2Q2I A;  1QUQ A;  3G4S A;  4JI1 Q;  2KHJ A;  4JI2 L;  1VQL A;  4WJ3 M;  3F2C A;  5H1S E;  1GM5 A;  1HR0 Q;  2PQA B;  2JEB I;  4L5R C;  1Q82 C;  3GD7 A;  4DV7 L;  1N32 Q;  3ZJY C;  4GNX C;  1M90 C;  1WCM G;  1KRS A;  1NMF A;  2VS1 A;  3W5O A;  1N8R C;  3RLO A;  3T1H Q;  3GTM H;  2BA0 A;  3GTL H;  2K50 A;  4BY1 G;  4JBJ A;  2JA8 H;  1Y1V G;  3J80 c;  1G29 1;  1I50 H;  1XTD A;  4PG3 A;  4R4C A;  4AQY Q;  1L1O B;  3CAM A;  3H15 A;  1KAW A;  1S72 A;  1A8V A;  3CD6 A;  4LF9 L;  2IY5 B;  1ASY A;  1RL2 A;  1EOV A;  3AEV A;  2WFW A;  3CCR A;  1JJ2 A;  3PF4 A;  4H02 A;  3PIO A;  5IP7 G;  1J6Q A;  2BH8 A;  1IBL Q;  3TRZ A;  1B70 B;  5FLM H;  1EIY B;  4QGU A;  1VQO A;  2N78 A;  4DV1 L;  1XJV A;  5EAY A;  4JOI C;  3U4V A;  5IYC G;  1OXS C;  1UE7 A;  1VQ4 A;  5LMN L;  1A63 A;  1L2F A;  4BXX H;  1Y14 B;  4DR4 L;  1SFO H;  2UU9 Q;  1OXU A;  1Q86 C;  1SMX A;  1WOC A;  4QJF A;  2R92 G;  1PVO A;  3NBH B;  2UXC L;  2L15 A;  4BA2 I;  2MQH A;  1K83 H;  2V1C C;  4RG1 A;  2LXK A;  2WAQ E;  1O7I A;  1YJ9 A;  2NN6 G;  4DK3 C;  3ULL A;  3S1R H;  4KI0 A;  5C4X G;  1IBK L;  5C3E H;  4JI7 Q;  4IJL A;  4IPC A;  5GAD C;  1YJW A;  1CKN B;  1VQD A;  2UXD Q;  2JJQ A;  3WWV A;  4A3F G;  4A93 H;  3PF5 A;  4JI8 L;  2HHH L;  3M7N A;  2UUB Q;  2WP8 J;  1SE8 A;  3EN2 A;  5M3M H;  3RNU A;  3KYH C;  4BBR G;  3GTK H;  3DLL A;  5IYD H;  1W3S A;  1Q1E A;  2KCM A;  2IX0 A;  5JEA J;  3PIP A;  2R6G A;  3CC2 A;  1CSP A;  3K80 C;  3FHW A;  1YHA A;  5C0X I;  3U50 C;  1UWV A;  4J15 A;  2CFM A;  4UPA A;  1PH3 A;  4DR6 Q;  2QEX A;  1PH8 A;  2IT1 A;  5IWA L;  4DV5 L;  1SRO A;  1XNQ Q;  4DV2 L;  2DGY A;  1XPU A;  2ZJQ A;  1W2B A;  1I5F A;  1NBW A;  2K5V A;  3FP9 A;  5C4J H;  1VQF A;  3F2B A;  4BBS G;  1Y1W H;  1GVP A;  1P16 A;  2N49 A;  1HNZ Q;  4KHP L;  1X65 A;  3E9I A;  3J7Z C;  4APV A;  2PQA A;  4A3B G;  2CWA A;  2VW9 A;  2Q2H A;  3PUX A;  1HJP A;  3F2D A;  1CUK A;  3A5U A;  1XMO L;  4JI3 Q;  3A74 A;  2C35 B;  4UP8 A;  1FJG L;  4DV3 Q;  2VUM G;  4AH6 A;  5FJ8 H;  3L7Z C;  4A3G H;  1L1O A;  3PUZ A;  4JI4 Q;  2CCZ A;  2LXJ A;  2YU9 H;  1VQ6 A;  2R92 H;  3M4O H;  2A8V A;  2Y0S E;  3I55 A;  4K0K Q;  3TRE A;  2CWP A;  4P75 A;  3CME A;  1L0W A;  1HZ9 A;  2K5N A;  1T9H A;  2YYZ A;  2R7F A;  4R1J A;  3PSI A;  1PH5 A;  4B3M Q;  4LNQ A;  2JA8 G;  2E8G A;  2R7D A;  5JJK A;  4LW1 A;  2MFI A;  1BKB A;  2RCN A;  4R4I A;  1R9T H;  3STB D;  3F8T A;  2RHS B;  3HOY H;  4A3L H;  3OYY A;  4TQU S;  4LF6 Q;  3CMA A;  2AWN A;  3OW2 A;  4JYA Q;  2R7Z H;  4LFA Q;  5GAG C;  5FLM G;  3PO2 H;  3E0E A;  4GLX A;  2WB1 E;  3G71 A;  4KHZ A;  4LF8 L;  3CP0 A;  4DUY L;  3HKS A;  1VQA A;  1N33 L;  3CCV A;  2QA4 A;  3HOV H;  1B7Y B;  2UXC Q;  4X66 Q;  1CKN A;  2KBN A;  1YEZ A;  2ASB A;  4BXX G;  1PYS B;  1E22 A;  3H0G H;  4R4T A;  4POF A;  4A3E G;  4DV0 L;  2B29 A;  4YWL A;  2Z0S A;  2ZTD A;  4LUV A;  5IE8 A;  3JAM c;  4X65 Q;  1N36 L;  3STB C;  3RZD H;  1Q46 A;  1HH2 P;  3S1Q H;  4LFB Q;  1C0A A;  1KXL A;  4DR1 L;  1LUZ A;  4JI5 Q;  4OX9 L;  3I4N H;  3GDE A;  1K8G A;  4PZ7 A;  4A93 G;  4LUZ A;  2Z6K A;  1EUJ A;  1JJC B;  4YY3 Q;  4HJA A;  1N9W A;  5M3M G;  4JI1 L;  1VQI A;  2VQF L;  5GQO A;  5IYD G;  4LF4 Q;  1PA6 A;  2IHE A;  1N34 Q;  2XGT A;  1VQJ A;  2ZJR A;  3CCM A;  3ULJ A;  4JI0 Q;  1I94 L;  5C44 G;  4JBM A;  5DLQ E;  4ALP A;  4IO9 A;  1YNX A;  4JC0 A;  1EFW A;  5E7N A;  2B63 G;  4JV5 Q;  2MO0 A;  1VQK A;  1JE5 A;  4B3T L;  1CKM A;  4POG A;  4IOA A;  2UXB Q;  1VCI A;  4GKK L;  4DR5 L;  4HIK A;  4QQB X;  3BZK A;  3CCQ A;  2JA7 H;  3KJP A;  1LYL A;  2ZJP A;  1Y1W G;  3TS0 A;  3T1Y L;  1IXR A;  1IBL L;  3EIV A;  3PGZ A;  2NVQ H;  2EQS A;  1BBU A;  3CPW A;  1XPO A;  4KLK A;  3RLF A;  4X62 Q;  5M3F H;  1KHI A;  1V1Q A;  4QY7 A;  2JE6 I;  1PHJ A;  1AH9 A;  2KEN A;  2UU9 L;  5FJ8 G;  1NMG A;  4EQ5 A;  1E1T A;  3FKI H;  4JI2 Q;  4LF7 L;  4A3G G;  4R4O A;  4L5Q A;  3E9H A;  1VQB A;  5ELN A;  1X3G A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...