1I3QH

Rna polymerase ii crystal form i at 3.1 a resolution
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
145
structure length
133
Chain Sequence
SNTLFDDIFQVSEVDPGRYNKVCRIEAASTTQDQCKLTLDINVELFPVAAQDSLTVTIASSLTRSWRPPQAGDRSLADDYDYVMYGTAYKFEEVSKDLIAVYYSFGGLLMRLEGNYRNLNNLKQENAYLLIRR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA-DIRECTED RNA POLYMERASE II LARGEST SUBUNIT
publication title Structural basis of transcription: RNA polymerase II at 2.8 angstrom resolution.
pubmed doi rcsb
molecule tags Transcription
total genus 20
structure length 133
sequence length 145
ec nomenclature
pdb deposition date 2001-02-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF03870 RNA_pol_Rpb8 RNA polymerase Rpb8
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 1i3qH00
1X65A 2JEBI 1EOVA 2A1AA 3GTOH 1Q12A 3K80C 5C44H 1CKNB 2JK8A 1IZ6A 1YNXA 1PHJA 4DV7Q 4B3SQ 3M4OH 4X62Q 3CCVA 5M5XH 1DGSA 2EQSA 2DUDA 2WAQE 1M90C 5IE8A 1L2FA 1X3FA 2HIXA 3LGJA 4YHHL 4YY3L 3ULLA 1I5FA 4DV6Q 3J7A5 2I5HA 4DR1L 4LF5Q 3TQYA 2N49A 2ZTCA 5BR8Q 2OTLA 2K75A 1C9OA 3PV0A 2EIFA 3FP9A 4LUVA 5GQOA 3STBC 2KHJA 1N36Q 2K5VA 4EX5A 5IP7G 5IYBH 4QGUA 3J80i 4A76A 1E22A 2VY3A 4YWKA 1K8GA 1KC8C 3CC4A 1HNWQ 3PSIA 2PI2E 4DNIA 3CCJA 3EIVA 4LF7L 3GTQH 4OWTB 1Z47A 4GKKQ 3M4PA 2BA0A 1XJVA 1SN8A 2ZJQA 3F1ZA 1WYDA 3J80c 3I4OA 4DV5Q 1SROA 2I5LX 4O0AA 4A3EH 1VQPA 1O7IA 1VQCA 4B3RL 3E9IA 1E24A 4A3JG 1AH9A 1FJGL 3KF6B 2R7ZG 3KOJA 4JG2A 1XMOQ 1EQRA 5C44G 4BBRG 3S2HH 1XNQQ 4L5SA 4OWXB 4DV2L 1VQ5A 4KHPQ 2Z0SA 4L5QA 1N33Q 4BBSG 1CKOA 4MZ9A 2FXQA 1I3QH 1UE6A 3CPFA 3I4NG 3G6EA 2HQLA 4DR4Q 3HOXH 3CD6A 4GKJQ 3CCUA 2UUBL 1HR0L 2JA7H 5M5WH 2B63H 3NENA 1K9MC 1LUZA 5IY0A 4DUZQ 1IBMQ 4JI1L 3HOZG 2CCZA 3GTGH 1VQLA 4DK6C 1HNZL 3PUVA 1I94L 1CKNA 1SLJA 2UU9L 4QY7A 1VS0A 3J81i 4A3FG 3PIPA 2CQOA 4UP9A 3NELA 1HZCA 3HFZB 2BH2A 4B3SL 4XIGS 4X62L 4HJ5A 1PVOA 4XTCS 1WCMH 3J81c 1G51A 3ULJA 5GAHC 3KFUA 4JV5Q 4DR7Q 3ZJYC 5IWAQ 1BBWA 1VQDA 4LF5L 2JA6H 3KYHC 1X3GA 3D0FA 1N9WA 5BR8L 4GLVB 3UDXA 2QEXA 2K14A 3CQZH 1N36L 3UDIA 1JE5A 3I7FA 1NJIC 4JBJA 4NXNQ 2Z6KC 1PH3A 1K83H 1NMFA 4GN4B 4GN5A 1XPOA 4GKKL 1Q46A 2BH8A 4NPSA 4NXNL 5C0XI 4DV5L 2VZAA 2WB1E 5GROA 4GOPB 1HZBA 4LF6Q 4DR2Q 1UWVA 4R4OA 2JA5G 2YU9H 1IL2A 3FKIH 2K4KA 3KF6A 4JI8Q 3OW2A 1K73C 4IFDI 4WJ4A 1XMOL 1CKMA 4HIOA 4A3DG 2IX0A 1JB7A 1IXRA 1KRSA 5IYDG 1EQQA 4KHPL 3PO2G 4POGA 3CF5A 1N33L 4OO1I 1HJPA 4A3KH 1QVCA 1WCMG 3A5ZB 5C3EG 5FLMH 4UP7A 2F4VL 2NN6I 2MO0A 4PZ6A 3RR5A 4DR4L 3EN2A 4IPDA 4GKJL 5FJ8G 2OQKA 2ZTDA 1R9TH 2ZTEA 2JA6G 2N8NA 1KL9A 2ZJRA 4X64Q 4HJAA 1WFQA 4O2DA 3W5OA 4DUZL 3ULPA 4JBWA 1YHQA 1IBML 2VQEQ 2UUAQ 3CCLA 3TS2A 1YHBA 1VQHA 1NBWA 3STBD 1JJCB 4B3MQ 1PH8A 3I4MG 1SRUA 4A3CG 1G291 1C0AA 4GS3A 1WOCA 1PA6A 1Q81C 3F2CA 4B3TQ 1Q1EA 1L1OB 4C2MH 3S1RH 5LMNQ 2JA9A 3CAMA 4J15A 3G71A 2E2JH 5IP9G 4GN3B 4A3LH 2ALYB 4BXXG 4DR7L 5IP7H 1XPRA 5IWAL 4JCVE 4JV5L 4K0KL 2R93H 1V43A 4GLXA 1MIUA 1VQ7A 3S14H 2OTJA 3ER0A 3WWVA 3CCRA 4LF4Q 1VQEA 2RHSB 3NBHB 4KLKA 4AYBG 5C0XJ 3CP0A 3UDGA 4KI0A 1PH6A 2D0OA 1BVSA 2B3GA 2VUMG 3MXNB 4IOAA 1T9HA 1K3RA 5ELOA 3VDYA 4A3JH 4IFDJ 2R7ZH 3JAMi 2KCTA 4ALPA 4BBRH 4MNOA 4GOPA 4LF6L 1SR3A 4LUOA 3KJOA 4DR2L 4Y52H 4BBSH 3HKZE 3JAMc 4JI8L 3RZDH 4R4CA 1B7YB 4JC0A 4JBKA 3I2ZA 4YCUA 3UE0A 1OXUA 2E2IH 2H5XA 3I4NH 1X54A 4IJLA 1MKHA 4LFAQ 2JA8G 1E7ZA 1E1OA 3W1GA 4DK3C 4DV4Q 4A3MG 3BZKA 2NVXH 5JJIA 3PF5A 3HKZG 2YTVA 2QA4A 3D31A 5C0XG 3HOZH 2AWOA 2YYZA 3Q8DA 1PV4A 2YV5A 1KD1C 5M3MH 1M1KC 1NMGA 4P72A 2K50A 2E8GA 1HZAA 4DPGA 4A3FH 4JI3L 4IFDG 4PMWA 4X6AH 4GNXC 2GN5A 1HNXQ 1JMCA 2UUAL 2VQEL 2OWOA 3B6YA 1TWAH 4JOIA 2ATWA 2HT1A 2IX1A 3CCQA 2ZJPA 2QGQA 5LMUL 1TXYA 3I56A 4B3ML 2KBNA 4DV3Q 1U0LA 2R7DA 1AE2A 1VQ9A 5JJLA 1GD7A 1L1OA 3OYYA 1FVIA 2NN6G 4IPCA 4PG3A 1QZHA 2I0QA 4B3TL 1PYSB 2AKWB 3PUWA 5LMNL 4P74A 1SFOH 4KHZA 2GVAA 1IBKQ 1A8VA 1MJEA 5E7NA 3RNUA 1V1QA 4DKAC 4AIMA 1VQJA 4TQUS 5AJ3Q 4AQYQ 2UUCL 4LF4L 2IT1A 1Y1VG 3BJUA 1Y1WG 1GKHA 3T1YQ 2JA5H 1YJWA 2E5LL 2N3SA 4JYAL 1QVGA 2UXBQ 1NE3A 3F2DA 3CCMA 3GTLH 1HZ9A 5M3MG 4DR3Q 2WFWA 4A3DH 1GM5A 5C4XG 1PH9A 5IYDH 1ASZA 3PO2H 4A3GG 3GDEA 4DV7L 3S1MH 4A3LG 4IPHA 1PFSA 1WJJA 5C3EH 2EXDA 3CCEA 5GAEC 1J5EQ 4LFAL 4DV6L 4TVAB 3U58A 5FJ8H 4DV4L 3CMEA 3PGZA 4X66Q 1VCIA 3RLNA 1VQ4A 3HOWG 3RN5A 4LF8Q 1NY4A 1HR0W 1YZ6A 1I50H 4JI7Q 1HNWL 3GD7A 1KQSA 1E1TA 1FL0A 4A3BG 1SE8A 4IPGA 4DV1Q 4BA2I 1UE7A 3I4MH 4A3CH 3MEFA 1TWCH 5DLQE 3OTOQ 3FHWA 4QJFA 4BY1G 4A3IG 2HHHQ 3CC2A 1I6HH 1H95A 1YITA 1XMQQ 1TWGH 5IP9H 2LXKA 4BXXH 1XNRQ 4DV3L 1LM0A 4OX9Q 4QL5A 4YCVA 1XNQL 3RLFA 1QUQB 3G48A 1YHAA 4DR6Q 4OWWB 1X55A 4L5TA 1D7QA 4MTNA 4AH6A 5IYCG 1RL2A 2VQFQ 4QIWE 4R4QA 4HJ8A 3HOUG 5GAGC 3PUXA 1IBKL 3U50C 2VUMH 1Q8KA 2XGTA 1B70B 2NVQH 2UXDQ 1X9NA 1TWHH 4HIDA 5HY6A 5AJ3L 3A74A 3GTJH 1KRTA 1X6OA 4A4IA 2Y0SE 4GOPC 4C3HH 1Y14B 2UXBL 1VQNA 4HJ9A 4LW1A 1JJ2A 2Q2HA 3DLLA 2CFMA 1S3OA 5IT9c 1BBUA 4IJHA 3A0JA 1W3SA 2A19A 4JI5Q 2ASBA 2JA8H 2LXJA 4AYBE 2CKZB 4A3MH 2B29A 3HKSA 4LF9L 5HGQA 4HJ7A 1QVFA 2Y0SG 2MO1A 3KLWA 4YWMA 2WP8J 2V1CC 3IRBA 1J5EL 1VQKA 3AEVA 3PO3G 4WJ3M 2LSSA 1K0RA 1V9PA 4X66L 1PH7A 2Z6KA 1YVCA 1WI5A 4JI2Q 4LF8L 3S17H 4JI7L 3T1HQ 4UPAA 3F8TA 1EYGA 1OXSC 2K5NA 3CCSA 4LFCQ 4DV1L 3UE1A 1YEZA 2C35B 1EWIA 4POFA 4JOIC 4BA1I 3RZOH 4DV2Q 4DAYB 2E2HH 1J6QA 2GVBA 2KHIA 3H0GG 1EIFA 2HHHL 1G6PA 3S1QH 1XMQL 1PH2A 4Y7NH 2KCMA 2Q2IA 1L1OC 2K52A 3SGIA 3CC7A 1Q86C 1EUJA 1HH2P 1QUQA 3PF4A 4OX9L 1OXXK 1A63A 4FDBA 1VQ8A 1VQAA 4UP8A 2L15A 3I55A 1Q82C 1VQ6A 3S2DH 2VQFL 1P8LA 1Y1VH 4RMFA 3CPWA 1Y1WH 3HOVG 2VNUD 1W2BA 1S40A 2ID0A 5H1SE 3M85A 4IO9A 1SMXA 4OO1G 4JI4Q 1CSPA 2RCNA 1I94Q 1HNZQ 2UXDL 1IBLQ 2UU9Q 5C4XH 2HIVA 4X64L 4GNXB 1TWFH 4C3JH 1P16A 4GLAC 3J7ZC 1B8AA 1UE1A 4A3GH 3K0XA 4LNQA 5M3FH 1VQGA 2I5MX 1YI2A 5M5YH 2MQHA 2NVTH 3HOYG 3ERSX 3KDFA 4JI5L 3TREA 3GTKH 2F3IA 3AQQA 4JI0Q 1E3PA 2BA1A 1VQFA 3EBEA 1N34Q 1AE3A 1KIXA 3HOWH 4PZ8A 5J3BA 1XTDA 2K5HA 2ZM6Q 4DR5Q 4A93G 2WAQG 2JQOA 4OXPA 1U5KA 4A3BH 1A0IA 2MFIA 4APVA 2A8VA 4HIMA 3CW2C 2PNHA 4A3IH 1MJCA 4JI2L 4BY1H 2PMZE 2R92G 2UXCQ 2CWPA 3T1HL 1EFWA 3KF8B 4LFCL 2N78A 4UY8C 2NVYH 4A75A 3S16H 1KHIA 2MNAA 1IYJB 1VQOA 4NXMQ 4JI6Q 1VQBA 3TS0A 2Q2TA 4QQBX 5IYCH 4L5RC 1X3EA 3M7NA 1JT8A 5M3FG 3HOUH 3CXCA 1PH4A 3E0EA 2F4VQ 5LMNW 4HIKA 2VW9A 4JBMA 3H3VH 1X56A 2PQAA 4DUYQ 1QZGA 3PCOB 3ICEA 1N32Q 3PIOA 5C4JH 3M3YH 1RIPA 1UEBA 2F52A 4DV0Q 2DGYA 2R7FA 3U4VA 1JJGA 4RG1A 5IYBG 3A5UA 1YBYA 1OXTA 2XTIA 4JI4L 2CWAA 1IBLL 4GNXA 2RHQB 3PUYA 5JEAJ 2YTYA 1NTGA 3U4ZA 4A3EG 1PH5A 1OTCA 3GTMH 4LUZA 1HNXL 3GO5A 2OQ0A 2IY5B 5K36G 1VQIA 3J81j 1GVPA 4C3IH 1KAWA 3PO3H 4X65Q 4DAMA 4K0KQ 1KXLA 2NZHA 2VS1A 4LWCA 1VQMA 4LFBQ 5GADC 3JC66 4JI0L 3L0OA 4H02A 1Q7YC 1A62A 1GO3E 1OXVA 2IHEA 1S72A 1N34L 1LYLA 2JJQA 3AFQA 2ZM6L 4DR5L 5EAYA 3HOXG 3F2BA 1N8RC 4P71A 2YTXA 4YCWA 2IHFA 3K8AA 3NEMA 1PH1A 1CUKA 3GTPH 4AQYL 2JA7G 2D62A 4R1JA 1YIJA 2ES2A 2B63G 5JJKA 3H15A 3H0GH 3M9BA 1BKBA 3T1YL 4BY7H 1ASYA 3E9HA 2UXCL 5JEAG 2R93G 4OONA 2AWNA 4DR3L 4YHHQ 4YY3Q 3AFPA 3PUZA 4DR1Q 1PYBA 1Q1BA 3KDFB 4NXML 3K7UC 4JI6L 2WB1G 1XPUA 2OCEA 3HOVH 2AHOB 2VL6A 3CMAA 2AMCB 3BZCA 4PZ7A 4YWLA 1YJ9A 3S24A 2JEAI 1Z9FA 4DUYL 1FGUA 1N32L 4LF7Q 5ELNA 4DV0L 4NB3A 2NZOA 4JI3Q 4LF9Q 3TRZA 1C7YA 1CSQA 4EQ5A 5FLXc 4B3RQ 3K7AH 3RLOA 3L2PA 1FJGQ 3W1BA 4R4IA 5LMUQ 3AYHB 3HOYH 4P73A 3OTOL 3G4SA 3RN2A 4BY7G 3FKIG 3H3VI 3DM3A 3UDFA 4IOCA 3S15H 1EIYB 1L0WA 4R4TA 1K8AC 4X65L 2Q2UA 1XNRL 3S1NH 2D0PA 4P75A 2PI2A 3M4QA 2R6GA 4ME3A 1LTLA 4A93H 4LFBL 2KENA 3BU2A 2PQAB 2UUBQ 4DR6L 2RF4A 3L7ZC 2UUCQ 1HR0Q 3TEHB 3K81C 3KJPA 4A3KG 2JE6I 1UE5A 5FLMG 1D8LA 1YJNA 2E5LQ 2R92H 4JYAQ 4JI1Q
chains in the Genus database with same CATH superfamily
2K5DA 1EOVA 4JVZA 1G6ZA 3K80C 3I90A 1CKNB 4FF1A 1PHJA 4DV7Q 1O7ZA 4HCSA 2E2JH 1L2FA 3LGJA 3J7A5 1I5FA 2EYPA 4C56C 4LF5Q 2AQ3B 1SJHD 1TWCB 4K14A 1G2SA 5ELEA 5D3IB 4BWGB 2EIFA 2KHJA 2R93G 5IYBH 1ICFB 4YWKA 3PSIA 1SBBB 4DNIA 3J7YW 3GTQH 1XJVA 3H3VI 4K8IA 4LF9L 2RSNA 3I4OA 1VQPA 1SROA 4A3EH 4CKEA 3E9IA 2B2TC 2NVQB 1AH9A 1PFNA 3KF6B 3FVQA 1TIID 4JG2A 1XMOQ 3S2HH 2O5IC 4L5SA 4DV2L 2L11A 4L5QA 2EXZA 3NWTA 1CKOA 4DFAA 3I4NG 3G6EA 1DYQA 3CCUA 1K8MA 2UUBL 2DNCA 4PMCA 2MGSA 1NNXA 2NWGA 1HR0L 2JA7H 3A55A 4JI1L 1SYBA 3HKZB 2K03A 5IT9L 1V1PB 2LKVA 1I94L 4UP9A 3NELA 1HZCA 2A74C 3HP3A 4XIGS 1NUCA 4HJ5A 4B3SL 1PVOA 4HN7A 2NTTA 4JV5Q 3ZJYC 5IWAQ 1VQDA 2BE5C 4X3UA 2JA6H 3RZOB 2E2HB 1ICWA 4GLVB 3MVVA 4Y7NB 1PZJD 2K14A 1JE5A 1XXGA 1UAPA 1K83H 3P1HA 4GN5A 1XPOA 5JAVA 1TVXA 1Q8IA 4NPSA 5C0XI 1V1OA 1MBYA 3P75A 1HZBA 4DR2Q 1D1IA 3FKIH 2FHTA 2MPMA 4S3SA 2KEDA 1WTRA 4HIOA 4A3DG 5A2QL 1IXRA 5M3MB 1Y8OB 3PO2G 1G2TA 1B3QA 4C3JB 4A3GB 4A3KH 1QVCA 2A6HC 5FLMH 1DXMA 1K3BC 3CKIB 4OL7A 2JA6G 2ZTDA 4RKLA 2EYLA 2N8NA 5IGFA 1RF2D 3NP8A 1FR3A 1WFQA 2M2LA 2B2YC 4DUZL 1YHQA 5J39A 1VQHA 1EQVA 3STBD 1JJCB 4LJZC 4B3MQ 1PH8A 1LTBD 2XWBB 3F2CA 4B3TQ 1BDOA 2EDGA 3G71A 4BY1B 1LT4D 1O7YA 1ZEQX 5C5MA 4A3LH 4HSPA 4OGQC 2D2CC 5IP7H 4JCVE 1V43A 4GLXA 3ITPA 1T5EA 2OTJA 3TP5A 3S16B 2BCOA 3NBHB 4KLKA 2F0PA 3CP0A 4X3SA 1PH6A 3WDNA 1BVSA 1FNUA 1D5ZC 3VDYA 1RODA 1EY6A 3PIP3 5G3LF 2KCTA 4CJ2C 4GOPA 4KKSA 4XYOA 4LF6L 5C4JB 3KJOA 1JCKB 2HD3A 2L5TA 1WVLA 3DMUA 1A3TA 4ODGA 3I2ZA 4PQXA 3NPPA 2CVRA 2MUYA 4IJLA 1X32A 1M4VA 3T16A 4Z9CB 4NW2A 1TWGB 2YTVA 5CORA 1GJXA 2YYZA 2YV5A 1NSNS 5IGEA 5ELBA 2E8GA 1HZAA 2UUAL 4ZKBB 4JOIA 2OWOA 2IX1A 5LMUL 1TXYA 3BVZA 4IALA 2R7DA 1TS3A 1GD7A 4FF2A 1HA6A 2NN6G 2OEOA 4RWSC 1WTQA 5DNFA 1A8VA 2E76C 3RNUA 4ZUIA 4KK7A 2F0MA 1NCVA 4LF4L 2IT1A 3BJUA 2WKCA 1GKHA 3T1YQ 2JA5H 1PTOB 1TS4A 3KLRA 4JYAL 1T5XD 5E1FA 4R8NA 1HZ9A 1EZ8A 1XWEA 5I9OA 1PH9A 3S1MH 4IPHA 3S17B 2I46A 3QWNA 1WJJA 5C3EH 2EXDA 2PZUA 5KNCA 4WFN3 3IAYA 1IKLA 2KEEA 4XQQA 4TVAB 1EWCA 4DV4L 3CMEA 1H9JA 2B2VA 3RLNA 1VQ4A 3HOWG 1SNPA 2XN9C 4LF8Q 1HR0W 3S15B 1DZ1A 1I50H 4JI7Q 3MFGA 4A93B 1E1TA 1UE7A 3I4MH 3MEFA 3MEHA 3OTOQ 1UNSA 4Q0FA 4QJFA 1I6HH 2XIWA 4K6DA 1STGA 3CC2A 1XMQQ 4V190 5IP9H 4MIUA 4OIJA 2Q8RE 4DV3L 1LM0A 1Y8PB 4MTNA 1RL2A 2VQFQ 4R4QA 1DCZA 1LABA 2F0OA 3U50C 1QOHA 2XGTA 1B70B 4FO2A 5M5XB 5M3FB 3ND8A 1X9NA 5HY6A 1J8IA 1X6OA 4A4IA 2Y0SE 4C3HH 3VR5A 2Q2HA 2CFMA 1BF4A 1BBUA 1DOKA 1V8QA 1FGBD 4A3MH 3AMUA 4HJ7A 5L37A 3KLWA 2MO1A 2ICIA 4WJ3M 1VQKA 3KK7A 4EQPA 2NVYB 1EY7A 3J80L 2DNEA 1EIHA 4IFDH 1X3QA 3NHHA 1EY9A 4UPAA 3HOXB 5EJWA 3MXGA 1EWIA 3A7AB 4DV2Q 1J6QA 1EWHA 1PH2A 4XDXA 1QNKA 3QOLA 4FYDA 2K52A 1Q86C 3CC7A 1EUJA 1QUQA 3D8GA 3Q0AA 3HEJA 4LMQD 1OXXK 1A63A 2CQAA 3I55A 2L15A 1GUNA 1W2BA 1Z7TA 2FMMA 4IZ8A 1S40A 2ID0A 4WRDA 4FXGC 4JI4Q 1XYIA 1I94Q 3I70A 2WACA 5C4XH 1TS2A 4X64L 4GNXB 4L63B 3J7ZC 4CDCC 4UAIA 3E5SA 3P20A 1DM0B 1GUGA 3TDQA 4LNQA 5EPKA 2MQHA 2L1BA 2NVTH 3KDFA 3TREA 4L8JA 1K0SA 1LO5D 4DK1A 2BA1A 1H9SA 2YU9B 1AE3A 1HFGA 3D4WA 3WOEA 2RVLA 2JQOA 2ENBA 1U5KA 1O78A 1SEBD 4APVA 4HIMA 2A8VA 1MJCA 4JI2L 1A15A 3FMCA 2R92G 2K01A 5EQ0A 5EBCA 2A6HD 2BDNA 5CGKA 2N78A 1R9TB 4N9TA 2FINB 1KHIA 5EKLA 1VQOA 1VQBA 4QQBX 5IYCH 2ZXRA 5BN4A 4HIKA 1Y8NB 2VW9A 4JBMA 3H3VH 2PQAA 4DUYQ 1QZGA 4CKCA 3ICEA 2CHBD 2H1EA 1UEBA 2DGYA 1EY0A 2PYKA 3MFYA 3OIPA 2DY7A 1PTOC 3SXHA 2CWAA 3S14B 1IBLL 4DGZA 1PRTB 3PUYA 1X3PA 2B2TA 1NTGA 1PTOF 1YNJC 3R8BA 4P2CB 1AEXA 3GO5A 2OQ0A 2IY5B 1BR9A 4A3JB 2F4IA 1ILQA 4X65Q 3PO3H 2NZHA 5C44B 2QILA 1A62A 2WV6D 3SK6A 4BBSB 3Q6SA 1AP0A 5M9OA 4DR5L 1JE4A 3VR4A 2CH4A 4YCWA 4PNYA 1PH1A 1CUKA 5IGDA 2XWJB 1R4QB 1FNVA 3H15A 4BY7H 1BKBA 3E9HA 1JQYD 2UXCL 4PMBA 4V0BA 5JEAG 1F2LA 2B2WC 4DR3L 4FXDA 5EKKA 1B53A 2AQ1B 2KCNA 3KDFB 4NXML 3K7UC 2RBMA 1XPUA 3H6MA 2AMCB 2HDMA 1EFID 5KRUA 1Z9FA 3K57A 4DNRB 4K2LA 2PZTA 2NUCA 1N32L 2NZOA 3TZUA 4M8AA 5FLXc 3LWUA 3C1EA 2DJFC 3C46A 5LMUQ 3HOYH 5IGGA 4BY7G 1L0WA 3GTGB 2Q2UA 1XNRL 3S1NH 4P75A 2PI2A 4FXKC 3MXPA 2PQAB 3VYSA 1WD1A 2RF4A 2F0QA 3TEHB 2JE6I 2IWHA 1YJNA 3NTKA 4JYAQ 1X65A 2JEBI 2A1AA 1C4QA 3GTOH 1HXYD 2B2YA 1ILPA 4CHTB 1IZ6A 2O5JC 1F2YA 4X62Q 3OWEB 3CCVA 1DGSA 1D5MC 2DUDA 3V2TA 5IE8A 4YHHL 1EIGA 3NQTA 2I5HA 4J6HA 3J7AF 5ELDA 3PV0A 3FP9A 3STBC 3J80i 2B2VC 3R93A 5BN3A 1TS5A 2F0EA 3CCJA 4LF7L 2BA0A 1F9QA 2RKSA 5JJKA 4AYBB 2VUMB 2HUGA 4ZQ3A 5HGTA 3KOJA 4BBRG 2F0TA 1N33Q 5F2DA 4MZ9A 3FEWX 1HA5A 1UE6A 3T51B 4DR4Q 3CD6A 4GKJQ 4QF4A 2RDHA 2EY6A 5M5WH 1WTOA 2B63H 3NENA 1LTSD 1IBMQ 1A3UA 2CCZA 3HOZG 1VQLA 3ND9A 2F0UA 1CKNA 1SLJA 4DN4M 2UU9L 4QY7A 1VS0A 4A3FG 3H91A 3I91A 3J81c 1BCPB 4RCOA 5LL6S 4DR7Q 1AW7A 4DAVA 4IN3A 3Q23A 1EU3A 3KYHC 1L0XB 1X3GA 3D0FA 1N9WA 5BR8L 3S1QB 3OHXC 3CQZH 1N36L 3UDIA 4JBJA 3NWSA 1R4PB 4NP5A 3R2IA 4GKKL 1Q46A 2BH8A 2K5QA 4NXNL 4DV5L 2VZAA 1PRTC 2WB1E 3KBGA 1Y1WB 1VF5C 3KF6A 4JI8Q 2K05A 4WJ4A 4IFDI 1PRTF 2IX0A 1JB7A 4KHPL 3RD4A 1KAAA 2LY7A 1JB3A 1ENAA 2MO0A 3RR5A 5M5YB 5FJ8G 4G7ZC 4X64Q 3N52A 4HJAA 4O2DA 2F0SA 4JBWA 2L55A 1V1PA 1YHBA 5CV8A 1HCZA 4A3BB 5DAUA 1WOCA 2RA4A 4DNTB 1Q1EA 1L1OB 4C2MH 4A3IB 5I2YA 1H9RA 3CAMA 5BN5A 3BDOA 3R2TA 1XPRA 2R93H 3OW7A 4KTAA 1VQ7A 5CMDA 2IL8A 2RHSB 5C0XJ 4KI0A 4B9XA 3HOUB 1K3RA 3LNNA 1EY5A 1EL0A 4MNOA 2VB3X 1IL8A 1STNA 3JAMc 3FPPA 4R4CA 4YCUA 3I4NH 1X54A 4LFAQ 3VR3A 3HGBA 2JA8G 1PTOD 2IX3A 1GUSA 1DOLA 2FFKB 2NVXH 3NTHA 1SE2A 4R8IA 3HKZG 2EYHA 2Y0SB 3GQBA 1YNJD 2DY8A 2AWOA 4C3IB 4DU9A 1HHVA 3E3XA 5M3MH 1NMGA 4DPGA 1HTPA 3I3CA 3VYRA 4N8FA 4X6AH 1JMCA 2VQEL 4U68A 1I4RA 1TWAH 3B6YA 3OMCA 2HT1A 4ID6A 2QGQA 3KBXA 5JJLA 3GTPB 1FVIA 2K7VA 4PG3A 1PYSB 2AKWB 3PUWA 5LMNL 4P74A 1SFOH 4RGOS 5ELCA 4KHZA 1IBKQ 1EY8A 4KKUA 2BOSA 1JWMD 3NBHA 2JA8B 2C9OA 4TQUS 2UUCL 2K32A 4DXGA 4RGTA 5FO9B 1A3VA 3HOVB 5KNDA 2UXBQ 1NE3A 3F2DA 5KGUA 3CCMA 5T1IA 3GTLH 2RCFA 2XNAC 5M3MG 2WFWA 4DR3Q 4A3DH 2K6AA 1GM5A 1LV9A 4C3JG 1ASZA 3PO2H 1LTID 4A3GG 1BO0A 3J7AV 5GAEC 4GZYC 5CV7A 4DV6L 4I7ZC 1D1KA 5E4XA 4FP5D 2EYFA 1TU2B 4H7BA 5CR3A 5HURA 1KQSA 4DV1Q 4BA2I 1F2ZA 3FHWA 2HHHQ 4BY1G 1H95A 1YITA 1TWGH 1BQQT 4O1NA 3C3LA 4CKBA 1XNRQ 1BCPC 4OX9Q 1LTTD 1YHAA 4RH6A 4L5TA 1U4LA 1BCPF 5GAGC 4HTHA 3Q24A 1Q8KA 2E2JB 2F3WA 1TWHH 3C1FA 4KHVA 5AJ3L 2B8GA 2G9HD 3A74A 1TY2A 5KIXA 3JAML 4BS9A 2IJ0A 1QCBD 2IW3A 1JJ2A 1PDQA 3BVMA 1JOQA 4NMZA 1A2TA 3A0JA 3I73A 2A19A 3GTQB 2LXJA 3D4DA 4AYBE 1J9OA 1F9RA 3HKSA 1QVFA 5HGQA 1D2BA 4A3EB 4ILWA 4YWMA 3TZDA 2WIIB 1Y69U 1LTGD 1MHWC 1J5EL 5KNBA 2LSSA 2GA4B 1V9PA 4HEDA 2R3ZA 2MP1A 4X66L 2Z6KA 1CQVA 1YVCA 3S17H 2N88A 1D5XC 4K5XA 4KY6A 3T1HQ 4HSVA 1EYGA 1OXSC 2K5NA 5JVG3 3BYTB 2C35B 2XSCA 2EOTA 2JA7B 1EIFA 2NN6H 2HCCA 4K6LA 1KTKA 2B2WA 1L1OC 3NBIA 1HH2P 3KLSA 1VQ8A 3TP6A 5CBEE 1VQAA 4QMGA 4UP8A 3GTMB 3QR8A 3S2DH 4NDXA 5H1SE 3M85A 5COYA 2RCNA 2UXDL 1XTCD 4IUQA 3J80E 2UU9Q 1SXTA 1TWFH 1HRJA 5M3FH 1VQGA 2I5MX 4CJ1B 1K83B 1QWYA 1U4PA 4JI5L 3GTKH 2F3IA 1EEID 4JI0Q 3OWFA 5FK9C 1E3PA 3MTSA 1LT5D 4YIJA 1KIXA 2H4OA 3FKIB 3HOWH 1PRTD 4ULLA 1VDZA 2ZM6Q 1ENCA 3VA5A 4H0LC 4A93G 2K5WA 3CW2C 3EA6A 4E6IA 4A3KB 1WTXA 2HDLA 5JPNC 1EFWA 4LFCL 3E6ZX 2NVYH 3K5LA 2MNAA 2C5CA 3FDTA 4L5RC 1X3EA 1QILA 5M3FG 4IUUA 4KN7C 5LMNW 4LAAA 3OIQA 3QOJA 2K04A 1X56A 3PCOB 3PIOA 5I4DA 3M3YH 4EVOA 3NK9A 4XQJA 3W2DA 4RG1A 3A5UA 1YBYA 2XTIA 3MHBA 4GNXA 3IKJA 2YTYA 3U4ZA 4LUZA 1VMPA 1HNXL 1B2TA 5K36G 4DAMA 2G9DA 2VS1A 4LWCA 2P5ZX 2IHEA 3K59A 1N34L 1CQFA 5T1GA 4CBVA 3HOXG 5E4WC 2YTXA 1RTNA 2Z8LA 1HTLD 2IHFA 3BDCA 2A73B 3K8AA 5KYLA 1QE6A 4AQYL 2Z6BA 4DF7A 5IIFA 2ES2A 4IUNA 2A68C 5IOCA 4N8X1 4OIKA 2AWNA 5A35A 3AFPA 4CDFC 1Q1BA 4JI6L 2WB1G 2OCEA 1DD2A 2V4DA 3IFTA 2VL6A 4YWLA 3BZCA 3HRZC 4PZ7A 3S24A 2AQ2B 1FGUA 3ONAB 1ONLA 4QCLA 4ME5A 2SOBA 4DV0L 4NB3A 4LF9Q 1UUPA 1C7YA 1CSQA 4EQ5A 3O13A 3K7AH 3RLOA 1I3QB 1EU4A 2EPBA 3AYHB 2KECA 3C2PA 3RN2A 3DM3A 4H44C 2JA5B 3D3RA 1B50A 1TKWB 1EIYB 4R4TA 1RJTA 2PCFB 4LFBL 2R6GA 1EYDA 2QDBA 2QDLA 3BU2A 3NTIA 4XXEA 2UUBQ 2UUCQ 1XX8A 3K6OA 1HR0Q 3N6RA 1HUMA 5D14A 2WB1B 1UE5A 1CK1A 1SE3A 1WCMB 2R92H 4JI1Q 5C3EB 2JSOA 1JWSD 4ZKCB 1Q12A 2FJ2A 5IODA 5C44H 2JK8A 4KN4C 4B3SQ 1HQRD 4K5VA 1JICA 3M4OH 1FD7D 3HZXA 4QIWB 2EQSA 5CC4A 1M90C 1X3FA 2HIXA 3GV6A 4YY3L 3ULLA 4DV6Q 2B63G 4DR1L 3I4MB 3TQYA 2N49A 2ZTCA 3M4YA 4IUTA 3NXWA 1GHKA 4LUVA 1PZID 2PO4A 4A76A 4QGUA 3K5MA 1K8GA 1E22A 3OMGA 1KC8C 3EIVA 1EY4A 4OWTB 1Z47A 3TP8A 3M4PA 1BCPD 3F1ZA 3M7NA 2F03A 1S4ZA 2I5LX 4O0AA 4B3RL 2XVSA 1O7IA 1E24A 4A3JG 1FJGL 5I2XA 3V96A 2R7ZG 2OT2A 2A6EC 1EQRA 5KYIA 5C44G 4OWXB 1VQ5A 2Z0SA 4BBSG 4HR7B 4C3HB 4JK1C 5C4HA 5IGBA 1CI3M 2F3VA 3K5NA 4A3MB 1K9MC 3URYA 5D65A 1LUZA 5IY0A 3DM1A 1LLRD 4DUZQ 5JEAH 3GTGH 1OO9B 3L3OC 3SE0A 4DK6C 1NAPA 2EZVA 2PW7A 1SYFA 2Z9HA 3VA7A 3ULJA 5G3LD 5GAHC 3U9SA 1BBWA 2R7ZB 1CZWA 1E0BA 4LF5L 2KVMA 1BBXC 3UDXA 2PQEA 3QJYA 1ZXTA 1S5BD 2BDOA 3I7FA 1IW7C 2Z6KC 1PH3A 2F0GA 1NJIC 1NMFA 1NR2A 2E2IB 1GXDC 4GN4B 4LF6Q 3SVMA 3WOFA 1UWVA 2RSOA 4R4OA 1IL2A 1K73C 3IFDA 3ZYYX 1SYCA 1XMOL 1KRSA 5IYDG 1EQQA 5C4XB 1NR4A 3CU7A 1HJPA 1CA5A 2PMZB 1I4QA 2NN6I 1JC7A 4Q5VA 3EN2A 4IPDA 2NVTB 2OQKA 2B2UC 2F0FA 1KL9A 4ZCKA 1LTAD 3ULPA 2UUAQ 3TS2A 1FYCA 1NBWA 1UEAB 1DOMA 4A3CG 1G291 1C0AA 4GS3A 2K1BA 4XYQA 3S1RH 1SYGA 2JA9A 5FO8B 5J1ZA 1LT3D 4JV5L 4BXXG 5IWAL 1MIUA 3ER0A 3WWVA 2DJGC 1LT6D 4LF4Q 2L9HA 3UDGA 4AYBG 2D0OA 2B3GA 2KOLA 2VUMG 3MXNB 2WKDA 2J7ZA 5FKAC 4IFDJ 1AZQA 2TMPA 3SR1A 4M1UB 4ALPA 4BBRH 1SR3A 1PFMA 4DR2L 4IUPA 1RD9D 4Y52H 2A5HA 3RZDH 2QEJC 1B7YB 2QCPX 1F77A 4JBKA 3UE0A 1OXUA 1GUWA 2H5XA 1YNND 3CRLC 3Q22A 2SEBD 4XT3B 1SDFA 1VMCA 1E1OA 3W1GA 4DK3C 4DV4Q 1SSOA 3TMEA 5JJIA 5LHY1 3PF5A 2QA4A 1SNQA 5C0XG 3HOZH 3PO3B 1K8OA 3KLSX 1M1KC 4P72A 2K50A 1B44D 3E0JA 3OSOA 4A3FH 4GNXC 3H09A 1HNXQ 3K58A 2ZJPA 3I56A 4B3ML 3NUCA 2KBNA 4DV3Q 3BVGA 1AE2A 1CZGA 1MI2A 1KABA 2E2DC 1L1OA 3OYYA 4OELB 4IURA 3TBIB 4B3TL 3GTJB 2Q8TA 1S5ED 3NQIA 1SYDA 4KY5A 2A68D 1JOKA 1V1QA 1VQJA 5EKIA 4AQYQ 1Y1VG 1Y1WG 1YJWA 2E5LL 1QVGA 1JWUD 2O4XA 1EYAA 3EROA 4QUCA 2G5DA 1SNCA 4KV6A 1IYUA 4B9WA 3CCEA 5CV5A 3SHLA 3U58A 3A8IE 4B08A 5FJ8H 3HOYB 2F0DA 3W3AA 2RQXA 5FLXL 5CV6A 3I8ZA 3RN5A 1NY4A 4G57A 1YZ6A 1A2UA 1HNWL 2J4XA 3GD7A 2ZXPA 4J1MA 3S1NB 4A3BG 2WAQB 1FL0A 4MTKA 1TWCH 5DLQE 4A3IG 1O7LA 1STBA 1CA6A 1Y1VB 1SMYD 2LXKA 3PMFA 3GTOB 2MJ8A 2B8FA 4J8QA 4QL5A 4YCVA 1XNQL 3G48A 4OWWB 4QIWE 4HJ8A 3HOUG 2NVQH 2F0WA 1BUVT 4UHVA 1I4HA 1ET9A 1Z6HA 3TSSA 5LL6X 2D5DA 4DA2A 3KF8A 1KLUD 2M00A 1PXUA 1VQNA 4HJ9A 2QKIC 4LW1A 5IT9c 4IJHA 1W3SA 2JA8H 1B1ZA 1Q90A 2CKZB 2Y0SG 2R61A 2JXMB 1STHA 4C3IG 3IRBA 2KHSA 3T13A 4OO1H 2L12A 2A6ED 1G91A 4JI2Q 1TR5A 4LF8L 4JI7L 3BZDB 3F8TA 4CDDC 3CCSA 2F0IA 1YEZA 4N9PA 1DJRD 4POFA 3RZOH 1F9PA 3JAME 2E2HH 2GVBA 3H0GG 5M5WB 2B63B 1G6PA 5C6AA 1XMQL 4KD4A 4CGYB 4Y7NH 1ML0D 1JR0D 3PF4A 1PFBA 4FDBA 2FMCA 2VQFL 3HOVG 3CPWA 2VNUD 1BXTA 2Z4HA 4IO9A 4G7HC 4OO1G 1CSPA 1QB5D 4JW0A 4WJWA 1IBLQ 2PZWA 3H3VC 3R3OA 1TQOA 1P16A 4C3JH 1B8AA 4A3GH 3J81L 3CQZB 1JOOA 3DWQA 3K0XA 4PV1C 3RMHA 3MA2B 3RUZA 1IW7D 2F0NA 1GUTA 5KEEA 4ZRZA 3H0GB 1I4GA 2E74C 5J3BA 1KNEA 2K5HA 4DR5Q 1EZ6A 3QO2A 1A0IA 2MFIA 2JP1A 3VR2A 5NUCA 2PNHA 2RDFA 4HCEA 4BY1H 2PMZE 1SAPA 2UXCQ 3KF8B 1TY0A 2L0CA 4UY8C 2EY1A 3GP7A 4A75A 3S16H 1IYJB 4NXMQ 5FOBB 2Q2TA 1S5DD 3E0EA 1AN8A 5DEHA 2RDGA 5EGTA 1N32Q 2F0VA 1LACA 5CBAE 5C4JH 2F52A 4OEMB 1KDBA 4C2MB 1STAA 2Z1CA 1WTPA 5IYBG 1OXTA 4JI4L 2R93B 5EPJA 2EVBA 4ABNA 2EYMA 1AZPA 4FF4A 3GTMH 4A3EG 1OTCA 5D3DA 4WORA 4I7AA 1KAWA 3P7JA 2NZ1D 5GADC 3JC66 3L0OA 4H02A 1Q7YC 1S72A 1OXVA 4RHRA 1LYLA 1WTHA 2JJQA 3X3MA 2VB2X 4ZAIA 3I4NB 1N8RC 4FVMA 4XT1B 1CHPD 1EOTA 4CDEC 3T53B 1STYA 2JA7G 2NVXB 3M9BA 4OONA 3NE5B 3K0YA 5CV9A 1EQTA 4YHHQ 3PUZA 2D9UA 2J0TD 3SK8A 1PTOH 1TWAB 4F87A 2SNMA 1M8AA 1ESFA 4DK0A 4DUYL 2KQ3A 2JEAI 3S2HB 2XRQD 4LF7Q 2L4NA 2EYOA 3LWEA 1CFMA 3TRZA 1SFOB 1F2MA 4ZYSA 4XQNA 2EE1A 1SYEA 2X6LA 5JOBA 3G4SA 3FKIG 1MSGA 1QG7A 4IOCA 3S15H 4X65L 3GTLB 4A93H 3M4QA 3PIO3 3QIAA 1LTLA 1K28A 4A3DB 2KENA 1GUOA 4DR6L 3BYYB 3PO2B 1DONA 4A3KG 3KJPA 3HS0C 1PYWD 5FLMG 1D8LA 2B2UA 2E5LQ 4QB4A 4IUVA 4MHEA 3UI2A 2X6GA 2JA6B 4RA8A 3T56B 1IHZA 3MXUA 1YNXA 2EJMA 4CJ0B 1W6JA 1KLGD 5M5XH 3K5OA 2WAQE 4KD3A 3NSWA 4TKOB 1PMRA 3T4AC 4O42A 5BR8Q 2OTLA 4HAEA 4F7XA 1MD2D 2K75A 1FNWA 1C9OA 3H94A 4A3LG 1B4OA 5GQOA 3F2UA 1N36Q 2K5VA 4EX5A 5I9PA 5IP7G 3CC4A 1HNWQ 2EY5A 2VY3A 4TRDA 2PI2E 4GKKQ 4RCNA 2ZJQA 1SN8A 4NXNQ 4DV5Q 1WYDA 3J80c 1A6XA 1VQCA 5K36H 2LS01 4LK1C 3D4RA 1TWHB 1XNQQ 3OPOA 5AFWA 4EQNA 4KHPQ 2Z4IA 4R9WA 2N55A 4HMIA 2PNRC 1HFNA 1IKMA 2A69D 2FXQA 2QF7A 1I3QH 3CPFA 2HQLA 2MHVA 3HOXH 3TN2A 1MSHA 2K28A 1RCVD 1YNNC 1KDCA 1L0YB 3A7LA 3PUVA 1HNZL 3J81i 1HQMC 2LMCB 2CQOA 4ZUJA 3VYTA 2AUKA 3PIPA 3HFZB 4X62L 4XTCS 1WCMH 1G51A 4RAUC 3KFUA 1I6VC 1HUNA 5J22A 1SNOA 3SEBA 3D6CA 3EJIA 1RHPA 2QEXA 2JN4A 1B9NA 3EVQA 4U673 2B39A 3SK4A 3EQLC 2LFNA 3S2DB 5GROA 3PQIA 4GOPB 4K8JA 4OO1I 1H9KA 2JA5G 2YU9H 4L6TB 2QW7A 2K4KA 4KKTA 3OW2A 1CKMA 2TSSA 4POGA 3CF5A 1TWFB 2F1MA 5I6WA 1N33L 4RKBA 5DM63 1WCMG 3A5ZB 4RHSA 5C3EG 4UP7A 1RDPD 1SNDA 4PZ6A 2F4VL 4DR4L 3A8JE 4GKJL 4IQZA 1R9TH 2ZTEA 3GTKB 2ICEC 5IGCA 2ZJRA 1SNMA 3W5OA 1IBML 2KA7A 3CCLA 3HOWB 2VQEQ 1CTMA 4ZLTF 3I4MG 1SRUA 1PA6A 5C5LA 1Q81C 1F9SA 2I07B 1KDAA 5LMNQ 4J15A 5IP9G 4GN3B 2ALYB 4DR7L 4K0KL 3S14H 3SK5A 3CCRA 1VQEA 2DN8A 1ZYRC 3SDZA 1SMYC 3S1MB 2PPBC 4IOAA 4UDUC 1T9HA 5ELOA 4A3JH 2R7ZH 3JAMi 3ERQA 5JJZA 4LUOA 3M3YB 1E2WA 4BBSH 3HKZE 4C3HG 4JI8L 4JC0A 2SNSA 1I50B 1E2ZA 2E2IH 1MKHA 3BG3A 1B9MA 1E7ZA 4DXFA 3DWPA 4A3MG 3G6JB 1CM9A 3BZKA 1I6HB 3IL8A 3AU7A 3D31A 3DEOA 3Q8DA 1KD1C 1PV4A 1QNUA 3KUPA 4RGMA 4IFDG 2BE5D 4JI3L 4EGVA 1RTOA 4PMWA 4MN3A 2GN5A 2ATWA 3CCQA 1EYCA 1C48A 4KY7A 4HMJA 1VQ9A 1U0LA 1QZHA 2BH2A 4IPCA 2I0QA 1CT1D 1II3A 5EBDA 2GVAA 5JVH3 1WTVA 1MJEA 5E7NA 4K2KA 4DKAC 1ET6A 4AIMA 4X3TA 1CHQD 5AJ3Q 4I65A 2ZXOA 3MXNA 3EFXD 2N3SA 3L9AX 2CW0C 4DAYA 5C4XG 4F88A 5IYDH 4RGNA 2NYZD 3GDEA 4DAPA 4DV7L 3K7AB 1O80A 1PFSA 1BNZA 5FO7B 3U9OA 1J5EQ 4LFAL 2JYOA 5JPMC 3DXJC 3D6WA 2PW5A 1W6KA 1S5FD 3PGZA 1EEFD 1VCIA 4X66Q 1ENFA 2M9VA 2HCIA 1SE8A 4IPGA 2EJFC 3G7LA 4A3CH 4QUFA 2R92B 3FPUB 1RKNA 4BXXH 2X69A 3RLFA 1QUQB 4DR6Q 1X55A 2F0KA 3CRKC 4AH6A 2ZT9C 1D7QA 5IYCG 3HG9A 3M4OB 5E3FA 3PUXA 1IBKL 2VUMH 2NBFA 2UXDQ 4HIDA 5FLXE 1STEA 3GTJH 4JPBW 1B3AA 1KRTA 2CH4W 4G4KA 4GOPC 2EYJA 2UXBL 1Y14B 4NKLA 1C8CA 1KNAA 3DLLA 1WTWA 1S3OA 3MWYW 4JI5Q 2ASBA 3X3NA 5C3XA 2NTSA 2B29A 3TP7A 4H13C 1H9SB 1SJED 2WP8J 3QB3A 2V1CC 3PO3G 5C0XH 3AEVA 1K0RA 1PH7A 1WI5A 1U4RA 1BOSA 2E75C 3MZ5A 4LFCQ 4DV1L 3UE1A 4JOIC 4BA1I 4DAYB 1GOZA 2KHIA 2HHHL 1AFPA 2O2LD 3S1QH 2KCMA 2Q2IA 3SGIA 4OX9L 4KMUC 2OXPA 1Q82C 1VQ6A 1P8LA 1Y1VH 4RMFA 5C4ZA 1Y1WH 2WINB 2F0HA 3DHQA 1I4PA 1SMXA 1HNZQ 5I6YA 3VYUA 2HIVA 1D6EC 1G8ZD 2NB0A 4GLAC 3BDLA 1UE1A 1YI2A 3FRPB 1ZKOA 5M5YH 3HOYG 3ERSX 3AQQA 4BY7B 1VQFA 3EBEA 1N34Q 1U9RA 4PZ8A 1ESRA 1XTDA 2WAQG 4OXPA 2EY2A 4A3BH 1Q3LA 5K5PA 3MC0B 5TSSA 4A3IH 3OOCA 3S9WA 4OHJA 2CWPA 2OF1A 3QG1A 1GHJA 3T1HL 4X3KA 3GV3A 1I4XA 2SDFA 3LX0A 3J81E 4FF3A 4JI6Q 3TS0A 4C1NI 1JT8A 3HOUH 2HQEA 3CXCA 2KCCA 1PH4A 2F4VQ 3I72A 1LTRD 1TT2A 1RIPA 3DUZA 4DV0Q 1HPCA 3S1RB 1PLFA 2R7FA 3V05A 3U4VA 1JJGA 2XRSD 3VR6A 3MAQA 2K33A 4RFBA 2RHQB 3AB9A 5JEAJ 1JORA 1PH5A 4K5WA 1ZYRD 1VQIA 4EQOA 3J81j 1GVPA 4C3IH 4K0KQ 1KXLA 1MGSA 2F0JA 4LFBQ 1VQMA 1QJOA 4FNFA 4BBRB 1WD0A 4JI0L 1H9MA 3A54A 3A56A 1GO3E 1VF7A 3RZDB 4F8MA 3AFQA 2AUJD 2ZM6L 5EAYA 1PZKD 3F2BA 4P71A 5CV4A 1IYVA 3NEMA 3GTPH 5DM73 2D62A 3I4LA 4R1JA 2A69C 5ISRA 3CHBD 5ELFA 3H0GH 3T1YL 1YIJA 1ASYA 2EJGC 5IT9E 1S5CD 5EPLA 3HOZB 4G7OC 4KJNA 4C1NK 4TSSA 4YY3Q 4DR1Q 1PYBA 3A8KE 4A3FB 3HOVH 2AHOB 3M7GA 3CMAA 5CYUA 1YJ9A 5C3WA 3BS1A 1U4MA 5ELNA 4JI3Q 4B3RQ 3L2PA 4ZK9B 1FJGQ 3W1BA 4R4IA 4KJOA 4P73A 1SE4A 3DEPA 3OTOL 3UDFA 1K8AC 5A2QE 2D0PA 3DWAA 4ME3A 2CW0D 2F0LA 2KJXA 2Q8IB 3L7ZC 2VXWA 2IPKD 1E2VA 2KUMA 3K81C
chains in the Genus database with same CATH topology
1X65A 2JEBI 1EOVA 2A1AA 3GTOH 1Q12A 3K80C 5C44H 1CKNB 2JK8A 1IZ6A 1YNXA 1PHJA 4DV7Q 4B3SQ 3M4OH 4X62Q 3CCVA 5M5XH 1DGSA 2EQSA 2DUDA 2WAQE 1M90C 5IE8A 1L2FA 1X3FA 2HIXA 3LGJA 4YHHL 4YY3L 3ULLA 1I5FA 4DV6Q 3J7A5 2I5HA 4DR1L 4LF5Q 3TQYA 2N49A 2ZTCA 5BR8Q 2OTLA 2K75A 1C9OA 3PV0A 2EIFA 3FP9A 4LUVA 5GQOA 3STBC 2KHJA 1N36Q 2K5VA 4EX5A 5IP7G 5IYBH 4QGUA 3J80i 4A76A 1E22A 2VY3A 4YWKA 1K8GA 1KC8C 3CC4A 1HNWQ 3PSIA 2PI2E 4DNIA 3CCJA 3EIVA 4LF7L 3GTQH 4OWTB 1Z47A 4GKKQ 3M4PA 2BA0A 1XJVA 1SN8A 2ZJQA 3F1ZA 1WYDA 3J80c 3I4OA 4DV5Q 1SROA 2I5LX 4O0AA 4A3EH 1VQPA 1O7IA 1VQCA 4B3RL 3E9IA 1E24A 4A3JG 1AH9A 1FJGL 3KF6B 2R7ZG 3KOJA 4JG2A 1XMOQ 1EQRA 5C44G 4BBRG 3S2HH 1XNQQ 4L5SA 4OWXB 4DV2L 1VQ5A 4KHPQ 2Z0SA 4L5QA 1N33Q 4BBSG 1CKOA 4MZ9A 2FXQA 1I3QH 1UE6A 3CPFA 3I4NG 3G6EA 2HQLA 4DR4Q 3HOXH 3CD6A 4GKJQ 3CCUA 2UUBL 1HR0L 2JA7H 5M5WH 2B63H 3NENA 1K9MC 1LUZA 5IY0A 4DUZQ 1IBMQ 4JI1L 3HOZG 2CCZA 3GTGH 1VQLA 4DK6C 1HNZL 3PUVA 1I94L 1CKNA 1SLJA 2UU9L 4QY7A 1VS0A 3J81i 4A3FG 3PIPA 2CQOA 4UP9A 3NELA 1HZCA 3HFZB 2BH2A 4B3SL 4XIGS 4X62L 4HJ5A 1PVOA 4XTCS 1WCMH 3J81c 1G51A 3ULJA 5GAHC 3KFUA 4JV5Q 4DR7Q 3ZJYC 5IWAQ 1BBWA 1VQDA 4LF5L 2JA6H 3KYHC 1X3GA 3D0FA 1N9WA 5BR8L 4GLVB 3UDXA 2QEXA 2K14A 3CQZH 1N36L 3UDIA 1JE5A 3I7FA 1NJIC 4JBJA 4NXNQ 2Z6KC 1PH3A 1K83H 1NMFA 4GN4B 4GN5A 1XPOA 4GKKL 1Q46A 2BH8A 4NPSA 4NXNL 5C0XI 4DV5L 2VZAA 2WB1E 5GROA 4GOPB 1HZBA 4LF6Q 4DR2Q 1UWVA 4R4OA 2JA5G 2YU9H 1IL2A 3FKIH 2K4KA 3KF6A 4JI8Q 3OW2A 1K73C 4IFDI 4WJ4A 1XMOL 1CKMA 4HIOA 4A3DG 2IX0A 1JB7A 1IXRA 1KRSA 5IYDG 1EQQA 4KHPL 3PO2G 4POGA 3CF5A 1N33L 4OO1I 1HJPA 4A3KH 1QVCA 1WCMG 3A5ZB 5C3EG 5FLMH 4UP7A 2F4VL 2NN6I 2MO0A 4PZ6A 3RR5A 4DR4L 3EN2A 4IPDA 4GKJL 5FJ8G 2OQKA 2ZTDA 1R9TH 2ZTEA 2JA6G 2N8NA 1KL9A 2ZJRA 4X64Q 4HJAA 1WFQA 4O2DA 3W5OA 4DUZL 3ULPA 4JBWA 1YHQA 1IBML 2VQEQ 2UUAQ 3CCLA 3TS2A 1YHBA 1VQHA 1NBWA 3STBD 1JJCB 4B3MQ 1PH8A 3I4MG 1SRUA 4A3CG 1G291 1C0AA 4GS3A 1WOCA 1PA6A 1Q81C 3F2CA 4B3TQ 1Q1EA 1L1OB 4C2MH 3S1RH 5LMNQ 2JA9A 3CAMA 4J15A 3G71A 2E2JH 5IP9G 4GN3B 4A3LH 2ALYB 4BXXG 4DR7L 5IP7H 1XPRA 5IWAL 4JCVE 4JV5L 4K0KL 2R93H 1V43A 4GLXA 1MIUA 1VQ7A 3S14H 2OTJA 3ER0A 3WWVA 3CCRA 4LF4Q 1VQEA 2RHSB 3NBHB 4KLKA 4AYBG 5C0XJ 3CP0A 3UDGA 4KI0A 1PH6A 2D0OA 1BVSA 2B3GA 2VUMG 3MXNB 4IOAA 1T9HA 1K3RA 5ELOA 3VDYA 4A3JH 4IFDJ 2R7ZH 3JAMi 2KCTA 4ALPA 4BBRH 4MNOA 4GOPA 4LF6L 1SR3A 4LUOA 3KJOA 4DR2L 4Y52H 4BBSH 3HKZE 3JAMc 4JI8L 3RZDH 4R4CA 1B7YB 4JC0A 4JBKA 3I2ZA 4YCUA 3UE0A 1OXUA 2E2IH 2H5XA 3I4NH 1X54A 4IJLA 1MKHA 4LFAQ 2JA8G 1E7ZA 1E1OA 3W1GA 4DK3C 4DV4Q 4A3MG 3BZKA 2NVXH 5JJIA 3PF5A 3HKZG 2YTVA 2QA4A 3D31A 5C0XG 3HOZH 2AWOA 2YYZA 3Q8DA 1PV4A 2YV5A 1KD1C 5M3MH 1M1KC 1NMGA 4P72A 2K50A 2E8GA 1HZAA 4DPGA 4A3FH 4JI3L 4IFDG 4PMWA 4X6AH 4GNXC 2GN5A 1HNXQ 1JMCA 2UUAL 2VQEL 2OWOA 3B6YA 1TWAH 4JOIA 2ATWA 2HT1A 2IX1A 3CCQA 2ZJPA 2QGQA 5LMUL 1TXYA 3I56A 4B3ML 2KBNA 4DV3Q 1U0LA 2R7DA 1AE2A 1VQ9A 5JJLA 1GD7A 1L1OA 3OYYA 1FVIA 2NN6G 4IPCA 4PG3A 1QZHA 2I0QA 4B3TL 1PYSB 2AKWB 3PUWA 5LMNL 4P74A 1SFOH 4KHZA 2GVAA 1IBKQ 1A8VA 1MJEA 5E7NA 3RNUA 1V1QA 4DKAC 4AIMA 1VQJA 4TQUS 5AJ3Q 4AQYQ 2UUCL 4LF4L 2IT1A 1Y1VG 3BJUA 1Y1WG 1GKHA 3T1YQ 2JA5H 1YJWA 2E5LL 2N3SA 4JYAL 1QVGA 2UXBQ 1NE3A 3F2DA 3CCMA 3GTLH 1HZ9A 5M3MG 4DR3Q 2WFWA 4A3DH 1GM5A 5C4XG 1PH9A 5IYDH 1ASZA 3PO2H 4A3GG 3GDEA 4DV7L 3S1MH 4A3LG 4IPHA 1PFSA 1WJJA 5C3EH 2EXDA 3CCEA 5GAEC 1J5EQ 4LFAL 4DV6L 4TVAB 3U58A 5FJ8H 4DV4L 3CMEA 3PGZA 4X66Q 1VCIA 3RLNA 1VQ4A 3HOWG 3RN5A 4LF8Q 1NY4A 1HR0W 1YZ6A 1I50H 4JI7Q 1HNWL 3GD7A 1KQSA 1E1TA 1FL0A 4A3BG 1SE8A 4IPGA 4DV1Q 4BA2I 1UE7A 3I4MH 4A3CH 3MEFA 1TWCH 5DLQE 3OTOQ 3FHWA 4QJFA 4BY1G 4A3IG 2HHHQ 3CC2A 1I6HH 1H95A 1YITA 1XMQQ 1TWGH 5IP9H 2LXKA 4BXXH 1XNRQ 4DV3L 1LM0A 4OX9Q 4QL5A 4YCVA 1XNQL 3RLFA 1QUQB 3G48A 1YHAA 4DR6Q 4OWWB 1X55A 4L5TA 1D7QA 4MTNA 4AH6A 5IYCG 1RL2A 2VQFQ 4QIWE 4R4QA 4HJ8A 3HOUG 5GAGC 3PUXA 1IBKL 3U50C 2VUMH 1Q8KA 2XGTA 1B70B 2NVQH 2UXDQ 1X9NA 1TWHH 4HIDA 5HY6A 5AJ3L 3A74A 3GTJH 1KRTA 1X6OA 4A4IA 2Y0SE 4GOPC 4C3HH 1Y14B 2UXBL 1VQNA 4HJ9A 4LW1A 1JJ2A 2Q2HA 3DLLA 2CFMA 1S3OA 5IT9c 1BBUA 4IJHA 3A0JA 1W3SA 2A19A 4JI5Q 2ASBA 2JA8H 2LXJA 4AYBE 2CKZB 4A3MH 2B29A 3HKSA 4LF9L 5HGQA 4HJ7A 1QVFA 2Y0SG 2MO1A 3KLWA 4YWMA 2WP8J 2V1CC 3IRBA 1J5EL 1VQKA 3AEVA 3PO3G 4WJ3M 2LSSA 1K0RA 1V9PA 4X66L 1PH7A 2Z6KA 1YVCA 1WI5A 4JI2Q 4LF8L 3S17H 4JI7L 3T1HQ 4UPAA 3F8TA 1EYGA 1OXSC 2K5NA 3CCSA 4LFCQ 4DV1L 3UE1A 1YEZA 2C35B 1EWIA 4POFA 4JOIC 4BA1I 3RZOH 4DV2Q 4DAYB 2E2HH 1J6QA 2GVBA 2KHIA 3H0GG 1EIFA 2HHHL 1G6PA 3S1QH 1XMQL 1PH2A 4Y7NH 2KCMA 2Q2IA 1L1OC 2K52A 3SGIA 3CC7A 1Q86C 1EUJA 1HH2P 1QUQA 3PF4A 4OX9L 1OXXK 1A63A 4FDBA 1VQ8A 1VQAA 4UP8A 2L15A 3I55A 1Q82C 1VQ6A 3S2DH 2VQFL 1P8LA 1Y1VH 4RMFA 3CPWA 1Y1WH 3HOVG 2VNUD 1W2BA 1S40A 2ID0A 5H1SE 3M85A 4IO9A 1SMXA 4OO1G 4JI4Q 1CSPA 2RCNA 1I94Q 1HNZQ 2UXDL 1IBLQ 2UU9Q 5C4XH 2HIVA 4X64L 4GNXB 1TWFH 4C3JH 1P16A 4GLAC 3J7ZC 1B8AA 1UE1A 4A3GH 3K0XA 4LNQA 5M3FH 1VQGA 2I5MX 1YI2A 5M5YH 2MQHA 2NVTH 3HOYG 3ERSX 3KDFA 4JI5L 3TREA 3GTKH 2F3IA 3AQQA 4JI0Q 1E3PA 2BA1A 1VQFA 3EBEA 1N34Q 1AE3A 1KIXA 3HOWH 4PZ8A 5J3BA 1XTDA 2K5HA 2ZM6Q 4DR5Q 4A93G 2WAQG 2JQOA 4OXPA 1U5KA 4A3BH 1A0IA 2MFIA 4APVA 2A8VA 4HIMA 3CW2C 2PNHA 4A3IH 1MJCA 4JI2L 4BY1H 2PMZE 2R92G 2UXCQ 2CWPA 3T1HL 1EFWA 3KF8B 4LFCL 2N78A 4UY8C 2NVYH 4A75A 3S16H 1KHIA 2MNAA 1IYJB 1VQOA 4NXMQ 4JI6Q 1VQBA 3TS0A 2Q2TA 4QQBX 5IYCH 4L5RC 1X3EA 3M7NA 1JT8A 5M3FG 3HOUH 3CXCA 1PH4A 3E0EA 2F4VQ 5LMNW 4HIKA 2VW9A 4JBMA 3H3VH 1X56A 2PQAA 4DUYQ 1QZGA 3PCOB 3ICEA 1N32Q 3PIOA 5C4JH 3M3YH 1RIPA 1UEBA 2F52A 4DV0Q 2DGYA 2R7FA 3U4VA 1JJGA 4RG1A 5IYBG 3A5UA 1YBYA 1OXTA 2XTIA 4JI4L 2CWAA 1IBLL 4GNXA 2RHQB 3PUYA 5JEAJ 2YTYA 1NTGA 3U4ZA 4A3EG 1PH5A 1OTCA 3GTMH 4LUZA 1HNXL 3GO5A 2OQ0A 2IY5B 5K36G 1VQIA 3J81j 1GVPA 4C3IH 1KAWA 3PO3H 4X65Q 4DAMA 4K0KQ 1KXLA 2NZHA 2VS1A 4LWCA 1VQMA 4LFBQ 5GADC 3JC66 4JI0L 3L0OA 4H02A 1Q7YC 1A62A 1GO3E 1OXVA 2IHEA 1S72A 1N34L 1LYLA 2JJQA 3AFQA 2ZM6L 4DR5L 5EAYA 3HOXG 3F2BA 1N8RC 4P71A 2YTXA 4YCWA 2IHFA 3K8AA 3NEMA 1PH1A 1CUKA 3GTPH 4AQYL 2JA7G 2D62A 4R1JA 1YIJA 2ES2A 2B63G 5JJKA 3H15A 3H0GH 3M9BA 1BKBA 3T1YL 4BY7H 1ASYA 3E9HA 2UXCL 5JEAG 2R93G 4OONA 2AWNA 4DR3L 4YHHQ 4YY3Q 3AFPA 3PUZA 4DR1Q 1PYBA 1Q1BA 3KDFB 4NXML 3K7UC 4JI6L 2WB1G 1XPUA 2OCEA 3HOVH 2AHOB 2VL6A 3CMAA 2AMCB 3BZCA 4PZ7A 4YWLA 1YJ9A 3S24A 2JEAI 1Z9FA 4DUYL 1FGUA 1N32L 4LF7Q 5ELNA 4DV0L 4NB3A 2NZOA 4JI3Q 4LF9Q 3TRZA 1C7YA 1CSQA 4EQ5A 5FLXc 4B3RQ 3K7AH 3RLOA 3L2PA 1FJGQ 3W1BA 4R4IA 5LMUQ 3AYHB 3HOYH 4P73A 3OTOL 3G4SA 3RN2A 4BY7G 3FKIG 3H3VI 3DM3A 3UDFA 4IOCA 3S15H 1EIYB 1L0WA 4R4TA 1K8AC 4X65L 2Q2UA 1XNRL 3S1NH 2D0PA 4P75A 2PI2A 3M4QA 2R6GA 4ME3A 1LTLA 4A93H 4LFBL 2KENA 3BU2A 2PQAB 2UUBQ 4DR6L 2RF4A 3L7ZC 2UUCQ 1HR0Q 3TEHB 3K81C 3KJPA 4A3KG 2JE6I 1UE5A 5FLMG 1D8LA 1YJNA 2E5LQ 2R92H 4JYAQ 4JI1Q
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1X65 A;  2JEB I;  1EOV A;  2A1A A;  3GTO H;  1Q12 A;  3K80 C;  5C44 H;  1CKN B;  2JK8 A;  1IZ6 A;  1YNX A;  1PHJ A;  4DV7 Q;  4B3S Q;  3M4O H;  4X62 Q;  3CCV A;  5M5X H;  1DGS A;  2EQS A;  2DUD A;  2WAQ E;  1M90 C;  5IE8 A;  1L2F A;  1X3F A;  2HIX A;  3LGJ A;  4YHH L;  4YY3 L;  3ULL A;  1I5F A;  4DV6 Q;  3J7A 5;  2I5H A;  4DR1 L;  4LF5 Q;  3TQY A;  2N49 A;  2ZTC A;  5BR8 Q;  2OTL A;  2K75 A;  1C9O A;  3PV0 A;  2EIF A;  3FP9 A;  4LUV A;  5GQO A;  3STB C;  2KHJ A;  1N36 Q;  2K5V A;  4EX5 A;  5IP7 G;  5IYB H;  4QGU A;  3J80 i;  4A76 A;  1E22 A;  2VY3 A;  4YWK A;  1K8G A;  1KC8 C;  3CC4 A;  1HNW Q;  3PSI A;  2PI2 E;  4DNI A;  3CCJ A;  3EIV A;  4LF7 L;  3GTQ H;  4OWT B;  1Z47 A;  4GKK Q;  3M4P A;  2BA0 A;  1XJV A;  1SN8 A;  2ZJQ A;  3F1Z A;  1WYD A;  3J80 c;  3I4O A;  4DV5 Q;  1SRO A;  2I5L X;  4O0A A;  4A3E H;  1VQP A;  1O7I A;  1VQC A;  4B3R L;  3E9I A;  1E24 A;  4A3J G;  1AH9 A;  1FJG L;  3KF6 B;  2R7Z G;  3KOJ A;  4JG2 A;  1XMO Q;  1EQR A;  5C44 G;  4BBR G;  3S2H H;  1XNQ Q;  4L5S A;  4OWX B;  4DV2 L;  1VQ5 A;  4KHP Q;  2Z0S A;  4L5Q A;  1N33 Q;  4BBS G;  1CKO A;  4MZ9 A;  2FXQ A;  1I3Q H;  1UE6 A;  3CPF A;  3I4N G;  3G6E A;  2HQL A;  4DR4 Q;  3HOX H;  3CD6 A;  4GKJ Q;  3CCU A;  2UUB L;  1HR0 L;  2JA7 H;  5M5W H;  2B63 H;  3NEN A;  1K9M C;  1LUZ A;  5IY0 A;  4DUZ Q;  1IBM Q;  4JI1 L;  3HOZ G;  2CCZ A;  3GTG H;  1VQL A;  4DK6 C;  1HNZ L;  3PUV A;  1I94 L;  1CKN A;  1SLJ A;  2UU9 L;  4QY7 A;  1VS0 A;  3J81 i;  4A3F G;  3PIP A;  2CQO A;  4UP9 A;  3NEL A;  1HZC A;  3HFZ B;  2BH2 A;  4B3S L;  4XIG S;  4X62 L;  4HJ5 A;  1PVO A;  4XTC S;  1WCM H;  3J81 c;  1G51 A;  3ULJ A;  5GAH C;  3KFU A;  4JV5 Q;  4DR7 Q;  3ZJY C;  5IWA Q;  1BBW A;  1VQD A;  4LF5 L;  2JA6 H;  3KYH C;  1X3G A;  3D0F A;  1N9W A;  5BR8 L;  4GLV B;  3UDX A;  2QEX A;  2K14 A;  3CQZ H;  1N36 L;  3UDI A;  1JE5 A;  3I7F A;  1NJI C;  4JBJ A;  4NXN Q;  2Z6K C;  1PH3 A;  1K83 H;  1NMF A;  4GN4 B;  4GN5 A;  1XPO A;  4GKK L;  1Q46 A;  2BH8 A;  4NPS A;  4NXN L;  5C0X I;  4DV5 L;  2VZA A;  2WB1 E;  5GRO A;  4GOP B;  1HZB A;  4LF6 Q;  4DR2 Q;  1UWV A;  4R4O A;  2JA5 G;  2YU9 H;  1IL2 A;  3FKI H;  2K4K A;  3KF6 A;  4JI8 Q;  3OW2 A;  1K73 C;  4IFD I;  4WJ4 A;  1XMO L;  1CKM A;  4HIO A;  4A3D G;  2IX0 A;  1JB7 A;  1IXR A;  1KRS A;  5IYD G;  1EQQ A;  4KHP L;  3PO2 G;  4POG A;  3CF5 A;  1N33 L;  4OO1 I;  1HJP A;  4A3K H;  1QVC A;  1WCM G;  3A5Z B;  5C3E G;  5FLM H;  4UP7 A;  2F4V L;  2NN6 I;  2MO0 A;  4PZ6 A;  3RR5 A;  4DR4 L;  3EN2 A;  4IPD A;  4GKJ L;  5FJ8 G;  2OQK A;  2ZTD A;  1R9T H;  2ZTE A;  2JA6 G;  2N8N A;  1KL9 A;  2ZJR A;  4X64 Q;  4HJA A;  1WFQ A;  4O2D A;  3W5O A;  4DUZ L;  3ULP A;  4JBW A;  1YHQ A;  1IBM L;  2VQE Q;  2UUA Q;  3CCL A;  3TS2 A;  1YHB A;  1VQH A;  1NBW A;  3STB D;  1JJC B;  4B3M Q;  1PH8 A;  3I4M G;  1SRU A;  4A3C G;  1G29 1;  1C0A A;  4GS3 A;  1WOC A;  1PA6 A;  1Q81 C;  3F2C A;  4B3T Q;  1Q1E A;  1L1O B;  4C2M H;  3S1R H;  5LMN Q;  2JA9 A;  3CAM A;  4J15 A;  3G71 A;  2E2J H;  5IP9 G;  4GN3 B;  4A3L H;  2ALY B;  4BXX G;  4DR7 L;  5IP7 H;  1XPR A;  5IWA L;  4JCV E;  4JV5 L;  4K0K L;  2R93 H;  1V43 A;  4GLX A;  1MIU A;  1VQ7 A;  3S14 H;  2OTJ A;  3ER0 A;  3WWV A;  3CCR A;  4LF4 Q;  1VQE A;  2RHS B;  3NBH B;  4KLK A;  4AYB G;  5C0X J;  3CP0 A;  3UDG A;  4KI0 A;  1PH6 A;  2D0O A;  1BVS A;  2B3G A;  2VUM G;  3MXN B;  4IOA A;  1T9H A;  1K3R A;  5ELO A;  3VDY A;  4A3J H;  4IFD J;  2R7Z H;  3JAM i;  2KCT A;  4ALP A;  4BBR H;  4MNO A;  4GOP A;  4LF6 L;  1SR3 A;  4LUO A;  3KJO A;  4DR2 L;  4Y52 H;  4BBS H;  3HKZ E;  3JAM c;  4JI8 L;  3RZD H;  4R4C A;  1B7Y B;  4JC0 A;  4JBK A;  3I2Z A;  4YCU A;  3UE0 A;  1OXU A;  2E2I H;  2H5X A;  3I4N H;  1X54 A;  4IJL A;  1MKH A;  4LFA Q;  2JA8 G;  1E7Z A;  1E1O A;  3W1G A;  4DK3 C;  4DV4 Q;  4A3M G;  3BZK A;  2NVX H;  5JJI A;  3PF5 A;  3HKZ G;  2YTV A;  2QA4 A;  3D31 A;  5C0X G;  3HOZ H;  2AWO A;  2YYZ A;  3Q8D A;  1PV4 A;  2YV5 A;  1KD1 C;  5M3M H;  1M1K C;  1NMG A;  4P72 A;  2K50 A;  2E8G A;  1HZA A;  4DPG A;  4A3F H;  4JI3 L;  4IFD G;  4PMW A;  4X6A H;  4GNX C;  2GN5 A;  1HNX Q;  1JMC A;  2UUA L;  2VQE L;  2OWO A;  3B6Y A;  1TWA H;  4JOI A;  2ATW A;  2HT1 A;  2IX1 A;  3CCQ A;  2ZJP A;  2QGQ A;  5LMU L;  1TXY A;  3I56 A;  4B3M L;  2KBN A;  4DV3 Q;  1U0L A;  2R7D A;  1AE2 A;  1VQ9 A;  5JJL A;  1GD7 A;  1L1O A;  3OYY A;  1FVI A;  2NN6 G;  4IPC A;  4PG3 A;  1QZH A;  2I0Q A;  4B3T L;  1PYS B;  2AKW B;  3PUW A;  5LMN L;  4P74 A;  1SFO H;  4KHZ A;  2GVA A;  1IBK Q;  1A8V A;  1MJE A;  5E7N A;  3RNU A;  1V1Q A;  4DKA C;  4AIM A;  1VQJ A;  4TQU S;  5AJ3 Q;  4AQY Q;  2UUC L;  4LF4 L;  2IT1 A;  1Y1V G;  3BJU A;  1Y1W G;  1GKH A;  3T1Y Q;  2JA5 H;  1YJW A;  2E5L L;  2N3S A;  4JYA L;  1QVG A;  2UXB Q;  1NE3 A;  3F2D A;  3CCM A;  3GTL H;  1HZ9 A;  5M3M G;  4DR3 Q;  2WFW A;  4A3D H;  1GM5 A;  5C4X G;  1PH9 A;  5IYD H;  1ASZ A;  3PO2 H;  4A3G G;  3GDE A;  4DV7 L;  3S1M H;  4A3L G;  4IPH A;  1PFS A;  1WJJ A;  5C3E H;  2EXD A;  3CCE A;  5GAE C;  1J5E Q;  4LFA L;  4DV6 L;  4TVA B;  3U58 A;  5FJ8 H;  4DV4 L;  3CME A;  3PGZ A;  4X66 Q;  1VCI A;  3RLN A;  1VQ4 A;  3HOW G;  3RN5 A;  4LF8 Q;  1NY4 A;  1HR0 W;  1YZ6 A;  1I50 H;  4JI7 Q;  1HNW L;  3GD7 A;  1KQS A;  1E1T A;  1FL0 A;  4A3B G;  1SE8 A;  4IPG A;  4DV1 Q;  4BA2 I;  1UE7 A;  3I4M H;  4A3C H;  3MEF A;  1TWC H;  5DLQ E;  3OTO Q;  3FHW A;  4QJF A;  4BY1 G;  4A3I G;  2HHH Q;  3CC2 A;  1I6H H;  1H95 A;  1YIT A;  1XMQ Q;  1TWG H;  5IP9 H;  2LXK A;  4BXX H;  1XNR Q;  4DV3 L;  1LM0 A;  4OX9 Q;  4QL5 A;  4YCV A;  1XNQ L;  3RLF A;  1QUQ B;  3G48 A;  1YHA A;  4DR6 Q;  4OWW B;  1X55 A;  4L5T A;  1D7Q A;  4MTN A;  4AH6 A;  5IYC G;  1RL2 A;  2VQF Q;  4QIW E;  4R4Q A;  4HJ8 A;  3HOU G;  5GAG C;  3PUX A;  1IBK L;  3U50 C;  2VUM H;  1Q8K A;  2XGT A;  1B70 B;  2NVQ H;  2UXD Q;  1X9N A;  1TWH H;  4HID A;  5HY6 A;  5AJ3 L;  3A74 A;  3GTJ H;  1KRT A;  1X6O A;  4A4I A;  2Y0S E;  4GOP C;  4C3H H;  1Y14 B;  2UXB L;  1VQN A;  4HJ9 A;  4LW1 A;  1JJ2 A;  2Q2H A;  3DLL A;  2CFM A;  1S3O A;  5IT9 c;  1BBU A;  4IJH A;  3A0J A;  1W3S A;  2A19 A;  4JI5 Q;  2ASB A;  2JA8 H;  2LXJ A;  4AYB E;  2CKZ B;  4A3M H;  2B29 A;  3HKS A;  4LF9 L;  5HGQ A;  4HJ7 A;  1QVF A;  2Y0S G;  2MO1 A;  3KLW A;  4YWM A;  2WP8 J;  2V1C C;  3IRB A;  1J5E L;  1VQK A;  3AEV A;  3PO3 G;  4WJ3 M;  2LSS A;  1K0R A;  1V9P A;  4X66 L;  1PH7 A;  2Z6K A;  1YVC A;  1WI5 A;  4JI2 Q;  4LF8 L;  3S17 H;  4JI7 L;  3T1H Q;  4UPA A;  3F8T A;  1EYG A;  1OXS C;  2K5N A;  3CCS A;  4LFC Q;  4DV1 L;  3UE1 A;  1YEZ A;  2C35 B;  1EWI A;  4POF A;  4JOI C;  4BA1 I;  3RZO H;  4DV2 Q;  4DAY B;  2E2H H;  1J6Q A;  2GVB A;  2KHI A;  3H0G G;  1EIF A;  2HHH L;  1G6P A;  3S1Q H;  1XMQ L;  1PH2 A;  4Y7N H;  2KCM A;  2Q2I A;  1L1O C;  2K52 A;  3SGI A;  3CC7 A;  1Q86 C;  1EUJ A;  1HH2 P;  1QUQ A;  3PF4 A;  4OX9 L;  1OXX K;  1A63 A;  4FDB A;  1VQ8 A;  1VQA A;  4UP8 A;  2L15 A;  3I55 A;  1Q82 C;  1VQ6 A;  3S2D H;  2VQF L;  1P8L A;  1Y1V H;  4RMF A;  3CPW A;  1Y1W H;  3HOV G;  2VNU D;  1W2B A;  1S40 A;  2ID0 A;  5H1S E;  3M85 A;  4IO9 A;  1SMX A;  4OO1 G;  4JI4 Q;  1CSP A;  2RCN A;  1I94 Q;  1HNZ Q;  2UXD L;  1IBL Q;  2UU9 Q;  5C4X H;  2HIV A;  4X64 L;  4GNX B;  1TWF H;  4C3J H;  1P16 A;  4GLA C;  3J7Z C;  1B8A A;  1UE1 A;  4A3G H;  3K0X A;  4LNQ A;  5M3F H;  1VQG A;  2I5M X;  1YI2 A;  5M5Y H;  2MQH A;  2NVT H;  3HOY G;  3ERS X;  3KDF A;  4JI5 L;  3TRE A;  3GTK H;  2F3I A;  3AQQ A;  4JI0 Q;  1E3P A;  2BA1 A;  1VQF A;  3EBE A;  1N34 Q;  1AE3 A;  1KIX A;  3HOW H;  4PZ8 A;  5J3B A;  1XTD A;  2K5H A;  2ZM6 Q;  4DR5 Q;  4A93 G;  2WAQ G;  2JQO A;  4OXP A;  1U5K A;  4A3B H;  1A0I A;  2MFI A;  4APV A;  2A8V A;  4HIM A;  3CW2 C;  2PNH A;  4A3I H;  1MJC A;  4JI2 L;  4BY1 H;  2PMZ E;  2R92 G;  2UXC Q;  2CWP A;  3T1H L;  1EFW A;  3KF8 B;  4LFC L;  2N78 A;  4UY8 C;  2NVY H;  4A75 A;  3S16 H;  1KHI A;  2MNA A;  1IYJ B;  1VQO A;  4NXM Q;  4JI6 Q;  1VQB A;  3TS0 A;  2Q2T A;  4QQB X;  5IYC H;  4L5R C;  1X3E A;  3M7N A;  1JT8 A;  5M3F G;  3HOU H;  3CXC A;  1PH4 A;  3E0E A;  2F4V Q;  5LMN W;  4HIK A;  2VW9 A;  4JBM A;  3H3V H;  1X56 A;  2PQA A;  4DUY Q;  1QZG A;  3PCO B;  3ICE A;  1N32 Q;  3PIO A;  5C4J H;  3M3Y H;  1RIP A;  1UEB A;  2F52 A;  4DV0 Q;  2DGY A;  2R7F A;  3U4V A;  1JJG A;  4RG1 A;  5IYB G;  3A5U A;  1YBY A;  1OXT A;  2XTI A;  4JI4 L;  2CWA A;  1IBL L;  4GNX A;  2RHQ B;  3PUY A;  5JEA J;  2YTY A;  1NTG A;  3U4Z A;  4A3E G;  1PH5 A;  1OTC A;  3GTM H;  4LUZ A;  1HNX L;  3GO5 A;  2OQ0 A;  2IY5 B;  5K36 G;  1VQI A;  3J81 j;  1GVP A;  4C3I H;  1KAW A;  3PO3 H;  4X65 Q;  4DAM A;  4K0K Q;  1KXL A;  2NZH A;  2VS1 A;  4LWC A;  1VQM A;  4LFB Q;  5GAD C;  3JC6 6;  4JI0 L;  3L0O A;  4H02 A;  1Q7Y C;  1A62 A;  1GO3 E;  1OXV A;  2IHE A;  1S72 A;  1N34 L;  1LYL A;  2JJQ A;  3AFQ A;  2ZM6 L;  4DR5 L;  5EAY A;  3HOX G;  3F2B A;  1N8R C;  4P71 A;  2YTX A;  4YCW A;  2IHF A;  3K8A A;  3NEM A;  1PH1 A;  1CUK A;  3GTP H;  4AQY L;  2JA7 G;  2D62 A;  4R1J A;  1YIJ A;  2ES2 A;  2B63 G;  5JJK A;  3H15 A;  3H0G H;  3M9B A;  1BKB A;  3T1Y L;  4BY7 H;  1ASY A;  3E9H A;  2UXC L;  5JEA G;  2R93 G;  4OON A;  2AWN A;  4DR3 L;  4YHH Q;  4YY3 Q;  3AFP A;  3PUZ A;  4DR1 Q;  1PYB A;  1Q1B A;  3KDF B;  4NXM L;  3K7U C;  4JI6 L;  2WB1 G;  1XPU A;  2OCE A;  3HOV H;  2AHO B;  2VL6 A;  3CMA A;  2AMC B;  3BZC A;  4PZ7 A;  4YWL A;  1YJ9 A;  3S24 A;  2JEA I;  1Z9F A;  4DUY L;  1FGU A;  1N32 L;  4LF7 Q;  5ELN A;  4DV0 L;  4NB3 A;  2NZO A;  4JI3 Q;  4LF9 Q;  3TRZ A;  1C7Y A;  1CSQ A;  4EQ5 A;  5FLX c;  4B3R Q;  3K7A H;  3RLO A;  3L2P A;  1FJG Q;  3W1B A;  4R4I A;  5LMU Q;  3AYH B;  3HOY H;  4P73 A;  3OTO L;  3G4S A;  3RN2 A;  4BY7 G;  3FKI G;  3H3V I;  3DM3 A;  3UDF A;  4IOC A;  3S15 H;  1EIY B;  1L0W A;  4R4T A;  1K8A C;  4X65 L;  2Q2U A;  1XNR L;  3S1N H;  2D0P A;  4P75 A;  2PI2 A;  3M4Q A;  2R6G A;  4ME3 A;  1LTL A;  4A93 H;  4LFB L;  2KEN A;  3BU2 A;  2PQA B;  2UUB Q;  4DR6 L;  2RF4 A;  3L7Z C;  2UUC Q;  1HR0 Q;  3TEH B;  3K81 C;  3KJP A;  4A3K G;  2JE6 I;  1UE5 A;  5FLM G;  1D8L A;  1YJN A;  2E5L Q;  2R92 H;  4JYA Q;  4JI1 Q; 
#chains in the Genus database with same CATH topology
 2K5D A;  1EOV A;  4JVZ A;  1G6Z A;  3K80 C;  3I90 A;  1CKN B;  4FF1 A;  1PHJ A;  4DV7 Q;  1O7Z A;  4HCS A;  2E2J H;  1L2F A;  3LGJ A;  3J7A 5;  1I5F A;  2EYP A;  4C56 C;  4LF5 Q;  2AQ3 B;  1SJH D;  1TWC B;  4K14 A;  1G2S A;  5ELE A;  5D3I B;  4BWG B;  2EIF A;  2KHJ A;  2R93 G;  5IYB H;  1ICF B;  4YWK A;  3PSI A;  1SBB B;  4DNI A;  3J7Y W;  3GTQ H;  1XJV A;  3H3V I;  4K8I A;  4LF9 L;  2RSN A;  3I4O A;  1VQP A;  1SRO A;  4A3E H;  4CKE A;  3E9I A;  2B2T C;  2NVQ B;  1AH9 A;  1PFN A;  3KF6 B;  3FVQ A;  1TII D;  4JG2 A;  1XMO Q;  3S2H H;  2O5I C;  4L5S A;  4DV2 L;  2L11 A;  4L5Q A;  2EXZ A;  3NWT A;  1CKO A;  4DFA A;  3I4N G;  3G6E A;  1DYQ A;  3CCU A;  1K8M A;  2UUB L;  2DNC A;  4PMC A;  2MGS A;  1NNX A;  2NWG A;  1HR0 L;  2JA7 H;  3A55 A;  4JI1 L;  1SYB A;  3HKZ B;  2K03 A;  5IT9 L;  1V1P B;  2LKV A;  1I94 L;  4UP9 A;  3NEL A;  1HZC A;  2A74 C;  3HP3 A;  4XIG S;  1NUC A;  4HJ5 A;  4B3S L;  1PVO A;  4HN7 A;  2NTT A;  4JV5 Q;  3ZJY C;  5IWA Q;  1VQD A;  2BE5 C;  4X3U A;  2JA6 H;  3RZO B;  2E2H B;  1ICW A;  4GLV B;  3MVV A;  4Y7N B;  1PZJ D;  2K14 A;  1JE5 A;  1XXG A;  1UAP A;  1K83 H;  3P1H A;  4GN5 A;  1XPO A;  5JAV A;  1TVX A;  1Q8I A;  4NPS A;  5C0X I;  1V1O A;  1MBY A;  3P75 A;  1HZB A;  4DR2 Q;  1D1I A;  3FKI H;  2FHT A;  2MPM A;  4S3S A;  2KED A;  1WTR A;  4HIO A;  4A3D G;  5A2Q L;  1IXR A;  5M3M B;  1Y8O B;  3PO2 G;  1G2T A;  1B3Q A;  4C3J B;  4A3G B;  4A3K H;  1QVC A;  2A6H C;  5FLM H;  1DXM A;  1K3B C;  3CKI B;  4OL7 A;  2JA6 G;  2ZTD A;  4RKL A;  2EYL A;  2N8N A;  5IGF A;  1RF2 D;  3NP8 A;  1FR3 A;  1WFQ A;  2M2L A;  2B2Y C;  4DUZ L;  1YHQ A;  5J39 A;  1VQH A;  1EQV A;  3STB D;  1JJC B;  4LJZ C;  4B3M Q;  1PH8 A;  1LTB D;  2XWB B;  3F2C A;  4B3T Q;  1BDO A;  2EDG A;  3G71 A;  4BY1 B;  1LT4 D;  1O7Y A;  1ZEQ X;  5C5M A;  4A3L H;  4HSP A;  4OGQ C;  2D2C C;  5IP7 H;  4JCV E;  1V43 A;  4GLX A;  3ITP A;  1T5E A;  2OTJ A;  3TP5 A;  3S16 B;  2BCO A;  3NBH B;  4KLK A;  2F0P A;  3CP0 A;  4X3S A;  1PH6 A;  3WDN A;  1BVS A;  1FNU A;  1D5Z C;  3VDY A;  1ROD A;  1EY6 A;  3PIP 3;  5G3L F;  2KCT A;  4CJ2 C;  4GOP A;  4KKS A;  4XYO A;  4LF6 L;  5C4J B;  3KJO A;  1JCK B;  2HD3 A;  2L5T A;  1WVL A;  3DMU A;  1A3T A;  4ODG A;  3I2Z A;  4PQX A;  3NPP A;  2CVR A;  2MUY A;  4IJL A;  1X32 A;  1M4V A;  3T16 A;  4Z9C B;  4NW2 A;  1TWG B;  2YTV A;  5COR A;  1GJX A;  2YYZ A;  2YV5 A;  1NSN S;  5IGE A;  5ELB A;  2E8G A;  1HZA A;  2UUA L;  4ZKB B;  4JOI A;  2OWO A;  2IX1 A;  5LMU L;  1TXY A;  3BVZ A;  4IAL A;  2R7D A;  1TS3 A;  1GD7 A;  4FF2 A;  1HA6 A;  2NN6 G;  2OEO A;  4RWS C;  1WTQ A;  5DNF A;  1A8V A;  2E76 C;  3RNU A;  4ZUI A;  4KK7 A;  2F0M A;  1NCV A;  4LF4 L;  2IT1 A;  3BJU A;  2WKC A;  1GKH A;  3T1Y Q;  2JA5 H;  1PTO B;  1TS4 A;  3KLR A;  4JYA L;  1T5X D;  5E1F A;  4R8N A;  1HZ9 A;  1EZ8 A;  1XWE A;  5I9O A;  1PH9 A;  3S1M H;  4IPH A;  3S17 B;  2I46 A;  3QWN A;  1WJJ A;  5C3E H;  2EXD A;  2PZU A;  5KNC A;  4WFN 3;  3IAY A;  1IKL A;  2KEE A;  4XQQ A;  4TVA B;  1EWC A;  4DV4 L;  3CME A;  1H9J A;  2B2V A;  3RLN A;  1VQ4 A;  3HOW G;  1SNP A;  2XN9 C;  4LF8 Q;  1HR0 W;  3S15 B;  1DZ1 A;  1I50 H;  4JI7 Q;  3MFG A;  4A93 B;  1E1T A;  1UE7 A;  3I4M H;  3MEF A;  3MEH A;  3OTO Q;  1UNS A;  4Q0F A;  4QJF A;  1I6H H;  2XIW A;  4K6D A;  1STG A;  3CC2 A;  1XMQ Q;  4V19 0;  5IP9 H;  4MIU A;  4OIJ A;  2Q8R E;  4DV3 L;  1LM0 A;  1Y8P B;  4MTN A;  1RL2 A;  2VQF Q;  4R4Q A;  1DCZ A;  1LAB A;  2F0O A;  3U50 C;  1QOH A;  2XGT A;  1B70 B;  4FO2 A;  5M5X B;  5M3F B;  3ND8 A;  1X9N A;  5HY6 A;  1J8I A;  1X6O A;  4A4I A;  2Y0S E;  4C3H H;  3VR5 A;  2Q2H A;  2CFM A;  1BF4 A;  1BBU A;  1DOK A;  1V8Q A;  1FGB D;  4A3M H;  3AMU A;  4HJ7 A;  5L37 A;  3KLW A;  2MO1 A;  2ICI A;  4WJ3 M;  1VQK A;  3KK7 A;  4EQP A;  2NVY B;  1EY7 A;  3J80 L;  2DNE A;  1EIH A;  4IFD H;  1X3Q A;  3NHH A;  1EY9 A;  4UPA A;  3HOX B;  5EJW A;  3MXG A;  1EWI A;  3A7A B;  4DV2 Q;  1J6Q A;  1EWH A;  1PH2 A;  4XDX A;  1QNK A;  3QOL A;  4FYD A;  2K52 A;  1Q86 C;  3CC7 A;  1EUJ A;  1QUQ A;  3D8G A;  3Q0A A;  3HEJ A;  4LMQ D;  1OXX K;  1A63 A;  2CQA A;  3I55 A;  2L15 A;  1GUN A;  1W2B A;  1Z7T A;  2FMM A;  4IZ8 A;  1S40 A;  2ID0 A;  4WRD A;  4FXG C;  4JI4 Q;  1XYI A;  1I94 Q;  3I70 A;  2WAC A;  5C4X H;  1TS2 A;  4X64 L;  4GNX B;  4L63 B;  3J7Z C;  4CDC C;  4UAI A;  3E5S A;  3P20 A;  1DM0 B;  1GUG A;  3TDQ A;  4LNQ A;  5EPK A;  2MQH A;  2L1B A;  2NVT H;  3KDF A;  3TRE A;  4L8J A;  1K0S A;  1LO5 D;  4DK1 A;  2BA1 A;  1H9S A;  2YU9 B;  1AE3 A;  1HFG A;  3D4W A;  3WOE A;  2RVL A;  2JQO A;  2ENB A;  1U5K A;  1O78 A;  1SEB D;  4APV A;  4HIM A;  2A8V A;  1MJC A;  4JI2 L;  1A15 A;  3FMC A;  2R92 G;  2K01 A;  5EQ0 A;  5EBC A;  2A6H D;  2BDN A;  5CGK A;  2N78 A;  1R9T B;  4N9T A;  2FIN B;  1KHI A;  5EKL A;  1VQO A;  1VQB A;  4QQB X;  5IYC H;  2ZXR A;  5BN4 A;  4HIK A;  1Y8N B;  2VW9 A;  4JBM A;  3H3V H;  2PQA A;  4DUY Q;  1QZG A;  4CKC A;  3ICE A;  2CHB D;  2H1E A;  1UEB A;  2DGY A;  1EY0 A;  2PYK A;  3MFY A;  3OIP A;  2DY7 A;  1PTO C;  3SXH A;  2CWA A;  3S14 B;  1IBL L;  4DGZ A;  1PRT B;  3PUY A;  1X3P A;  2B2T A;  1NTG A;  1PTO F;  1YNJ C;  3R8B A;  4P2C B;  1AEX A;  3GO5 A;  2OQ0 A;  2IY5 B;  1BR9 A;  4A3J B;  2F4I A;  1ILQ A;  4X65 Q;  3PO3 H;  2NZH A;  5C44 B;  2QIL A;  1A62 A;  2WV6 D;  3SK6 A;  4BBS B;  3Q6S A;  1AP0 A;  5M9O A;  4DR5 L;  1JE4 A;  3VR4 A;  2CH4 A;  4YCW A;  4PNY A;  1PH1 A;  1CUK A;  5IGD A;  2XWJ B;  1R4Q B;  1FNV A;  3H15 A;  4BY7 H;  1BKB A;  3E9H A;  1JQY D;  2UXC L;  4PMB A;  4V0B A;  5JEA G;  1F2L A;  2B2W C;  4DR3 L;  4FXD A;  5EKK A;  1B53 A;  2AQ1 B;  2KCN A;  3KDF B;  4NXM L;  3K7U C;  2RBM A;  1XPU A;  3H6M A;  2AMC B;  2HDM A;  1EFI D;  5KRU A;  1Z9F A;  3K57 A;  4DNR B;  4K2L A;  2PZT A;  2NUC A;  1N32 L;  2NZO A;  3TZU A;  4M8A A;  5FLX c;  3LWU A;  3C1E A;  2DJF C;  3C46 A;  5LMU Q;  3HOY H;  5IGG A;  4BY7 G;  1L0W A;  3GTG B;  2Q2U A;  1XNR L;  3S1N H;  4P75 A;  2PI2 A;  4FXK C;  3MXP A;  2PQA B;  3VYS A;  1WD1 A;  2RF4 A;  2F0Q A;  3TEH B;  2JE6 I;  2IWH A;  1YJN A;  3NTK A;  4JYA Q;  1X65 A;  2JEB I;  2A1A A;  1C4Q A;  3GTO H;  1HXY D;  2B2Y A;  1ILP A;  4CHT B;  1IZ6 A;  2O5J C;  1F2Y A;  4X62 Q;  3OWE B;  3CCV A;  1DGS A;  1D5M C;  2DUD A;  3V2T A;  5IE8 A;  4YHH L;  1EIG A;  3NQT A;  2I5H A;  4J6H A;  3J7A F;  5ELD A;  3PV0 A;  3FP9 A;  3STB C;  3J80 i;  2B2V C;  3R93 A;  5BN3 A;  1TS5 A;  2F0E A;  3CCJ A;  4LF7 L;  2BA0 A;  1F9Q A;  2RKS A;  5JJK A;  4AYB B;  2VUM B;  2HUG A;  4ZQ3 A;  5HGT A;  3KOJ A;  4BBR G;  2F0T A;  1N33 Q;  5F2D A;  4MZ9 A;  3FEW X;  1HA5 A;  1UE6 A;  3T51 B;  4DR4 Q;  3CD6 A;  4GKJ Q;  4QF4 A;  2RDH A;  2EY6 A;  5M5W H;  1WTO A;  2B63 H;  3NEN A;  1LTS D;  1IBM Q;  1A3U A;  2CCZ A;  3HOZ G;  1VQL A;  3ND9 A;  2F0U A;  1CKN A;  1SLJ A;  4DN4 M;  2UU9 L;  4QY7 A;  1VS0 A;  4A3F G;  3H91 A;  3I91 A;  3J81 c;  1BCP B;  4RCO A;  5LL6 S;  4DR7 Q;  1AW7 A;  4DAV A;  4IN3 A;  3Q23 A;  1EU3 A;  3KYH C;  1L0X B;  1X3G A;  3D0F A;  1N9W A;  5BR8 L;  3S1Q B;  3OHX C;  3CQZ H;  1N36 L;  3UDI A;  4JBJ A;  3NWS A;  1R4P B;  4NP5 A;  3R2I A;  4GKK L;  1Q46 A;  2BH8 A;  2K5Q A;  4NXN L;  4DV5 L;  2VZA A;  1PRT C;  2WB1 E;  3KBG A;  1Y1W B;  1VF5 C;  3KF6 A;  4JI8 Q;  2K05 A;  4WJ4 A;  4IFD I;  1PRT F;  2IX0 A;  1JB7 A;  4KHP L;  3RD4 A;  1KAA A;  2LY7 A;  1JB3 A;  1ENA A;  2MO0 A;  3RR5 A;  5M5Y B;  5FJ8 G;  4G7Z C;  4X64 Q;  3N52 A;  4HJA A;  4O2D A;  2F0S A;  4JBW A;  2L55 A;  1V1P A;  1YHB A;  5CV8 A;  1HCZ A;  4A3B B;  5DAU A;  1WOC A;  2RA4 A;  4DNT B;  1Q1E A;  1L1O B;  4C2M H;  4A3I B;  5I2Y A;  1H9R A;  3CAM A;  5BN5 A;  3BDO A;  3R2T A;  1XPR A;  2R93 H;  3OW7 A;  4KTA A;  1VQ7 A;  5CMD A;  2IL8 A;  2RHS B;  5C0X J;  4KI0 A;  4B9X A;  3HOU B;  1K3R A;  3LNN A;  1EY5 A;  1EL0 A;  4MNO A;  2VB3 X;  1IL8 A;  1STN A;  3JAM c;  3FPP A;  4R4C A;  4YCU A;  3I4N H;  1X54 A;  4LFA Q;  3VR3 A;  3HGB A;  2JA8 G;  1PTO D;  2IX3 A;  1GUS A;  1DOL A;  2FFK B;  2NVX H;  3NTH A;  1SE2 A;  4R8I A;  3HKZ G;  2EYH A;  2Y0S B;  3GQB A;  1YNJ D;  2DY8 A;  2AWO A;  4C3I B;  4DU9 A;  1HHV A;  3E3X A;  5M3M H;  1NMG A;  4DPG A;  1HTP A;  3I3C A;  3VYR A;  4N8F A;  4X6A H;  1JMC A;  2VQE L;  4U68 A;  1I4R A;  1TWA H;  3B6Y A;  3OMC A;  2HT1 A;  4ID6 A;  2QGQ A;  3KBX A;  5JJL A;  3GTP B;  1FVI A;  2K7V A;  4PG3 A;  1PYS B;  2AKW B;  3PUW A;  5LMN L;  4P74 A;  1SFO H;  4RGO S;  5ELC A;  4KHZ A;  1IBK Q;  1EY8 A;  4KKU A;  2BOS A;  1JWM D;  3NBH A;  2JA8 B;  2C9O A;  4TQU S;  2UUC L;  2K32 A;  4DXG A;  4RGT A;  5FO9 B;  1A3V A;  3HOV B;  5KND A;  2UXB Q;  1NE3 A;  3F2D A;  5KGU A;  3CCM A;  5T1I A;  3GTL H;  2RCF A;  2XNA C;  5M3M G;  2WFW A;  4DR3 Q;  4A3D H;  2K6A A;  1GM5 A;  1LV9 A;  4C3J G;  1ASZ A;  3PO2 H;  1LTI D;  4A3G G;  1BO0 A;  3J7A V;  5GAE C;  4GZY C;  5CV7 A;  4DV6 L;  4I7Z C;  1D1K A;  5E4X A;  4FP5 D;  2EYF A;  1TU2 B;  4H7B A;  5CR3 A;  5HUR A;  1KQS A;  4DV1 Q;  4BA2 I;  1F2Z A;  3FHW A;  2HHH Q;  4BY1 G;  1H95 A;  1YIT A;  1TWG H;  1BQQ T;  4O1N A;  3C3L A;  4CKB A;  1XNR Q;  1BCP C;  4OX9 Q;  1LTT D;  1YHA A;  4RH6 A;  4L5T A;  1U4L A;  1BCP F;  5GAG C;  4HTH A;  3Q24 A;  1Q8K A;  2E2J B;  2F3W A;  1TWH H;  3C1F A;  4KHV A;  5AJ3 L;  2B8G A;  2G9H D;  3A74 A;  1TY2 A;  5KIX A;  3JAM L;  4BS9 A;  2IJ0 A;  1QCB D;  2IW3 A;  1JJ2 A;  1PDQ A;  3BVM A;  1JOQ A;  4NMZ A;  1A2T A;  3A0J A;  3I73 A;  2A19 A;  3GTQ B;  2LXJ A;  3D4D A;  4AYB E;  1J9O A;  1F9R A;  3HKS A;  1QVF A;  5HGQ A;  1D2B A;  4A3E B;  4ILW A;  4YWM A;  3TZD A;  2WII B;  1Y69 U;  1LTG D;  1MHW C;  1J5E L;  5KNB A;  2LSS A;  2GA4 B;  1V9P A;  4HED A;  2R3Z A;  2MP1 A;  4X66 L;  2Z6K A;  1CQV A;  1YVC A;  3S17 H;  2N88 A;  1D5X C;  4K5X A;  4KY6 A;  3T1H Q;  4HSV A;  1EYG A;  1OXS C;  2K5N A;  5JVG 3;  3BYT B;  2C35 B;  2XSC A;  2EOT A;  2JA7 B;  1EIF A;  2NN6 H;  2HCC A;  4K6L A;  1KTK A;  2B2W A;  1L1O C;  3NBI A;  1HH2 P;  3KLS A;  1VQ8 A;  3TP6 A;  5CBE E;  1VQA A;  4QMG A;  4UP8 A;  3GTM B;  3QR8 A;  3S2D H;  4NDX A;  5H1S E;  3M85 A;  5COY A;  2RCN A;  2UXD L;  1XTC D;  4IUQ A;  3J80 E;  2UU9 Q;  1SXT A;  1TWF H;  1HRJ A;  5M3F H;  1VQG A;  2I5M X;  4CJ1 B;  1K83 B;  1QWY A;  1U4P A;  4JI5 L;  3GTK H;  2F3I A;  1EEI D;  4JI0 Q;  3OWF A;  5FK9 C;  1E3P A;  3MTS A;  1LT5 D;  4YIJ A;  1KIX A;  2H4O A;  3FKI B;  3HOW H;  1PRT D;  4ULL A;  1VDZ A;  2ZM6 Q;  1ENC A;  3VA5 A;  4H0L C;  4A93 G;  2K5W A;  3CW2 C;  3EA6 A;  4E6I A;  4A3K B;  1WTX A;  2HDL A;  5JPN C;  1EFW A;  4LFC L;  3E6Z X;  2NVY H;  3K5L A;  2MNA A;  2C5C A;  3FDT A;  4L5R C;  1X3E A;  1QIL A;  5M3F G;  4IUU A;  4KN7 C;  5LMN W;  4LAA A;  3OIQ A;  3QOJ A;  2K04 A;  1X56 A;  3PCO B;  3PIO A;  5I4D A;  3M3Y H;  4EVO A;  3NK9 A;  4XQJ A;  3W2D A;  4RG1 A;  3A5U A;  1YBY A;  2XTI A;  3MHB A;  4GNX A;  3IKJ A;  2YTY A;  3U4Z A;  4LUZ A;  1VMP A;  1HNX L;  1B2T A;  5K36 G;  4DAM A;  2G9D A;  2VS1 A;  4LWC A;  2P5Z X;  2IHE A;  3K59 A;  1N34 L;  1CQF A;  5T1G A;  4CBV A;  3HOX G;  5E4W C;  2YTX A;  1RTN A;  2Z8L A;  1HTL D;  2IHF A;  3BDC A;  2A73 B;  3K8A A;  5KYL A;  1QE6 A;  4AQY L;  2Z6B A;  4DF7 A;  5IIF A;  2ES2 A;  4IUN A;  2A68 C;  5IOC A;  4N8X 1;  4OIK A;  2AWN A;  5A35 A;  3AFP A;  4CDF C;  1Q1B A;  4JI6 L;  2WB1 G;  2OCE A;  1DD2 A;  2V4D A;  3IFT A;  2VL6 A;  4YWL A;  3BZC A;  3HRZ C;  4PZ7 A;  3S24 A;  2AQ2 B;  1FGU A;  3ONA B;  1ONL A;  4QCL A;  4ME5 A;  2SOB A;  4DV0 L;  4NB3 A;  4LF9 Q;  1UUP A;  1C7Y A;  1CSQ A;  4EQ5 A;  3O13 A;  3K7A H;  3RLO A;  1I3Q B;  1EU4 A;  2EPB A;  3AYH B;  2KEC A;  3C2P A;  3RN2 A;  3DM3 A;  4H44 C;  2JA5 B;  3D3R A;  1B50 A;  1TKW B;  1EIY B;  4R4T A;  1RJT A;  2PCF B;  4LFB L;  2R6G A;  1EYD A;  2QDB A;  2QDL A;  3BU2 A;  3NTI A;  4XXE A;  2UUB Q;  2UUC Q;  1XX8 A;  3K6O A;  1HR0 Q;  3N6R A;  1HUM A;  5D14 A;  2WB1 B;  1UE5 A;  1CK1 A;  1SE3 A;  1WCM B;  2R92 H;  4JI1 Q;  5C3E B;  2JSO A;  1JWS D;  4ZKC B;  1Q12 A;  2FJ2 A;  5IOD A;  5C44 H;  2JK8 A;  4KN4 C;  4B3S Q;  1HQR D;  4K5V A;  1JIC A;  3M4O H;  1FD7 D;  3HZX A;  4QIW B;  2EQS A;  5CC4 A;  1M90 C;  1X3F A;  2HIX A;  3GV6 A;  4YY3 L;  3ULL A;  4DV6 Q;  2B63 G;  4DR1 L;  3I4M B;  3TQY A;  2N49 A;  2ZTC A;  3M4Y A;  4IUT A;  3NXW A;  1GHK A;  4LUV A;  1PZI D;  2PO4 A;  4A76 A;  4QGU A;  3K5M A;  1K8G A;  1E22 A;  3OMG A;  1KC8 C;  3EIV A;  1EY4 A;  4OWT B;  1Z47 A;  3TP8 A;  3M4P A;  1BCP D;  3F1Z A;  3M7N A;  2F03 A;  1S4Z A;  2I5L X;  4O0A A;  4B3R L;  2XVS A;  1O7I A;  1E24 A;  4A3J G;  1FJG L;  5I2X A;  3V96 A;  2R7Z G;  2OT2 A;  2A6E C;  1EQR A;  5KYI A;  5C44 G;  4OWX B;  1VQ5 A;  2Z0S A;  4BBS G;  4HR7 B;  4C3H B;  4JK1 C;  5C4H A;  5IGB A;  1CI3 M;  2F3V A;  3K5N A;  4A3M B;  1K9M C;  3URY A;  5D65 A;  1LUZ A;  5IY0 A;  3DM1 A;  1LLR D;  4DUZ Q;  5JEA H;  3GTG H;  1OO9 B;  3L3O C;  3SE0 A;  4DK6 C;  1NAP A;  2EZV A;  2PW7 A;  1SYF A;  2Z9H A;  3VA7 A;  3ULJ A;  5G3L D;  5GAH C;  3U9S A;  1BBW A;  2R7Z B;  1CZW A;  1E0B A;  4LF5 L;  2KVM A;  1BBX C;  3UDX A;  2PQE A;  3QJY A;  1ZXT A;  1S5B D;  2BDO A;  3I7F A;  1IW7 C;  2Z6K C;  1PH3 A;  2F0G A;  1NJI C;  1NMF A;  1NR2 A;  2E2I B;  1GXD C;  4GN4 B;  4LF6 Q;  3SVM A;  3WOF A;  1UWV A;  2RSO A;  4R4O A;  1IL2 A;  1K73 C;  3IFD A;  3ZYY X;  1SYC A;  1XMO L;  1KRS A;  5IYD G;  1EQQ A;  5C4X B;  1NR4 A;  3CU7 A;  1HJP A;  1CA5 A;  2PMZ B;  1I4Q A;  2NN6 I;  1JC7 A;  4Q5V A;  3EN2 A;  4IPD A;  2NVT B;  2OQK A;  2B2U C;  2F0F A;  1KL9 A;  4ZCK A;  1LTA D;  3ULP A;  2UUA Q;  3TS2 A;  1FYC A;  1NBW A;  1UEA B;  1DOM A;  4A3C G;  1G29 1;  1C0A A;  4GS3 A;  2K1B A;  4XYQ A;  3S1R H;  1SYG A;  2JA9 A;  5FO8 B;  5J1Z A;  1LT3 D;  4JV5 L;  4BXX G;  5IWA L;  1MIU A;  3ER0 A;  3WWV A;  2DJG C;  1LT6 D;  4LF4 Q;  2L9H A;  3UDG A;  4AYB G;  2D0O A;  2B3G A;  2KOL A;  2VUM G;  3MXN B;  2WKD A;  2J7Z A;  5FKA C;  4IFD J;  1AZQ A;  2TMP A;  3SR1 A;  4M1U B;  4ALP A;  4BBR H;  1SR3 A;  1PFM A;  4DR2 L;  4IUP A;  1RD9 D;  4Y52 H;  2A5H A;  3RZD H;  2QEJ C;  1B7Y B;  2QCP X;  1F77 A;  4JBK A;  3UE0 A;  1OXU A;  1GUW A;  2H5X A;  1YNN D;  3CRL C;  3Q22 A;  2SEB D;  4XT3 B;  1SDF A;  1VMC A;  1E1O A;  3W1G A;  4DK3 C;  4DV4 Q;  1SSO A;  3TME A;  5JJI A;  5LHY 1;  3PF5 A;  2QA4 A;  1SNQ A;  5C0X G;  3HOZ H;  3PO3 B;  1K8O A;  3KLS X;  1M1K C;  4P72 A;  2K50 A;  1B44 D;  3E0J A;  3OSO A;  4A3F H;  4GNX C;  3H09 A;  1HNX Q;  3K58 A;  2ZJP A;  3I56 A;  4B3M L;  3NUC A;  2KBN A;  4DV3 Q;  3BVG A;  1AE2 A;  1CZG A;  1MI2 A;  1KAB A;  2E2D C;  1L1O A;  3OYY A;  4OEL B;  4IUR A;  3TBI B;  4B3T L;  3GTJ B;  2Q8T A;  1S5E D;  3NQI A;  1SYD A;  4KY5 A;  2A68 D;  1JOK A;  1V1Q A;  1VQJ A;  5EKI A;  4AQY Q;  1Y1V G;  1Y1W G;  1YJW A;  2E5L L;  1QVG A;  1JWU D;  2O4X A;  1EYA A;  3ERO A;  4QUC A;  2G5D A;  1SNC A;  4KV6 A;  1IYU A;  4B9W A;  3CCE A;  5CV5 A;  3SHL A;  3U58 A;  3A8I E;  4B08 A;  5FJ8 H;  3HOY B;  2F0D A;  3W3A A;  2RQX A;  5FLX L;  5CV6 A;  3I8Z A;  3RN5 A;  1NY4 A;  4G57 A;  1YZ6 A;  1A2U A;  1HNW L;  2J4X A;  3GD7 A;  2ZXP A;  4J1M A;  3S1N B;  4A3B G;  2WAQ B;  1FL0 A;  4MTK A;  1TWC H;  5DLQ E;  4A3I G;  1O7L A;  1STB A;  1CA6 A;  1Y1V B;  1SMY D;  2LXK A;  3PMF A;  3GTO B;  2MJ8 A;  2B8F A;  4J8Q A;  4QL5 A;  4YCV A;  1XNQ L;  3G48 A;  4OWW B;  4QIW E;  4HJ8 A;  3HOU G;  2NVQ H;  2F0W A;  1BUV T;  4UHV A;  1I4H A;  1ET9 A;  1Z6H A;  3TSS A;  5LL6 X;  2D5D A;  4DA2 A;  3KF8 A;  1KLU D;  2M00 A;  1PXU A;  1VQN A;  4HJ9 A;  2QKI C;  4LW1 A;  5IT9 c;  4IJH A;  1W3S A;  2JA8 H;  1B1Z A;  1Q90 A;  2CKZ B;  2Y0S G;  2R61 A;  2JXM B;  1STH A;  4C3I G;  3IRB A;  2KHS A;  3T13 A;  4OO1 H;  2L12 A;  2A6E D;  1G91 A;  4JI2 Q;  1TR5 A;  4LF8 L;  4JI7 L;  3BZD B;  3F8T A;  4CDD C;  3CCS A;  2F0I A;  1YEZ A;  4N9P A;  1DJR D;  4POF A;  3RZO H;  1F9P A;  3JAM E;  2E2H H;  2GVB A;  3H0G G;  5M5W B;  2B63 B;  1G6P A;  5C6A A;  1XMQ L;  4KD4 A;  4CGY B;  4Y7N H;  1ML0 D;  1JR0 D;  3PF4 A;  1PFB A;  4FDB A;  2FMC A;  2VQF L;  3HOV G;  3CPW A;  2VNU D;  1BXT A;  2Z4H A;  4IO9 A;  4G7H C;  4OO1 G;  1CSP A;  1QB5 D;  4JW0 A;  4WJW A;  1IBL Q;  2PZW A;  3H3V C;  3R3O A;  1TQO A;  1P16 A;  4C3J H;  1B8A A;  4A3G H;  3J81 L;  3CQZ B;  1JOO A;  3DWQ A;  3K0X A;  4PV1 C;  3RMH A;  3MA2 B;  3RUZ A;  1IW7 D;  2F0N A;  1GUT A;  5KEE A;  4ZRZ A;  3H0G B;  1I4G A;  2E74 C;  5J3B A;  1KNE A;  2K5H A;  4DR5 Q;  1EZ6 A;  3QO2 A;  1A0I A;  2MFI A;  2JP1 A;  3VR2 A;  5NUC A;  2PNH A;  2RDF A;  4HCE A;  4BY1 H;  2PMZ E;  1SAP A;  2UXC Q;  3KF8 B;  1TY0 A;  2L0C A;  4UY8 C;  2EY1 A;  3GP7 A;  4A75 A;  3S16 H;  1IYJ B;  4NXM Q;  5FOB B;  2Q2T A;  1S5D D;  3E0E A;  1AN8 A;  5DEH A;  2RDG A;  5EGT A;  1N32 Q;  2F0V A;  1LAC A;  5CBA E;  5C4J H;  2F52 A;  4OEM B;  1KDB A;  4C2M B;  1STA A;  2Z1C A;  1WTP A;  5IYB G;  1OXT A;  4JI4 L;  2R93 B;  5EPJ A;  2EVB A;  4ABN A;  2EYM A;  1AZP A;  4FF4 A;  3GTM H;  4A3E G;  1OTC A;  5D3D A;  4WOR A;  4I7A A;  1KAW A;  3P7J A;  2NZ1 D;  5GAD C;  3JC6 6;  3L0O A;  4H02 A;  1Q7Y C;  1S72 A;  1OXV A;  4RHR A;  1LYL A;  1WTH A;  2JJQ A;  3X3M A;  2VB2 X;  4ZAI A;  3I4N B;  1N8R C;  4FVM A;  4XT1 B;  1CHP D;  1EOT A;  4CDE C;  3T53 B;  1STY A;  2JA7 G;  2NVX B;  3M9B A;  4OON A;  3NE5 B;  3K0Y A;  5CV9 A;  1EQT A;  4YHH Q;  3PUZ A;  2D9U A;  2J0T D;  3SK8 A;  1PTO H;  1TWA B;  4F87 A;  2SNM A;  1M8A A;  1ESF A;  4DK0 A;  4DUY L;  2KQ3 A;  2JEA I;  3S2H B;  2XRQ D;  4LF7 Q;  2L4N A;  2EYO A;  3LWE A;  1CFM A;  3TRZ A;  1SFO B;  1F2M A;  4ZYS A;  4XQN A;  2EE1 A;  1SYE A;  2X6L A;  5JOB A;  3G4S A;  3FKI G;  1MSG A;  1QG7 A;  4IOC A;  3S15 H;  4X65 L;  3GTL B;  4A93 H;  3M4Q A;  3PIO 3;  3QIA A;  1LTL A;  1K28 A;  4A3D B;  2KEN A;  1GUO A;  4DR6 L;  3BYY B;  3PO2 B;  1DON A;  4A3K G;  3KJP A;  3HS0 C;  1PYW D;  5FLM G;  1D8L A;  2B2U A;  2E5L Q;  4QB4 A;  4IUV A;  4MHE A;  3UI2 A;  2X6G A;  2JA6 B;  4RA8 A;  3T56 B;  1IHZ A;  3MXU A;  1YNX A;  2EJM A;  4CJ0 B;  1W6J A;  1KLG D;  5M5X H;  3K5O A;  2WAQ E;  4KD3 A;  3NSW A;  4TKO B;  1PMR A;  3T4A C;  4O42 A;  5BR8 Q;  2OTL A;  4HAE A;  4F7X A;  1MD2 D;  2K75 A;  1FNW A;  1C9O A;  3H94 A;  4A3L G;  1B4O A;  5GQO A;  3F2U A;  1N36 Q;  2K5V A;  4EX5 A;  5I9P A;  5IP7 G;  3CC4 A;  1HNW Q;  2EY5 A;  2VY3 A;  4TRD A;  2PI2 E;  4GKK Q;  4RCN A;  2ZJQ A;  1SN8 A;  4NXN Q;  4DV5 Q;  1WYD A;  3J80 c;  1A6X A;  1VQC A;  5K36 H;  2LS0 1;  4LK1 C;  3D4R A;  1TWH B;  1XNQ Q;  3OPO A;  5AFW A;  4EQN A;  4KHP Q;  2Z4I A;  4R9W A;  2N55 A;  4HMI A;  2PNR C;  1HFN A;  1IKM A;  2A69 D;  2FXQ A;  2QF7 A;  1I3Q H;  3CPF A;  2HQL A;  2MHV A;  3HOX H;  3TN2 A;  1MSH A;  2K28 A;  1RCV D;  1YNN C;  1KDC A;  1L0Y B;  3A7L A;  3PUV A;  1HNZ L;  3J81 i;  1HQM C;  2LMC B;  2CQO A;  4ZUJ A;  3VYT A;  2AUK A;  3PIP A;  3HFZ B;  4X62 L;  4XTC S;  1WCM H;  1G51 A;  4RAU C;  3KFU A;  1I6V C;  1HUN A;  5J22 A;  1SNO A;  3SEB A;  3D6C A;  3EJI A;  1RHP A;  2QEX A;  2JN4 A;  1B9N A;  3EVQ A;  4U67 3;  2B39 A;  3SK4 A;  3EQL C;  2LFN A;  3S2D B;  5GRO A;  3PQI A;  4GOP B;  4K8J A;  4OO1 I;  1H9K A;  2JA5 G;  2YU9 H;  4L6T B;  2QW7 A;  2K4K A;  4KKT A;  3OW2 A;  1CKM A;  2TSS A;  4POG A;  3CF5 A;  1TWF B;  2F1M A;  5I6W A;  1N33 L;  4RKB A;  5DM6 3;  1WCM G;  3A5Z B;  4RHS A;  5C3E G;  4UP7 A;  1RDP D;  1SND A;  4PZ6 A;  2F4V L;  4DR4 L;  3A8J E;  4GKJ L;  4IQZ A;  1R9T H;  2ZTE A;  3GTK B;  2ICE C;  5IGC A;  2ZJR A;  1SNM A;  3W5O A;  1IBM L;  2KA7 A;  3CCL A;  3HOW B;  2VQE Q;  1CTM A;  4ZLT F;  3I4M G;  1SRU A;  1PA6 A;  5C5L A;  1Q81 C;  1F9S A;  2I07 B;  1KDA A;  5LMN Q;  4J15 A;  5IP9 G;  4GN3 B;  2ALY B;  4DR7 L;  4K0K L;  3S14 H;  3SK5 A;  3CCR A;  1VQE A;  2DN8 A;  1ZYR C;  3SDZ A;  1SMY C;  3S1M B;  2PPB C;  4IOA A;  4UDU C;  1T9H A;  5ELO A;  4A3J H;  2R7Z H;  3JAM i;  3ERQ A;  5JJZ A;  4LUO A;  3M3Y B;  1E2W A;  4BBS H;  3HKZ E;  4C3H G;  4JI8 L;  4JC0 A;  2SNS A;  1I50 B;  1E2Z A;  2E2I H;  1MKH A;  3BG3 A;  1B9M A;  1E7Z A;  4DXF A;  3DWP A;  4A3M G;  3G6J B;  1CM9 A;  3BZK A;  1I6H B;  3IL8 A;  3AU7 A;  3D31 A;  3DEO A;  3Q8D A;  1KD1 C;  1PV4 A;  1QNU A;  3KUP A;  4RGM A;  4IFD G;  2BE5 D;  4JI3 L;  4EGV A;  1RTO A;  4PMW A;  4MN3 A;  2GN5 A;  2ATW A;  3CCQ A;  1EYC A;  1C48 A;  4KY7 A;  4HMJ A;  1VQ9 A;  1U0L A;  1QZH A;  2BH2 A;  4IPC A;  2I0Q A;  1CT1 D;  1II3 A;  5EBD A;  2GVA A;  5JVH 3;  1WTV A;  1MJE A;  5E7N A;  4K2K A;  4DKA C;  1ET6 A;  4AIM A;  4X3T A;  1CHQ D;  5AJ3 Q;  4I65 A;  2ZXO A;  3MXN A;  3EFX D;  2N3S A;  3L9A X;  2CW0 C;  4DAY A;  5C4X G;  4F88 A;  5IYD H;  4RGN A;  2NYZ D;  3GDE A;  4DAP A;  4DV7 L;  3K7A B;  1O80 A;  1PFS A;  1BNZ A;  5FO7 B;  3U9O A;  1J5E Q;  4LFA L;  2JYO A;  5JPM C;  3DXJ C;  3D6W A;  2PW5 A;  1W6K A;  1S5F D;  3PGZ A;  1EEF D;  1VCI A;  4X66 Q;  1ENF A;  2M9V A;  2HCI A;  1SE8 A;  4IPG A;  2EJF C;  3G7L A;  4A3C H;  4QUF A;  2R92 B;  3FPU B;  1RKN A;  4BXX H;  2X69 A;  3RLF A;  1QUQ B;  4DR6 Q;  1X55 A;  2F0K A;  3CRK C;  4AH6 A;  2ZT9 C;  1D7Q A;  5IYC G;  3HG9 A;  3M4O B;  5E3F A;  3PUX A;  1IBK L;  2VUM H;  2NBF A;  2UXD Q;  4HID A;  5FLX E;  1STE A;  3GTJ H;  4JPB W;  1B3A A;  1KRT A;  2CH4 W;  4G4K A;  4GOP C;  2EYJ A;  2UXB L;  1Y14 B;  4NKL A;  1C8C A;  1KNA A;  3DLL A;  1WTW A;  1S3O A;  3MWY W;  4JI5 Q;  2ASB A;  3X3N A;  5C3X A;  2NTS A;  2B29 A;  3TP7 A;  4H13 C;  1H9S B;  1SJE D;  2WP8 J;  3QB3 A;  2V1C C;  3PO3 G;  5C0X H;  3AEV A;  1K0R A;  1PH7 A;  1WI5 A;  1U4R A;  1BOS A;  2E75 C;  3MZ5 A;  4LFC Q;  4DV1 L;  3UE1 A;  4JOI C;  4BA1 I;  4DAY B;  1GOZ A;  2KHI A;  2HHH L;  1AFP A;  2O2L D;  3S1Q H;  2KCM A;  2Q2I A;  3SGI A;  4OX9 L;  4KMU C;  2OXP A;  1Q82 C;  1VQ6 A;  1P8L A;  1Y1V H;  4RMF A;  5C4Z A;  1Y1W H;  2WIN B;  2F0H A;  3DHQ A;  1I4P A;  1SMX A;  1HNZ Q;  5I6Y A;  3VYU A;  2HIV A;  1D6E C;  1G8Z D;  2NB0 A;  4GLA C;  3BDL A;  1UE1 A;  1YI2 A;  3FRP B;  1ZKO A;  5M5Y H;  3HOY G;  3ERS X;  3AQQ A;  4BY7 B;  1VQF A;  3EBE A;  1N34 Q;  1U9R A;  4PZ8 A;  1ESR A;  1XTD A;  2WAQ G;  4OXP A;  2EY2 A;  4A3B H;  1Q3L A;  5K5P A;  3MC0 B;  5TSS A;  4A3I H;  3OOC A;  3S9W A;  4OHJ A;  2CWP A;  2OF1 A;  3QG1 A;  1GHJ A;  3T1H L;  4X3K A;  3GV3 A;  1I4X A;  2SDF A;  3LX0 A;  3J81 E;  4FF3 A;  4JI6 Q;  3TS0 A;  4C1N I;  1JT8 A;  3HOU H;  2HQE A;  3CXC A;  2KCC A;  1PH4 A;  2F4V Q;  3I72 A;  1LTR D;  1TT2 A;  1RIP A;  3DUZ A;  4DV0 Q;  1HPC A;  3S1R B;  1PLF A;  2R7F A;  3V05 A;  3U4V A;  1JJG A;  2XRS D;  3VR6 A;  3MAQ A;  2K33 A;  4RFB A;  2RHQ B;  3AB9 A;  5JEA J;  1JOR A;  1PH5 A;  4K5W A;  1ZYR D;  1VQI A;  4EQO A;  3J81 j;  1GVP A;  4C3I H;  4K0K Q;  1KXL A;  1MGS A;  2F0J A;  4LFB Q;  1VQM A;  1QJO A;  4FNF A;  4BBR B;  1WD0 A;  4JI0 L;  1H9M A;  3A54 A;  3A56 A;  1GO3 E;  1VF7 A;  3RZD B;  4F8M A;  3AFQ A;  2AUJ D;  2ZM6 L;  5EAY A;  1PZK D;  3F2B A;  4P71 A;  5CV4 A;  1IYV A;  3NEM A;  3GTP H;  5DM7 3;  2D62 A;  3I4L A;  4R1J A;  2A69 C;  5ISR A;  3CHB D;  5ELF A;  3H0G H;  3T1Y L;  1YIJ A;  1ASY A;  2EJG C;  5IT9 E;  1S5C D;  5EPL A;  3HOZ B;  4G7O C;  4KJN A;  4C1N K;  4TSS A;  4YY3 Q;  4DR1 Q;  1PYB A;  3A8K E;  4A3F B;  3HOV H;  2AHO B;  3M7G A;  3CMA A;  5CYU A;  1YJ9 A;  5C3W A;  3BS1 A;  1U4M A;  5ELN A;  4JI3 Q;  4B3R Q;  3L2P A;  4ZK9 B;  1FJG Q;  3W1B A;  4R4I A;  4KJO A;  4P73 A;  1SE4 A;  3DEP A;  3OTO L;  3UDF A;  1K8A C;  5A2Q E;  2D0P A;  3DWA A;  4ME3 A;  2CW0 D;  2F0L A;  2KJX A;  2Q8I B;  3L7Z C;  2VXW A;  2IPK D;  1E2V A;  2KUM A;  3K81 C; 
#chains in the Genus database with same CATH homology
 1X65 A;  2JEB I;  1EOV A;  2A1A A;  3GTO H;  1Q12 A;  3K80 C;  5C44 H;  1CKN B;  2JK8 A;  1IZ6 A;  1YNX A;  1PHJ A;  4DV7 Q;  4B3S Q;  3M4O H;  4X62 Q;  3CCV A;  5M5X H;  1DGS A;  2EQS A;  2DUD A;  2WAQ E;  1M90 C;  5IE8 A;  1L2F A;  1X3F A;  2HIX A;  3LGJ A;  4YHH L;  4YY3 L;  3ULL A;  1I5F A;  4DV6 Q;  3J7A 5;  2I5H A;  4DR1 L;  4LF5 Q;  3TQY A;  2N49 A;  2ZTC A;  5BR8 Q;  2OTL A;  2K75 A;  1C9O A;  3PV0 A;  2EIF A;  3FP9 A;  4LUV A;  5GQO A;  3STB C;  2KHJ A;  1N36 Q;  2K5V A;  4EX5 A;  5IP7 G;  5IYB H;  4QGU A;  3J80 i;  4A76 A;  1E22 A;  2VY3 A;  4YWK A;  1K8G A;  1KC8 C;  3CC4 A;  1HNW Q;  3PSI A;  2PI2 E;  4DNI A;  3CCJ A;  3EIV A;  4LF7 L;  3GTQ H;  4OWT B;  1Z47 A;  4GKK Q;  3M4P A;  2BA0 A;  1XJV A;  1SN8 A;  2ZJQ A;  3F1Z A;  1WYD A;  3J80 c;  3I4O A;  4DV5 Q;  1SRO A;  2I5L X;  4O0A A;  4A3E H;  1VQP A;  1O7I A;  1VQC A;  4B3R L;  3E9I A;  1E24 A;  4A3J G;  1AH9 A;  1FJG L;  3KF6 B;  2R7Z G;  3KOJ A;  4JG2 A;  1XMO Q;  1EQR A;  5C44 G;  4BBR G;  3S2H H;  1XNQ Q;  4L5S A;  4OWX B;  4DV2 L;  1VQ5 A;  4KHP Q;  2Z0S A;  4L5Q A;  1N33 Q;  4BBS G;  1CKO A;  4MZ9 A;  2FXQ A;  1I3Q H;  1UE6 A;  3CPF A;  3I4N G;  3G6E A;  2HQL A;  4DR4 Q;  3HOX H;  3CD6 A;  4GKJ Q;  3CCU A;  2UUB L;  1HR0 L;  2JA7 H;  5M5W H;  2B63 H;  3NEN A;  1K9M C;  1LUZ A;  5IY0 A;  4DUZ Q;  1IBM Q;  4JI1 L;  3HOZ G;  2CCZ A;  3GTG H;  1VQL A;  4DK6 C;  1HNZ L;  3PUV A;  1I94 L;  1CKN A;  1SLJ A;  2UU9 L;  4QY7 A;  1VS0 A;  3J81 i;  4A3F G;  3PIP A;  2CQO A;  4UP9 A;  3NEL A;  1HZC A;  3HFZ B;  2BH2 A;  4B3S L;  4XIG S;  4X62 L;  4HJ5 A;  1PVO A;  4XTC S;  1WCM H;  3J81 c;  1G51 A;  3ULJ A;  5GAH C;  3KFU A;  4JV5 Q;  4DR7 Q;  3ZJY C;  5IWA Q;  1BBW A;  1VQD A;  4LF5 L;  2JA6 H;  3KYH C;  1X3G A;  3D0F A;  1N9W A;  5BR8 L;  4GLV B;  3UDX A;  2QEX A;  2K14 A;  3CQZ H;  1N36 L;  3UDI A;  1JE5 A;  3I7F A;  1NJI C;  4JBJ A;  4NXN Q;  2Z6K C;  1PH3 A;  1K83 H;  1NMF A;  4GN4 B;  4GN5 A;  1XPO A;  4GKK L;  1Q46 A;  2BH8 A;  4NPS A;  4NXN L;  5C0X I;  4DV5 L;  2VZA A;  2WB1 E;  5GRO A;  4GOP B;  1HZB A;  4LF6 Q;  4DR2 Q;  1UWV A;  4R4O A;  2JA5 G;  2YU9 H;  1IL2 A;  3FKI H;  2K4K A;  3KF6 A;  4JI8 Q;  3OW2 A;  1K73 C;  4IFD I;  4WJ4 A;  1XMO L;  1CKM A;  4HIO A;  4A3D G;  2IX0 A;  1JB7 A;  1IXR A;  1KRS A;  5IYD G;  1EQQ A;  4KHP L;  3PO2 G;  4POG A;  3CF5 A;  1N33 L;  4OO1 I;  1HJP A;  4A3K H;  1QVC A;  1WCM G;  3A5Z B;  5C3E G;  5FLM H;  4UP7 A;  2F4V L;  2NN6 I;  2MO0 A;  4PZ6 A;  3RR5 A;  4DR4 L;  3EN2 A;  4IPD A;  4GKJ L;  5FJ8 G;  2OQK A;  2ZTD A;  1R9T H;  2ZTE A;  2JA6 G;  2N8N A;  1KL9 A;  2ZJR A;  4X64 Q;  4HJA A;  1WFQ A;  4O2D A;  3W5O A;  4DUZ L;  3ULP A;  4JBW A;  1YHQ A;  1IBM L;  2VQE Q;  2UUA Q;  3CCL A;  3TS2 A;  1YHB A;  1VQH A;  1NBW A;  3STB D;  1JJC B;  4B3M Q;  1PH8 A;  3I4M G;  1SRU A;  4A3C G;  1G29 1;  1C0A A;  4GS3 A;  1WOC A;  1PA6 A;  1Q81 C;  3F2C A;  4B3T Q;  1Q1E A;  1L1O B;  4C2M H;  3S1R H;  5LMN Q;  2JA9 A;  3CAM A;  4J15 A;  3G71 A;  2E2J H;  5IP9 G;  4GN3 B;  4A3L H;  2ALY B;  4BXX G;  4DR7 L;  5IP7 H;  1XPR A;  5IWA L;  4JCV E;  4JV5 L;  4K0K L;  2R93 H;  1V43 A;  4GLX A;  1MIU A;  1VQ7 A;  3S14 H;  2OTJ A;  3ER0 A;  3WWV A;  3CCR A;  4LF4 Q;  1VQE A;  2RHS B;  3NBH B;  4KLK A;  4AYB G;  5C0X J;  3CP0 A;  3UDG A;  4KI0 A;  1PH6 A;  2D0O A;  1BVS A;  2B3G A;  2VUM G;  3MXN B;  4IOA A;  1T9H A;  1K3R A;  5ELO A;  3VDY A;  4A3J H;  4IFD J;  2R7Z H;  3JAM i;  2KCT A;  4ALP A;  4BBR H;  4MNO A;  4GOP A;  4LF6 L;  1SR3 A;  4LUO A;  3KJO A;  4DR2 L;  4Y52 H;  4BBS H;  3HKZ E;  3JAM c;  4JI8 L;  3RZD H;  4R4C A;  1B7Y B;  4JC0 A;  4JBK A;  3I2Z A;  4YCU A;  3UE0 A;  1OXU A;  2E2I H;  2H5X A;  3I4N H;  1X54 A;  4IJL A;  1MKH A;  4LFA Q;  2JA8 G;  1E7Z A;  1E1O A;  3W1G A;  4DK3 C;  4DV4 Q;  4A3M G;  3BZK A;  2NVX H;  5JJI A;  3PF5 A;  3HKZ G;  2YTV A;  2QA4 A;  3D31 A;  5C0X G;  3HOZ H;  2AWO A;  2YYZ A;  3Q8D A;  1PV4 A;  2YV5 A;  1KD1 C;  5M3M H;  1M1K C;  1NMG A;  4P72 A;  2K50 A;  2E8G A;  1HZA A;  4DPG A;  4A3F H;  4JI3 L;  4IFD G;  4PMW A;  4X6A H;  4GNX C;  2GN5 A;  1HNX Q;  1JMC A;  2UUA L;  2VQE L;  2OWO A;  3B6Y A;  1TWA H;  4JOI A;  2ATW A;  2HT1 A;  2IX1 A;  3CCQ A;  2ZJP A;  2QGQ A;  5LMU L;  1TXY A;  3I56 A;  4B3M L;  2KBN A;  4DV3 Q;  1U0L A;  2R7D A;  1AE2 A;  1VQ9 A;  5JJL A;  1GD7 A;  1L1O A;  3OYY A;  1FVI A;  2NN6 G;  4IPC A;  4PG3 A;  1QZH A;  2I0Q A;  4B3T L;  1PYS B;  2AKW B;  3PUW A;  5LMN L;  4P74 A;  1SFO H;  4KHZ A;  2GVA A;  1IBK Q;  1A8V A;  1MJE A;  5E7N A;  3RNU A;  1V1Q A;  4DKA C;  4AIM A;  1VQJ A;  4TQU S;  5AJ3 Q;  4AQY Q;  2UUC L;  4LF4 L;  2IT1 A;  1Y1V G;  3BJU A;  1Y1W G;  1GKH A;  3T1Y Q;  2JA5 H;  1YJW A;  2E5L L;  2N3S A;  4JYA L;  1QVG A;  2UXB Q;  1NE3 A;  3F2D A;  3CCM A;  3GTL H;  1HZ9 A;  5M3M G;  4DR3 Q;  2WFW A;  4A3D H;  1GM5 A;  5C4X G;  1PH9 A;  5IYD H;  1ASZ A;  3PO2 H;  4A3G G;  3GDE A;  4DV7 L;  3S1M H;  4A3L G;  4IPH A;  1PFS A;  1WJJ A;  5C3E H;  2EXD A;  3CCE A;  5GAE C;  1J5E Q;  4LFA L;  4DV6 L;  4TVA B;  3U58 A;  5FJ8 H;  4DV4 L;  3CME A;  3PGZ A;  4X66 Q;  1VCI A;  3RLN A;  1VQ4 A;  3HOW G;  3RN5 A;  4LF8 Q;  1NY4 A;  1HR0 W;  1YZ6 A;  1I50 H;  4JI7 Q;  1HNW L;  3GD7 A;  1KQS A;  1E1T A;  1FL0 A;  4A3B G;  1SE8 A;  4IPG A;  4DV1 Q;  4BA2 I;  1UE7 A;  3I4M H;  4A3C H;  3MEF A;  1TWC H;  5DLQ E;  3OTO Q;  3FHW A;  4QJF A;  4BY1 G;  4A3I G;  2HHH Q;  3CC2 A;  1I6H H;  1H95 A;  1YIT A;  1XMQ Q;  1TWG H;  5IP9 H;  2LXK A;  4BXX H;  1XNR Q;  4DV3 L;  1LM0 A;  4OX9 Q;  4QL5 A;  4YCV A;  1XNQ L;  3RLF A;  1QUQ B;  3G48 A;  1YHA A;  4DR6 Q;  4OWW B;  1X55 A;  4L5T A;  1D7Q A;  4MTN A;  4AH6 A;  5IYC G;  1RL2 A;  2VQF Q;  4QIW E;  4R4Q A;  4HJ8 A;  3HOU G;  5GAG C;  3PUX A;  1IBK L;  3U50 C;  2VUM H;  1Q8K A;  2XGT A;  1B70 B;  2NVQ H;  2UXD Q;  1X9N A;  1TWH H;  4HID A;  5HY6 A;  5AJ3 L;  3A74 A;  3GTJ H;  1KRT A;  1X6O A;  4A4I A;  2Y0S E;  4GOP C;  4C3H H;  1Y14 B;  2UXB L;  1VQN A;  4HJ9 A;  4LW1 A;  1JJ2 A;  2Q2H A;  3DLL A;  2CFM A;  1S3O A;  5IT9 c;  1BBU A;  4IJH A;  3A0J A;  1W3S A;  2A19 A;  4JI5 Q;  2ASB A;  2JA8 H;  2LXJ A;  4AYB E;  2CKZ B;  4A3M H;  2B29 A;  3HKS A;  4LF9 L;  5HGQ A;  4HJ7 A;  1QVF A;  2Y0S G;  2MO1 A;  3KLW A;  4YWM A;  2WP8 J;  2V1C C;  3IRB A;  1J5E L;  1VQK A;  3AEV A;  3PO3 G;  4WJ3 M;  2LSS A;  1K0R A;  1V9P A;  4X66 L;  1PH7 A;  2Z6K A;  1YVC A;  1WI5 A;  4JI2 Q;  4LF8 L;  3S17 H;  4JI7 L;  3T1H Q;  4UPA A;  3F8T A;  1EYG A;  1OXS C;  2K5N A;  3CCS A;  4LFC Q;  4DV1 L;  3UE1 A;  1YEZ A;  2C35 B;  1EWI A;  4POF A;  4JOI C;  4BA1 I;  3RZO H;  4DV2 Q;  4DAY B;  2E2H H;  1J6Q A;  2GVB A;  2KHI A;  3H0G G;  1EIF A;  2HHH L;  1G6P A;  3S1Q H;  1XMQ L;  1PH2 A;  4Y7N H;  2KCM A;  2Q2I A;  1L1O C;  2K52 A;  3SGI A;  3CC7 A;  1Q86 C;  1EUJ A;  1HH2 P;  1QUQ A;  3PF4 A;  4OX9 L;  1OXX K;  1A63 A;  4FDB A;  1VQ8 A;  1VQA A;  4UP8 A;  2L15 A;  3I55 A;  1Q82 C;  1VQ6 A;  3S2D H;  2VQF L;  1P8L A;  1Y1V H;  4RMF A;  3CPW A;  1Y1W H;  3HOV G;  2VNU D;  1W2B A;  1S40 A;  2ID0 A;  5H1S E;  3M85 A;  4IO9 A;  1SMX A;  4OO1 G;  4JI4 Q;  1CSP A;  2RCN A;  1I94 Q;  1HNZ Q;  2UXD L;  1IBL Q;  2UU9 Q;  5C4X H;  2HIV A;  4X64 L;  4GNX B;  1TWF H;  4C3J H;  1P16 A;  4GLA C;  3J7Z C;  1B8A A;  1UE1 A;  4A3G H;  3K0X A;  4LNQ A;  5M3F H;  1VQG A;  2I5M X;  1YI2 A;  5M5Y H;  2MQH A;  2NVT H;  3HOY G;  3ERS X;  3KDF A;  4JI5 L;  3TRE A;  3GTK H;  2F3I A;  3AQQ A;  4JI0 Q;  1E3P A;  2BA1 A;  1VQF A;  3EBE A;  1N34 Q;  1AE3 A;  1KIX A;  3HOW H;  4PZ8 A;  5J3B A;  1XTD A;  2K5H A;  2ZM6 Q;  4DR5 Q;  4A93 G;  2WAQ G;  2JQO A;  4OXP A;  1U5K A;  4A3B H;  1A0I A;  2MFI A;  4APV A;  2A8V A;  4HIM A;  3CW2 C;  2PNH A;  4A3I H;  1MJC A;  4JI2 L;  4BY1 H;  2PMZ E;  2R92 G;  2UXC Q;  2CWP A;  3T1H L;  1EFW A;  3KF8 B;  4LFC L;  2N78 A;  4UY8 C;  2NVY H;  4A75 A;  3S16 H;  1KHI A;  2MNA A;  1IYJ B;  1VQO A;  4NXM Q;  4JI6 Q;  1VQB A;  3TS0 A;  2Q2T A;  4QQB X;  5IYC H;  4L5R C;  1X3E A;  3M7N A;  1JT8 A;  5M3F G;  3HOU H;  3CXC A;  1PH4 A;  3E0E A;  2F4V Q;  5LMN W;  4HIK A;  2VW9 A;  4JBM A;  3H3V H;  1X56 A;  2PQA A;  4DUY Q;  1QZG A;  3PCO B;  3ICE A;  1N32 Q;  3PIO A;  5C4J H;  3M3Y H;  1RIP A;  1UEB A;  2F52 A;  4DV0 Q;  2DGY A;  2R7F A;  3U4V A;  1JJG A;  4RG1 A;  5IYB G;  3A5U A;  1YBY A;  1OXT A;  2XTI A;  4JI4 L;  2CWA A;  1IBL L;  4GNX A;  2RHQ B;  3PUY A;  5JEA J;  2YTY A;  1NTG A;  3U4Z A;  4A3E G;  1PH5 A;  1OTC A;  3GTM H;  4LUZ A;  1HNX L;  3GO5 A;  2OQ0 A;  2IY5 B;  5K36 G;  1VQI A;  3J81 j;  1GVP A;  4C3I H;  1KAW A;  3PO3 H;  4X65 Q;  4DAM A;  4K0K Q;  1KXL A;  2NZH A;  2VS1 A;  4LWC A;  1VQM A;  4LFB Q;  5GAD C;  3JC6 6;  4JI0 L;  3L0O A;  4H02 A;  1Q7Y C;  1A62 A;  1GO3 E;  1OXV A;  2IHE A;  1S72 A;  1N34 L;  1LYL A;  2JJQ A;  3AFQ A;  2ZM6 L;  4DR5 L;  5EAY A;  3HOX G;  3F2B A;  1N8R C;  4P71 A;  2YTX A;  4YCW A;  2IHF A;  3K8A A;  3NEM A;  1PH1 A;  1CUK A;  3GTP H;  4AQY L;  2JA7 G;  2D62 A;  4R1J A;  1YIJ A;  2ES2 A;  2B63 G;  5JJK A;  3H15 A;  3H0G H;  3M9B A;  1BKB A;  3T1Y L;  4BY7 H;  1ASY A;  3E9H A;  2UXC L;  5JEA G;  2R93 G;  4OON A;  2AWN A;  4DR3 L;  4YHH Q;  4YY3 Q;  3AFP A;  3PUZ A;  4DR1 Q;  1PYB A;  1Q1B A;  3KDF B;  4NXM L;  3K7U C;  4JI6 L;  2WB1 G;  1XPU A;  2OCE A;  3HOV H;  2AHO B;  2VL6 A;  3CMA A;  2AMC B;  3BZC A;  4PZ7 A;  4YWL A;  1YJ9 A;  3S24 A;  2JEA I;  1Z9F A;  4DUY L;  1FGU A;  1N32 L;  4LF7 Q;  5ELN A;  4DV0 L;  4NB3 A;  2NZO A;  4JI3 Q;  4LF9 Q;  3TRZ A;  1C7Y A;  1CSQ A;  4EQ5 A;  5FLX c;  4B3R Q;  3K7A H;  3RLO A;  3L2P A;  1FJG Q;  3W1B A;  4R4I A;  5LMU Q;  3AYH B;  3HOY H;  4P73 A;  3OTO L;  3G4S A;  3RN2 A;  4BY7 G;  3FKI G;  3H3V I;  3DM3 A;  3UDF A;  4IOC A;  3S15 H;  1EIY B;  1L0W A;  4R4T A;  1K8A C;  4X65 L;  2Q2U A;  1XNR L;  3S1N H;  2D0P A;  4P75 A;  2PI2 A;  3M4Q A;  2R6G A;  4ME3 A;  1LTL A;  4A93 H;  4LFB L;  2KEN A;  3BU2 A;  2PQA B;  2UUB Q;  4DR6 L;  2RF4 A;  3L7Z C;  2UUC Q;  1HR0 Q;  3TEH B;  3K81 C;  3KJP A;  4A3K G;  2JE6 I;  1UE5 A;  5FLM G;  1D8L A;  1YJN A;  2E5L Q;  2R92 H;  4JYA Q;  4JI1 Q; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...