1I3VA

Three-dimensional structure of a lama vhh domain unliganded
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
129
structure length
129
Chain Sequence
b'QVQLQESGGGLVQAGDSLKLSCEASGDSIGTYVIGWFRQAPGKERIYLATIGRNLVGPSDFYTRYADSVKGRFAVSRDNAKNTVNLQMNSLKPEDTAVYYCAAKTTTWGGNDPNNWNYWGQGTQVTVSS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ANTIBODY VHH LAMA DOMAIN
publication title Lateral recognition of a dye hapten by a llama VHH domain.
pubmed doi rcsb
source organism Lama glama
molecule tags Immune system
total genus 32
structure length 129
sequence length 129
chains with identical sequence B
ec nomenclature
pdb deposition date 2001-02-16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1i3vA00
4Y19A 4AM0B 4BZYA 1RULH 2IANB 4JPKL 4WEBH 4J4PD 5ANME 5FOBA 3LQMA 5DMKB 1QR1A 2V2TB 3BP6B 1JPSH 1IAKB 3BWAB 3IETB 3P4NB 3ZDZF 1MJJB 2BC4A 4KKLD 4LGRB 5DVNA 4APQC 3MMEB 5KVEL 3BKMH 3CDGB 3CVHB 5GHWL 1KN2H 3GI9H 4GMTH 2O61A 4OZHB 1Q0YL 1BZ9B 2J8UF 3ARDD 4UNVA 5IJKA 1MCPL 5J89A 2DQCH 1I8MB 4EZMA 3QWRA 5AZ2H 1EVUA 3CLFL 3NA9L 4PJAA 4UV4L 5A2JH 3BPCB 4N8PA 5T1LB 4PRHB 1KEGH 2IGFL 3X11A 2H26A 3BE1H 4KQ4L 4C56D 5HGHB 1BZ7B 5D1ZA 5FYKE 3S35H 4O58H 5IMLB 4Y0GA 3EYOB 3UO1H 1FN4B 5EC1A 1JGUL 2XTJD 4PREB 4JFFA 3B83A 1URLA 5GGRB 2YD4A 3VGFA 2CLVB 4YX2H 3C5JA 1TJHH 2HTKD 1QSED 1KUMA 3TIEB 3IDGA 1UADC 3LVEA 3TFKD 1JFQL 3NCJH 2JIXA 4GAGL 5DJAA 5FO8B 3NCEB 1P84K 4XCNB 2MNUA 4H88L 2CMRL 4CADA 3HG1A 2BVOA 4LKCB 5C0NC 1QG3A 3LKRA 5IGXH 3VXMD 4FFYL 3QCUL 4FQ2L 1JF1B 5TDOB 2AJSH 3O6FA 3OJDB 4FTVD 1CZ8L 2ICWB 3DBXB 1YY8A 3VH8B 3RUGF 2HJLA 4HPYL 2DICA 1A4KB 3FO2A 5D1XB 4HMEA 2GT9B 3TA3B 4NKMB 1OGAD 1J8HB 1Z2KA 2FJHB 2F5AL 1A3LL 3SGKA 1GZPB 3D87B 4YXKL 4OKVB 1NBYB 2XY2A 2H41A 5HYQA 1NEZB 2OXHA 1IM9D 1IJ9A 1BIHA 3D6GA 5F7EL 4QO1A 3VRIA 1A9BB 1G7MA 3VFSB 4P3CL 3KPRE 4G8IA 5KOVC 1MFCH 2A1WH 3EYVB 3FZUC 1G7LA 4OQ1A 1S7WA 2ATPB 3LHPH 3UTZA 1HXMA 4NM4L 1YN6B 4ZFGL 3UTPD 4Q2ZB 5DJ6A 4DN3H 2VABB 2GITB 3SDCB 5E24E 2AJZB 4PJFF 5FFLA 3JTSB 3RA7H 1W2KT 3RZWA 2R2EB 5DR5L 5I76B 2ZUWA 2DKMA 2JKXA 3KPPA 1JZ7A 4LLVA 2HG5A 3DRTB 4LARL 3HA0A 4XP1L 3ILQD 3MRRB 3G6AB 4YC2C 3MV7B 3DX7A 3GMPA 1JNJA 1OSZA 5IWLC 5E7FA 3V8CA 3MREB 3MR9B 3QIUA 2BX5A 5DTFB 3T2OA 4U1LB 1S78C 2ENYA 4WI4A 1N6QL 4GKSB 5DD3H 3MCKA 1OP5K 5DC9B 1GZQB 2AEQH 1R3JB 2GAZB 4KKCD 5H94A 1M1SA 3K7UA 4JRYE 3CZFA 4YXLL 5I1CH 3WJJA 2EKSA 2Y9RT 3CFCL 3H7LA 1MIEH 4DAGL 4CVZB 1YEKL 4OD3H 3OKLB 1RUMH 3GKWH 1J18A 4KPHH 4AL8H 4W4NA 1JI1A 4GKZA 3DETD 1RZ8A 4MA7H 1BBDL 3WFCL 2Z31B 5FF6A 3QNZA 4Y5XA 4ELMF 2W60B 3KLSA 3PIQB 4P3WA 2EDRA 4LSPH 3O3AB 3JTTB 5KS9F 2NPLX 1YN7A 3PDOB 5CIPA 4CKVX 2FLRT 3GSNL 3OV6A 4MSWA 4NRYA 2XY1A 1A47A 1JRHH 2A73B 1FL6B 4ZD3L 2A6JA 3OXSB 3CH1A 5HI5D 1MLBB 3FO0H 1KJ2B 1CLOH 3GSRA 1MHHB 1D6VH 3QZWB 3EZJB 3JXAA 3BD4A 2EYTB 3MRQA 4TVPE 4WEBL 1MHCA 4PJ9C 2IAND 1PFCA 2HP4A 4JHBA 2DTSA 3TYGH 5IQ9B 4NC1E 2V9QA 2XKNA 3RVWD 3LKPA 3QDHA 3MCLH 4K7PY 4X0KA 3VXUA 1BBJB 1GRWA 1KN2L 3GI9L 5I71C 4GS7B 3IDYC 4AENA 3TVMA 3QUZC 4KJYB 3RY4A 2DQCL 4CMHB 3WO4C 3GUTB 3MOBH 4BK5A 4AG4H 1R3LB 5AZ2L 2PO6A 3KNBB 3OKEA 3U9PH 1KJ3H 3GSVA 4B50A 1KEGL 3V6ZA 4PRHD 3BE1L 4EIZC 2PXYB 1HN1A 2BCKA 1G7HA 3HC3L 1KIPA 1BQHB 4O58L 3S35L 5EBWB 4F7MA 1T22A 3UO1L 2DB8A 1LHZA 1F3DJ 1HSBA 4JGUA 1AQDA 4NFCA 4QY8A 4G43A 4G6AC 3VXNA 3UJTH 1TZIA 3I6GB 3MBEB 4WUUA 3RIAF 4QNPE 1I7ZA 2B5IB 2PF6A 3ARBB 3QG6A 1EBAA 5HDBF 3VI3F 5K9KA 3REWB 4B41A 1CDHA 5JLZB 1XF5A 3DHJA 5I8EA 3TIDB 2DQJH 3AREA 4K3DH 4NQVA 4M93B 4DCQA 3G5VB 2B20A 1RUPH 5E03A 5D7IF 3PWVB 4NQEE 4BYHA 1XZ0B 4NP4H 3NA4A 4WI2A 1QFHA 2GSIB 4WO4C 5D1XD 3TA3D 1J8HD 1NGYB 4G42A 2P4AB 1CDBA 3G04A 1CG9A 4XMPH 3HLAB 1OB1A 3MRBB 2Q8AH 4ZQKA 3LQAH 2APVA 3RNKB 3VWJD 5IW1A 1UFUA 4F33B 4B5EA 5HI3C 3A6CH 3QUXA 4MAYC 1MFCL 2A1WL 3LHPL 4U3XA 1P1ZB 4MJIA 1RU9L 4IRSB 4KI5E 1P9MA 4JR9H 4ODVL 1CL7I 4JHWL 2MCPL 5IROA 3JBG7 3N0PB 2O93L 3SDCD 4XHJC 4WFHD 2K7QA 3RA7L 1E27A 4E41E 1KF9B 3S5LB 4P57A 3I6LE 4UIMB 2W07A 4JFDB 3N1MC 4JPIB 4XBPA 5FUCC 1C08B 3MYZA 1T1XB 5CJ5A 3MV7D 3QNXA 5DSCA 1JPGA 1ZHBA 3BVNA 4CUCA 4XX1E 3RDTB 5D96C 1WITA 5C8JB 4U6VH 2CGRH 5ADPH 4H26A 1U8NB 4X7EC 4L3AA 3QRFM 3NFPA 3QXUA 3T0EE 3VXSB 3WDIA 5DD3L 2EDJA 3FQWB 4B53A 3NGBC 4S0SD 1ORQB 2AEQL 2Z8SA 3SGDH 5IEKA 1S7VA 5I1CL 5B39G 3QDJB 4I9WE 1UXWB 3TM6A 1SBBA 5JUEH 1MIEL 4X9BA 1KV3A 1N7MH 3MRPA 4OD3L 1RUML 2FIKA 4ZO7A 3BD5A 4LBEB 3GKWL 4KPHL 5SWSB 2EDOA 4H5SA 3UAJC 2VL5B 5B38G 3ZT7A 4U05A 3ULSA 4FQIH 4MA7L 3QPXH 1F5WA 2X4SA 3U83A 4C54A 1Q9WA 4QRPE 1ACYL 4LSPL 3NZ8A 1T4KA 3HS0A 1PLGH 3O9WB 5C1MB 2WWKT 3DOSA 3MOQA 4LLQA 1KN4L 4ONHA 4Y16B 3W0WA 2AQ1A 2X09A 2H8PA 1FG9C 2NY6B 3AAZA 3MNZB 2ZG3A 2V5SA 1NCUA 4ODWB 3FO0L 1UGNA 3U0TB 1G1CA 1IVLA 1CLOL 4GRLB 2OJEB 1D6VL 5GISH 3TVMD 4NSKB 3MLZH 4WI5A 1AP2B 3D5OF 4KRPC 5DS8A 3QH3A 2FCBA 5FGCE 4QWWC 2ZG2A 2B0SH 1AY1H 1C5DB 4XPBH 3TYGL 3QNYA 1YPZA 5C07B 1IGCH 1GGBL 4OFYD 3MCLL 1JUFA 3RZCC 2XZQL 2WUBH 2EDXA 2GTWA 3P11H 3RJQB 1FO0L 4QF1B 5SX4I 1U8LA 2PCPB 4PJ7A 3ROLA 3K2UH 1K3ZA 3ZT6A 1S8DB 3S3SA 4PS4H 3MOBL 4PGJA 2VYRE 4AG4L 1KYOK 5HXMA 3C5SB 3MGAA 1EEYB 2AQ3A 3U9PL 1KJ3L 4NNPH 1C7TA 5D7LB 5B3NA 4LRIA 3O3BB 3UYPA 3DTXA 2PXYD 4OZIA 5LVEA 4ZDHB 2BXYA 4GAJH 2VDMH 4TUJA 2PR4H 3H9HB 1U58B 3CSPA 4H8WH 3LS4H 1FVCA 3QXAA 1F6AA 1AHWA 3MBED 4OGAD 3RRQA 4PJXB 3ARBD 5F97E 3SE8H 4TNWK 2DQJL 3HN3A 3K1DA 4OSUH 4K3DL 1UT9A 3PGDA 4I2XB 1RUPL 5ENWA 4KK8D 4I0CC 1DBMH 1RHFA 3KHQA 4OCRL 4CBPA 4JY5H 4NP4L 1M7DA 3QUXD 2IMNA 1OSPH 3HMWH 1KOAA 2HVKA 4OLUH 4Z76B 4UB0H 3ECBA 2XI9A 5T3XD 3FAXA 4W6YB 5H35B 2D7NA 2I9TA 1T66D 2Q8AL 4P4KC 1XF2B 4XCYA 3CCHA 4Z7WE 3DVNA 4L8BB 5I1AA 2YRLA 4LIQH 2PTTB 4JO2H 3SN6N 3A6CL 3F62A 3NOIA 4R7DB 1HEZA 1U9KA 2KQNA 2AJ3A 5DA4A 5KAQG 1T21B 4IRSD 1XGUA 4JR9L 3QIBA 1Q9OA 1SBSH 5T1DH 4G3YH 2UVFA 1OF2A 1OAXH 5F70A 3WFHB 5EBLA 1FNEA 4ZUTA 4GUPB 4N0UA 2NTFA 1UZ6F 4JFDD 2QR0B 3ETBF 1QEWA 3IDJA 1KCKA 3V6FA 3QFDA 3UZEA 4RWYL 3LQZA 1JNLL 1U93A 2E27H 3T3PF 1KJMA 4QNPF 2QHRL 1QFWI 3FQXB 4LLWB 5F9WB 2CUHA 2IPTH 4L8SA 4PTTB 1FVDB 1HHKB 1JHLH 1IEAA 2IALB 1TPXB 5ADPL 3KLHC 1W0WB 3INUH 4UUJA 4YPJA 5E6IB 1G9EA 4KK5D 1BQLH 3VXSD 3ZYZA 4L1HA 2V5MA 5J9PA 3ZTJH 2MQ0A 1RIVH 4QHUA 4IOFC 5KSVB 3QDJD 5ABDE 5JUEL 5LGJA 4IMLA 4QTHB 1N7ML 1RURH 3O2DH 4TSAH 3FCTA 5IKCB 3IU3B 3W0WD 3WFBH 5SWSD 5B4MD 1OHQA 2IF7A 4FQIL 3QPXL 3SDXA 3BI9X 3MSPA 4TSBH 1QBLH 2BMKA 5C08B 3TCLB 3S4SB 2XWBA 5EPMB 4B7IA 1QFPA 2Z0BA 1PLGL 3G08A 1D7FA 5B22A 3O9WD 5GS1B 3QXWA 4Z7UE 4Y16D 4R2GB 3V5HB 1CT8B 3ULUE 2NY6D 2DS4A 1TNMA 4M7KH 1S9XB 1NQBA 4WWKC 3RUGB 1YZZA 2HAZA 3WDHA 1HI6A 2X9WA 3MLZL 4OT1H 2E8YA 3G6JA 3KHOA 1XR9B 2B0SL 1AY1L 1NFIB 3IXTA 4XNMA 4XPBL 2GTZB 1IGCL 2LFGA 5C07D 3BPNB 1YDPB 4HH9B 5HBBA 4YPGA 2WUBL 4IRJB 4NHCL 1EEUA 1OTUC 3QEHA 1U8QB 2R2CA 4YHPB 1F3JB 2ZG1A 1SYSB 3HKFA 1KTDA 1GGUA 5I1DB 1QLEH 2VMFA 3WL9A 1S5HA 3OKNB 4NNPL 1DQJB 4JQXC 5D7LD 5IVXB 2FX7H 5HY9A 1ES0A 1NFKA 1E4KC 1BM3H 2RCSL 1HH6A 1PQZB 2YD7A 1TFHA 3EO1A 2VDML 2VLRB 2CR6A 4XC1H 4Z8FL 5JOPD 1RK0B 1HHHB 4H8WL 5DRZA 4EN3A 5C0AB 5IMOB 1U3HC 2LU7A 3FTGB 3NAAH 3H42H 3NZHH 3VMOA 3DUUB 1BVLB 5DHVA 1RZ7H 3SE8L 4LSVH 3VGGA 4G7VH 4MNQA 2HT4C 1JTPA 3FT4A 4OSUL 4JY4B 1KB5H 4YO0B 3UPCA 3RPKA 4GJTB 1DBML 2VDQH 4R0LB 1JHTB 4O5LH 1PW3A 2CIKA 1SJEB 3S7GA 3HMWL 3RI5K 2R9HD 4OLUL 4DVBB 1GAFL 2GCYB 4UB0L 2GI7A 1RPQA 2JCCB 2FWOB 1J88A 5JR1H 1FNGA 4HGWB 2AV1B 3P9WB 1XCQA 4O2EA 1TCRB 2X1QA 3N06B 5KS9B 1AGEB 4JO2L 3EO9H 4AEFA 3TO4C 1J11A 3MV9B 2R23B 4HUXB 3GSNA 1SBSL 5T1DL 4G3YL 4YR6A 2P49B 3DXAA 2BHZA 3NPSB 1OAXL 5I17B 3TNNA 3RTQA 1ZSDB 4JN2B 1VEMA 4OI7A 4OM1H 4FFVD 4NQXB 4OCXH 2XG4A 4JB9H 3AFLA 3BN3B 3VFRB 3IS1X 3HZMA 3UTSB 1S7TB 1CGSH 1J87A 1XF4A 2E27L 3P3YA 4KTEH 1F3DH 1U8OA 4MQTB 3HE7B 3RVXD 2VXTH 2IPUK 4Y4HA 5TF1L 2ESVB 2V9TA 2FJFA 2J8OA 1JHLL 2R15A 4HGMA 4JZJA 1HNGA 4LPTA 1E4WH 4MZ2A 5JORA 3CFJA 3INUL 5E6ID 1TETH 2DQFB 4JCMA 1KT2A 1P4LA 5I1LB 2QHLA 3R06A 1A1MA 3WKMH 3H9ZA 4ESKA 3DPBA 1NMAH 3JV5A 4H25A 1U3YA 1U8MA 3HAEB 1ZLUK 1UYWH 3RWEB 3BN9D 3O2DL 4TSAL 5JIKA 2AK1L 4KUZH 1CLZH 3WFBL 5T33H 1MCNA 3RNQB 3MRIB 4Z7WF 1ZOXA 3LB6C 4YDVB 1E6JH 3VFPB 5L6YH 4S11A 4P23B 1QBLL 3KLDA 5HVWA 3LS5L 3IFOB 3D2UB 4C57C 3V0AC 2R0LH 43CAA 2K3TA 2W9EL 4UAOB 4J8RB 1EHXA 1I3RB 4Y8AA 1S7SB 5DUBA 3TZVA 4JANA 4F58H 5IFAH 5JNYB 5DHYA 1ONQA 2W1NA 4M7KL 3U79A 3L3OA 1SJXA 1QQDB 4IOIA 4RQQB 1YECH 1X7QB 4OT1L 3X13A 3IJSA 4HBQA 2NY1C 1N0XH 1PKOA 3GSUA 1WZMA 3EYUH 5C2BH 1I9RL 1JI2A 4KHTH 1YA5A 2PYFA 1WZ1H 2L4OA 4F7PA 3GZKA 3P40A 1YY9D 3O8XB 1Z3GH 3BIKA 2FX8L 3MLXH 3O11B 4Z78B 4IRJD 2E7LA 3M17B 2FH8A 4XP9H 3QQ3B 1H3PH 3QEQE 1WBXB 3V4PH 1I7TA 3BDYH 4KRLB 5KVGH 4MCZA 5DXWA 4K3HA 3O3DB 3C8HA 5DD6B 2WM0A 1N5YH 3GMMB 2IPKB 1NKRA 3L3IA 5JW5A 4UT7H 3DO7A 4JFZL 2FX7L 2YPKA 3IJHB 3U1SL 5C0GA 3FT3B 5DK2B 1V8HA 5I0DA 4ONGL 5BMFL 1PGRB 4U1NB 1CK0L 4XC1L 2VLRD 2EH8H 4HIHB 3SKJH 1ETZB 4RGOL 1VHPA 4J6RL 5E9DE 4N5UA 1S7UB 3G5YB 1TNNA 5MP6H 3R1GH 3QWOA 1CL7H 4KWUA 3SCMB 4X9HA 5C0AD 3Q5OA 3CSBA 2N7BA 4QHMA 5GZOD 1WAAE 4Z7UF 3F58H 4UI2A 2Y1VA 3ZYJA 1RZ7L 4LSVL 1MFEH 3ULUF 4HWBH 2F53A 4G7VL 4G8EB 1VFBA 1CGVA 3GSOB 2IQ9H 1KB5L 3HPJB 1F8TH 2VDQL 2NX5A 2BZDA 1VEOA 4P3DA 4PG2A 2EDDA 2I07B 1KCVH 5C0EA 3EJZD 5DD0L 5DEFB 2ZNXA 2HFFB 3KPNB 4EUPB 1ZGLM 4R90H 5HHPB 4EOWH 3F7YA 4PYHA 5JR1L 2A9MH 4B7LA 5IB5B 1XIWA 1OD9A 5BV7B 1CICD 3KPRB 1D5MB 4X7CC 3HFMH 3BX7C 4JFPA 4XMLH 5GGVH 4J4PC 4MWFB 3VI4E 3EO9L 5EOCJ 2A6DA 3MV9D 1IGJA 1EAPA 5GS0D 2NMSA 4TTDD 2FNBA 3C9NA 4XXDB 1X4XA 2BJMH 3LV3B 4JFYB 4YAQB 3FO9A 3AS0A 1FV1A 1VFMA 4FOMA 3FKUS 4YDIH 3RL1B 3MLUH 4OM1L 25C8L 1UJ3A 4JKLA 2VUOA 4OCXL 4CU8A 3WHXB 4JB9L 4LEOB 1PVHA 5FB8B 3RQ3A 4RMTA 5E8PA 5TE4H 1ZVSB 5EWIL 4LEXL 3ROOA 5EO9B 1D6EA 4KTEL 1X5FA 5D2NA 3UTSD 3QI9A 2VXTL 3HE7D 3MV11 4ALAL 1ZXQA 5EUOB 2HJFA 3V0VA 1S7RA 2DBLH 3ZHDA 4BELD 2F8OA 4JRYB 3UROR 5J0BA 1TETL 4DJMA 2CXGA 4ZPVA 2GJZA 3SKMB 4RIRB 3JSSA 2DMCA 1NMAL 2BSTA 2HVJA 2ED8A 3STZB 3ZYOA 1HILB 3N50A 4R7NA 2BSSA 3IVKA 3S96B 3EKCA 4KUZL 3FQNB 1AIFA 1K85A 1CLZL 5T33L 2R0KH 3AXLA 3TZVD 2Q1EA 1E6JL 5L6YL 1H8NA 3SKNA 5MEPB 5F3HA 2ZUSA 5IOPB 3WE6A 4P23D 2IAMC 2A2QT 1BWWA 4KZDH 2R0LL 2X4NB 5MENE 3E6FA 4LCCB 4LGSB 1D9KA 2I60L 4V2BA 4CVXA 1X5AA 5L2JA 3T4YB 3WKNA 4NO2B 3LPWA 1R5WA 4F58L 5IFAL 5JZ7C 1N59A 3D25B 4UZGA 4HAGA 5MEOA 2D7OA 1T0MB 1CE6A 5EC2B 3LDBC 2W59A 4JO3H 1UG9A 1EFXA 1KLGA 1WBZB 4X80H 1JNNH 3R8QA 4FQQB 3RGVB 3U6RB 1NGWB 1YECL 3Q5YA 3S88H 2B7DT 3ZE1E 5DEGB 2VL4A 1HINH 3EYUL 5C2BL 5IEHB 4XP6L 4OCMC 1WZ1L 5HVHC 2CRIA 2R2BB 3N1PC 1H3UA 3MLVH 1Z3GL 3MLXL 5E6ZA 4HPOH 1VFAB 4HWUA 5ICZA 4G6MH 3FOLB 1TMCB 3VXPA 3U30B 3HTLX 4NJ9H 5BS0B 2ED7A 3V4PL 3BDYL 2D7MA 4M00A 4YHLH 1HZHL 1X5ZA 1RZGA 4OF6A 1UVQB 5C3LD 4HMCA 1CE1H 1WCBB 3OX8A 5FKPB 3WIHH 5IR1A 4UT7L 3ZLQC 1BD2B 5T3ZE 5BZDA 2XACC 2FEDC 1OLLA 5KSAC 1XGQA 5FHBH 2HH0H 3QJFB 4OLZH 5KVDH 1UM5H 3F7VA 2X89A 1I8KA 3OR6B 5HHNA 5MP6L 2XRAL 3R1GL 2A6KA 5I74C 1CL7L 3TESA 4ISVB 3SCMD 3DARA 3E8UH 1E28A 5C9KA 5C2UB 4FQHB 1I1AC 4JY6B 3F58L 1QRKA 1HSAA 4ORGA 5ESVB 1MFEL 4XAKE 2B8OT 4AEHH 4U1MB 1BOGB 1JE6A 4NC0B 3IF1B 2LTQB 3QFJE 3SDDA 2IQ9L 4IHOA 3MRKB 4LQ1A 1F4WH 1UB5B 4HV8B 1QFWH 3JWNC 4ZPTA 1MVUA 1T7VA 3V4VL 1JTTA 3KPMB 2ICEB 3NFSH 3L7FB 1KCVL 2BVPA 4LHUA 2FR4B 1S9WA 1W72H 3Q0HA 3RL2A 2D31A 3KPLA 4R90L 4EOWL 1KJVA 2NY0C 1M05B 2R2HA 4LCYB 2A9ML 4PLKD 2YPLB 3WLBA 3TN0A 1A2YA 4RGND 2OP4H 3L95B 1H5BA 3HFML 1NCBL 3BT2H 3KJ6H 2Q87A 4KKAD 4XMLL 5GGVL 5I66A 1B88A 1KFAL 3P4MA 5C0JB 1Z9LA 1FYTE 1HH9A 4GW5A 3QCTH 2UYLB 4TQEH 5F3BA 1T0NB 1CIUA 4YHNB 4ZAKD 4RA0C 5IB2A 1A6VH 4OZGB 3B5TA 1CFQB 1DUYB 4I8DA 3D85A 4I3GA 5L0QB 5D1ZC 1U6AL 4WFGE 2NY2C 3RHWF 3KYMA 5HD8D 1IAOB 3GMQA 3MLUL 1DQTA 4PRDB 4C55A 1TVDA 5HVFB 2QJDA 4PJCE 1C12B 3UPRA 3D3VA 1WAAF 5INCA 3T0AA 2CLZA 4XNUH 2FD6H 5FYJH 3GIZH 4Y4FA 4U3HA 4NRZB 4JRXB 2DBLL 5K33A 3M1BA 2LABA 3O4OB 4EI5B 1ZLVH 3STLB 4Y2DA 1Q0XH 5JW4R 4N9GA 4HKZB 2D3VA 1P69B 1QA9A 5IESL 3ZO0A 4BH8B 5EORH 3O6FC 2DI9A 4MJ4A 5LAXB 1CFSB 1KB9J 3UX9B 1NMBH 1S9VA 3AU1A 3VXOA 3LN4B 4YBHA 4MZ3A 1YYMH 1LP9A 2AV7A 1JPTH 2VIRB 3SGKC 2E9WA 1H3XA 4NOBA 1JZ3A 3FFDA 4HC1H 4LVHC 3NFNA 1I85A 3GRWL 4QRPB 2OYPA 4PR5A 4HS3B 3TBTB 5FECA 3OSKA 3I75B 3QO1A 1NC2B 3VI4F 5GSVA 4MXWL 3ILPB 2YWYA 1G6RB 1VEPA 4QXTA 5CSZA 4R4ND 3ZKNC 1T1ZA 4Q0XH 2YN5A 3MRLA 3SQOH 5SWZA 2J6EH 3SE9H 1FZKA 3DV6B 5T5NG 1C1EH 3PGFL 4G9FA 5EU3B 4PRNB 3VWJC 5HDLA 4TVPD 1NFDB 4JO3L 4E9LA 2NLJB 1OAYL 1JNNL 3BP7B 4HG4J 1DQQA 2Q76B 3DYOA 3MRCB 5FO9B 4LOUC 3UCRA 2EIZA 5TPWL 3S88L 4RFEA 5FYKH 4XMKH 1HINL 4P2OB 1U8IB 3P73A 1YNTA 2DYPD 3MYJB 1NUNB 1UENA 1YN6A 1ZE3C 3C2SA 3D69B 3R0NA 3FFCA 3MLVL 1PJ9A 3QIUC 3BH9B 1NDGB 4ETQB 2WWMD 4K94C 4HPOL 4PJGA 5IBTL 1FJ1A 4G6ML 4PGDA 1KCUH 1YC8A 1X44A 3J7HA 4NJ9L 4X6EB 5FYLH 5BS0D 1JVKA 2NXYD 4CU6A 5BOPA 2D9QB 2IWGA 5HYJA 2LE9A 4BZ2L 3WJJC 3WIHL 2FEEL 1LILA 3QO0A 1HCFX 4D9QE 1WEJH 1BD2D 4LLUA 3QDGA 5I16A 3T09A 3BOVA 2FSEA 4NQCE 1EV2E 4GO6B 4O2CA 5FHBL 3QXDA 4MNGA 4WW2B 2HH0L 1KCSH 4OLZL 5KVDL 1UM5L 5DK0A 5FDWB 1KTRL 4XXCA 4Y5XC 8FABB 2E7CA 2HMID 3EO0A 2V2WA 1CFTA 4QHNB 3VE0B 3E8UL 3EGSA 4FXGB 2PYEA 1W0VA 1OT2A 4M6NH 4AEHL 2AJVH 3LRGA 1A1OB 1CDCA 4M9PA 4NKOB 4R97B 1KPRB 1FAIH 2Y5TB 3MNVB 5F88A 4W81A 1QRNA 1F4WL 1QFWL 5CEYA 3VGAB 4PRBB 5BRZA 1EPFA 3ZE1F 3NFSL 3D39E 4OZFB 2Z9TA 3MA7A 1W72L 2W0FB 3PGCA 1SEBA 5C0BE 5I1EH 3O2DA 5DJCA 2YPLD 3HCVA 2OP4L 3FB8A 3MJ7A 3OXSA 2R29H 1F42A 3BT2L 3KJ6L 3TVMC 5ESAB 1K8DB 4HIIB 1SHMA 1UWEL 4KI5D 5E94A 3KJ4C 2PO6C 3QCTL 3MRMA 3OKOB 1QNZH 4ZSOE 4TQEL 4GSDH 2WW8A 4A2LA 1XAUA 4GG8A 2R69H 3O41B 1A6VL 1K2DA 5IQ9A 3GFUA 2VXSH 4TTGA 4X4YB 5KJRH 5EBMA 3LEYH 3QAZB 3FQRA 2E7HA 4M61A 1BP3B 2ZJSL 3VFTA 3I9GH 3O6KL 3CZJA 5EU6B 2X4OB 4KJWD 1BFOA 2H32B 4MDIA 2OTWB 4GH7B 1HNFA 4W6XB 4I5BB 1CFBA 5DGQA 3D0LB 5TGBA 3B9EA 3NBNA 3HC4H 2ZOLB 4XNUL 2FD6L 3GIZL 4GKOA 3B9KB 4O4YH 2J12B 2BOBB 4BFBD 4JRXD 5E8EB 3ULVC 4KY1H 2MHAB 2BDNH 3AREC 4EI5D 3I2CH 3MRHA 3ZKXB 1A4JB 3BW9A 4N5ED 3BGMB 5EORL 1J0KA 3MBEC 5JPMA 2C4FU 3P2TA 5HYSG 4R4FL 5JHLH 1IE5A 2YD2A 4A6YH 1NMBL 1X5JA 1UB6A 3DURA 3HUJB 2ICCA 5IMKB 4IDLA 1HOCA 1T0PB 1A5FH 1U2CA 2NY3C 4J3TA 3OKDA 3O45B 6CGTA 4JM2F 4M1GH 5IW6B 3ARFA 4CU7A 5GIRA 1NC2D 3VFOA 4PJEE 3QUXC 3NH7H 3IGAA 4N9OB 4NNYA 1FFPB 2VLJE 1P9MC 1LMKA 5IFHH 3SQOL 2YK1L 4RAUA 3SE9L 4PRIA 1C1EL 5EOCH 5GJSL 1LO5B 3PHOA 4XH2A 3A67L 3GI8H 1VADB 2NQCA 1LK3H 4XNZB 4Z18A 2GUOB 3CXHK 2OTUA 1VGKA 5E99H 3CUPB 1KB5A 2HN7B 4PJCF 3PDDA 3S8WA 5FYKL 3SGJA 4XMKL 1WTGT 2BHUA 4P2OD 4GW4A 5FGSA 3F5WA 3PNWA 4ZFOL 4HUWB 4JQVA 4UMGA 4LLYB 1MCSA 4PV8B 5IUSA 1KCUL 4M7ZC 4YLQT 3PV7A 4I4WA 3FN0H 1HQ4A 3MGOA 1SJHB 5GRXG 5F7HA 5HYEA 5D5ME 2NY4D 1SQ2N 5EDXA 3SJVE 4PLNC 4A2MA 2B2XH 4X8JA 1KENH 4JFEA 1WEJL 3MO1B 4KDWA 2OBGA 5DRNB 4CGTA 4GOSA 5A3ID 2ADGA 5C0CE 4X6DE 4NZUL 1OP9A 2YXMA 4L9LA 1KCSL 4AYFA 5K9OB 3EYFB 1BQUA 2NXZB 1GXEA 1FQ9C 5DC0A 2D0FA 2WIIB 1T04B 3VDCA 2DM3A 5FEBA 3RKDD 2JLLA 5F96H 3MRNA 1GPOH 1DN0B 2E9IA 5GXBB 4P59L 3CJJA 4BSVA 1Z0NA 4HEME 5BQ7A 3DYMA 3IFNH 2WBJB 1RUKH 4M6NL 2HJKB 2AJVL 1ZVYA 4NO0B 3OB0K 3UBXB 5IBUB 4RRPG 2EIEA 1FAIL 1OAZL 2VE6B 4EVNB 1E6OH 2IPUG 5GGVY 4MJ5A 3JV4A 3U0PA 1X5YA 3IDMA 1UM4H 1VB9A 3ELAT 4P4RA 1F2QA 5B8CB 5ESQB 4JLRB 4ZTPL 2GK2A 3DUSB 4GG6A 2VRAA 4M43H 4U1GB 5IW3A 5CCKH 1OM3L 3V6OA 4W68A 1QO3B 1RHHA 4HULB 1J0ZA 1OTTD 4J1UB 5EU4B 2VUYA 3ARUA 2AEIT 5I8CB 4OTXH 4P5MB 4MD4A 1CQKA 3AGVA 2QADB 4GSDL 5DJXB 5JA9A 1X6NA 5F7DB 4LRIC 2R69L 1L7TH 3CFDB 1ERNA 1JN6B 5BXFA 5JHDA 3LEYL 1Q94B 3RWCB 5GRJH 5D93B 1BHGA 4XP5H 4EI6A 3I9GL 1NLDH 4HS6B 1S9KC 4LF3B 5EU6D 1FNSH 3L5WB 5AYQA 1BF8A 2Z92B 4Z7VE 1AHWC 4DZ8A 3ESUF 2EYSB 1T1YB 2AJYH 5CJXA 3O3BA 3G9AB 4L3CA 1II4E 4KY1L 3U2SA 4U6YA 3I2CL 3T2QA 4PB9H 1F11B 2UY7A 3PABA 3B9VA 3C6LB 4LFHG 4WI9A 4GMSH 4U1JB 4WCYH 4A6YL 5FUZH 3C6SA 1LEGB 1XGTA 1L9MA 1MJ8L 4QTIH 1ORSA 1A5FL 1PZUB 3RPIB 3C5ZA 4X6BB 4BUHA 3PWUB 4GRWB 4M1GL 1P84J 2RHEA 4X6CE 4OV5A 4F3FA 5J1TC 5M94B 3WD5L 4R9HA 1W8NA 4CAGA 4TNWF 3NH7L 2C1PA 4PJHB 1R0AH 1R3KA 4Y4KB 3FQTA 4X98A 1T1WB 5IFHL 3PL6A 3QIBC 3VG0H 2P7TB 5ADOH 5EOCL 4DKFH 1HWHB 3GI8L 1U2HA 3ARWA 1LK3L 2G2RA 3D48R 5E99L 3B43A 2DLIA 1YQ2A 3SGEI 4NZTH 4Y5YB 1JZ5A 1MNUH 1LO0L 2YRPA 3JVGA 3UYRH 5HJ3B 1XGPB 4L8SC 1MH5A 3QEQB 4JFED 5JW4N 1T5WA 3HE6A 1O5DT 4HKXB 4JO4H 3VXTA 1TZHA 4HXAH 4X4XB 5LGHH 1INQB 1FCGA 1ZT4B 2HLAA 4OB5H 4OAWB 3WFHA 4FQPA 4F7EA 1B0GA 3BH8A 3VU2A 3GB7A 5DO2C 2X4UA 2QR0A 3Q3GA 5DYOB 2W0KA 2X05A 5CS7A 1PSKH 2ADJB 4L9DA 2NZIA 4OCSH 2B2XL 3BMVA 4Y5VB 2V7HA 1KENL 3BEVA 3RVTC 4ZYKB 1JYWA 3LKOB 1IMHC 5DQDH 15C8H 1KXQE 5DD1H 3LN5B 3RVUD 4KUCF 5E9DB 2ZSVA 4LDLB 1QR4A 2GK0A 4JKMA 3E6HA 2J8UA 4ZFZA 5IVZB 2MCG1 2LAAA 1L4IA 1HYSD 1ZV5A 4PJEF 1X3DA 2NXZD 4M3JA 2BNRA 4H1LG 4P99A 4APQB 1ACZA 3NCYS 5F96L 3BUYB 1GPOL 1JMZA 4P2RB 5EZLB 5FA4A 5C09E 3IFNL 5SX5H 1RUKL 4G8FB 2WBJD 5T5FH 4ODXA 4WI6A 3I84A 2EXWD 4NO0D 1MHPH 1LNUB 4J3UA 3KVQA 1E6OL 3MV8A 3PQYE 3T65B 5FCUH 3DX6A 3O81A 4NRXA 1UM4L 3BEWA 2NW3B 3OAZK 3HRZA 5F9JA 5TDPB 2NYYC 1S3KH 4X8XA 1QTYT 3BYTA 4WHTB 4UOJA 5CCKL 3STBA 2FGWH 2WZPD 3SBWA 4Q9RL 4WDIA 5DI8A 3O0RL 1WVZA 3UTTA 5IG7A 5E8DH 4GT7A 2D03H 3KDMB 3HZKA 4E5XB 5D5MF 1RVFL 4JFXA 4OTXL 2N7AA 4KROC 3QSKB 1KPVA 3WNKA 5GS3A 4Z77B 1CU4H 1TJGH 3UDWA 2QADD 3CXDH 4NQSB 2JK5A 1A7PH 5J12C 1KTLB 1L7TL 3WXVH 1SM3L 3BZ4B 2EDNA 3RY6A 1CIDA 4X6DF 5GRJL 3TYFB 2XXMB 3GMLA 4XP5L 4DGIH 1NLDL 3FONA 3MFGB 3T8XB 3CK0L 3CPLA 1FNSL 1KACB 4EN3C 4ZO9A 4OD2A 4FNLH 4PJDB 2ZUQC 5DUPL 1CFNB 1FVEA 2AJYL 4PJFA 1KEMH 4L4TA 3TH2T 1ZHNA 1R3IL 3J8F7 5F1NB 4TSCH 2DKSA 3ZTNH 3GBLA 4PB9L 4RISH 4BFIB 2R4RL 1XCTB 4JKWA 1G6RL 1TTFA 3BESR 1UQSB 4ONFL 4ZODA 1T5XB 1I7RA 3C6LD 4V1DE 3VFNA 4WCYL 3ULUH 5GZOC 1EO7A 2P47B 4JG0L 4AK1A 2I27N 1GJIA 5FUZL 3WIHA 3MUY1 3LD8C 3DUUA 5CZXD 1P7KA 5GGUA 2X7LB 4YC2B 2Z8WC 4RBPH 4ZUWA 3V4UH 1JGEA 3IKCA 2H2SD 1J7VR 1JWSA 4RFOL 3BQUA 3OF6D 3MNWA 1R0AL 2AK4A 3DIFB 4LCUA 5HHQB 5FK9B 2C5DC 3H3PL 2JJVA 2OMNA 4KZEL 1SJEA 4C56E 2F15A 3I50H 4YDLC 4AMKH 1EBPA 5CEZD 5ADOL 3TJHC 1MFBL 5CKAA 5JW3H 2FWOA 4DKFL 2XTJE 1CICC 3RI5F 1MAKA 3HE6D 2XFXA 3RTQC 4NHUB 4DKEH 1CDYA 4ELMA 3H7BA 4U1IA 4M6MH 2K9UA 3VGHA 1QSEE 3QQ9C 1J10A 1CGXA 2DI8A 2J4WH 2HKHH 2AKRB 4NZTL 4Z7VF 4YEFA 1MNUL 4R96A 1A7BA 2E5EA 4Y4HC 2WBKA 4LSQL 3LRSA 1W72A 2M2DA 2YD1A 1BJ1J 2DLFH 3X3GH 1DEEA 4HXAL 1J1XH 4JZJC 5T1KB 1RIUH 3VXME 3FO1A 5CBAB 4FTVE 5EO1A 2EIBA 5E00B 2EO1A 1PY9A 5F7NC 5IK3A 5AZEH 5CD5D 1OGAE 4MDJB 3DGGB 5F1IA 5F9DC 5J57B 1PSKL 5E2WH 1S7TA 3PJSB 5JDJA 5EA0H 3Q2CA 5DQDL 15C8L 4N1EA 4HX1A 5DD1L 3BPLC 5ID0B 1WCQA 4PJ9B 2PW1A 5DZOA 4IIQA 3X12A 5DJDA 4X6CF 4R3SA 1TVBB 3Q6GH 3PP3H 1MAMH 3VXRB 3FQUB 1D3CA 4OIAA 4APQD 5HYFA 3UTPE 1V3KA 1A6ZA 3BKCL 5ETUB 4NGHH 5I71B 3IDYB 5IFJB 3BRDA 5IF0B 4P2RD 3QFJB 3QUZB 3GJFH 4F7TA 3K4AA 5D7JA 1QVOA 4QOKB 3TZVC 1BVKB 2F5BL 4JVPA 3EFFB 2VERN 3BO8A 1MHPL 3O2VL 2X1OA 3BFOA 2P8LB 5IB4A 4UU9A 4NUJB 2SEBB 3P9LA 5FCUL 3OXRA 4JFHD 4NDMB 3CD4A 2ZOKA 1YMMB 1DUZB 1QZ1A 2W92A 3D2UA 4PGCA 5AUMB 4HQQH 4UILL 1MCWW 4FABH 1K4DB 5EZJB 1I3RA 4ODSL 1QLRA 5EU7E 3OR7A 1FYTB 2ITDA 3MRGA 5D7IA 2E7LC 4QRSA 5ANMA 1K5NA 1FCCA 3IAGC 3WN5A 1CS6A 1FNAA 4AEIH 1EGJH 1J0IA 2HWZH 1RUQH 2D03L 2P8PB 3PWJB 4X9IA 2QSVA 3DMMA 5DD5H 5GSRA 1X7QA 1EX0A 3VXQB 1CU4L 5C0ND 3QQ4A 3P0YL 1A7PL 2BVYA 2EEAA 2CO7B 2VDKH 1WT5A 3WXVL 1IAIM 3BJ91 2J6EA 2I26N 4UDUB 3TEUA 5KG9B 5D6DA 3M17A 4WO4B 2CJUH 3P0VH 1OWWA 4LP4A 5GGSY 1A7NH 4AIZA 5HYIA 4XPTH 4ONOA 4FNLL 4CRPA 5DFWH 2Q7YB 4F7CB 1ZS8B 2APXA 4WTXA 4IRZH 5J13C 5JQ6H 1KEML 5JA8B 3AS2A 4ZFOA 5CGYC 3ZTNL 2ATKB 4LNRB 4U1HB 2H9GB 3FZUD 4Z0XB 4MA8H 2KPNA 2UZYB 4RISL 5EU5B 2IANE 4WUKH 3KR3H 1ZHLA 4RMQA 4PG2C 1WIUA 2XA8H 4PJAE 2IJ0C 5A2FA 2BRQA 3LEXB 3ULUL 2Y25A 1LEKA 2MOVA 4U1SA 2F54B 4HKJA 2YC1B 2N4IA 1OLZA 1XIWC 1TCMA 5C0RL 2XN9B 2BSRA 4LLMA 3U7YH 3ZYIA 4UV7H 4JE4B 4KDTA 3S37X 5FYJU 3V4UL 1C16B 3LZFL 2UWEF 2CKBB 1U8JA 2BNQA 3SOBL 5L2KB 2XOTA 5D96B 3RX5A 2LU3A 2G5BB 1N64L 3D0VB 3I50L 3DX9B 1OQXA 5ICXB 1XR8A 3NGBB 5JW3L 5HHPA 3H9SA 1VESA 4RGNC 2BRRL 3FB5A 4KVCH 4BQBA 5EBGA 4DKEL 1WFNA 5JO5A 2ARJA 4G9DB 4QYOB 1UJ3C 3B2UC 1X5IA 4M6ML 3L5JA 3FT2A 2J4WL 1E0OB 4PJ5B 4NCC1 2HKHL 3L3KA 4K8RH 2FHBA 2CDGA 4PD4K 2OR7A 4WJ5B 4C59B 4IJ3C 4ZAKC 4GAYB 5D2NC 2RGSA 3P9MB 3QI9C 4KMTH 2WAHA 3AS3A 1PY4A 2DLFL 2YUZA 1UKTA 1J1XL 3QJHA 1MCJA 1RIUL 3G6DH 4XCEA 5ELIA 5T1KD 4F8QA 5T1MB 1TLKA 1R3HA 4KU1A 3WS3B 4KVNH 1OGTB 4MLIA 1AD9A 4WU5B 1JV5B 4K3GA 5CMAB 1A6TB 2P5WB 2KBGA 1QBBA 5E2WL 1ZT7A 1ZVSA 1J8HE 2WLZA 3CMGA 4RAVA 3T4AA 4K9EH 3KPSB 1FZOB 1JL8A 1QSFB 3GK8L 4K23H 3IJYA 4KRPB 5FYJD 4PJ9D 4U0QB 5H8DA 3DVGB 1P5VA 3Q6GL 3K46A 2EE9A 1AGCB 1MAML 1NDMA 3VFGL 3RZCB 3VXRD 4BFEA 1OTSC 5TH2B 4PP2A 2X4QA 4NGHL 5LWYH 1WF5A 1D9KC 4EDWH 4JGJA 4GKNA 3C08H 3ARVA 4WFHE 3F8UB 3QUZD 3ARSA 2WMPA 3QXTA 4QOKD 4EDXB 3MRFB 1DVFA 4HUMB 4N68A 5TFSH 4YHIA 4G8GB 5I8KH 3D39B 2XICA 1IL1B 3MV7E 3TT1H 2ADFL 5GGSA 2ZSWA 4CW1B 1YMMD 2MKLC 4YDJB 2ARWA 2YEZA 4HQQL 4A6YA 5E4IA 5IV2B 4NIKB 5IMMB 4G6AD 1IGYB 3L9RA 4YIQB 4XVUD 4I77H 4ZSOB 3LQAC 1INEH 4ODUA 4ZUVB 4EQ3A 2HWZL 1FFOB 1RUQL 1WBZA 2DWDB 3GSQA 2PW2A 1MWAB 5KSBB 3RGVA 4J3WA 4MJ6A 1FG2A 4QEGA 4ZUUB 4ZFFB 4MXVE 4I3RH 5KVFH 2PTVA 2VDKL 2AGJL 2OS7A 1MREH 3N1FC 1NAMH 1NGZA 3VFWB 1FFNB 5HHMB 3VRJA 1KIUA 4E42B 3AB0C 5EO0A 5JOFA 3U30C 5DURB 1JBJA 2CJUL 2NXYC 4L1DA 1CGUA 5CSBA 4WO4D 1DSFH 2V6HA 4Z95H 3S6CA 1N2RA 2LQRA 4PLJC 3ABZA 4XPTL 5FYLD 4P4KB 1A6AB 4XCCH 4IRZL 1M71B 5KOMC 5JQ6L 1NCAL 1R5VA 5HI3D 5LQBH 4HWEH 5C0FB 4Q58C 5BCAA 1AR1C 4HJGA 4OFDA 3SGEH 3SDDC 2C7UB 2P24A 4NKDA 1OP5H 4WUKL 4N90D 4OM0H 2BNQD 2CLRA 4KH2A 4QRTA 4LCWB 4OGZA 5LXGH 4JHZA 4BZ1H 4XHJD 4NUGL 3VFVB 1CF8L 4CN1A 4P9HH 2NZ9C 2F54D 3BHBA 4MXQC 1HQRA 5FA3B 3TN0C 2BK8A 3H9SD 4DUWA 2FGZA 4NQEA 3U7YL 1H5BC 2XN9D 5TJWK 3S5LG 3MCG1 2VLJB 3ME0A 3VFMB 4S1SH 4XCFH 1V3MA 3MRKA 4RMWA 4P0DA 1T80A 5L2KD 3U9UB 5CEXA 5EUKB 1ZGLB 4MNHB 1QD0A 2CRZA 1JZ4A 3OAYK 1F4YH 3MRJA 1XH3B 4HHAB 1JK8B 3QUML 4LRNH 4HGKC 4WI7A 3OHXA 4KVCL 2EE2A 2EDFA 4HLJA 3L95A 2EIDA 3W5MA 4LSUH 1UEMA 5T3ZH 3X14B 2DQDH 2X1WL 1IT9L 1EK3A 4K8RL 4PJ5D 4YWGH 5LCVH 1GGIH 4MD0A 2DIBA 1P7QA 1ZA3A 4UDTB 3BIAX 3KPOA 2Q86B 3W9DA 3UAJD 3V2AR 4UTBH 1Z9SA 2FECI 1UA6H 4KMTL 5HGBB 4Y4FC 3EDJA 5IHUH 4E41A 3TT3L 2EC9T 2A6IA 4X5XA 3I85A 1TVHA 2M1KA 3G6DL 2ADIA 1ZHKB 4Y2DC 5D5MB 1HHGB 4MHHG 4U6XB 3U46A 3SE4A 5DJ2B 1M6OB 2F74B 3QDMB 4KVNL 5F9OL 4YEEA 2Y4SA 4PJAF 1JIBA 4PRPB 4MJIE 2FLBT 4CDGC 2P5WD 4RDQG 5JXEA 5CWSA 5C0CB 5KN5B 5T3XE 4K9EL 4WWKB 1Y6KR 3DX8B 3L3DA 3EJJX 3KPSD 4K23L 3T0EA 1QSFD 1J5OH 2GSGB 1EFQA 3DWTA 3TBSA 1AQKL 1I85C 4KRPD 5EFIA 2AP2A 1PG7X 1SJVA 3KYOA 1NBZA 5DRWB 4YFEA 5GS2H 1IZJA 4WTZG 2EZ0C 2PETA 2DQUH 1QHPA 1NJ9B 3THMH 4H8WC 3L6FB 4ODBD 5AEAA 5HPMA 5LWYL 4EDWL 1XF3B 2WINA 3C08L 1BAFH 4Y1AB 4DTGH 1NEUA 2BP3A 4FMFA 4JFQA 4QRPA 3M8OH 4JFDE 5I8KL 3KXFB 1J1OL 4KTYA 4G8GD 3D39D 4MA3A 1NC4A 5C9JA 5HGDB 1U91B 3ILPA 3TT1L 1F6FB 43C9A 4NT6B 3EYSH 1E4XI 2CIIA 2Z4QA 1G0XA 1U95A 3GMNB 3VXSE 2EDBA 5GJTH 4LLDB 4HFWB 1DBBL 1N5AB 1U3HB 3FOMB 1L6ZA 1CR9H 3CFBA 4Q6IA 1RZIB 4LCIL 3QDJE 1F58H 1AKJA 5ICYB 4P2QB 4X7TB 1AC6A 4I3RL 4MX7B 2Z35A 5KVFL 3W0WE 5SWSE 1MREL 1NAML 2XWJA 4POUB 3GHEH 3DROB 5INDA 5HHMD 4IDJH 4ZUSB 5B39B 5DURD 3T1FA 4XXCC 3CSGA 4KQ3L 2B4CH 1DSFL 4RFNC 1VPOH 3OZ9H 3FRUA 2NY4C 4Z95L 1VACA 3EOAA 2OQJB 5DEZA 5BW7A 4XCCL 5DVLA 4PTUA 1QOKA 3HMXH 1OP3K 5A3IC 3KYNA 3S37H 3TO4B 2VLKB 4PY7B 5LQBL 3B3IA 1PYWB 4HWEL 2QQNL 1BX2A 2WLYA 3PP4H 5HHOB 2V17L 2OL3B 1U92A 3FAWA 1XFPA 2WIMA 3FHQA 2GEEA 5LXGL 1AGDB 2FYYA 4L29A 4LCWD 4XRCA 4BZ1L 5C07E 4DZBB 2ZUXA 5B38A 3HC0B 4G6FD 4P9HL 4XZUA 1D5BA 2JJTC 3LPGA 5LG1A 1HHIA 4OZIE 3S36X 4X6CB 1FGVL 4AZ8A 2EDQA 3WUWB 5IB3B 1I3VA 3BPOC 1MELA 1AD0A 1ED3A 1P2CA 1MF2H 1MUJB 1T2QH 5D7LE 1BFSA 4WV1A 1K3IA 4OZFA 3KLHD 3JWDH 1BFTA 4UT9H 1FL3A 1WLHA 1KNOA 4TVSa 1NBVH 4LRNL 4Z7WA 4D0BB 2JJSC 4BH7B 2V2XB 4HCRL 5JOPE 4IOFD 3REVA 1WBYB 2HFEA 4NWUH 1FLRH 4LSUL 5T3ZL 2DQDL 3EDKA 4XNXL 4HIIA 4XI5C 3TC9A 4RWHA 4YWGL 5LCVL 3MA9H 4L5FH 4CNIB 2G75A 4OF0A 4PJXE 4UTBL 5KZCB 3MV01 2AQ2A 1BMGA 5GRVK 5IHUL 2FL5B 4ELKA 1UC6A 3MLRH 4IEFB 3ZZ1A 4I2XE 1OD7A 3MJ8A 3RWIB 2YRZA 3AC0A 5CHNA 2BFVH 3KWWA 2R1XA 3QDMD 3VD3A 1A3RH 1TXKA 4PRPD 4OUUA 1QBML 5MERB 2XZZA 3Q5TA 1INDH 3DLQR 1Q9KA 5IIEA 2VZTA 3K80A 4NOFA 3FL7A 3FB6A 1JGDA 4OCWH 3BZFA 1J5OL 2HKFH 3OAUH 4MD5B 3JZ7A 4HJ0C 2NY1B 2C3HA 3ARFC 2LVCA 3A0OA 1J05B 2BOCB 1KIRA 2CXKA 2DQUL 1GGCH 3THML 1OTUD 1CBVH 3MUGA 3OGCA 3HR5A 4U6HB 1DDHB 1GHFH 4OF8A 3D18A 2DQTL 4DTGL 4P5KA 1LK2A 2FX9H 4Y1AD 4HWZA 4N0FB 3M8OL 2XWTB 4LLAA 3KXFD 5HHXH 4HK3J 1KULA 3NIDE 4JZNA 4IMKA 5C0DB 3SGJC 4Z7UA 5E1AB 2X4RB 1AO7B 3RU8H 5BVJA 3EYSL 3SEPA 1LO3L 4L3EB 2EH7L 4JQVC 1OW0A 4GXVH 1NGXA 4HIXL 3SDXE 2W38A 4NYLB 3P77A 5D9SB 4HUKB 1U3HD 4WW1A 3DI2B 4YGAB 3CUPA 2RIKA 3GSXB 1DLHA 1F58L 1BPVA 2DLTA 4P2QD 1N6UA 2VQ1B 4MQ7A 1OAKH 3OKMA 3ET9F 2DL9A 1WISA 3VG9C 4JAMA 5E70A 3GHEL 1MJUL 1Y18B 4OJFL 4NO5A 5CZVH 2VISB 4IDJL 4L9LC 3ARRA 4Z6AT 4OIBA 1VPOL 3FRPA 3GMOA 4K7FA 5D2LB 1G9NH 5I2IA 1S7XB 1FGNL 3DV4B 5IJVA 3HRPA 3O2WH 4Y7MA 3GSWB 3HMXL 4KKBC 3RVUC 4OLXH 3QT2A 4JPKH 3S37L 5EIVA 4QCIA 1JF6A 3F7RA 3TO4D 1CVRA 2VLKD 1U8KA 1HYSC 2VITB 1RFDH 2OI9C 4V1DB 1MCQA 3MLSH 3PP4L 2IC2A 4MMZC 5HHOD 3EYFA 4GXUN 1J8KA 3C8KB 4L8DB 1B0RB 3U4EA 3R4DA 5GHWH 1FYHB 2X70A 1A9EB 1HKLL 4BSWA 1Q0YH 3VGBA 3IAPA 1BIIA 2AEPL 3V6OC 2FJGB 4PJ8D 3T3ME 2P8MB 2PUQT 4FZEL 3MRDA 4M8QA 2IGFH 1YEIL 3OJVC 4I18A 1IQDA 1F2XK 2X41A 3PWLA 4QRRB 1MF2L 1T2QL 3BYYA 5B8CC 4LL9A 1JF5A 1JGUH 4PGBB 1MCIA 4WFFD 1ND0A 3JWDL 4UT9L 3WSQH 2OLDA 1WUNT 3U36A 1EEZB 5CP7B 5JW4M 3GJFA 3KYKH 4HIEA 2VLRE 3GJEA 1JFQH 1WZKA 2ITCB 1FLRL 4H88H 5C0AE 4MB5A 4XNQA 5K9JH 2R0WL 3MA9L 4L5FL 5D4QA 5J6GA 4HUVB 2FO1A 5TE6H 2DMBA 1QKZL 3HAEG 4PGEB 3LB6D 5KZCD 2RJMA 2JTDA 5CJXC 3QCUH 2VDOH 4FQ2H 1MLCA 1PG7H 4FTVB 4NCC2 3IAQA 2X42A 3MLRL 2IAMB 1GSMA 1L0YA 2YKLH 4ERSH 2W91A 5ISZB 3V5KB 1DBJH 5JMRA 5DJZB 1MAJA 3TBWA 2BFVL 4M1DH 3IYLW 4YXKH 5AD0B 2I9LB 2FZ3B 1MJ7L 1INDL 2JCCE 2Z92A 5E4EC 3LDBB 4I13B 1P4BH 5DJYB 4OZIF 5F7EH 2APFA 4WIQA 3MLWH 3RJDA 1RJLA 1QFOA 1E4JA 4P3CH 2HKFL 4UQ3B 3C5ZC 4JDZA 5A16B 5HI4C 2YD8A 5HSFA 5ID1A 2NY1D 3TWCH 2BVQA 3MV9E 5HVHB 3ORJA 3CC5B 1L0QA 4JFOB 1GGCL 2QSQA 1OVZA 1X5KA 3UTQB 1PDKA 2C3XA 3PL6C 3B9AA 4OFIA 3LN9A 5CZXC 1LE9A 1J86A 2FX9L 4LARH 3QQNA 3LKQA 2H2SC 4HKBA 4PJIB 5F6HI 2FHFA 5K9QI 1A6PA 3IFPB 5MEQA 2YBRB 5HHXL 1U8HB 3BXNB 1ZAGA 5DJ0A 3UTSE 4I0PA 1I7UA 5DJ8B 2VR5A 5KSAB 4PJXF 3RU8L 4CDHA 3DRQA 1AO7D 3JVGC 3EOYG 3E3QC 4L3ED 5DT1L 4PJBB 5E2TH 3HE6C 1YEDA 5CBEB 1D5ZB 2CDEB 2FB4H 4HDIA 3X3FH 3CFCH 1I1AB 3MFFA 4DAGH 5I9QC 3IDIA 3QPQD 3KPQB 4L4VB 1TTUA 1KPUA 2C9AA 3EDFA 1CGYA 1JNHA 3WNNA 5ERWB 1YMHB 1OAKL 1X5XA 3VMNA 4D0CA 1R5IA 2IQAA 1S7QA 4Y19B 2YHGA 5FOBB 1QR1B 3ZHLA 3QRGH 4X9FA 4WNQA 5IM7A 1N3NA 3QUMA 5CZVL 4X4XA 3E1F1 3GO1H 5F6HJ 1JZ6A 4YBQC 2NY0B 2BC4B 3UEZA 5J1SC 4HS8H 1IGTA 5EOTA 5ECJE 1OPGH 3S36H 3O2WL 3CX5K 3F7QA 2O61B 2V9RA 3EFDH 4YJZL 4U2YA 5C3TA 1CD1A 1CYGA 4OLXL 4XVTH 2IBZX 4LASH 4EXKA 1IM3A 4PY8I 5E9DA 4PJAB 3C87A 1RFDL 3RHWK 3MLSL 3X11B 2H26B 4V1DD 3RAJH 3NIDF 2A9NH 5F89A 1X4ZA 2NCMA 1WAAA 4J3VA 5E5RB 5D1ZB 4NKIH 2NY2B 1XGRB 5EC1B 4JFFB 4KKNA 1ZLUH 4OV6F 4C4KT 3IT8D 3C5JB 3QCVH 3NABH 3SDXF 1L7IH 1IC4H 3IDGB 4NPYA 3SBWC 5DJAB 1U3ZA 2JIXB 2R1WA 1H8OA 5FKAA 1C7SA 1LNUA 1FBIL 2WSKA 4CADB 3HG1B 2BVOB 4WEUD 3HC3H 5E8OA 2OMBA 4QRRD 2O26U 2AXGA 1BFVH 3UDWC 1BJ8A 2QQLH 4U1KA 3LKRB 3WSQL 4JKKA 4HK0A 4NNXA 3QIWA 3RY6C 2R1YA 3BP5A 3O6FB 5DZLA 3KYKL 1WC7A 4ZS7H 2J88H 1YY8B 3CSYA 2HJLB 1EHLH 3FO2B 3WS6A 4S2SA 3JWOH 1H15A 2H45A 4W70A 1VERA 2QQKH 5K9JL 2QTEA 1QLFA 4LVHB 5EH1A 1MI5D 2YZ1A 5TE6L 2APBA 1WV7T 1G7QA 1S9YA 4PP1D 2VDOL 3VRIB 1KTLA 1PG7L 1G7MB 3G5ZA 1VGEL 4G8IB 3UTZB 2YKLL 1G7LB 2IAMD 1S7WB 4ERSL 1K6QH 1HXMB 1NUFA 5HDQL 1DBJL 5ISZD 8CGTA 5EN2A 4M1DL 5DJ6B 3LH2H 1E4XH 1XGYL 4ZOBA 2EEBA 5JZ7D 3VWJB 4CMMA 3QUKA 1P4BL 5FOJA 3ISWA 4RGNE 3MLWL 2IFGA 5E2UL 3KPPB 3C2AL 4LLVB 2HG5B 3T3MF 4TULH 5KSUA 1NAMA 3I6KA 1IARB 4MB3A 5F1NA 3DX7B 3GMPB 1RU9H 1OSZB 3TWCL 3BQUC 5E6YA 4ODVH 2MCPH 4JHWH 3RIFK 1QBAA 2ZUYA 1G1YA 1NUGA 3QIUB 4PBWD 4D94A 4NCDA 3PV6B 5IVXF 1WZLA 3MCKB 1I1YA 3BP4A 1F6LL 4FQXA 5H94B 1P4IH 2W9DH 3CZFB 2EECA 7FABH 2EKSB 4LPYA 4P46A 1J0YA 4J3OC 3JV6A 5MENA 5DMYA 4Z7OE 4NFDA 3IDNA 3N1QC 4Z7NE 4GBXA 3O6LH 4NJAH 2FEDD 5L88H 4GKZB 4M48H 5KSAD 1RZ8B 4ZNCD 1RZKL 1I4FA 5EUOE 5FF6B 3QNZB 4Y5XB 5E2TL 3QULA 3KYAA 2O5YH 2FB4L 1YN7B 5CIPB 3X3FL 4MSWB 4NRYB 1KG0A 1I1AD 5IBLD 1L6XA 2A6JB 2VDNH 2Y36H 4L4VD 3CH1B 2JCCF 1UJTA 3CXHJ 2PTUA 3GSRB 4H1LH 2QLVB 3MRQB 4Y19D 4D8PA 1ACYH 1MHCB 3QRGL 1HKFA 4IIQC 5JTWA 5GZNC 5DA0B 3EOBA 1KN4H 4KK9C 2OL3L 4I48A 3CFEA 2DKUA 3GO1L 2XKNB 2KUTA 4W4OA 3LKPB 4OGXH 2NY0D 1MIMH 4HS8L 4K71C 4X0KB 4W6WB 3OMZA 1MHEA 3VXUB 1OPGL 3S36L 4AENB 1G7IA 3EFDL 3TVMB 3V0WL 1GGYA 5C6TH 5D7JC 4XVTL 4LASL 4MHHI 1P6FA 3H3KA 5DHXB 3KJ4B 2PO6B 3QWRD 3ARYA 3OKEB 1XMWA 3GSVB 5CJOH 1TITA 2X4TA 4NWTH 2ZWLT 4K3EL 1GGBH 3RAJL 2A9NL 1HIMH 2FECL 5I1JH 2BCKB 1G7HB 2VQTA 2XZQH 4G80A 1KIPB 3EYQD 3FQUA 4NKIL 1DBKH 4F7MB 5D1ZD 1T22B 2NY2D 4I1NB 1ZA6A 1FO0H 5L7XL 1HSBB 2J1KA 4JFFD 1VDGA 5IFJA 5AG9A 1AQDB 1H0DA 1MQ8A 4O2FA 4QY8B 4G43B 3VWKA 3QCVL 5FO7A 3VXNB 3W9EA 3NABL 3MROA 1L7IL 1IC4L 1TZIB 3QEUA 3WNMA 5BS0E 3SPVA 2JIXD 4WUUB 12E8H 3QHZH 3WN5C 1I7ZB 4HUUA 3QG6B 5K9KB 4XX1G 3HG1D 3DMMC 1XF5B 1BFVL 5I8EB 1BD2E 2V5YA 4OLYH 3AREB 2QQLL 4NQVB 4DCQB 1CCZA 1NCTA 3A6BH 5FM8A 1PKQE 1WT5C 1M7IA 3GEWB 2Z93A 4RX4A 5DWUH 4JM2A 4DUXA 4XVUC 4ZS7L 2J88L 3O6FD 5E2VH 1EHLL 5DMIL 5D6DC 5J7CC 2OR8A 3JWOL 3BAEL 3DVFA 2UUDK 4G42B 2QQKL 3G04B 1CG9B 2NY3B 1OB1B 4ZQKB 3FMGL 4YFLF 2RQ8A 1J12A 3MGTA 5IW1B 4X99A 4TN9A 2VXUH 4OCRH 3RWHB 1NCCH 3QUXB 4KJQD 5I19L 1K6QL 3ZKND 2GFBA 2VZSA 4MJIB 1IC1A 4ZTOH 3TCXA 4FFWC 4PJCA 1LD9A 5KG9A 2X5PA 1PZ5A 3LH2L 2G60H 1E4XL 2VZVA 4M1CD 3B9DA 2G9HA 1E27B 4O02L 3TBYA 4P57B 2WBWB 2YPLE 4XBPB 5D6CA 3IXAA 2BVTA 4GRMA 4TULL 4FQXD 4LOUD 5D71H 1U3JA 4KDTC 4MAYA 4PV9A 4G5ZH 4M6OH 3QNXB 5DSCB 1JPGB 1ZHBB 3BVNB 1EZVY 4N8CL 1U8PA 1ZWIA 4L8CA 1MPAH 5AG8A 1EJ6A 3QIUD 4GBXD 4H26B 4K55A 2R8SL 1OARH 3NFPB 4OZGE 4M7ZB 4FXKA 3PDGA 5IEKB 2YC1A 3HMXA 1P4IL 4NO3A 4RWYH 2W9DL 1JNLH 1S7VB 3TBVA 3ZSSA 2ORBH 7FABL 4OF3A 2QHRH 4PRAA 1C16A 1Y0LA 2A83A 3MRPB 5ACZA 2FIKB 2APWA 2VLLA 3O6LL 4NJAL 5L88L 4H5SB 1T83A 4M48L 4PG9A 3ULSB 4MVBC 2GJ6A 1ZT1A 1T03H 4JRXE 5SWQA 5IHZA 1VKXA 2X4SB 1Q9WB 1AXSA 4KGLA 1A6WH 4O51A 2O5YL 3WIIL 3L3JA 3NZ8B 3HS0B 1T4KB 5ILTL 4LLQB 4JO1H 2Z8RA 5A2IH 1FZJA 3DUHA 1FIGH 4RGMC 4ONHB 2BHYA 3W0WB 2EICA 2H8PB 2VDNL 2Y36L 3AAZB 4WJ5A 3Q6FA 2VWEE 2H3NA 2W0PA 4QT5A 3EOTH 1ULVA 5DS8B 3QH3B 4ZO8A 1FZMA 3ZKMC 4YBLC 2ZCHH 1XF1A 2VH5H 4CL7A 3QNYB 1YPZB 3WMSA 1GOFA 1B0WA 2GY7B 4OGXL 3UJJH 3CVHH 3T2PA 1MIML 2GTWB 3RWJA 4OZFG 4XWOC 5IVNA 3VXUD 3SO5A 1U8LB 4PJ7B 3ROLB 4NQCA 3FN9A 4K3JH 5C6TL 1N8ZA 2XPGA 1NFDE 1DVFC 1DQLL 4RNRA 2PO6D 5CJOL 4NWTL 1UXSA 1NAKH 4Z7OF 5E95B 1YUHA 1HIML 3DTXB 4LIQE 4Z7NF 5I1JL 3RWDA 4OZIB 4NHCH 1DBKL 2NW2A 5D70H 5DQJA 1UCBL 5ALBL 4ODTH 3V7MA 3M45A 4N1CA 4TUJB 5EUOF 3CMOH 2CK2A 4P48A 2VNCA 4DFHA 1IC7H 1FVCB 3QXAB 1F6AB 4DOHB 2K1MA 1AHWB 1NPUA 3GM0A 3N85H 12E8L 3QHZL 2OJZH 4DEPC 4WUUD 2EYRA 4NC1C 2Q8BL 2RCSH 5C0BA 4XBGA 1KCLA 2GHWB 3WEXA 4RMRA 4OLYL 3ULVD 4P2YA 3ARED 3A6BL 3PGDB 5ENWB 4Z8FH 4QXUL 5DWUL 1HXYA 1M7DB 1IQWH 1O7SA 2V7NA 3QWQB 5E2VL 2HVKB 4I3SH 1DR9A 4JZOA 4DN4L 4ZOCA 4NZRH 3V6BR 3RWFA 2A77H 2IH1A 2NY3D 2I9TB 2DN7A 4XCYB 3HZYA 1QPXA 3CCHB 4ZFFA 3DVNB 1P7HL 5I1AB 2VXUL 1NCCL 3DSFH 1HEZB 2Y23A 4DQOH 2AJ3B 3UZVB 1JWUA 1EXUA 3UC0L 3LSOA 4ZTOL 1GAFH 4FN0A 4MJID 1XGUB 2YUXA 3QIBB 1QFWM 1Q9OB 2G60L 3BZEA 3ZDYE 4RZCA 5ITBH 4MCYB 1DL7L 1D5XA 1OF2B 2FEEI 5GGTH 4F57H 1N0LA 1FL5A 5F44A 2HTLC 1DLFH 5EBLB 1FNEB 1AE6H 1K8IA 4N0UB 2NTFB 4ZUTB 1I3GH 5E7BA 3WIFA 4M4RA 2AI0H 3QUYA 1QEWB 3IDJB 1TTGA 3V6FB 3QFDB 1G7JA 3LQZB 5D71L 1U93B 4G5ZL 4M6OL 3V5DA 1KJMB 4K2UH 5DQ9A 4NZJA 3SO3C 4O9HL 5EZIH 4L8SB 1P53A 3IRPX 1MPAL 3VD5A 1IEAB 5DRXA 1RZJH 1OARL 4UUJB 4HXBH 2BNUA 4HAFA 2EXYD 4JCLA 2GJ6D 3PWPA 1M7XA 5J9PB 1MRDL 3G5XA 1HDMA 1F3RB 4QHUB 1A1NB 5C70A 4PJEA 2XA3A 2ORBL 5EU6E 5LGJB 4IMLB 3FRPG 4Z5RA 5J6HA 5TF1H 3FCTB 4OLVH 1QFUH 1K4CA 4JRWA 1UH4A 3IU4H 4KRMB 5DK3A 3SDXB 2P5EA 1T03L 4YHYC 3RWGA 2DQGL 1LGVA 3V95A 2MTPA 2BMKB 1A6WL 4UOW1 4MS8C 2XWBB 4WI8A 2MSPA 4F37K 3G08B 4JO1L 2XQYG 3SE4C 3CGTA 4QRUA 1FIGL 2C1OA 2AK1H 5B21A 1EDQA 1IEBA 4U7KA 3SKOA 2Y7QA 3HUJE 5CP3H 5JXEC 1KJ2H 2N56A 4NN5C 2VR4A 5CJ8A 1EO8L 3EDDA 2FHCA 2Q86A 4PGZA 3DECA 4LKXA 2DQHH 3EOTL 1HI6B 3T0EC 3L3GA 3LS5H 3P0GB 3KGRA 3G6JB 2ZCHL 4KI5F 1V7MH 5F93C 2VH5L 3QHFH 4TPRH 3IXTB 4Y89A 4XNMB 2W9EH 1EHAA 3SJVA 3MJGX 1B2WH 3UJJL 3CVHL 4YPGB 3QEHB 3BMWA 4BK4A 4OZGF 1LVEA 2CO6B 4X6DA 2OZ4H 5D1QA 1KTDB 4K3JL 2BSED 3IDUA 3WL9B 1S5HB 4KROB 1RJZA 4FHBD 3RP1A 3GGWA 5HYSA 1I9RH 1KLUA 3KAAA 3CFKA 1NAKL 2IH3A 5J12B 2DLGA 5HY9B 1ES0B 2FX8H 4AH2A 4XVSH 1A0QH 1HH6B 5D70L 3EO1B 4ODTL 4YFLI 1UACL 5IB1A 4OLWL 3DNKA 4JFEE 4M5YL 3CMOL 4E0RA 4XT1C 4Y88A 5H2BA 4G6KH 4HW6A 1NL0L 1IC7L 2WUCL 5DRZB 4PB0L 4EN3B 4D3CH 3KLAA 5M95B 1AGFA 3SDAA 5JDSA 2ZUQB 3N85L 3ARTA 2HFTA 2OJZL 4JFZH 2C3VA 5LKNA 4Q6IC 2VKWA 4YFDB 5DHVB 3U1SH 4F15C 5CJQH 4ONGH 4BQ6A 5BMFH 2H6PA 1CK0H 3FT4B 3QB7C 4EBQH 1JZ2A 4RGOH 4J6RH 3TV3H 3O4LA 3RX7A 1A3QA 3K81A 1RK1A 1IQWL 2CIKB 4D9RE 3ARGA 4X6FA 3QYCA 4I3SL 5T3XH 5C7XL 1YEHL 4NZRL 3LD8B 2XIDA 3NIFE 1FNGB 2A77L 2CK0H 5BW7C 5D7KD 1JPFA 1XCQB 3PWNA 4O2EB 5I73C 1ZLWK 5DGRA 1NSNH 3DSFL 1NFDF 4FQ1L 4DQOL 4Y2OA 1TQBC 5DD0H 4YNYA 4X5WA 4YDLB 4Z7VA 3GSNB 3QIBD 5ITBL 4YR6B 1JYVA 3DXAB 1YEGH 1CICB 5GGTL 2FRGP 3A6OA 3VGEA 3TNNB 3RTQB 3R0MA 4F57L 3F65A 1DLFL 4XPFH 1AE6L 2RFXA 1I3GL 3B8SA 2AI0L 3PWPD 2UV3A 4F2MA 3HZMB 4UQ2A 1XF4B 4K2UL 3PXJA 1Q1JH 4Y4HB 5EZIL 1PBYA 2FJFB 1JWMA 1V5JA 1ZKAA 4JZJB 4WV1C 1RZJL 5JORB 3CFJB 2YWZA 4HXBL 4RRPA 25C8H 3T0WA 5GRUL 2P5ED 1KT2B 1P4LB 4C83A 4PJ8C 3R06B 4KV5E 2VC2H 5BJTA 1A1MB 4OI9A 4WW2F 5EWIH 4LEXH 3OB0H 5DO2D 4R8WH 4Q9QH 1Q8MA 4H25B 1V7NH 1U8MB 5J4MA 4ALAH 4OLVL 3RVTD 2R39A 2VZ1A 1QFUL 3BPLB 5I1KL 2VR9A 1SMAA 4U7SA 3IU4L 5EOQH 4UBDC 4TYUA 3P30L 4ZOAA 1UZ8A 4OIIH 3OBAA 4URTB 3I02A 4M62H 2YUWA 43CAB 2DJ4A 3ZDYF 2R56H 4HG4K 2Q3AA 3MTRA 4JANB 3TZVB 4XP4H 3LKNA 1ONQB 5DHYB 1KJ2L 1IAMA 3L3OB 1CFVL 2DQHL 4IOIB 1Z9MA 1RD6A 4PD4J 2VDRH 4GRWE 3X13B 3IJSB 1V7ML 3GSUB 3MX0A 1RIHH 3QHFL 4TPRL 2PYFB 2I60H 4PJHE 4F7PB 2NYYD 2Q6WA 1B2WL 4TNVF 5DLMH 2J2ZA 5I1GH 3BIKB 5CEZE 3V79C 1LEIA 1WFUA 1LE5A 2OZ4L 3T77B 1FNLA 1I7TB 2VAAA 4HIJA 3I3BA 3FB7A 1NLBH 4X4ZA 4HZLA 2HLFC 4KROD 5FCSH 3I3EA 4CJ1A 3L3IB 5JW5B 4DKDC 4XP6H 3DO7B 3ARQA 3TNMA 5TDNA 2YPKB 4IMKC 5C0GB 1KIQA 1A0QL 4XVSL 5C09A 3B6SA 5DDHA 1X4YA 3ULUC 5J1AA 2IBGA 4G6KL 3LEVH 4QRQA 5J8OA 4P2CG 1HZHH 4ZXBA 3O4LD 1OW0C 3PQYA 4D3CL 2ZPKL 4EN3D 3UYOD 4QHMB 1SVZA 2BNRE 5J13B 3T0XA 1I9IH 3HUJF 2AJXH 2F53B 5CJQL 1VFBB 5CD3A 4MNQD 4EBQL 4FS0A 3TV3L 1NUDA 3B2VH 3TPUA 2NX5B 2XRAH 1R24B 4P3DB 2PN5A 1JZ8A 2UWEA 3VW3L 1Z5LA 5C0EB 1TJIH 4XC3H 3QPQC 2D7QA 4P5TA 5T3XL 1SYVA 2DIAA 3F7YB 5AWNH 2WNGA 4K07A 2Y6SC 1XIWB 1KGCD 2CK0L 4P2RE 3W39A 2VZOA 4JFPB 2OCFD 2DD8L 2V5RA 3WCYA 1NSNL 3UXFA 3V4VH 1IGJB 1EAPB 5E5MA 3C9NB 1ZMYA 4JFHE 4NQDA 4KAQH 4OBSA 1DE4A 4AT6A 3FO9B 3TJHD 4RGNB 1YEGL 4X4ME 1FV1B 3DXAD 4FG6C 5J56B 3RTQD 1NCBH 2BY2A 4XPFL 5EZOH 1UJ3B 1KFAH 3QQ9D 5E8PB 1LDPL 3QR2A 2MJWA 4H1LA 1XT5A 4IJ3B 3ROOB 4ZAKB 5D2NB 1T6WA 3QI9B 4I18C 2JB6A 1Q1JL 3L7EA 1H3TA 1RAMA 4Y4HD 2HJFB 1U6AH 3V0VB 1S7RB 3GHBH 3EW3B 2VZUA 3ARDA 4Z7QE 4ZPVB 2GJZB 1ZVHA 2GIYA 3PP3K 2VC2L 2YA2A 3F12A 4TUOA 2BSTB 3P4OA 4R8WL 4Q9QL 1NANI 2HVJB 1V7NL 5K93A 4R7NB 3V7AE 2BSSB 3IVKB 4NC2B 3NIFF 2NNAA 3V52L 4C56A 5BVPL 2E9JA 1AIFB 2AXFA 4PJDE 3AXLB 3OAZH 2IBBA 5EOQL 3K3QA 2IBZY 3VCLA 1FO0A 3SKNB 4JDVA 5IESH 5F3HB 4D0DA 3WE6B 4OIIL 1QSEA 2F8VA 3L3HA 4M62L 3E6FB 5EIIA 2VN7A 3G9VA 3GNMH 4IS6A 1D9KB 1UH2A 5SX4H 4CVXB 4POZC 4LPXA 5L2JB 2VDLH 2R56L 3GMRA 5BZWA 1WIOA 4LDOB 1R5WB 3QA3B 4XP4L 1N59B 3GRWH 2YSSB 5MEOB 1CE6B 4PP1C 3VJ6B 1I9JH 1EFXB 1KLGB 1I8LA 3VXMA 5L9DH 4MXWH 4PFEA 3AM8A 2HRPL 2LU4A 4LHJB 1JYXA 2VDRL 4G6JH 4XTRC 4Q7DA 4YXHL 1RJYA 3MLYL 1RIHL 4KHXL 4JN1H 2Z91A 4LFHD 1JP5A 4IM8A 3C60A 1OGAA 1G9MH 4FQCL 3PGFH 5DLML 5I1GL 2QKIA 3HB3C 4FFZH 5CLWA 5ICZB 3VXPB 1OAYH 1IM9A 5IT2H 1WK0A 1G7PA 5GGRY 4KV5F 4JM4L 3NN8A 1RZGB 5TPWH 1NLBL 4J23A 4OZ4A 3OX8B 2DYPB 4EEEA 5C0IA 5IR1B 5BZDB 3VMPA 2NR6C 4I0PC 3TO2A 3MC0A 4BKLA 4NKQB 5B3JE 5IBTH 3AB0B 1BGXH 1XGQB 2BY1A 2NXYB 32C2A 3F7VB 3LEVL 1I8KB 4JREC 1B4JH 4WU7A 4XBEH 1MFAH 2A6KB 2GJJA 1I1FA 3QISA 5E08H 4BZ2H 3HI1A 1E28B 3PHQA 2IADA 1AGBA 1HSAB 1U8HA 3W2DH 4ORGB 1I9IL 1PKQB 2AJXL 5HGAA 2P44B 2WP3O 1IAIL 3LIZH 2F53D 3SDDB 5CGYD 1I8IA 4IHOB 4S1RH 3GIVA 5ITFA 4YHOL 1T2JA 3B2VL 1NCWL 5FYJE 1ZLSL 2NX5D 4GRWF 1MVUB 4ZPTB 1T20A 1Q9LA 3HZVA 1HHJA 2BVPB 3CNKA 3H0TA 3HPLA 1TJIL 4LHUB 2QQQA 4XC3L 3WDJA 4DK3A 4R4BA 1S9WB 3T1WA 4LAQL 4PJHF 5IBLC 3RL2B 2D31B 5JIIA 3KPLB 1T3FA 3VXRE 5IHLB 1KJVB 3EAKA 2KQMA 2R2HB 4NQDD 2X4PA 1CD9B 5AWNL 3WLBB 1X5GA 2E8ZA 3TN0B 1ITBB 3VI3E 1A2YB 5I18H 4K8RC 1H5BB 4Z0BH 1XIWD 4YGVA 1AXTH 1YMHA 2OSLB 4QOKE 5I66B 4FP8L 5E8NA 3P4MB 5GS0H 3E2HC 4GLRI 5D7IE 1FORH 1HH9B 4S1DC 4GW5B 5F3BB 1PX3A 2X1PA 2MQ3A 5IB2B 4KAQL 5JPNA 3LKSA 1OT1A 3GKZA 2W65A 3D85B 4RCAA 1YMME 1WWCA 3FHAA 3KYMB 3GMQB 4QHLA 3HNSL 5EZOL 2XNAA 5IJKC 2DWEA 3B2UD 2AABH 1UWEH 2CPCA 4K9EC 4UTAH 4AM0A 2IANA 5DMKA 3ZE2E 3UPRB 1MY7A 1QACA 3BP6A 2V2TA 3D3VB 1VFUA 5INCB 1IAKA 4NN7C 2CLZB 3BWAA 3IETA 3QI9D 3P4NA 4LVNC 4Y4FB 1CXIA 3EYQC 3F7PC 4LK4A 1MJJA 3H9YA 3MMEA 3CDGA 3GHBL 3M1BB 3OWEA 3CVHA 5D72H 1XGRA 4Y2DB 2ZJSH 3O6KH 4N9GB 4YE4L 4KTDH 5FHAL 1QA9B 3QIWC 4OZHA 1BZ9A 4H0GA 1I8MA 1BEYH 2UY6A 2UZXB 1UM6L 1S9VB 3AU1B 3HAEH 3VXOB 3WS6C 3BPCA 5T1LA 2AEWA 4PRHA 1LP9B 3BZDA 2AV7B 2EDWA 4LVOC 5FYLE 5F7YC 1AH1A 5HGHA 2MKWA 3FFDB 3NFNB 3KPTA 1BZ7A 5IMLA 1WSST 3EYOA 5AAWA 1C5BL 1FN4A 3NACH 4PR5B 1UKQA 4PREA 5FECB 3QO1B 2YA1A 1ADQH 5GSVB 3AS1A 5GGRA 4QXTB 2CLVA 5CSZB 1T1ZB 4R4FH 3TIEA 1OTSD 4N90E 4HWNA 35C8H 5FO8A 1F90H 3GNML 2BNQE 3MRLB 4ZS6C 5SWZB 1FZKB 3NCCB 3C60D 4XCNA 1D9KD 2UZIL 2VDLL 4HBCL 2ZKHH 4G9FB 5F1OB 1ZTXH 3EJYC 4LKCA 2F54E 2VSCA 3O3EB 1MCWM 5DMJB 1I9JL 3H9SE 5L9DL 1EFXD 4KJQC 5FUCE 1DQQB 2XN9E 3C8DA 4JPVH 1JF1A 2EIZB 4N8VB 5TDOA 4RFEB 4G6JL 3OJDA 2ICWA 3VH8A 3DBXA 3VDBA 4J3XA 1BECA 2E6JA 2DDQH 3PUCA 2DQIL 3P73B 1A4KA 4JN1L 1YNTB 5D1XA 5L2KE 2GT9A 2YK1H 1G9ML 3TA3A 2A0LC 4NKMA 5DC4B 3FFCB 1J8HA 4M1CC 3U4AA 5GJSH 2FJHA 4LQFH 2V5TA 4OKDA 3A67H 1GZPA 4PJGB 4FFZL 4OKVA 1FJ1B 1NBYA 4PGDB 3L5IA 3VWJA 3WO3B 4Z7QF 5IT2L 1NEZA 4JVWA 4HD9A 3U0WL 2COQA 1KXVC 1A9BA 4FQXC 5HYJB 2O5ZH 3H2WA 3VFSA 2DOCA 1FP5A 3EYVA 4UINH 2ATPA 4P46C 3OJMB 3QO0B 4PJ5E 2EKJA 4LLUB 4Q2ZA 3QEGH 3QDGB 4N0RA 4PJDF 4GBXC 5I16B 2VABA 2GITA 2ICES 3SDCA 1YEFH 2AJZA 2FSEB 3PV6A 4I0KA 1BGXL 4O2CB 5GGTA 3JTSA 3QXDB 4MNGB 5IVOA 3RIFF 2R2EA 5DK0B 2J8HA 5I76A 1B4JL 1GC1H 4P9HC 2X89D 4RFNB 4XBEL 1MFAL 2NY4B 3EO0B 2V2WB 1A6UH 1SMOA 3DRTA 1CFTB 1A7RH 5E08L 4PLJD 2MPAH 3MRRA 3G6AA 3EGSB 3MV7A 1L0XA 5JQHC 4YHZH 2PYEB 3IDXL 3W2DL 1W0VB 2P5WE 4JDTH 3MREA 3SY0B 3MR9A 3LIZL 5DTFA 4Q9CA 4NZUH 4LSSH 3KPSE 4U1LA 5F88B 1AR1D 2QEJA 1QSFE 4S1RL 3SDDD 4GKSA 1QRNB 1GZQA 5DUMH 5CEYB 3OB8A 4DW2H 2ERJB 1R3JA 2GAZA 5BRZB 3MQIA 5F7UA 3MA7B 4LHUD 4EUPH 4QGTA 3ZDXE 4P59H 3PGCB 5C86A 4W4OC 4CN6A 1SEBB 2NZ9D 4CVZA 3OKLA 4WWID 5DJCB 5BV7H 4MXQD 5I18L 3TN0D 3HCVB 3FB8B 4Z0BL 3MJ7B 1AXTL 1OAZH 3BPOB 3ES6B 4UT6L 2Z31A 5GS0L 5E94B 1EH9A 2W60A 3PIQA 1FORL 1RULL 1CGTA 4G8GE 3MRMB 1SEQH 4ZTPH 3O3AA 4BFGA 3JTTA 1TQCC 3PDOA 1JPSL 4GG8B 4MYWB 5CGTA 1K2DB 2YD3A 1OM3H 2A73A 5B3JF 5EBMB 1FL6A 3D85D 2DLEA 3FQRB 3BKML 4M61B 1QSZA 1MLBA 5CP3A 3VFTB 1KJ2A 2Y06H 4GMTL 1P6AB 3UBXI 3TP4A 1MHHA 2AABL 3QZWA 4GQPH 2NTSP 3VWKC 4UTAL 1BFOB 2EYTA 4MDIB 2XTLA 1UH3A 5TGBB 3D3VD 1C8PA 5T1LD 5KSBE 4OFYA 4LDEB 1LDSA 3V8OA 4Y4FD 1AI1H 3TJEH 3AMLA 3HI5H 5C6PB 5D72L 3QBTB 5AAMA 1BBJA 4Y2DD 3MRHB 4JKPH 4KTDL 2FBOJ 3BW9B 4KJYA 4S10A 5HHME 4MJ2A 4JM2C 4X9GA 2OZ4A 1BEYL 4YX2L 3GUTA 1MRCH 1UZ6E 1TJHL 4LGPB 5JPMB 1R3LA 3KNBA 1UB6B 3DURB 1Z0MA 3NCJL 4JPWH 1HOCB 1FHGA 3T3PE 2PXYA 2BVUA 1BQHA 3OKDB 5EBWA 3WLWC 3ZT5A 3NACL 3ARFB 1ADQL 5GIRB 3VFOB 5IGXL 3IGAB 2EZ0D 3GBMH 2AJSL 3HHRB 4NNYB 2B1HH 4XB7A 3I6GA 3MBEA 35C8L 1F90L 4HMDA 1I3UA 4X7DC 1F4HA 1MJ8H 4RAUB 2WV3A 4LCWE 4PRIB 5SWZD 3ARBA 2ZKHL 4TVPH 3REWA 3PHOB 4XH2B 1ZTXL 5JLZA 4G9FD 4LPVA 3TIDA 2OTUB 3DVIA 1VGKB 4FMKA 3G5VA 3NCFB 3WD5H 1KB5B 3PWVA 3ZE2F 4JPVL 4QGYA 3RWHA 5BO1H 1XZ0A 3SKUD 4Q74A 3TF7C 2DDQL 2GSIA 4GW4B 2VTFA 3F5WB 5IROC 3PNWB 4LQFL 3FFCD 1NGYA 4DN3L 2B4CC 3VDAA 1UWXK 1EA9C 3HLAA 3MRBA 3U48A 3RY5A 1MCEA 4HK3N 5GRYA 5E5UB 3RNKA 1F97A 4I4WB 1UWGH 1HQ4B 2EO9A 4ETYA 3MGOB 5EB9A 4F33A 4MQXD 2O5ZL 5HYJD 5CGMA 1LO0H 4UINL 3VFUB 2RR3A 4U0RC 1P1ZA 4X8JB 4IRSA