1I3VA

Three-dimensional structure of a lama vhh domain unliganded
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
129
structure length
129
Chain Sequence
QVQLQESGGGLVQAGDSLKLSCEASGDSIGTYVIGWFRQAPGKERIYLATIGRNLVGPSDFYTRYADSVKGRFAVSRDNAKNTVNLQMNSLKPEDTAVYYCAAKTTTWGGNDPNNWNYWGQGTQVTVSS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Lateral recognition of a dye hapten by a llama VHH domain.
pubmed doi rcsb
source organism Lama glama
molecule tags Immune system
molecule keywords ANTIBODY VHH LAMA DOMAIN
total genus 32
structure length 129
sequence length 129
chains with identical sequence B
ec nomenclature
pdb deposition date 2001-02-16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1i3vA00
1JJUA 1S5IL 3D18A 2UZIL 5KG9B 1T21B 5GRJL 4OI9A 1RHHB 2VDOH 1EJOH 4YXKH 1EUTA 2R4RH 5TFSH 4WUUE 3LAFA 5DK2B 5I1GH 1C5BL 2BSSA 4GKZA 4JE4B 3EJYD 1ZGLM 4GKSA 4HZLB 5C0GA 1DVFD 4XVUD 1XT5A 4FA8A 4N8CL 5CSZB 1TTUA 3DRTB 4LAQH 2JJUA 3UTSA 4WUUA 3RGVA 5K59F 2DQEL 1FN4B 4YXHL 3GNML 3O6KH 1HHJA 4FZEH 4LCUA 1N5AA 4OFYD 2ZUYA 1AHWC 3VFOA 4GQ9H 3C5ZA 1D5ZB 4ESKA 1PY9A 1RIVH 3BDYL 1FSKC 3FRUB 2V5MA 1Z9MA 5F3HB 2L0DA 2IEPA 4OLXH 5DMKB 4Y4KC 3GIZL 4NQUA 4U1SB 1QFUL 4JKPL 4ALAH 5MENB 1TMCB 1ED3A 1ZTXL 1HEZB 3FT4A 1CS6A 1NBQA 5E8DL 4ERSH 3ULUH 3VXTB 3CFEB 3OJDA 1F4XH 1MJ7H 3CFDA 2W9EL 2CLRB 2OK0L 4BZYA 3IFLL 4S1RH 2PO6B 1KB5B 3T2NH 5MEOB 2EXYD 2PF6A 3WD5L 2IBZY 2XA8L 3TH2T 1DBBL 5F88A 1ZE3C 2CLRA 1CBVH 2NY3B 2R23A 2V2WB 1UZ8A 2HN7B 2IH3A 2AJZA 3UJJH 3VRLF 3R1GL 1EGJH 3C60A 4KUZH 4Z0XB 1OAUH 4C56B 1ADQA 1MI5E 4YIQB 5AD0B 1F5WA 4OCYH 5DWUL 1EO8L 1QRND 2NY3C 3GMQB 3DO7A 5EG6C 1BQUA 1PD6A 2NNAB 1JHTA 3ARYA 5AZEH 3CDYA 4W4OA 3OXSA 4I5BA 1OSPH 2OX5A 4WU7B 4Z76B 3STZB 1EHLH 3QG6A 4TTDD 2YEZA 4PRPE 4Q6IB 5GSRA 5J6HA 1U3HB 1JGEA 5ESVA 4DTGH 4HWBA 4LVHC 4PJ7B 1NMBH 4KV5F 4HUUB 3X11A 1INEL 3L5HA 4WWKA 1NCDL 3HNTH 5T1LB 1X9QA 4HH9B 1WWAX 1NCWH 4LSVL 3V6OA 3S35L 1MFEH 3U9UA 1HXMB 3N85L 4NKDB 5C0ND 3U4EB 4NSKA 4G7YL 3VGDA 5B4MD 4Y8DC 1FGVH 1MCEA 4ZG1A 2XN9E 5C8JA 4OCXH 1R3IH 4HQQL 2GITA 2B1AL 1CWVA 1CCZA 3HS0A 4Y5YC 2JTDA 4AEHL 5D2NE 4WW1B 3KXFD 5D7SL 3ZKNC 3ELAT 4ZO7A 5IQ9A 1OGTB 4LLDA 1T80A 1I9IL 1MVUB 1S7TB 1T1WB 3RWDB 4QGYA 4PRID 5ANME 5FYKH 4HLJA 4U1MA 2Z35B 5FM8A 1UYWL 3FONB 1QOKA 2N7BA 3EKCA 2Y07H 5T1KA 2YZ8A 1P1ZB 5JUEH 3DIFB 3G5VA 5I8CB 3EOAB 5F88B 1HZHH 4KHXL 2GJZB 3MFGB 3CSPA 1VERA 5FM5M 4GS7B 5IHZA 1M7DA 4G8GB 1AQDB 4EXKA 2LTQC 1GHFH 3VXUB 2W1NA 1GPOH 3MXWL 3HRZA 4AJ0A 2YPVL 4B41A 5FGRA 3KYOA 2F54B 5D7JA 2AV1A 4MNQD 1NGWB 3O4OC 3AC0A 4MD0A 1U93A 4NN7B 4XMLH 2FEDC 3CLEL 3CX2A 2F8OA 3NA4A 3V5KB 4TQEL 3AXLA 4HWEL 3CFKA 4M7KH 3ZSTA 3U36A 1P5UA 3BRGC 1OP3H 1MFBH 3S9DB 2DTML 1IFHH 5JOFA 3IDNB 2BERA 4Q0XL 2DD8H 1X5XA 2VLRB 1T5XB 3ZT7A 3DVNB 4CL7A 2IANB 1BGXH 1UCTA 4PJ5A 1N0LA 3RWEB 3VFPB 5DSCA 1UVQA 3U0TB 2VH5L 3ILPB 5CJBA 4P5KB 3QO0A 3WXWL 3V4PH 1H3XA 5C0GB 4O2FA 2X7LB 2Z9TA 4U33A 2VAAA 4MJIE 4YFDB 1RV6X 4HWNA 4YHKL 3BIBX 2CDFB 4LAJH 2CUMA 1FG9C 4P23A 3JWDL 3OAYH 4XC1H 4GG6B 1OOAA 3PUCA 1B0GA 2X89D 2VXVL 1LD9A 1EFXA 1KB5H 1Q9WA 3QI9B 5HHPA 3P11L 2R0WL 5A2LH 1N59B 5LJYH 4Y1AE 2NYYC 4I0KA 1W8NA 4YXLL 1U8PB 4ORGA 5CEXA 3CDFA 4NNPL 5GRUH 1LGVA 1AI1H 1LNUB 5CHNA 5SWQA 1CGSL 1S78D 1GZPB 4U1JB 5DEZA 3P9LA 1S5IH 1MFDL 3MYJB 3I9GL 4X5WB 4S0TD 1MREH 4HV8B 2HJLB 1RK0B 3Q2CA 4UV7H 1NUGA 3LN9A 1QSFA 4GRLC 3B6SB 1MCOH 2GIYA 5EZLA 4XC3L 1DBKH 1IBGL 2V2XB 2G75A 5MHSD 3QI9C 4HJ0C 3L5WB 2X9XA 2DYPB 5K9QI 1TCRB 3JV0A 1DBAH 5E00B 3S3PA 4QRRB 2Y5TA 3D2UB 4M1DH 1AGBB 5HJ3A 3F6IA 1KCRL 3SGJC 4HK3J 3U46A 3UC0H 4XNMA 3C6LC 4OF5A 1R0AH 3ZSSA 3O11B 4LLMB 5CJQH 5CUSL 3PP3H 4PY7B 4RFNB 3IXAB 3LRGA 3ULSA 4XCFL 3ZHDA 3V95A 3X13A 1PSKL 4X4ZA 4P46A 3W82A 1NAMH 4YUEH 4H1LH 4PREA 2JELH 3QUYC 3QSKB 1S9YB 3MACH 5DMGC 4ZODA 3QEQD 4D8PA 3PJSB 2R2EA 4M9OA 5H35B 4JHWL 3ECBA 1WZ1L 1BZQK 4WO4D 35C8H 5EZOH 5IVXF 4XMKH 2EEDA 2Z91B 4NQTA 4PIRF 3W0WA 3ALWA 4J3TA 4QTHB 1E6OH 3C6SB 3C5JA 3MR9B 1Q9LA 5DQ9B 1F90L 4F7CA 4Y4FB 1BF8A 2IMMA 3WXVL 4X4YA 4NN5B 1N5YL 1ETZA 5BZDA 5I1KH 1RIVL 4K8RL 4LARH 1QFHA 2LVEA 1FNEB 5K33A 2Q7YB 3D0VB 5ICXA 1KIQA 1KULA 4NO5B 4WNQB 2DJSA 3KLHD 3VXNB 3QDJB 2ZPKL 3BQUD 3SKJL 1JMZA 2PYEA 2AXFA 2MCPL 5MEPB 4CADA 2CLZB 3G08B 5CKGA 5I1AA 4KVNL 4H26B 2H32A 3DRQB 1NPUA 3QJHB 3MJ8A 5DR5L 5EO9B 2OLDA 3DURB 1ZLVK 1BFVL 1BM3L 5F7NC 3N1QC 5MI0B 4JRYD 3SQOL 4D0BB 4ETQB 3JUYA 1URLA 2V9RA 1T5WB 2GJ6D 4NNXB 4Z0BL 1T04B 2R9HC 1JWUB 1A7QL 2E6PA 5I1DA 5IROC 3BE1L 2V7HB 5H35A 4HWBH 3H7BB 4HSQA 1X7QB 5DT1L 5CGYD 1G7HA 5FA4A 4RFOL 4XCYB 5J8OA 3MRRB 1ZA3B 3V52H 3QO1B 5HDQH 1E6JL 2X9YA 4ETYA 4LSSL 1CLCA 3U9UB 3LPFA 4FQCH 2G5BB 1AO7A 1UCBL 1ZEAL 4LBEB 4LSDA 4ZFGL 4U2YA 2BY2A 4G42A 4NT6B 4KY1L 1HWGB 1QRNB 2J8OA 1D7FA 3WFDH 4GXVL 1BBJB 2VLKD 3IKCA 1TVHB 2NW2A 2BVOA 2Y23A 3FN3A 3OR7B 2EXWC 5B38A 5L6YL 1CXIA 4Q2ZA 2NNAA 4FQIL 5KVFL 4NP4H 1NANI 4UBDC 1CGVA 5IUSA 4OCXL 2IADA 3QEHA 2P47B 1FL3B 5FGBA 4A6YA 5HVHB 1WFTA 1RU9H 3D69B 3ARPA 3LKSA 3RWFA 1ZSDB 5K9QG 2FJFB 4NWTL 1TZHB 2Q1EA 3I6KA 1I1AA 2EDOA 4GG6A 1RK0A 1ZA6A 5CEYB 5CEZD 5C08B 1AJ7H 1JFQL 5E8PA 2CKBB 3HG1B 2VAAB 4P23C 1FBIL 1DLFL 1TZGL 4P4KA 3PWNA 3ZE1F 4MB4A 1A2YA 4KFZC 4QYOA 5CFHA 5HPMA 1JTOA 3U1SL 5HVHC 4OSUL 1BVLB 4RIRB 5CZKA 4QKXB 4E41A 3C5SB 4MJIB 4AM0A 1WC7B 1E4XL 4JM2F 3W5NA 1KG0A 1DBJH 4OUUB 2EH7H 3GSXB 2LTQB 4EN3A 3HAEA 1GGIL 1V7ML 3GKWL 2Y5EA 2DKMA 1XF2A 1FNLA 4NO3A 1TVHA 3QA3A 2A73A 3IETA 3P4OB 1I7ZA 4BFBD 5IB3A 3DSFH 4MWFB 1OSZB 2A74B 4Z7WF 2W9DL 4Z7UE 3FCTA 4GRWE 1MLBB 3S5LA 4UOJA 4GBXC 3BPCB 4WGWB 3NPZB 2A1WH 3FQTB 1UM6H 5F89B 5HXMA 5EA0H 5TQ2L 3FRPA 4POZD 1BLNA 4ZAKD 1DQQB 1DUZB 2G60L 2GJ6B 3WS3A 5BJTB 3E2HC 3ULVD 4FQHA 3OKEB 3U4AA 1I9JL 3AM8A 2XN9D 4DGIL 5FHBL 2VQUA 1OP5K 4DTGL 1K85A 1QFWI 3FRPG 3H7BA 1L0XA 4N0UA 4O2EA 4OZGF 5E95B 5EU3A 1QBBA 3GMLB 4XBGB 1T5WA 4NNXA 3JXAA 1IZKA 1LK3L 1AGDA 1WWCA 3MRPB 3FHAA 2I60H 3F58H 4MMZC 1IZJA 4KMQA 5IW6B 4FG6C 2FATH 4EDWH 1CE6A 3UTPD 4HC1L 5C0BB 1KTRL 3ME0A 3WO3B 4YZFE 4QEGA 3QXUA 4Z5RB 3PWLA 3FB5A 4QOKB 3TPKA 4OZGA 4KJQC 3QWRA 2ZCLL 2XWBA 5D6CA 1P4BH 2CIKA 4U6XB 4H25B 2F58H 1MFDH 5C2BH 1J11A 1QRNA 3SE3C 5CEZE 2BNRA 4OLVH 3MLXL 2VXQH 4DWHA 4OB5L 4OFKA 1MCIA 1Q0YL 2EYSB 3QAZB 2XWJA 4JAMB 5HYJD 3MRNB 4Z6AT 1X4ZA 3BPLB 4JFZH 5H2BB 3RX5A 1UZ6F 3FO2A 2AI0L 3T0WA 5M94B 4Y4KD 3V6ZA 4NO3B 4FMKA 1U8HB 2NLJB 3VXMA 3SDCC 2ADGA 1XGRB 4XT1C 2EDKA 3RUGF 4EI5B 5GS2H 1JYXA 3GMQA 3DO7B 1CD0A 5DVKA 4FXLA 4ZPVA 5FIEA 4YNYA 4D0CB 2DTSA 2RFXA 4M7LT 4DGYL 4I9WD 2W0PA 5B38G 4K3JL 5IK3A 4G6FB 3LPGA 2ATKB 1U8MB 4WY7L 1KXQE 1BFOB 4EXPX 4K94H 4RAVB 2XNAA 4PJHF 1JE6A 4AQ1B 5GSRB 3P2TA 5GS1C 2ZSWB 4X9IA 4CN1A 3DX9B 2ZUVA 4KK8D 4X6CA 3CVHB 4MMXC 3IU3A 3B9KD 3B8SA 4PJ9B 3IFNL 3JTSA 2X4QB 1H15A 3WSQL 3B5GA 1R3LA 1CF8H 1I1FA 1FORH 3T0AA 5EU7E 1QBMH 5GJSH 1U8NA 1N7MH 4PGJA 2OP4H 4JFHE 3I2CL 3PWUB 1OAZH 3UYRH 3X3GL 2VABA 5IB1A 1G1YA 1SVZA 3UROR 3BOVA 1ORQA 1MCFA 2XWTA 3OGCB 5ITBH 4YDKH 2WQRA 4ZFFA 3FO9B 2J12B 1YMHA 1D5XB 1I1RA 2OTPA 3RFZC 2NXZD 5B21A 3O8XB 1MVFA 4P2QE 5FYLE 5F8QC 1UWEH 5CLTA 5E2UH 3REVA 4FTVE 1U8IB 1KIQB 1Z0MA 2BOCA 2Q7YA 4JY4A 4HKBA 3KPSD 4LBEA 5E5RB 4ZUVB 3WD5H 4DFHA 4YBHA 5SWSA 1E4KC 2Y36H 3BEWB 4X6FA 4LSRH 4OCRH 3UTTE 4WO4B 1FYTA 4MB5A 5DHYA 5DJDA 4XXDB 3T0ED 1AO7E 3DVGA 3MOQA 1I8MB 4UINL 5MERA 4BQ8A 4JFFA 1X5FA 1AQKH 1F3DH 3HCVB 3NFNA 4ZXBB 3D6GA 3OF6D 4JO3H 4LU5L 2YWYA 4PP1D 4LHUA 4R7DA 1KACB 1KJ2L 1ZS8A 4XMKL 5JA8B 1RHHA 4XMPL 4ZPTA 5E4IA 1FYTD 5F96L 1RURL 5L88H 4O5LH 3GRWL 5D7JD 3EYQC 2E9JA 1E4KA 2N7AA 4HC1A 4S10A 4Y4HB 3WIHL 5KS9F 1A7OL 1BREA 3VXRE 4PGEA 2XPGB 3BMWA 4M5YH 4P4KB 3WIFA 2NMSA 4OKDA 1N8ZA 3SGJA 2FB4L 4LKXA 2FEEI 3RAJL 4XCYA 4U3CA 4BJLA 5HHMD 4NWTH 2BY3A 5IWLC 3HNVH 4FHBD 5JUEL 3BPOB 1JYNA 1Q94A 4JO2H 1LDSA 5D2NC 2DQDH 5EU4B 1FNAA 3TJHC 3MXVL 4NRYB 3SPVB 2BVPA 3MREB 1J05B 1CFVH 2XKNB 4LLUA 2O5ZL 3V0WH 1DP0A 4HCRH 3SBWC 1YEIL 5HJ3B 3BW9A 1U8QB 2XI9A 4MSWB 3TWCL 3ZKQD 3KPMA 3K46A 1HHGA 2JB5H 5GGTL 3QIWC 1C5DA 3V0VB 3OKMB 5DS8A 1J18A 1KGCE 3QUMB 4N90D 4NZTH 5HGAB 3ZTJH 1GGTA 3K4ZA 2PETA 3RIAF 4M48H 1YUHB 4NFBA 4IMLB 2LU7A 4F37F 2YPKB 4PJFE 5A2FA 1C12B 1BOYA 4ZTOL 3NN8B 1LD9B 4BH7B 1KCSL 3MV7A 5IJKC 3CC5A 1S7VA 3G6AB 3Q5TA 5I8OH 2A1WL 5D7LA 1JN6A 5TE7L 1FAKT 1ORQB 1MH5B 1EK3A 4NKMB 1WF5A 2VZ3A 3UPRA 1RVFH 2XZQL 4MAUH 4MA1C 4Z7QE 1O5DT 2O26U 3PL6A 5GSVA 3GIZH 2VDKH 2K7PA 3TVMB 1LEIB 1XIWC 3MGOB 2BCKA 5JW4R 3BYYA 4WRLA 1MCBA 3D39D 4LLVB 4L29B 5KSAB 3O6FB 3OZ9H 4OZHA 5JHLH 4JFEA 3NA9H 3GMRB 5C9JB 1OAQH 2MQCA 1FJ1A 4M7KL 3TBYA 3K1DA 1R3JB 2HVJA 3O4LA 1ERNA 3L6FB 4D2NA 4JFDA 4BSJA 2R2BA 2D7MA 3BP7A 2ICCA 4NJ9H 1DBMH 4DVBA 3B4NA 1FAIL 1GGUA 5I1JH 5E2VH 4IMLA 3TVMC 4K7PY 1XCQA 3ES6A 4PJGF 2BNQD 3OAYK 4LCCB 1EEYB 3TJHD 3OX8B 4HS8H 1PX4A 1NBZB 3UJTH 2NY5C 3BGAA 1GZPA 3B43A 2VDQH 2VISB 1K3ZA 3F7PC 2JCCE 5D93C 4PRBA 2RAMA 2AI0H 4LF3B 3OBAA 2XZZA 1H3PH 1FRGH 4MJ2A 4C4KO 1AGDB 1DBJL 2WUCL 1JPFB 2ED9A 3O9WC 2H3NA 2C7UA 4YC2C 2V2XA 2HJKA 1TDQA 3ZYJA 2B20A 5D6CB 2FBOJ 3GDBA 4XP6H 2C3XA 5D7JC 3QR2A 5HGBB 1EAPA 3FO0L 5IHZB 3SY0B 4TUKH 4U49A 4IIQB 5JDJA 3K4DA 4KK8C 1WIUA 3BP5A 2EDYA 4HULB 1CFQB 2NY6B 3HA0A 1QBLH 3G04A 4DZ8A 1GC1L 1V3LA 2C4XA 3DXAD 5B8CB 4J23A 4NKDA 2XFXA 4C56E 5IQ7H 5C09B 3EYSL 3Q5OA 1YA5A 2DIAA 2FX9L 2O5YL 2VH5H 1YMME 3BXNB 3U82B 2X44D 4CJ1A 2F58L 1MCNA 4GW1B 3RVXD 3GMLA 5TDPA 2VL5B 3ILQC 5DDHB 3CVIH 4HIIB 2PTTB 1ZVYA 2ZUQB 3DPBA 3O81A 3PIQA 4GXUN 3MJ9H 3R06A 2Z93B 1AGBA 3ISWA 2VXTL 4M3JA 1C08A 3BPLC 4I3RL 1F13A 3KLDA 3LN4A 1HN1A 2R69L 2DYPA 3F65A 2F54A 2LAGB 4FRWA 3CUPB 4KAQH 2EDRA 3O6FD 2BSSB 4EOWL 1JVKA 4RBPH 4X6BA 4XBEH 5CLWA 3SDAC 3QEGL 3PDOB 2D03H 4KK6C 4LVOB 3O41A 3D3VB 4PJ8C 1GRWA 3VI3F 3ARGB 3BZEA 4LIQH 5HDBF 4QCIA 5EZOL 4E41B 1QSEE 2IQAA 4PRNA 2X2YA 3MA9L 4LSQL 4WI5A 3UTTB 3IDIB 4L8SA 2A6JB 1K5NB 4O00A 1CIDA 3ABZA 4DZBA 3SDDC 1NMAL 3QXWA 1SEBB 1K2DB 1U95A 1Z3GH 1CICB 3PGDA 4R4NC 1A1MA 3QRFM 2JB6B 2K3TA 3BO8A 3BZFA 1JHLL 4QO1A 5K9OA 2BVOB 3O6MH 4MCZA 1P1ZA 3HE6C 3QIUC 5EBMB 4ZAKC 1KENL 2H32H 2HT2C 4J3VA 5D8JL 1MFNA 2UUDH 2P7TA 5F7DB 1LE9A 2A6KA 3LV3A 1UC6A 4KTEH 5DJ2A 4UOW1 1WAAA 4BK4A 4HH8A 1C16A 1WICA 3VJ6B 4I8DA 1L7IH 1VEOA 2YXFA 1NC4A 4JDZA 5DC9B 5GRUL 3CFJA 3MLVH 3S37X 1N4XH 5HGGS 4DKDC 3PIQB 1RUQH 1WAAE 1W72L 1C7TA 3SGEH 1SEQL 3F7YA 5I15L 2NPLX 3GMOB 4YFLI 4I5BB 3OXSB 3BQUC 3VW3L 1CFVL 2CDGB 4ODXB 1LK2A 4PJXB 3CFKB 1IGFH 3BMVA 4KJQD 4LCWB 1FNFA 4XH2A 4NQVB 1OTSC 1QLEH 4KZEL 3BT2H 1M71B 3GM0A 1AO7B 1U58A 2OR7A 4HGWA 3VXME 3GEWB 4HUUA 4OZIE 3PG2A 3PDDA 3DUUA 5ILTH 2P8PA 3ZKMC 1A6ZA 4HJGA 1H3TA 2NY5L 5TE4L 3K2MC 3PF2A 5D1QC 1QFWM 4EN3D 4X9GA 2C3GA 3LQAC 1F3JB 4B7IA 4GW4B 1J8HB 3B9DA 4ZXBD 3GMMB 1DANU 3ARRA 3GSRA 4Y19B 1F58H 1WTGT 2E7BA 3CK0H 2RGSA 1B4JL 5E6YA 9CGTA 2CXGA 5CILH 5DC4B 3FJTA 5ADOL 1PJ9A 3FQXB 4GRLA 2XTLA 4TULH 5J06A 4LP4A 4WI8A 3FOLB 1HQRB 2X1PA 2BMKB 4JCLA 4NGHH 1BFVH 2AXFB 4TVPH 3L7FA 5T33L 4FQQA 2ICWA 4ZYKA 4J4PD 4GKOA 3E8UL 2VIRA 4WEUD 3FQNB 3CSYB 2NZIA 2XTJB 3GB7B 2ESVA 4G6KH 1T3FB 2I25N 3QUZA 4KKLC 5DJCB 2BP3A 3UBXB 1A8JH 3UTSB 2CR3A 3V52L 3VXMD 1IQDA 1T2XA 1DN0A 4TUOA 5F9DC 4Z7WB 1VFBA 4JM4H 2Z8SA 4KKBC 3IJYB 4H0HB 4YBQD 3N1MC 4QTHA 4G9FB 3LCYA 4L4VE 1LE5B 2V7HA 3L1OH 1A6WH 3E2HB 2WM0A 3VWJB 4ZNEA 2VSCA 5KSVB 2BNRD 4D9LH 5CCKL 1RUKH 1L0YA 1U2CA 1UB6B 4I18A 4KKCD 1YEHH 5EULV 5GGSY 5JPNB 1YEIH 4C83A 4L4TA 5L6YH 5DK0B 3B9KA 3C09B 1PAMA 1C16B 1UKQA 3NCYP 4Y8AA 5BOZG 4L4JA 5L8KB 4OD3H 4P2RA 3A6BL 1IAKB 2EKSB 2DQUL 3WFCH 3G6AA 1CDCA 3RWJA 3G9AB 3TH3T 4OQTA 3K2UH 5HI3C 3QQ9C 2B0SL 5E6IB 5BO1H 5CJXA 4Z78B 1SBBA 3D18B 3VFWB 1I1YA 4P2RD 4ZOAA 4UDTA 3AAZB 5BMFH 1U92B 4FQXA 4F9LA 3SDYH 1HHHB 4N9GA 4R2GD 2YPLB 2GSIB 4WUUD 1VFUA 2BVQA 4JO2L 3UBXG 3GI8L 1F4WH 2HVKA 4OSUH 4F7CB 1LILA 1KYOJ 1BZ9A 4OQTL 4J3OC 2F53B 5GGVH 2UVEA 3RNQA 3Q48A 4Z7OF 5HVWA 4AG4H 4L9LC 4PGCA 1BBJA 1D9KD 1TQBB 1RZJC 2ZJSL 5E8EB 2FEEL 5DZLA 5HI3D 5B3NA 1F00I 1OB1A 4PJDF 4QRPA 1OM3L 2HA1A 2OQJA 3JV5A 3HE6B 3LD8C 5DTFB 4L8BB 4CNIA 5E2WL 3R8BB 1YNLL 5KS9A 1U6AH 3FO0H 3EOBA 5HI4D 2Z4QA 4LHUD 5I1LA 3KPPA 4XNXH 5DEFB 3LEXA 4BSVA 1FVCA 3QNXA 4F8QA 3KPLB 5K93A 4MJID 1UVQB 3MZTA 2V5TA 4I0CC 2LFGA 1M6OA 1NAKL 4LRIC 4MQ7B 5FYJD 3MFFA 2WSKA 4DW2H 3HR5B 1WWBX 2IC2A 3MRLB 4P23B 3U6RA 5TDPB 4XCNA 1I9RL 4IJ3B 3KLHC 3EYVA 3BRDA 1NCCL 2XZQH 5JMOC 2XQBL 3BEVA 3C60D 3O2DL 4PJDE 5E1AB 3T0EA 2OP4L 3KNBA 1YMMB 4D0DA 4LDEB 2NXYB 3EYUL 3BAEH 5DQDH 3GNMH 4AEIL 4CADB 4OI7A 1FFNB 2NR6D 2G9HA 2XKSA 4PJBE 5ID0B 3PWPA 1YECL 4HJ0D 4XPAL 1JGLL 2JJVA 1JNLH 3LRHA 1JHLH 2YA1A 1CTNA 3I02B 4RWHA 3L3IA 4AMKH 2YD1A 5BZWB 3CFCH 1JNHA 5E1HB 4CVZB 4N0RA 2C3VA 2Q3ZA 5EFIA 1GZQA 1HIMH 1I9EA 1LDPL 2OJZL 2F5BL 4LPCA 5GGSB 5GRJH 1DUYB 2ED7A 5E6ID 1OLZA 3ZDYE 4UQ2B 1II4E 1CGUA 1HH9B 1RIHH 1UFUA 3TO4B 4G9DA 2DKSA 1GIGL 5EFIB 5B3JF 4F15B 5FM5O 1FIGH 3MJ7A 3L5XH 4ZOEA 3LB6C 4LFHG 4HUNB 3NVQA 5IVXB 1JPTH 3BH9A 2Z92A 3EAKA 3RU8L 4NOFA 3MUY1 5C8JB 2XOTA 1KIPB 3DYPA 3CD4A 4FZEL 1OAYL 3AROA 3BZDA 1FYTE 2YD7A 2P5WD 5D1QD 1XGTB 2LU3A 1A3RL 3ZKMD 3QUMH 4MQSB 5E6ZA 2B5IB 4KJPC 4TUKL 4KJYB 2P42B 3A67L 2YXMA 3RL2B 4PJBF 4M62H 3GHBL 4JKMA 4L9LA 4YE4L 4JVUA 5E2TL 1XGRA 4JY6B 1ZTXH 2B1HL 3TN0D 1AQKL 1IC4H 1LE5A 3QXVA 3VWJC 4C58B 4X7TA 3T1FB 4XNUH 1TLKA 1INDL 4FFYL 4HCRL 3WN5B 3GSNB 3VCLB 4WHDA 1RUQL 1WT5A 4OLWH 1S78C 1MH5A 5EPMB 5IT2L 4X6FB 4X99B 1IEBB 1RJYA 3C60B 4PJCA 4MJ6A 1NGZB 4OB5H 4ODSH 2DQEH 4I18C 4P2QB 1MHPH 4UILL 5JTWA 4X0KA 3B9AA 2FL5A 3S96B 4JDTL 4HHAB 1KENH 1OF2B 2A0LC 1NGQH 4G7VL 1YMHB 2OSLB 3IDYB 3RJQB 1QFUH 4OZIB 5J11B 1IGMH 4XBPA 2VLME 4ENEC 3WKNA 2OJEA 5LGKA 4U1MB 2P24B 3C9NB 3HUJA 5FUZL 1PVHA 2W9EH 4XP9L 5T5FL 1EA9C 1X6LA 4JM2D 4C57C 3EYVB 3TO2A 4XCEB 3FMGL 5FUCE 2BNQA 4I18B 4G9FE 3TYGH 2QKIB 2D0FA 1KOAA 4QRSA 3D85D 1I85C 4KVCL 1OQXA 1MFEL 3VFRB 4N8CH 3U4EA 2X09A 4RISL 2A6IA 5FHAL 3NCYS 5C0AB 4BQ6A 2NY4C 2AGJL 1EXUA 3GSWB 5DQJB 1WJ3A 1TJIL 1S7RB 2YC1B 3OKYA 4JFOB 5ACMA 3QUZB 5DJCA 1U3HA 4F57H 4TTDC 2YBRB 3D2UD 4PP2A 2BFVL 2D9QB 5J1SC 1I7RA 3RP1A 3VWJA 1UWGL 1RZGA 4OF7A 3P0YL 3T3PE 4WIQA 2KQNA 2DI8A 1G7JA 5T3ZH 2WIIB 2M8XA 2I26N 5HI5D 3T0VA 4I77L 5C0JB 3ILQD 3OHXA 4X6CF 4PJ5E 4LGRB 1HWHB 1WLHA 3QNZB 5I16A 4Y5XB 5IV2B 1A6WL 1MJJB 4Z77B 5F71A 4Q74A 3VXQA 4EDXA 1MFAL 3QPQC 3FN0H 3C9NA 3HUJB 3IRPX 2P5WE 3MCG1 1J88A 5KSBB 2DQIL 1P4IL 5TF1H 5JHDD 1S9VA 2EXYC 3CH1B 5EBLA 5BVPL 4XP4H 3RWCB 2K9UA 4YX2H 2YSSB 3QXAA 4TRPH 3WO4C 1FHGA 3RWJB 2H6PA 4FN0A 4YDIL 5FYLL 1G6RL 1U6AL 1XH3B 1CG9A 1UH4A 2WBWB 2VWEC 4JREC 5KVEH 1U8OB 5D7SH 4M4PA 1IM9D 1OGTA 5CSBA 4Z95H 5E03A 1MRFH 4UDTB 4K9EC 1I9IH 3S35X 5L2KD 5E08H 3CJJA 4ODUA 5DFVD 4MNGA 5D2NB 1GJIA 1UB6A 1QD0A 4QCIB 3VXOA 5GS0H 5DO2D 4X4XA 5T1MB 5JQ6L 2R1YB 3LMJL 3SJVA 1ZGLB 4R96A 1I9RH 1MHEB 5CSGA 3D87B 5AWNH 4MNGE 2Y7QB 3MRGA 4ZNCD 3SE9L 4I3GA 3PP4H 3RTQB 1S7QA 2QHRL 3VH8B 3BAEL 3SE3A 1BFOA 2I9TB 3LQAL 1ZMYA 5CSZA 2EDXA 3UTZB 1UJTA 1JIBA 4EIGB 1WUNT 3BH8A 1TETH 1JGLH 1M71A 2IPUK 1S7UA 3KHQA 4WV1A 3L3HA 1S7QB 1CT8B 4GG6E 5EOTB 4JFDB 1DR9A 1KLUA 5DJYA 5CUSH 1G7JB 5DJ8A 5IBUG 4JDVA 5E2WH 5ICZB 4JJHA 3OSKA 4BUGA 1ZOXA 1RZ7L 1SJHA 5J1AB 1NSNL 4PJ8A 3H9SE 5C70A 1NC4B 4JDZB 2XG4A 4XCEA 1IGIL 1CFSB 1YEEL 2WK2A 1RIHL 5C6TL 1EUUA 3MA9H 3MO1B 3W9EA 3QDGB 4FQ1H 4N0YL 5I1HL 2P5EA 2I5YH 5JW4N 2ZUXA 3N0PB 2FJGB 3UTPE 5HHOB 2X4OA 2ZSVB 1AHWA 3NTCH 4NQCD 2VDLH 1DLHB 1G7MB 3CSYA 3ARTA 1IRAY 1FG2A 3RI5K 5IOPA 5GRWA 4F7EB 3QZWB 1UA6L 4S1DC 5ISZE 3V7AG 1G9MH 4NHUB 4P2QA 2X4TB 4M8VA 3FB5B 2ZUSA 4GSDL 4LPWA 4HLZH 2FO4B 1OW0C 4PS4H 3TO4A 1DEEB 2VLLB 4QXUH 2PTVA 4JFYA 4LF3A 2E3VA 5DA4A 1NQBA 3GJFK 4UDUA 4RRPG 2NY0D 5FOBB 4K7FB 1MREL 4M62L 3OHXB 1LQSR 3U0WL 1EV2E 3LDBC 2QEJA 5HSFA 2H2SD 2HWZL 4KGJA 4X7EC 4PJFB 3UTQB 5FA3B 4DW2L 1TQCC 2EIDA 4ZS6C 3RWHA 4OD2B 2NW2B 3THMH 5CEZL 3DTXA 2B4CH 3V4UH 5F6IB 5HYJA 4PRHA 3LVEA 1R3KB 4HKXB 3GIVB 1LO4L 3KLAB 3RU8H 1KTDA 3T1WA 4RGND 1JPTL 3WUWA 5E70A 1SJVA 25C8L 2VQTA 1CE1H 3MLWH 3PQYE 4QRPE 4KAQL 4PY8I 4QF1A 4NQDA 2WLYA 1QR1A 4KH2A 1YY9C 4OJFL 3HZMB 1LP9E 3ZDYF 3UP1A 1UEMA 3PHSA 3CFBA 4PJIB 1TJHH 2ENSA 1SJXA 2VZSA 3QEQB 1N4XL 5DFVC 5DXWA 4G8GD 1LDPH 4G80B 5GRYA 3L95A 5E8NA 1RZFL 4Q6IC 5HHME 1JF5A 5FUOH 5JMRA 4JFQA 3P4MB 1IQWH 1GIGH 3SKJH 4PUBL 5CP7A 4KRMB 5DMIL 3T8XA 1H0DA 1IGJA 3QCUL 1DANT 3MNZA 1YEJH 1YNKL 5GRVL 5T3XH 1NLDL 5F9OH 3PDOA 5HHXH 5TE4H 2AAVA 1BHGA 4G8FA 5EUKB 2JK5B 2RQ8A 4N5EC 3VFVB 3NZ8A 3T77B 5CP3H 1JMXA 3CFIC 2HP4A 4N90E 4DKEL 3HMWL 1A6AB 3MRBB 2GT9A 3TM6A 3QUXB 3HPJB 1X5ZA 4ZAKA 3BQUB 4XI5D 4RGMB 5E8DH 2ZZUT 3ULUL 3B2VL 2YA2A 1MCSA 5DC0A 1UWGH 1AXSB 3W81A 3TBWB 4MLIA 4U1IB 1OWWA 4TSCL 5HGHB 2Y9RT 2ATPB 2QQQA 1MQKL 4RMTA 2XTJD 1ZHLB 4AT6A 4FABL 5AYQA 5M7QA 4YEEA 3OGOE 5JOPE 1F45A 3BKCL 4FQ2H 5IMKA 5DUPH 1A7BA 3ECBB 3E3QE 4Y5VB 3B9KC 1S9WA 1WGOA 1FFNA 5DQJA 5LVEA 1TTFA 1T4KB 2N4IA 4TNWF 5C3LD 2W07A 4JJ5B 3IJYA 2DQHL 3INUL 1FFQA 1NJ9A 1JPSL 4Y4KA 4R97C 3TIDB 3MRKB 4Y5VA 1PZ5B 4Z0BH 4FMFA 4OGXL 2VDPL 1T3FA 4QRPD 4NQXA 5E8EA 1JWUA 1UENA 4N1HB 5I1DB 1EHNA 4HKZB 3S7GA 4I1NB 3KJ4C 2R4SL 3H42L 1I7TB 2FGWL 5DYOA 4P3DA 3P9WB 3EOBB 5C0BD 2P8LA 1MPAL 5D1ZC 3FB6A 4PJEE 3ARZA 4G43B 3GI8H 3MNVA 2GEEA 1J9CT 4LQFH 4S1QL 3MLUH 3RVUC 5LBSL 1TZGH 1I8KA 3H0TB 5IBUB 3NFPB 1WBYA 5F21B 2C1OA 5T5NG 5LG1A 1G7PA 3CDCA 1YUHA 1P2CA 2Q86B 1TZIB 2UZXB 4YHOH 5I71C 4DVBB 4HKJB 4PG2A 4OIIL 2J4WL 3BX7C 1P4IH 3SDAB 5D70H 1ADQL 1AIFB 4JFQB 4N0FB 2IALB 2R2CA 3FFDA 5F70A 3C2AH 2AK1L 3VGEA 4LPTA 3T65A 2FLBT 2FX8H 1LO3H 5D1XA 5IJVB 3H8NA 4NQVA 4OCYL 4WTZG 3P77A 2LVCA 4ODVH 4N68A 4Y1AD 1FVCB 2Y6SC 5DD1H 1A9BA 1DN0B 4TUOB 5KAQG 1EGJA 3NTCL 5CD5C 2A6DB 4DK6A 4TSBL 3M1BA 3V5HB 2V7NA 5DHVH 5C0RL 4MCYB 4JFED 3QFDA 3SDXB 2W65B 4XPAH 4PLOB 3PP4L 5L2JA 1OSZA 3SGDI 2BOCB 1GOGA 3DNKA 3SE8H 4UUJA 5C0CE 3SKMA 1IL1A 3FO1B 3GKWH 1T0NA 2R29L 4PLKC 5JNYA 3O4LD 3OKNB 4P9HL 5F7YC 4NO2A 3HAEB 1QFPA 2DLFL 2NTFB 1KXTB 4LRNL 4YHLH 5AD0A 3OKMA 3FZUD 5H2BA 4JGUA 5SWZB 1UXWB 2JJSC 4ZUVA 2JIXA 2EH8L 3LV3B 3QCTL 4HMCA 3SO3B 5L8JB 1VADB 15C8H 3AY4A 1T7ZA 5ENWA 3T0EE 4X4MA 2OBGA 5EWIL 3MJGX 1QSED 3SE9H 4O02L 2D0GA 3VWKB 2GSGB 4EUPA 3AVEA 4P5TD 5CAYB 1ZLUK 5A43C 4X6CB 4Z5RA 3CMOH 4OBRA 2VDLL 1A4JA 2OMNA 3C8HA 3IAQA 4E0RA 3PWPD 4GT7A 4JFPB 1OD9A 2Z31D 4PGEB 5HHVH 2EIZB 5ISZD 3O6LH 4RDQF 3ULVF 3QEUA 5CIPB 2BDNL 4NQDE 4HBQA 4OJFH 1BZ7B 1NDGA 2BJML 2WIIA 1J1OL 1I4FB 2PCPB 3P73A 3KPNB 4LLYB 2EXWD 4YDJB 1LP9A 3C5ZB 3MRJB 4KXZI 4CU7A 4F2MA 1FP5A 5DD5H 5E5MA 1SYVB 4K94L 2CUHA 3CXDH 5IGXH 5I2IB 5KVEL 2Z31A 2DIBA 2RCSH 3QPXH 4RQQB 4NSKB 3BD5A 1ZV5A 3MODL 4I2XA 4HF5L 3WUWB 4XHJD 4Y4FC 1NBYB 3GJFB 2AXGA 3DETD 4NZDA 3TC9A 2ZCKH 3CX5K 5JQ6H 4RFNC 1MELA 4BFGA 5JW4M 2B5IC 3IYLW 5IJKA 2QSCL 3GGWB 4R7DB 3MLTB 1HE7A 1BD2A 1K6QL 4P2OD 3WIIL 2NY1C 1XMWA 4S2SA 2NLJA 4KPHL 4AIXA 1RUAL 3KPQB 2R9HD 3FOMB 3KVQA 1UACH 5E9DE 4YE4H 3VI3E 1GPOL 3MXWH 5JIHA 5D2LE 4ETQA 4KDWA 1U3HD 3E0GA 3O45A 4DCQA 2CUIA 4R8WH 3GK8L 4PRNB 3VXSD 1ZT4B 2H26A 2PUQT 5EOQL 4G8GE 1OF2A 1CVSC 2GSGA 4UIKH 4UTAH 4YEFA 2CGRH 3MMEA 1QACA 3AFLA 5I19L 1JWSB 1ORSA 1H3WM 2EKSA 4JPIA 1NEUA 1U95B 5FECA 3V4UL 1HSBA 4PUBH 1YQ2A 1RJYB 4NO5A 1A9EA 4YHNA 3EO0B 1AGCB 2ADFH 1XF5A 1MVUA 1AD9B 1VENA 4U0RC 1XZ0B 4KKCC 2HLAB 3SBWA 1WZMA 5I17A 4YFLF 5J9PB 1PW3A 3WIHH 3OR7A 4U6YB 4R26H 5IVZB 1V05A 3JWDH 3O2WL 2EEBA 3ZHLA 2AJVL 1QVOA 5E2TH 3K8KA 3MLTA 4I9WE 4WO4C 4F37K 4ZNEE 3AS0A 3DHMA 4OLXL 1H8OA 1HXMA 2Q6WB 2VRAA 3LKOB 1MLBA 1X5KA 3S5LB 3TV3L 2O61A 1RZKC 3QDMD 5C86A 5F72S 1KEGH 3DETC 4BZ1H 2GAZB 4XHJC 3JVGA 4Y2DA 3VH8A 3MRRA 1YEDA 1YNKH 3K1KC 3KXFB 5EB9A 1A47A 4KWUA 3T2PA 5I1EL 4Z8FH 2HJFA 2XACC 2D4DA 2XA8H 4Y4HC 7FABH 3AS2A 5DLML 2P5ED 4EUPG 1T7VA 5L9DH 4GRWH 4D9RD 5F96H 2AK1H 5SWSD 5BQ7A 1Q0XH 4NHCH 4QT5B 3IJHB 3LS5L 1UB5B 4WHTA 2VR4A 1DFBH 2AJYL 1CICD 3ULUD 4IEFB 1DQML 1BAFL 4W68A 1A3RH 1F6LL 4XRCA 4K3DH 2FYYA 3MXVH 1DTUA 1ZAGA 4BH8B 7CGTA 1BQLL 2IPTL 1OAKL 3AGVA 3KYMA 1KELL 5GS0D 2H41A 4MA3B 5CJXC 3O3EA 3ARFC 1UJ3B 4GRLD 4MYWB 2EYTB 2WV3A 1ES0B 3H0TA 1F02I 4JHAH 2V6HA 4J3XA 3IGAA 4IOIA 5HDOA 4KK9C 1MCPH 4BELD 2W60A 1G0XA 3N9GH 1SY6H 3KPMB 4AL8L 4MXWL 3QDMB 3GI9H 4FQLL 3FZUC 3QUYB 1NL0L 2KZ1B 3ULVE 1IKFL 5L88L 1H5BA 4ZUUB 3ES6B 4L4VD 4JPKL 1P7QB 1K8DB 3HR5A 2BFVH 2B4CC 3RKDC 5EUOA 3W0WB 2VLJE 3VMOA 4NQXB 4AEHH 5AUMA 1OL0A 3VFTB 4DN3L 2D31B 4G3YH 2ERJB 5KBNC 1M7IB 1X5LA 3RIFK 1LEIA 2F74B 2F8VA 2UYLB 3TCXA 2ITCA 5CZVL 1N0XL 4LKXB 2R1XA 3NZHH 2MJWA 4IRSC 3SOBL 4DQOH 3OKLB 2HT2D 3TBYB 3OAUH 1RVFL 4OCSH 4FQ2L 3ULVL 1I3RB 3KS0H 1G6RA 1I1AB 1HNFA 4X4ME 3KDMB 3MGAA 4QRSB 3MV7D 1WC7A 4ONHB 3RBSA 1AR1D 3M8OH 1CDYA 4PJCF 4WNQA 1AC6A 5ICXB 2EIZA 1T2QH 5BXFB 1D5XA 4DOHE 3STLB 1GVIA 3WNOA 2PO6D 3WFZA 1IEAB 4M48L 3V5DB 4OM0H 2NZ9C 3SDXE 5CD3B 1C1EH 1VKXB 4PGBA 5MEPA 3OX8A 4F7TA 2BNUA 4WI3A 3STLA 4PJ8D 3QDJE 2QADC 4UTBH 4JQVC 1NFIA 4ELMF 2FNBA 3FFCA 4PG9A 43CAB 4DGIH 2JCCF 3P4NA 2CMRL 3W0WD 2O93L 4YHPB 5FO7A 2GJJA 3JTSB 2ZG1A 2KDGA 4NZJA 1AE6L 1W2KT 4RCAA 5JZ7D 4KQ4H 4MQXC 5DD6A 3BHBA 3VD7A 3MSPA 2HKFL 5IFAH 1U8KA 1NGYA 3P4MA 1R6VA 2GFBB 2KPNA 1HHIA 3R06B 5IB1B 5D1ZD 1ZA3A 3I75A 3VFNB 3RIFF 2FATL 3OB0K 4RAUB 4OT1H 1DQDL 3RY5A 2Q8BH 1XCTB 3ZKND 4NO0A 4KPHH 4RMSA 4YHOL 4WI4A 1U8JA 4WW1A 1BJMA 3PP3K 4LQ1A 4UUJB 1HXYA 3ZDZE 1UADC 1E4XH 1HSAA 1TJHL 5FCSH 2UWEA 1Y18B 1NLBH 2UY7A 4GBXB 4UT9L 1G0DA 3W2DH 5E9DB 4HS6B 3MOAH 1A7PH 3LDBB 3VDCA 4QWWD 1IC7H 4P5KA 5ADPL 1U3JA 1YN6B 3PDGA 5SWSB 1ZHBA 1VEPA 1NFKA 1XF4B 15C8L 2R4RL 4PRPA 1IARB 1S7VB 1ZT1A 3LS4H 5A40E 2Q86A 1KIRB 2CQVA 5IW1B 3GJEA 4OZFA 1JPFA 1MAML 4BSWB 3MZGB 5JDSA 2DL9A 3DXAB 5FA3A 4ZFZB 4ELKA 1V7NL 3UAJC 1XF1A 5EIIB 3CGTA 3ZTNL 4PGBB 4HXAL 4UIMB 3P30H 5GHWL 3V5KA 3MJ9L 3TNNB 5M95B 2ARJQ 4JAMA 2Y6SD 5HHVL 4HS3A 1DZBA 2OI9C 3HUJE 1VACA 2PYFA 4MZ2A 3CDGB 3SQBA 4I48B 4KXZH 1J1OH 4OF3A 3VXUA 4NC1E 2EIEA 1FVDB 1ONQB 4P3CH 4M6NH 5E5UB 5GZOD 1DL7L 2EO9A 5I1CL 4XRCB 2EDJA 3D0LB 2BZDA 1J1PL 1JWMA 4JRYB 3I6LD 3THML 2IF7A 2EH8H 4RMQA 1KJMA 3QCTH 4P46D 1IEAA 3R0NA 1FLRL 4OLZL 3ZZ1A 3EDJA 5BW7C 1TITA 5KTEH 1Q9LB 3Q6GL 3NABL 4KTYA 3CU7A 3QIBD 3BT2L 2BY1A 5GJTL 4MJ5A 1XR8B 3LKRB 2EDTA 4G6FD 2DM2A 3RY6A 1FFPA 2FH8A 5T1LD 4MA8H 3O11A 2GITB 2BX5A 5C0EA 1P7QA 1ZHKB 3IDNA 2ESVE 1U8LB 1UM4H 1PG7W 3QUXC 4OZHE 2X7LA 5FUCC 1JGDA 4PV9B 5T1DH 5LQBL 1IGCL 3T3MF 1CL7L 5D8JH 1FE8H 2OTWB 5DJ2B 5DSCB 4PYHA 1RMFH 2YUZA 4E41D 1Q9OB 4NC0B 5ALBH 3IFLH 1P7QD 4S1RL 2Q6WA 4JFDE 5HPOA 4UI2A 3NN8A 2ADJA 3QUZC 4LQFL 4ZOBA 4LVNC 1QYGH 1I8IB 3G6JA 2CKBA 1D9KA 4TULL 5D9SA 3GSXA 1I75A 3MMEB 1PKQB 2GYSA 3U0PA 5EC1B 2FHCA 3T0BA 3WN5C 3U30C 2PR4H 4H1LG 1YEFL 5FF6B 1WFUA 3K81A 5CIPA 2E7HA 3IFOB 1S8DA 4AL8H 1TIUA 2VB5A 3C2AL 4ORGB 3LH2H 4Y89A 4XWGH 3T2OA 4WWKC 1KPUA 1WV7T 3FKUS 4F9PA 3T0XA 3HG1A 1WISA 2NY5H 3F12A 2XTJC 5KZCD 1P4LB 1PLGL 4HPOH 4ZDHB 5ICYA 1MI5B 2HJLA 4Y16B 4LCWD 4P2CG 5LBSH 4QXWA 4XZUB 4DGVL 1C7SA 3O3AB 1BLNB 4KHXH 5DEGA 3MRPA 1WBZA 2X10A 3M17B 4PJAB 2LQRA 4WWKB 5CJ5A 5J13B 3WLWD 4ZPVB 5HDLA 5CCKH 3MYZA 5D71L 4L4TB 3WFBH 2GK0B 1MCWM 4UU9A 43C9A 1BIIA 5FUOL 3VFMB 1Q1JH 3ZL4L 1LO0L 1GL4B 1QQDA 4LSTL 3N9GL 1RSFA 2V9QA 3W9DB 1BZ7A 1P9MA 4LCUB 3F7QA 4XNXL 1Q9OA 4JVWA 1KJ3L 4OIBA 3H9HA 4R4FL 2H8PB 4Q9QH 4GAYA 4PJ7A 4X6DA 1OGAB 2XFXB 5IMMB 4IRZL 3QIBB 5AZ2H 4AIZB 4GAJL 3RTQA 2X70B 5DA0B 1BGXL 3D39A 1JGUH 1T0MB 5FECB 1OT1A 3DV4A 1PG7X 5HHQB 3PV7A 1J8KA 2V2TB 1JV5A 1LP9B 5JW4Q 4KI5E 3EOTH 1KG0B 2Q3AA 4IDJL 1RJLB 3IF1A 1F4WL 1ZT7B 1JZ3A 5F9WC 3UCRA 2KL6A 3VFSB 3WNPA 5DRNB 5GGVL 2X4SA 4OIIH 3BISA 4XMLL 4ELMA 1O0VA 3IDGB 3QDGA 4S11A 2GI7A 1FL3A 2DM4A 4HIHB 4QWWC 1DVFA 3KYNA 3TNNA 2EZ0D 2Q8BL 1AIFA 4GG6F 5D4QA 5GISH 3M8OL 4XBPB 4EQ2A 2O5XL 3U9PL 2NTFA 1N3NA 4JFEE 4I0PA 3GMPA 4OZIF 2DI7A 5IHBA 1FVDA 3QDGD 4G3YL 4JRXE 5D1XC 3UJJL 5F7LB 1KJVA 4LRIA 4XVSH 3WKML 2X4OB 2ZSVA 1S5HB 4ONOA 1YQVL 4OZGE 1MIEH 5ERWA 1MCOL 4JM2A 5K9KA 2Q76A 3QPQD 2GKIA 1S9YA 2AEQL 3NGBC 2H9GA 3GSNA 3VCLA 4ZS7H 5J6HB 5JZ7C 4JHZA 5EORL 1TFHA 4EBQH 5HBBA 1BQHB 2W0KA 1OSPL 4WDIB 4XAWL 2E7LA 1EHLL 3DMMA 1HSAB 2HT4C 3I50L 5I71B 1CZ8H 3LD8B 3LZFH 3F7VB 3L7EA 3TCLA 4DJMA 5GS1B 4JB9L 1QFOA 3ARBB 4KZDL 3CLEH 4AENB 3QEUB 4M7JH 1P6FA 3PL6B 1CDJA 3NA9L 1WQVT 3PWJA 4GH7B 4P46C 4QHMA 1CDHA 1CFTB 4PTTB 2NZ9D 4RNRA 1CIUA 1UWXH 3VWJD 2FH6A 5BO1L 3RY4A 3TN0C 3SDCA 1OP9A 1KB9K 3MOAL 2IPUG 4JQVA 4IJ3C 5FO9A 4MCZB 5I1CH 3D85A 2X4NB 3MV7B 4P4RA 3ZYOA 2FDBP 3G5ZB 4RGOH 3LQZB 4MX7B 2CRZA 4DN4L 4BZ2H 4X6CE 3RZCD 1FNEA 1HINH 4KMLB 1PG7H 3U46B 3L3OA 5SV4A 4YIQA 5DRWA 2AS5M 3BFOA 1UXWA 1BD2E 2XQBH 3O2DH 5CD3A 4QNPF 2VKWA 1AY1L 1EEYA 3WHXB 4M1DL 2IAND 2VDKL 5D6DC 2X9WA 4FP8H 2CK2A 3LB6D 3EFFB 4P5MB 3FO1A 4BM7A 3QUKA 3TBSA 3TO4D 4XCCH 4PJCB 4OLYL 1VCAA 3MRHA 3V5HA 3HE7A 5CMAB 1BECA 3MRKA 1KCUL 4TQEH 4M6NL 4MNQB 3JVGC 4Y2DC 3LY6A 2YHGA 4KK9D 2ZCKL 1EVUA 2CMRH 4X6EA 2IBBA 4NM4L 3HE7D 3MRLA 3U6RB 1F11B 2V17L 3OG4B 4OZHF 4P3WA 5LGHH 1KC5H 3R4DA 2A9ML 4ZUWB 3BN3B 3O2VH 3UXFA 4GAGL 2NX5D 1MRCH 1J0KA 3VRIA 4QRRA 4JFXB 4WTXA 1G7IA 3K8LA 1INQA 3C6LA 4Z7VB 1EBAA 4R8WL 5C3TA 4QY8B 4NIKB 4YDLB 4QRQA 1BAFH 5FO7B 4QRRE 3SJVD 3KG5A 3GBNH 4ZO8A 4S1SH 5EZLB 2DBLL 3LKNA 1V5JA 2UZIH 5IROA 5BVJA 2C7UB 4YPJA 4X5WA 2PYEE 2OMBA 4JFDD 5DD5L 5HI4C 4KZEH 5C09E 1G0YR 1U93B 4UBDD 3SGKC 2KZWA 2XY2A 1JTTA 1ZK9A 1OP5H 3WFBL 2YOCA 4H8WL 3EYOA 1CXHA 4P99A 4ZUSA 5I8EA 5D1QB 2D7NA 5DVNA 2YD6A 32C2A 3BN9C 1OAYH 4OIAA 3NPSC 1PBYA 4X8JB 3NFPA 2MWCA 3KDMA 2FECL 4G6ML 3OF6A 2WBJA 1NGQL 4G7VH 1B2WH 3RL2A 4IRSD 1YZZA 1HDMB 4LMQI 3H9SD 3HI6L 4F3FB 4RAHA 5KW9L 2Z35A 3VD4A 1FZOB 1OGAE 2R69H 5IVOA 4NQCA 4QHKI 4JKPH 3BEVB 4MQXD 5E1AA 1KEGL 5IQ9B 3OXRA 5CGYC 3S4SB 3WUZA 4WEBH 3V4VL 3BUYA 3GK8H 1INDH 1QVOB 1KBGL 1YNTA 1BQHA 2PXYC 3D3VE 4WDIA 4F33A 3AY4C 3OXRB 4P59H 5KVFH 1B88A 3SQOH 3CZFA 3QFJB 1CTOA 1SJEB 4O51A 1D5BB 3GSVA 3QT2A 3ZDZF 2VZTA 2VDMH 1MAJA 2W9LA 3PL6C 4JM2B 4ZQKA 1MUJA 4N8VG 1A14L 2J8HA 5CBAA 3NH7L 4JFYB 2AGJH 2EDEA 2UZYB 1U91B 1Z5LB 4XNZB 3UBXA 5GS0C 4FNLL 3BDXA 1G9MC 1JRHL 1HK6A 5I76A 4HPOL 4OLEA 2W9DH 4CRPA 2UWEF 2R23B 5BS0B 1KJ3H 3WKMH 3DUHA 1MRFL 3CVHH 2PNDA 2BVUA 4LKCB 1Z6JT 2MHAA 4YWGL 5GPRA 1MJ8H 3HR6A 5BZDB 4M6OH 3WXVH 1F6AA 4G8EA 4R26L 2X05A 5I1HH 2A9NH 3MA7B 1XGUB 5JIKA 5D2LB 1DUYA 5KJRH 3OJDB 4YHYB 3QXDB 4KKLD 3RL1A 5K9JL 3LKPA 1R5IA 5CILL 2AKRB 4R2GC 1R24B 4R9HA 1MCKA 3AAZA 1OARH 1W0VB 2AJXH 2VC2H 3QEQA 3KWWB 2HFEA 4KQ3L 4XNQA 5GQBA 2I60L 3F58L 2VQ1A 4XGZA 3RTQC 3T4YB 2HFTA 3ESVF 3G5VB 5I8CA 1V3JA 4H88L 4F80A 2ZKHH 2PO6A 2VN7A 5DMGD 4LNRA 1R3IL 4Y5YA 1UM5H 1VESA 1HHKA 3JWDC 4OGYL 3IFPA 5GGUB 4DEPB 5EA0L 1XGPB 3NAAH 3QUYD 3DSFL 2H2PC 4KKAD 5E8NB 1QSFE 3L95B 4HUMB 2AK4B 5AZ2L 1M7IA 3O9WA 4JZOB 3FN9A 2GCYB 3GSQA 4HGWB 1A1NA 3BIAX 4PY7A 3LKQA 1KF9B 3HS0B 5DUMH 5F3HA 3TF7C 3H9SB 2F5AH 3OG6B 3KGRA 3L7EB 3TCLB 5AEAA 1X5AA 4K3EH 3Q0HA 4R96B 5EC2A 5IB2B 1PG7L 3SJVB 2HT3C 5I17B 2AEQH 2B2XH 4FTVD 3BQUA 3L1OL 2WQ8A 4GUPB 1ULVA 4HXBL 5EZIH 3QP3A 5H94A 5C08E 4YBQC 1N6QL 25C8H 4KKNA 4OF0A 1GHFL 5FV1L 1ZLWH 1CZ8L 4HEPG 5F1NB 5L7XL 2HFFB 4NO0D 1EMTH 2FO4A 3ARDD 1CR9H 5F1IB 1GXEA 3GSNH 1S5HA 4GG8A 5A2KH 4LEOA 1ORSB 5F1OB 4I0PC 4Q9BA 3PGCB 3GSOB 1AP2A 5E2JA 2D2OA 2VQ1B 1RZFH 4YO0B 3TBVB 1UQSA 3TIEA 3HKFA 1AHWB 1F4YH 1KPRA 4JKWA 2BRRH 3CFDB 4PY8J 4XNZC 5DD0H 1B0RA 4NKOA 3S8WA 1S3KL 3MCKA 3QDHA 2ICWJ 5F6IC 3QH3B 4CUCA 4R7NB 5GJSL 3CXHK 5FGSA 4HAGA 4JFHD 3V8CA 5JXAH 4GRWB 4ISVA 1IM3B 1MCQA 4NM4H 2FIRT 5DJ0A 1D9KC 1JNJA 5KSVA 3FRUA 3QNYA 2C3WA 3QDGE 1VFMA 1YEDB 2EECA 2GHWB 3EO9L 3GMMA 5E94A 4DKEH 2G5RA 4B0MM 1UA6H 4G9FA 1PDKA 3WHE1 4M7JL 2X1QA 6FABL 2ZSWA 2O61B 4AIZA 1HIML 1C8PA 5ALCL 1IEBA 3UO1L 3BH8B 4X99A 1EEZA 3DYOA 3PWJB 4ZFOL 5IBTL 5BRZA 3O2DA 3MRFB 2R2HA 3L3JB 3QA3B 3RZCB 3IRZA 1VPOH 2X5PA 4LCWA 2HMIC 3PWVA 3QQ9D 3I6GB 4JO4L 4JGJA 3EFDH 4KV5E 2B4CL 3SKOB 2XIDA 1CGYA 3EOYG 5FKPA 2NXYC 4UINH 1T1ZA 2W65A 5BRZD 4YPGA 3UYRL 2J3SA 2FO1A 4UU9B 43C9B 4N8VA 3INUH 4JN2A 4U6VL 4O4YL 2DN7A 3DBXB 3VJ6A 5TH2B 1N7ML 5DMJB 4APQA 4BUHA 1QA9B 2BOBA 2YPLE 3MRNA 4WI6A 2AK4A 2J6EH 2CRIA 1KN2L 4JQXA 2G60H 3BKYL 4KMTL 5F93C 1U3HC 1BQHG 1T03H 1W0WB 4OUOA 5ITBL 5LXGH 3K80A 4O9HH 3QCVL 4ZFOA 3CMGA 2DLEA 3RWCA 1OTUD 4PJGB 3QJFA 5C0CD 4EKXA 3RAJH 3MCLL 4M93C 1B9ZA 3T09A 5D2NA 5C07A 3PQYB 1CU4H 2OYPA 5TDOA 4YXLH 4Z7VE 3WMSA 2ZWLT 2J88H 3SDDD 3G6JE 5B22A 4ZUSB 3UTTA 4I4WB 1A6PA 3DROA 2J8UA 3QNZA 5I16B 2PR4L 4QXTA 4PLJD 5C07B 1U58B 3UPAA 5IVNA 4P4KD 1CF8L 2JJTC 4MNHB 4GUPA 4NUJA 4P2YA 2IH1A 3S3JA 5HHXL 3GZKA 4KTDL 1U41A 4QTIL 4Y1AB 3I6GA 3ZL4H 4Y88A 3SKMB 3L3GB 5KSUB 1JPSH 2XQYG 5C0NC 1EBPA 4EI5D 5KANG 3VMNA 4JREB 3ARWA 4GKNB 5BRZB 3MLWL 4D8PB 1AXIB 3BWUC 1MHHB 3UZEA 5EPMA 2EICA 2G9HB 2F53E 3QULA 2Z31C 4DAGH 1J0JA 4PV9A 5DJXB 4D0DB 3X3FL 1F97A 3KNBB 4HJJL 3P77B 2IFFL 4N5ED 2IQ9L 4X4XB 1GAFH 1KCVL 1VFOA 4RAUA 3EW3B 2CRMA 3KAAA 3TFKC 3S4SA 1PSKH 3VFUA 1R24A 3OZ9L 3RVXC 4K55A 4Y2DD 1T1XA 4K7PX 3U7AA 2Z4QB 5I1LB 5J0BA 4Y2OA 3MACL 4U1HA 4X80L 2HH0H 1E27A 3HFMH 3SKNA 5J7CC 2X6MA 3CZJA 2MHAB 3B2UC 3QDJA 4LSPH 4UNTA 2JK5A 2ITDA 3DOSA 5ITFB 1YDPB 4R2GB 3B6SA 1OCWH 1DDHA 3VD5A 3WE6A 2FB4H 5I76B 3HB3C 1FAIH 1E6OL 1D3CA 1SBSL 1VSCA 3MYJA 1R5IB 2W0FA 1YEKH 1Z0NA 4NC1C 4PR5A 3LHPL 2FBJL 3U7WH 4RMUA 1S7WA 5DYOB 3IS1X 2FGWH 5IIEB 3NCCB 2AXJA 3VXRB 4M93B 2C4FU 3TESA 1IE5A 4RA0C 2FL5B 4AYFA 3K4AA 2VDQL 3MRCA 1NCBL 3OKDA 3V7AE 3VGHA 4LSUL 1A6VL 1MWAA 3A6OA 4MJ4A 3X14A 1FC2D 1OAQL 4LHQB 2EDNA 1D9KB 1DSFL 3EDEA 5DRZB 2IAMD 2UVFA 2HFFA 1MIMH 2AJUH 3ZYZA 4M8QB 4NJ9L 1RJZB 2ZUTA 3KHOA 1KTDB 2HTLD 4KI1A 2B39A 3KPRE 1FO0B 3VFRA 4U2ZA 5L0QB 3MUGA 1PEWA 5EO1B 4EUPH 1XFPA 1BVKA 4AY0A 3HZMA 4NN6B 3W39B 3LMJH 3L3GA 5KSUA 5JO5B 4JR9L 2GCYA 1FO0A 4WUKL 5F3BB 4X6EB 5FK9B 2X1XR 5DJAB 2RHEA 5D1QA 3AMLA 3EGSB 3IVKA 2NY6D 4K7FA 4BQ9A 2FD6L 3RNKA 1UH2A 4UQ2A 1BJ1H 1NGWA 5FKAB 5D7JB 2A77H 3KYAA 5B8CA 4PR5B 3OAZK 4L8BA 2V9TA 4CNIB 1RY7B 4JZJA 4YGAB 3IDMA 2QSQA 1FH5L 5FDWA 5IEHA 5MI0C 2C1OB 3OQ3B 2DWEB 4FQXC 2JCCB 5IVXA 4EZMA 2ZJSH 3VA6A 1K8IB 3V7MA 4MXVF 4Z78A 5EU6E 3MTRA 3AMKA 3VXNA 1TNMA 1VFAA 2F19H 3B3IB 6FABH 5L0QC 3TA3D 1QLFA 2PW2A 4NPYA 4I0PB 1NDMA 2AJ3B 4AIOA 3NH7H 3ZE2F 3OR6A 4JZNA 1LO0H 1NC2A 1IGIH 5D2LA 2M26A 2BJMH 3G5YA 3QIUB 4NP4L 4E9LA 3RPIB 2MPAH 4XWOC 1CGSH 3QB7C 4RGNE 1YMMA 4FQJL 3FFCD 2DKUA 1TJIH 4LIQL 4Q9RL 3VFUB 4ELKB 4X98B 1F3RB 3EFDL 2AABL 5DD0L 1YEGH 2R56H 5LKNA 3UEZA 1U0QA 2X4NA 4KRPC 5C0AE 5HYSG 5JXEA 3EO1B 3IU4L 1QEWB 5E24E 1GGCH 2ARWA 1FIEA 1F3JA 1FSKB 2NY0B 3TVMA 1GOHA 5TE7H 1G7QA 1VGKB 1RULH 2P5EE 1PEZA 2R2BB 4FXKB 3DI3B 4XI5C 4PJFF 4XCCL 4K23L 4HS6A 5IR1B 4XPFH 4NZRL 4ALAL 3QQ4A 3TVMD 1R0AL 2R0LH 4AH2A 1UT9A 4WU7A 4XPBH 1AKJB 4CW1A 1P7KA 4GRMB 3FQRB 3SEPA 4Y7MA 1SMOA 4NQCB 2VXSH 4LPYA 3TNMA 2OTUA 2CO6B 3VFMA 2OXGA 2OJZH 4U6HB 1S7UB 4WV1B 3VU2A 4F3FA 4JKKA 2AW2A 4PRPD 2HG5A 5DS8B 2DDQH 4PV8B 1HQRA 3KJ6H 1DQLH 4U1KB 1BF2A 1RUPH 1KCKA 5BCAA 3TA3C 3L3OB 5DUBA 1DBKL 5INDA 4XVJL 1A6TA 5KN5A 3MUZ1 1C12A 1MCDA 4G6AD 1I9JH 3HG1E 3NIDE 4YAQB 4H0GA 3EO9H 4F7MB 3QNYB 2YPLD 3BZFB 1QFWH 5DHVB 5CP7B 2Y1VA 2AP2A 4PJCE 5F44A 1W0WA 4HZAA 2VDNL 3WLBA 3O6ML 3PABB 4LVNB 1RUAH 3P9LB 5KVDL 3QCVH 2OL3B 3WFHA 1CE6B 1OWRM 4X5XA 1IVLA 3S88L 1FCGA 3VXUD 2CJUL 4Z77A 2D7TL 1G1CA 3TA3B 2ICES 4C83B 2VXUL 5DMKA 4F8TA 4XP6L 5I73C 5FF6A 2DOCA 4KUCF 1Y6KR 2D7PA 5DVOA 4HIXH 1HILA 3D85B 2VERN 3E6FB 4HFUL 2JELL 4BZ1L 5HHQA 4Y0GA 1I7UA 1TVDA 3ESUF 1SYSB 5L2KE 4KHTH 1AGEB 2IFGA 4J8RB 5ANMA 3EYSH 2XNAB 5C1MB 1RZIB 1OT2A 4W81A 5MP6L 1OGAA 4WUUB 5MEND 5C0BE 5CBEA 5C6TH 5TH2A 2I07A 1SHMA 4JQXC 4ZUWA 4H1LA 3BPCA 4Q7DA 1JZ7A 4X9BA 1AGEA 5C0JA 4NNYA 1A22B 4L5FL 1HHKB 2CKBL 4Y5XC 1WTLA 2HAZA 5EU5B 1A7QH 3IETB 4LAQL 4YGVB 4GFTB 1I3GL 1F2QA 3S36L 5H37G 5J11C 4N9OB 5BV7L 5BRZE 4G8IA 1FYHB 2AQ2A 2QKIA 3DECA 3QUYA 1KNOB 1A1NB 5IHLB 3L3KA 3I85A 4Z7WA 1I3VA 3QIBC 2WZPD 2Y4SA 3RGHA 1HHHA 1DVFB 4GMSH 1EO5A 5KJRL 4J3SA 1K5NA 3EYQD 2ZNWA 4LPXA 4TUJA 4JHAL 2VDML 3EIFA 5EN2B 3NOIA 1R3LB 4ERSL 2Q20A 4ZFOB 4JPIB 4LK4A 1WBXB 2XWBB 1C5BH 1NKRA 2EDWA 4HG4K 5HGBA 2A83A 3SDCB 1JRHH 1UEYA 3DX8B 2DF3A 5GZNC 2WWKO 1NL0H 4JLRB 4J2XA 4RFEA 1RURH 4M7ZC 2P8PB 3ARDA 3DUSA 4M5ZL 1HCFX 4NM8L 1KEMH 1JI1A 2IG2L 1A0QH 1S8DB 4WFHE 1UQSB 1C08B 3IF1B 2AQ3A 1J87A 3OKNA 3ALPA 3T0DA 5EU5A 3V4VH 3ETBF 5BS0A 1JUFB 3RX7A 1I8LC 3PXHA 3DWTA 4FQHB 5GS3A 3GGWA 5E9DD 4H1LB 4XPTL 3O3DA 4NN6C 4L4VB 4G5ZL 1EAJA 1MHHA 1WK0A 4POZC 2RFXB 4F9LC 2ARJB 1YJDH 2DQJH 1DSFH 3DX7A 4QTIH 2IPKB 1JGDB 1LO3L 5E4EC 5ID1B 3HPLA 3NIGE 4HGKC 5IMOA 4BFIB 3QAZC 4J6RL 5FA4B 4DK3A 5JHDA 1I8LA 3W2DL 3MUHL 1L9NA 2PCPA 3P73B 3O6FA 1J86A 2XN9B 3OMZA 3DROB 4YFEA 5JR1L 2HJKB 1FV1A 2ID5A 1YEKL 2YD9A 2NTSP 2NR6C 1TNNA 2K7QA 4KDVA 1IAIM 5F7DA 5F7KC 3ALXA 4NKIH 3V6OC 1XGUA 4WUKH 5KZCB 4DZ8B 3BHBB 3B2VH 2CLZA 3G08A 3NZHL 4A6YH 2XQYK 5FHBH 3B3IA 1KGCD 5DMYA 5ACLA 1UYWH 5D2LF 4BH7A 1VGEL 1PY4A 5IEHB 1RULL 2F54E 4HUWB 3A6BH 4X6DE 3D69A 1G9NL 3LN4B 4JO1L 3ZYIA 2BSTB 3H9YA 3BSZL 4KJWC 2PO6C 2XY1A 4M61A 3TYFB 3BW9B 3L3KB 4RZCA 5C0CA 5EC1A 2ICEA 2FRGP 3GHEL 2Q8AH 1HYSD 1MY7A 4JY6A 1QSEA 2VXSL 2X1WL 3FQUB 3GMRA 2FR4A 3ZE1E 1D5ZA 3PHQB 2QL1A 2WNGA 3LKQB 2E27H 4CKVX 3UYOD 4ZO6A 2GK0A 5SWZD 5CZXC 4FG6D 4G42B 4WWID 5KTEL 3NCFB 4APQC 4DQOL 3PJSA 5SWSE 3GBML 3C6LB 4PJEB 1YECH 5IEKB 4NRXA 3QO1A 5E94B 2VYRE 4GW5B 5IF0B 1CI5A 3NACL 3U4BL 1XF2B 1NGXB 2UWEB 1KIPA 4F7PB 3MRHB 3MLRH 2OZ4L 5C9JA 3BO8B 3MLUL 4KK5C 2YRZA 4G9FD 5FOJA 5EO0A 5TF0A 5JHLL 4XX1G 1M6OB 3MRQB 4JANB 5HHNB 1IT9H 2Z8VC 1LMKA 3QWQB 1D5IH 4XCFH 4RWYH 4O58H 5EOCH 1A6UH 4JQIL 3VXRA 2WBJC 2P24A 4BSVB 3EYOB 4ZOCA 1ADQH 2IADB 3QEHB 3P11H 1HDMA 4TSAH 4YO0A 2VO5A 4KROD 3TBVA 3TIEB 5DD6B 3T77A 1P53A 3K2UL 3BP5B 1FZJA 4KRPB 1BWMA 2WBJB 1J05A 4MAYC 1EAPB 4UAOC 2E6QA 4M00A 3L5WA 4L9DA 5I1JL 1OAXL 2VLJD 3P0VH 3GJEB 5AYUL 35C8L 2I9LA 5DD3L 4HCRA 3DSNA 1Q0YH 5F1KC 1UH3A 4ODSL 1BZ9B 3P30L 5GHWH 1OAZL 3X3GH 4UV4L 2SEBB 3DX6B 3BZ4B 4W4OC 4KUCD 3RJDA 4OV6F 4MA8L 1LNUA 5CHNB 4IHOA 3QFJA 2P8LB 3TLRA 2X4PB 3CLFL 3DXAE 4YDKL 4Z18A 3QDJD 3B9KB 5DQ9A 5BVJB 1QNZL 2OTUB 4OCLC 1DN2A 5HYEA 1DBAL 4HIIA 1VPOL 4U1LB 4XP1H 4K94C 1F4HA 2L7JA 3QYCA 4OZHB 2LU4A 5KSAA 2MTPA 1CR9L 3GBLA 3QFJD 1WCBB 3VE0B 2X41A 5IKCB 2ZOLA 3LEVL 2D03L 2MCPH 1HH6A 1AH1A 1FZKB 5CMAA 4Y4HA 5D7IE 1ZHKA 5IKCA 4KI5C 3PV6A 1CVRA 2PXYB 4X80H 1Q9KA 1MJUH 1BVZA 2Z92B 1YEJL 5T3XL 3BP4A 3UTOA 1BX2B 4LP5A 1IKNC 3L5JA 4EI5A 1MWAB 3LKRA 3QHZH 3FQNA 5LXGL 3WL9B 3RKPA 1PFCA 3H9ZA 4B7LA 1OPGL 3FB8A 4U1IA 4XWGL 4DKFL 5JOEA 4HWBL 1CDBA 3I75B 3G6DH 4HG4J 2ICEB 1KEML 3C6LD 4EN3C 1QPXA 3HMWH 3A67H 3MJ8B 4ZSOB 1KCVH 3FFDB 4LCYA 4XP9H 5T5FH 2D7TH 4X4YB 5BV7H 3KPSA 5F6HI 5CZXD 3S36H 4U4BA 2C3VB 4FOMA 4LCCC 2WWKT 4Z7QF 2I9LB 1J1PH 3HRZB 1OTSD 3VGBA 4ZMAT 3C2SA 4KVNH 4PG9B 43CAA 4PJGA 5I1KL 2PW1B 3QEGH 4G8FB 1K4CB 3S97C 4F7EA 3NCBB 3FN0L 4TYUA 5D6DA 1WIPA 3DIFA 2DQIH 5DVMA 2XWTB 3OKLA 2YN5A 1KSRA 4R4BA 3O3BA 1ZT4A 2H26B 4YX2L 3TBTA 3MBXH 5FKAA 4NZTL 2OZ4A 2BOBB 1ZHNA 4MD4B 4D9RE 4PRAA 1Y18A 5JPNA 5JXED 3RRQA 1YYLH 2WBJD 4YNYB 1NMAH 5J3HD 5BV7C 2DBJA 4AEEA 5DFTA 1BM3H 3BP4B 5I0DA 3OL2A 2FCBA 3MGOA 4MS8C 4NQEE 3P0YH 3UX9B 4KK5D 5EOTA 3D1MC 1ZEAH 3HHRB 4MA1B 4X7SL 4ZFGH 5BJTA 3DMMC 1A7RH 1EFXD 5IK3B 5IM7B 2FWOB 4JZJC 4WENB 1WBZB 4WHYH 4Y4FD 1GH7A 3IGAB 4X9FA 2IANA 4PJ5B 3O3DB 3LRSB 2DQTL 3DJ9A 4ZPTB 3C8DA 4OZ4A 1IKFH 2CDGA 4ODXA 2F15A 5GGRB 2IAMA 4XPTH 4YUEL 4IOFC 1VHPA 4JB9H 5A2JH 4TVPL 1UCBH 2OI9B 3QG6B 5KS9E 3PNWA 4HWZB 2BNRE 5IFHH 4HK0B 4KTDH 4CAGA 4OUUA 4QXTB 3LH2L 4M61B 4ZAKB 5ESAA 5B39A 1SBSH 3ZDXE 1WZ1H 3X12B 3IJHA 5L9DL 3QQNA 1EHAA 4H25A 3SPVA 4UQ3A 4PD4J 2CIKB 4U6XA 4Y19A 2CIIB 4ZXBC 5AAWA 1LWRA 1QSZA 4J1UB 4J3WA 2V2TA 2JB6A 1D5MB 5I8OL 1Z9SA 1ZLUH 1OHQA 1E6JH 3VRJB 3OKEA 4K8RH 1QZ1A 1CFTA 4PTTA 4KDTA 2GUOB 4A6YL 4KKBD 2QHRH 3MBEB 2X4SB 5C09D 3E1F1 3U0TA 3FTGB 1ED3B 1Q1JL 4X5LA 4HGMA 3MO1A 3IAPA 4PJAF 3WNNA 3MRQA 5T33H 1I3UA 3HE7C 2R0LL 4LCWE 2FX7L 5KOMC 4HWEH 3VFGL 4FQJH 4S2SB 5MEQA 5B8CC 5C0EB 4O58L 5EOCL 1RFDL 3C8KB 2IAMB 3H9SA 4OBSA 5DDHA 2VJXA 1AC0A 2DL2A 2YZ1A 2H9GB 4LLAA 1HKFA 3O9WD 3GKZA 1UWXK 3CUPA 1AGFA 4NQED 3UJIH 1FFRA 3T2QA 2XRAL 4WO4A 3PGFL 3FQTA 3ROOB 2EEAA 1JBJA 5CD5D 1RIUH 3VG0L 4RIRA 2VXQL 2HFGL 4PB9L 1WSST 4RX4D 3OB0H 4GKNA 4PJHE 3BI9X 2R1WA 1V3KA 2I27N 3LEYH 3U7YL 4CN6A 4NYLA 2P4AB 2Z31B 5K9OB 1TVBA 3MRGB 4FTVA 4K3DL 1QKZL 4JVPA 2XA3A 4J1UA 3T3ME 2CR6A 1S7XA 1T22A 1NDGB 3D3VD 2BMKA 1UXSB 4AG4L 4LSUH 1OLLA 4AM0B 4HC1H 3CSGA 4HPYH 2YPVH 5T1KB 3LZFL 1KB5L 3RVVD 4WI9A 4KGLA 1MHCB 3EO0A 3VMPA 4ORZC 1MCPL 3MROA 5JIPA 3HAEG 3HC3H 4RFEB 4MGXA 4MX7A 4HDIA 3MV8B 3G5ZA 1FFOA 2J8UE 1F6AB 3GBNL 4XP4L 4WTZA 1A6UL 3TT3L 5ICYB 2P45B 1GC1H 4TVSa 2HJFB 3MJ9A 4PTUB 4EI6B 2CO7B 4QHNB 1MWAH 1J7VR 5EIVA 3RQ3A 4JG1H 2GJ6A 3RVWC 2AEWA 2VMFA 3D0VA 3LRSA 3WS3B 5D5ME 1KJ2H 1XIWD 2P5EB 1UM6L 5DURD 5LGJA 1NCCH 4OV5A 3E3QC 1D5BA 3GSVB 1OAXH 2BVEA 3I50H 3FT3B 5EH1A 3T1FA 4MAYB 3NCJL 1Z3GL 3H2WA 1I7TA 4GAGH 2HKFH 5TE6H 5E8OA 3AM8C 1RK1B 3MNWB 3STZA 4XC1L 1U8HA 4F2MB 3CFJB 3CCHA 1H3VA 1RZGB 4OT1L 4WCYH 4MAYA 3VRLE 5DK3A 5E2UL 5B39G 1CT8A 2N56A 3BKJH 4LLQB 3G5XB 2E8ZA 4R4ND 4MVBC 5F89A 1CLZH 3WEXA 3VFNA 2WP3O 5DF0A 1FZOA 1L9MA 2MOVA 4M3KB 2IGFH 1WEJL 3GO1H 4MWFA 4M1GL 1A9EB 3P4OA 3UYPA 1QO3B 1T0PB 3QBTB 4XBEL 3W5MA 1DVFC 3OTTA 3VXUE 5JQHC 1AKJD 1RUPL 1IQWL 1MCWW 1I7UB 1ZWIA 3GUTA 1IC7L 3VXSA 2WANA 1EVTC 2CGRL 2NY2D 5I18L 2KUTA 5KVGH 4X7FC 3I6KB 4XXCC 2HFEB 2HLAA 5LGHL 4Z7WE 3C08L 5TQ0L 3ARQA 2YK1H 3BUTA 1XGQA 2AK4D 1N64H 3TO2B 3LKSB 4PRAB 3GRWH 1HHIB 4MLSA 4R7NA 3PWNB 3AU1B 4QRTB 4FFZL 4DEPC 4XBGA 3N06B 4H26A 3QUXA 1OPGH 3BPNB 3SDAA 5KW9H 4FTVB 3VGGA 1K4CA 3HNVL 4EVNA 4YWGH 4OLYH 5MEOA 1MJ8L 2B8OT 3D39B 4UQ3B 3HLAA 2V5RA 4GSDH 4YGVA 4FZ8L 3Q1SL 1E28A 5HGDB 2QV2A 3O4LE 2ADIB 5L2JB 4G6AC 2FHFA 2PXYA 2Z0BA 4HUXB 5A16A 3SCMA 3T3PF 1YN6A 1KBGH 1M05B 4QRRD 3VXQB 4EDXB 1A1OB 3S35H 1J12A 12E8L 2HG5B 4XNUL 4RGNB 4NGHL 3RA7L 5HHMB 5ANMB 2IANE 2HKHH 5ACZB 5FGCB 3VXPB 4HKZA 1FJ1B 5ELIA 1KC5L 5I1EH 4Z8FL 4OZFB 4P46B 5JNYB 4HQQH 3QXTA 4J6RH 1FFPB 5HY9B 1BEYL 4X7CC 3SDXF 5GGTA 3EDKA 4GW1A 4XPHH 3V9FA 3TPUA 3SCMC 4Z7NF 2W92A 4XNMB 1QR1B 4DGVH 4QF1B 5J89A 3JWOL 1N8ZB 1KXVC 4R0LB 4O2FB 5DHXB 5DHYB 5DJDB 4PREB 2Z8WC 5DK2A 4HKJA 4M5YL 5JHDE 4I2XE 5AUMB 4OFDA 1QHOA 4HMEA 1BQLH 5A3IC 2QSVA 4HEME 1YJDL 3W11C 1P7HL 1FRGL 1Y0LB 1Q72L 1JNNH 2C3HA 5TDNA 2MSPA 1WVZA 4I48A 3HNTL 3WIHA 2F53A 5EU6A 5D1XB 2XT1B 1MRDH 3FB7A 3ARVA 2KBGA 2BNUB 3QIWD 4R0LC 2Y06H 4U3HA 3S98A 3OGCA 4L1HA 1GGYA 4U1JA 2CK0H 5FOBA 1BFTA 4UZGA 3OB8A 4MSWA 3SCMB 4OLWL 4A2MA 3STBA 5KVMC 3MLPA 1FGVL 4HK0A 3WSQH 3FB7B 1A4KA 2EE6A 2B1AH 4C54A 3C6SA 4XB7A 4XMPH 4H5SA 4XVTH 3NAAL 4OGYH 1MHPL 4UILH 5EBGA 1HKLL 5E2VL 5FO9B 4HT1L 5INDB 4HV8A 1XF3A 3MLYH 3D9AL 4JZJB 4PB0L 4P57A 3FFCE 1KFAL 3A6CH 3FB6B 2RJMA 4PB9H 4QRTA 2GAZA 3QHFH 4U6HA 4H0IA 5BXFA 3KPRD 4O51B 3VI4E 4NO2B 4OD1L 1NBVH 3VG9B 4FABH 5ESQB 3FMGH 3TYGL 4GO6B 4F33B 1JTPA 3B2UD 3IXAA 3ULSB 1QYGL 4WHYG 3MUJA 3MNWA 1A7NL 4NQDD 4HPYL 4EJ1C 5IMOB 2QR0B 2GFBA 2JKXA 4H88H 1YNLH 2NY7H 4EEEA 1U8MA 1KJMB 4NQSB 2ARJA 1JZ4A 1FL6B 3BZ4A 3ILPA 3L3DB 1UM5L 1WFNA 4M8QA 4D3CL 1DQTA 2ZUQC 3RWEA 2FX9H 3VFPA 1RU9L 1QEWA 2GQHA 4R4FH 5AAMA 5T3ZD 1EH9A 4K3GA 4IRJB 5ETUB 3I3EA 3QG7L 4Z76A 1QSFB 3G6JF 4JG1L 1EFQA 3NFSL 4S0SD 3TBWA 3WFEL 5A3ID 3JV4A 1A5FL 4WI2A 5I1IL 3L9RB 4C4KT 5J9PA 3L7FB 3FL7A 5FYJH 3MNVB 4ODHL 2J6EL 2ORBH 4KZDH 1K6QH 3WIIH 1P6AB 1Z2KA 1D6VL 1BOGA 1FGNL 4AEIH 3IVKB 5BQ7B 4GBXD 3C5JB 3UAJD 3FB8B 1P2CB 4KRPD 4BFEA 4JANA 3MCLH 4EI6A 2NY2C 1TETL 3FOMA 1RAMA 1VB9A 3GSNL 1CU4L 1ZT1B 2E8YA 3KYKH 4P9HC 3TZVC 1KLGB 3DARA 2JE8A 2FHBA 4ZTPL 3RVTD 1IAII 4TOYL 5EOQH 4NQDB 3SO5A 1FVEA 3UJIL 2W91A 3D5OF 4J4PA 2DQFA 4Z7VA 1NJ9B 4M1GH 2XPGA 3WNKA 4KI5F 4L3CB 3RDTA 1T4KA 2CXKA 3DGGA 5IP4A 3X11B 1CK0L 4PGDB 4FQ1L 1FIGL 4QXGH 3MRDA 4JCMA 3W39A 1ZS8B 2CLVA 4NO0B 4O4YH 3PHQA 3CMOL 4G8IB 2FR4B 1T6VN 4MXQD 1TVBB 4ZUUA 3PHOB 2DM3A 5D5MB 4GW5A 5IF0A 3IAGC 3EOTL 2DMCA 2X4PA 3O6LL 4LCIH 2RB8A 1XZ0A 2ICWI 1LO5A 3QULB 4EOWH 5D7IA 4TPRL 2AV1B 2SEBA 3SE4C 1EEZB 4LARL 2W0FB 1CD1A 2FIKB 2YD5A 1F8TH 4WCYL 5HGDA 3BWAA 5I9QC 3LOWA 2YEZB 1SYSA 4U1NB 4JPWL 5I2IA 3Q1SH 1SYVA 2ZPKH 3T2NL 5JIIA 2DLFH 3GRWA 4IOFD 2CIIA 2IH1B 3HI5L 5I19H 2P5WB 5KSBF 2HFGH 4IS6B 5DR5H 4P4KC 1RQ5A 1CLYH 1B3JA 1T1XB 3BKYH 4KMTH 4PLJC 1XR9B 3I3DA 4MDIA 4YHNB 4BZ2L 3PE9A 3HC0B 1U8OA 2WWMD 3FQXA 5F7HA 1FV1B 2P5WA 2OL3A 1QKZH 2OJEB 3CLFH 5EOCJ 1YYLL 4MVBD 4EUPB 5CINH 1Z9OA 2X4QA 1X44A 4XP5H 5CEYA 3U0PB 2ITDB 5ITFA 4W6WB 5E6IA 1NUNB 3JZ7A 3DV4B 4DAGL 2QQKH 3R8QA 1NC2D 4YAQA 4IMKA 1ZSDA 1IL1B 5KSBE 2RR3A 4LSSH 4PRIA 4X6DB 2P48B 4X7SH 1Y6MR 4D9LL 1NFDE 1OTTC 2NY2B 3GO1L 3WEXB 5IFJA 2YS4A 4GLRH 3WDJA 5ESVB 1CFBA 2JIXD 5B38B 4RQQA 5D5MA 3RX8A 4LDOB 4UB0L 5JHDB 4UT7L 2V5YA 3RWHB 4I0PD 1MFCH 4OLUH 1PKOA 5C0IB 1MJUL 5F6HJ 3ZDXF 1M7XA 2MKLC 2Q7NA 3MQIA 3FO2B 3QQ4B 2R0ZH 2VTFA 4TNVF 3M17A 4OKVB 4PJAA 4DKFH 1HINL 3Q6FB 4JFFD 4KJPD 3UZVB 4P23D 1YY8B 1QUNA 1LO4H 4Z0XA