1I43A

Cystathionine gamma-synthase in complex with the inhibitor ppca
Total Genus 127
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
127
sequence length
396
structure length
396
Chain Sequence
YASFLNSDGSVAIHAGERLGRGIVTDAITTPVVNTSAYFFNKTSELIDFKEKRRASFEYGRYGNPTTVVLEEKISALEGAESTLLMASGMCASTVMLLALVPAGGHIVTTTDCYRKTRIFIETILPKMGITATVIDPADVGALELALNQKKVNLFFTESPTNPFLRCVDIELVSKLCHEKGALVCIDGTFATPLNQKALALGADLVLHSATKFLGGHNDVLAGCISGPLKLVSEIRNLHHILGGALNPNAAYLIIRGMKTLHLRVQQQNSTALRMAEILEAHPKVRHVYYPGLQSHPEHHIAKKQMTGFGGAVSFEVDGDLLTTAKFVDALKIPYIAPSFGGCESIVDQPAIMSYWDLSQSDRAKYGIMDNLVRFSFGVEDFDDLKADILQALDSI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CYSTATHIONINE GAMMA-SYNTHASE
publication title Crystal structures of cystathionine gamma-synthase inhibitor complexes rationalize the increased affinity of a novel inhibitor.
pubmed doi rcsb
source organism Nicotiana tabacum
molecule tags Lyase
total genus 127
structure length 396
sequence length 396
chains with identical sequence B, C, D, E, F, G, H, I, J, K, L
ec nomenclature ec 4.2.99.9: Transferred entry: 2.5.1.48.
pdb deposition date 2001-02-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01053 Cys_Met_Meta_PP Cys/Met metabolism PLP-dependent enzyme
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.640.10 Alpha Beta 3-Layer(aba) Sandwich Aspartate Aminotransferase; domain 2 Type I PLP-dependent aspartate aminotransferase-like (Major domain) 1i43A01
3.90.1150.10 Alpha Beta Alpha-Beta Complex Aspartate Aminotransferase, domain 1 Aspartate Aminotransferase, domain 1 1i43A02
1IX7A 2E7UA 4JF0A 2D63A 1ZC9A 3ZRRA 4IYOB 2CSTA 4AO9A 1I48A 3DR4A 3BS8A 1ECXA 4A0GA 4QGRA 3DXVA 4ZSWA 3BV0A 4RJYA 3QBOA 4Q75A 4WYAA 3QI6A 1E5FA 4XJMA 3NUIA 2Z9XA 2F8JA 4GSAA 1V2EA 2VMYA 3I4JA 1MLZA 2YCNA 3ZRQA 4CVQA 2DKJA 2CINA 2BYJA 3IHJA 3T32A 4WLHA 4ATQA 3FRKA 2EGYA 1ASDA 1FG3A 4JEXA 5F9SA 1KMJA 4N0BA 1D7RA 1M0PA 3B1EA 4E3RA 1X29A 3AEJC 3D6KA 2BWNA 2JISA 1WYUB 3FQ8A 3NDNA 4WYGA 3FSLA 3I5TA 4F5IA 2R5EA 2Z1ZA 4PVFA 1DTYA 3DRDA 1V72A 1JS6A 1U08A 1WKHA 4WD2A 3WCNA 1S09A 1X2AA 3EI7A 4ZM3A 3NNKA 3RI6A 1ASEA 1PMMA 1WSTA 1ZODA 1PFFA 3K28A 3B1DA 4P3MA 2FNUA 4W91A 2CFBA 1B4XA 2DR1A 3VAXA 3VOMA 1AIAA 4ADBA 2JJHA 3AATA 2HP1A 2HZPA 4WB0A 3EI5A 4JE5A 3A2BA 3HVYA 4ISYA 1CZCA 1W23A 2YKXA 4ZASA 1Y4IA 5FT4A 4CBSA 2VMXA 3B1CA 4E77A 4ZDLA 4OT8A 2D61A 4LNMA 1VP4A 1D2FA 1IVRA 2Z20A 4MY5A 2VGWA 2AY4A 2D65A 3QN6A 5D95A 2YKVA 2YHKA 3EI6A 3G0TA 3WZFA 4CBRA 1TOKA 3ZRPA 3AOWA 1E5EA 2E7IA 1CQ6A 3FZ6A 3MC6A 5M4BA 1UKJA 2VGZA 2C7TA 3JW9A 4R5FA 2Z9UA 3F0HA 1D7SA 1I41A 4ITGA 4L0OA 5E3KA 2JG2A 5EUNA 5IWQA 2OGEA 1TPLA 2VLFA 5FT6A 1AY4A 1QGNA 3FZ8A 2R0TA 2VIAA 3DXWA 2WK7A 1WYUA 2YRRA 3HMUA 4PFFA 4XJLA 1C7OA 1GEXA 1TARA 2CANA 2VMRA 4OBUA 1YJZA 2W7IA 4DQ6A 3BWNA 3RUYA 2O7CA 3FD0A 3E77A 4AO4A 5HXXA 3BCAA 1ASBA 2OATA 4ZDPA 3VK4A 2W7MA 1LS3A 1GD9A 2TPLA 3TFTA 2ORDA 2YKUA 9AATA 1GCKA 2VMSA 3DODA 2ZJGA 3GBXA 3JWBA 1AX4A 3LVMA 4IXSA 4A6UA 4JEZA 2ZSLA 4K2BA 5F8VA 2GMUA 3ISLA 1VEFA 2Z1YA 2FYFA 2BI5A 1G7WA 3K7YA 4FL0A 2AY9A 2W8UA 1SZKA 1W7LA 2BIEA 2DOUA 1B9HA 2GMSA 3QM2A 4GE9A 4MQQA 5FT8A 1ARGA 5JAYA 1ASNA 1S06A 3II0A 1YAAA 1SZUA 3LV2A 3GR9A 4KAMA 1ORDA 2FNIA 2R5CB 4ZWMA 3RCHB 1GEYA 2EZ2A 4ADCA 1AMRA 1AMAA 2VMZA 3LVLB 3VK3A 1AJSA 3USFA 1GEWA 3PAAA 1ASFA 3CQ4A 4MKJA 1YJYA 1FG7A 1QJ5A 4W1WA 2VMWA 1TOEA 1ELQA 3W1IA 3FTBA 1G4XA 4EB7A 4CXRA 4RIZA 1AMSA 3WKSA 1I43A 3OP7A 2BKWA 1N8PA 5G0AA 4UHOA 3COGA 3HL2A 2YKYA 1AY8A 3PIUA 1SF2A 2Z67A 4UHMA 4WLJA 3TATA 1UU0A 2W7GA 2X5FA 2VI8A 1DJUA 3AEMA 4N0WA 5EQCA 1KL2A 3GZCA 3HLMA 1RVUA 1C9CA 2JGTA 3PJ0A 4BA4A 1AHFA 4FFCA 1SPAA 3GWPA 1IJIA 2D64A 2E54A 4DGTA 2CJHA 1TOJA 3NU8A 2W8WA 3PDXA 1YIZA 2JJGA 3TQXA 1KL1A 3MAFB 2W7JA 2C44A 1XI9A 4J5UA 4R8DA 1LW5A 2W8TA 3E2YA 1BJ4A 2O0RA 4WBTA 1KMKA 1LW4A 2PB0A 4R5ZA 3EIBA 1WYTB 4WYDA 3MC6C 2ZY3A 1YNUA 5EFSA 3H14A 1LC5A 2ZY4A 1LC7A 1S07A 4E1OA 4W8IA 1IAXA 1QIRA 2QMAA 3NYTA 3PGYA 4OCAA 1IX8A 4W1XA 1W7MA 3MBBA 2VMTA 2XH1A 4K2IA 4LC3A 3EI8A 1X28A 4EU1A 1DFOA 3MADA 3PD6B 3W1JA 2HOZA 2X8UA 3ELEA 2DGLA 3BWNC 4IW7A 8AATA 3PPLA 2AY3A 1EQBA 2NMPA 2X3LA 1M0OA 2ZSMA 2ZC0A 4XK1A 4OTLA 3L8AA 1T3IA 1MAPA 2W7EA 3GJUA 4WXBA 1AHYA 1ZOBA 4RLGA 3Q8NA 3LVKA 7AATA 1YOOA 3NUBA 3TCMA 1D7VA 2WKAA 2ZY5A 4RAEA 3BCXA 3E2FA 2FQ6A 5EUDA 2VIBA 2FN6A 4IYOA 1MDZA 4TMRA 3MAFA 3PDBB 2DGMA 5M4DA 4KYOA 3HBXA 1Z3ZA 3NRAA 4UQVA 2JJFA 1CS1A 2FM1A 1WYTA 3AOVA 1OXPA 4U1TA 3E6GA 2Z9VA 1CJ0A 1UU1A 4XEWA 4ZM4A 1C7GA 1C4KA 3A9YA 2W7HA 2VGSA 1X0MA 2BI2A 3FFHA 1B8GA 3ZZKA 4ADEA 3LVJA 5M49A 4GDYA 4CXQA 3JTXA 2W8JA 2R2NA 4JEYA 2W7FA 1WYVB 4R2NA 5D5SA 1C7NA 1O69A 2VYCA 2EZ1A 4J8LA 3N75A 4MQPA 2VGTA 4F5JA 1AKCA 4EFFA 1TOGA 3AEMC 5HHYA 1RV3A 4Y0IA 2W8VA 3BN1A 1OHYA 4O6ZA 4WP0A 3JWAA 3KGWA 2EPJA 1GC3A 4OYTA 1ARSA 4AOAA 1AHEA 2RFVA 4GE7A 4IXOA 3WKRA 1BQAA 1QISA 1ELUA 1M4NA 1QJ3A 5DB5A 3FVXA 5C6UA 4E3QA 3BCBA 2E7JA 3PDBA 1FC4A 2PO3A 4A0HA 2QB3A 4ZDOA 3R9AA 3F9TA 1B5PA 3FKDA 5EAVA 1AKBA 1B9IA 3KGXA 4AZJA 1OHVA 1KKPA 1QZ9A 3DC1A 4GRXA 3AEPA 4ZLVA 2BWOA 1LKCA 5J8QA 1J04A 4OBVA 3GZDC 3EI9A 4M2MA 1TATA 2AY5A 1SVVA 3A9XA 1W7NA 3WY7A 1W3UA 1BJOB 4ATPA 2AY7A 3FQAA 5G4JA 1B5OA 2QLRA 2O1BA 2OKKA 2VMVA 3NTJA 4TN4A 5EIGB 1AKAA 2OGAA 1GDEA 4JF1A 1JG8A 2HOYA 4W1VA 1VJOA 2GSAA 4ITXA 4JE5D 4F5GA 3PA9A 1KKJA 1M0NA 1OHWA 3W1HA 3WGBA 2AATA 4EB5A 3HQTA 1V2DA 1IBJA 3ASBA 1XEYA 2BIGA 3RBLA 3EUCA 4RM1A 4LW4A 3WX9A 2AY1A 4JEWA 2D5YA 2YCPA 4AZKA 3ACZA 2AY8A 2ZY2A 2HUUA 3NU7A 2QA3A 1CL1A 1M6SA 4TV7A 4DBCA 3G8MA 4Q76A 3MEBA 5I92A 4ZAHA 4ZWVA 1ASAA 3VP6A 1G7XA 1ARHA 2W7DA 2AY6A 3QGUA 2W7LA 3FDBA 5LH9A 4XAUA 3JU7A 1PMOA 2R5CA 3ATHA 3RCHA 3EIAA 5DJ9A 2BYLA 4WXFA 3E2ZB 1AIBA 1O61A 3H7FA 5DJ1A 3UE8A 3DR7A 4M2JA 1M32A 2ZP7A 2W7KA 3ELPA 2DKBA 1N31A 1AHGA 4EMYA 3GZDA 5HDMA 2QB2A 1P3WA 3BB8A 2CH1A 5G2PA 1IAYA 1GC0A 2HOXA 3N5MA 5EIGA 2AEUA 1JF9A 4B9BA 4NOGA 4XJOA 1AMQA 5G2QA 2ZUKA 2BWPA 5FT5A 2Q7WA 4A00A 3ZZJA 2VMOA 4LNLA 4BQ0A 4HVKA 1D7UA 2AEVA 5BJ3A 2GQNA 4A0RA 1CQ7A 2WK8A 2EO5A 1TASA 2C0RA 3L44A 1YJSA 3CQ6A 1DGEA 4RJ0A 5E5IA 2VMNA 4AH3A 3FVSA 3P1TA 3LG0A 3DZZA 1EJIA 3ECDA 1ARIA 3CBFA 4K2MA 3LWSA 4ZSYA 4BMKA 3MAUA 2CB1A 3E9KA 1CQ8A 3BWOA 2YRIA 3KKIA 3ASAA 2PB2A 1SFFA 1OATA 1UU2A 2AY2A 3CQ5A 4F4EA 2EH6A 4RKCA 4XJPA 4UHNA 3RQ1A 1G4VA 2XBNA 3QPGA 3AELA 1JS3A 1GC4A 3FVUA 4GE4A 1TOIA 1RV4A 3IF2A 4Y0DA 4KXKA 2BI3A 3I16A 3E2ZA 3FDDA 1O62A 3AENB 2HUFA 3KE3A 4HF8A 4M2KA 4MSOA 2YCTA 3B46A 3GSBA 1C0NA 4W5KA 4MKKA 5EAAA 4F5KA 2GB3A 3FZ7A 3HDOA 3QHXA 1IUGA 4OC9A 4H51A 2BI9A 1ASCA 1J32A 1AHXA 1GBNA 2BHXA 3PD6A 3UAKA 3NYSA 1QITA 1AAWA 4LW2A 5G09A 2V1PA 4F5LA 1BS0A 2JJEA 3G7QA 2CJGA 4BHDA 1M0QA 3NYUA 1OXOA 5TF5A 1I29A 4IY7A 3EZSA 2ZYJA 1IX6A 3WLXA 4MQRA 4WXGA 1S08A 4F5MA 2BIAA 2Z61A 1MGVA 2DGKA 3JZLA 4XQ2A 2VLHA 3TFUA 3WCOA 4UOYA 1AJSB 4Q31A 2CJDA 2HP2A 1DJ9A 3B8XA 3LY1A 3NX3A 1MDOA 3M5UA 5LHAA 4U2HA 1H1CA 2HORA 3A8UX 4LNJA 4A0FA 3MKJA 4I8AA 2VMPA 3EZ1A 4MGRA 4WYCA 1BJWA 2CTZA 2QBTA 2BI1A 3RBFA 3R4TA 3VK2A 1BQDA 4A6TA 1Z7DA 5K8BA 4F5HA 5BJ4A 4PIWA 1BW0A 3AEJA 4RITA 1YIYA 1MDXA 3OKSA 3UWCA 3AENA 1LK9A 1ASLA 3FQ7A 2X5DA 4F5FA 1AICA 1DJEA 2WK9A 1ASGA 1O4SA 1BJNA 3BC8A 1ARTA 1MLYA 1GC2A 3P6KA 1RVYA 2VI9A 2VMQA 1WYVA 4WYEA 2OQXA 4ADDA 4PFNA 2CY8A 4RKDA 2D66A 2CH2A 2HUIA 2OKJA 2VGUA 3AV7A 1M7YA 4JEVA 2YOBA 1CZEA 3AEOA 3FCRA 1SZSA 5E4ZA 4A72A 3K40A 3GETA 4Q6RA 3CAIA 1H0CA 4BA5A 4IXZA 2D7YA 4IX8A 2V0YA 5DX5A 5EUEA 1AY5A 3DYDA 4P7YA 1AJRA 2VGVA 1V2FA 1WKGA 3N0LA 3WGCA 2D7ZA 5G4IA 5M46A 1BKGA 1AAMA 1DKAA 2C81A 3FFRA 1LC8A 4B98A 1ASMA 3F6TA 3A9ZA 4WYFA 1PG8A 4A6RA 1DGDA 2Z9WA 1S0AA 1MAQA 4OMAA 2VMUA 3DU4A 1N2TA 4Y0HA 1BT4A 4GEBA 3HT4A 5AX8A 1EG5A 2G6WA 4WB0B 1CL2A 1BJOA
chains in the Genus database with same CATH superfamily
1IX7A 2E7UA 4JF0A 2D63A 1ZC9A 3ZRRA 4IYOB 2CSTA 4AO9A 1I48A 3DR4A 3BS8A 1ECXA 4A0GA 4QGRA 3DXVA 4ZSWA 3BV0A 4RJYA 3QBOA 4Q75A 4WYAA 3QI6A 1E5FA 4XJMA 3NUIA 2Z9XA 2F8JA 4GSAA 1V2EA 2VMYA 3I4JA 1MLZA 2YCNA 3ZRQA 4CVQA 2DKJA 2CINA 2BYJA 3IHJA 3T32A 4WLHA 4ATQA 3FRKA 2EGYA 1ASDA 1FG3A 4JEXA 5F9SA 1KMJA 4N0BA 1D7RA 1M0PA 2KFPA 3B1EA 4E3RA 1X29A 3AEJC 3D6KA 2A1VA 2BWNA 2JISA 1WYUB 3FQ8A 3NDNA 4WYGA 3FSLA 3I5TA 4F5IA 2R5EA 2Z1ZA 4PVFA 1DTYA 3DRDA 1V72A 1JS6A 1U08A 1WKHA 4WD2A 3WCNA 1S09A 1X2AA 3EI7A 4ZM3A 3NNKA 3RI6A 1ASEA 1PMMA 1WSTA 1ZODA 1PFFA 3K28A 3B1DA 4P3MA 2FNUA 4W91A 2CFBA 1B4XA 2DR1A 3VAXA 3VOMA 1AIAA 4ADBA 2JJHA 3AATA 2HP1A 2HZPA 4WB0A 3EI5A 4JE5A 3A2BA 3HVYA 4ISYA 1CZCA 1W23A 2YKXA 4ZASA 1Y4IA 5FT4A 4CBSA 2VMXA 3B1CA 4E77A 4ZDLA 4OT8A 2D61A 5KTBA 4LNMA 1VP4A 1D2FA 1IVRA 2Z20A 4MY5A 2VGWA 2AY4A 2D65A 3QN6A 5D95A 2YKVA 2YHKA 3EI6A 3G0TA 3WZFA 4CBRA 1TOKA 3ZRPA 3AOWA 1E5EA 2E7IA 1CQ6A 3FZ6A 3MC6A 5M4BA 1UKJA 2VGZA 2C7TA 3JW9A 4R5FA 2Z9UA 3F0HA 1D7SA 1I41A 4ITGA 4L0OA 5E3KA 2JG2A 5EUNA 5IWQA 2OGEA 1TPLA 2VLFA 5FT6A 1AY4A 1QGNA 3FZ8A 1KAFA 2R0TA 2VIAA 3DXWA 2WK7A 1WYUA 2YRRA 3HMUA 4PFFA 4XJLA 1C7OA 1GEXA 1TARA 2CANA 2VMRA 4OBUA 1YJZA 2W7IA 4DQ6A 3BWNA 3RUYA 2O7CA 3FD0A 3E77A 4AO4A 5HXXA 3BCAA 1ASBA 2OATA 4ZDPA 3VK4A 2W7MA 1LS3A 1GD9A 2TPLA 3TFTA 2ORDA 2YKUA 9AATA 1GCKA 2VMSA 3DODA 2ZJGA 3GBXA 3JWBA 1AX4A 3LVMA 4IXSA 4A6UA 4JEZA 2ZSLA 4K2BA 5F8VA 2GMUA 3ISLA 1VEFA 2Z1YA 2FYFA 2BI5A 1G7WA 3K7YA 4FL0A 2AY9A 2W8UA 1SZKA 1W7LA 2BIEA 2DOUA 1B9HA 2GMSA 3QM2A 4GE9A 4MQQA 5FT8A 1ARGA 5JAYA 1ASNA 1S06A 3II0A 1YAAA 1SZUA 3LV2A 3GR9A 4KAMA 1ORDA 2FNIA 2R5CB 4ZWMA 3RCHB 1GEYA 2EZ2A 4ADCA 1AMRA 1AMAA 2VMZA 3LVLB 3VK3A 1AJSA 3USFA 1GEWA 3PAAA 1ASFA 3CQ4A 4MKJA 1YJYA 1FG7A 1QJ5A 4W1WA 2VMWA 1TOEA 1ELQA 3W1IA 3FTBA 1G4XA 4EB7A 4CXRA 4RIZA 1AMSA 3WKSA 1I43A 3OP7A 2BKWA 1N8PA 5G0AA 4UHOA 3COGA 3HL2A 2YKYA 3N4XA 1AY8A 3PIUA 1SF2A 2Z67A 4UHMA 4WLJA 3TATA 1UU0A 2W7GA 2X5FA 2VI8A 1DJUA 3AEMA 4N0WA 5EQCA 1KL2A 3GZCA 3HLMA 1RVUA 1C9CA 2JGTA 3PJ0A 4BA4A 1AHFA 4FFCA 1SPAA 3GWPA 1IJIA 2D64A 2E54A 4DGTA 2CJHA 1TOJA 3NU8A 2W8WA 3PDXA 1YIZA 2JJGA 3TQXA 1KL1A 3MAFB 2W7JA 2C44A 1XI9A 4J5UA 4R8DA 1LW5A 2W8TA 3E2YA 1BJ4A 2O0RA 4WBTA 1KMKA 1LW4A 2PB0A 4R5ZA 3EIBA 1WYTB 4WYDA 3MC6C 2ZY3A 1YNUA 5EFSA 3H14A 1LC5A 2ZY4A 1LC7A 1S07A 4E1OA 4W8IA 1IAXA 1QIRA 2QMAA 3NYTA 3PGYA 4OCAA 1IX8A 4W1XA 1W7MA 3MBBA 2VMTA 2XH1A 4K2IA 4LC3A 3EI8A 1X28A 4EU1A 1DFOA 3MADA 3PD6B 3W1JA 2HOZA 2X8UA 3ELEA 2DGLA 3BWNC 4IW7A 8AATA 3PPLA 2AY3A 1EQBA 2NMPA 2X3LA 1M0OA 2ZSMA 2ZC0A 4XK1A 4OTLA 3L8AA 1T3IA 1MAPA 2W7EA 3GJUA 4WXBA 1AHYA 1ZOBA 4RLGA 3Q8NA 3LVKA 7AATA 1YOOA 3NUBA 3TCMA 1D7VA 2WKAA 2ZY5A 4RAEA 3BCXA 3E2FA 2FQ6A 5EUDA 2VIBA 2FN6A 4IYOA 1MDZA 4TMRA 3MAFA 3PDBB 2DGMA 5M4DA 4KYOA 3HBXA 1Z3ZA 3NRAA 4UQVA 2JJFA 1CS1A 2WB6A 2FM1A 1WYTA 3AOVA 1OXPA 4U1TA 3E6GA 2Z9VA 1CJ0A 1UU1A 4XEWA 4ZM4A 1C7GA 1C4KA 3A9YA 2W7HA 2VGSA 1X0MA 2BI2A 3FFHA 1B8GA 3ZZKA 4ADEA 3LVJA 5M49A 4GDYA 4CXQA 3JTXA 2W8JA 2R2NA 4JEYA 2W7FA 1WYVB 4R2NA 5D5SA 1C7NA 1O69A 2VYCA 2EZ1A 4J8LA 3N75A 4MQPA 2VGTA 4F5JA 1AKCA 4EFFA 1TOGA 3AEMC 5HHYA 1RV3A 4Y0IA 2W8VA 3BN1A 1OHYA 4O6ZA 4WP0A 3JWAA 3KGWA 2EPJA 1GC3A 4OYTA 1ARSA 4AOAA 1AHEA 2RFVA 4GE7A 4IXOA 3WKRA 1BQAA 1QISA 1ELUA 1M4NA 1QJ3A 5DB5A 3FVXA 5C6UA 4E3QA 3BCBA 2E7JA 3PDBA 1FC4A 2PO3A 4A0HA 2QB3A 4ZDOA 3R9AA 3F9TA 1B5PA 3FKDA 5EAVA 1AKBA 1B9IA 3KGXA 4AZJA 1OHVA 1KKPA 1QZ9A 3DC1A 4GRXA 3AEPA 4ZLVA 2BWOA 1LKCA 5J8QA 1J04A 4OBVA 4K05A 3GZDC 3EI9A 4M2MA 1TATA 2AY5A 1SVVA 3A9XA 1W7NA 3WY7A 2G7JA 1W3UA 1BJOB 4ATPA 2AY7A 3FQAA 5G4JA 1B5OA 2QLRA 2O1BA 2OKKA 2VMVA 3NTJA 4TN4A 5EIGB 3N4RA 1AKAA 2OGAA 1GDEA 4JF1A 1JG8A 2HOYA 4W1VA 1VJOA 2GSAA 4ITXA 4JE5D 4F5GA 3PA9A 1KKJA 1M0NA 1OHWA 3W1HA 3WGBA 2AATA 4EB5A 3HQTA 1V2DA 1IBJA 3ASBA 1XEYA 2BIGA 3RBLA 3EUCA 4RM1A 4LW4A 3WX9A 2AY1A 4JEWA 2D5YA 2YCPA 4AZKA 3ACZA 2AY8A 2ZY2A 2HUUA 3NU7A 2QA3A 1CL1A 1M6SA 4TV7A 4DBCA 3G8MA 4Q76A 3MEBA 5I92A 4ZAHA 4ZWVA 1ASAA 3VP6A 1G7XA 1ARHA 2W7DA 2AY6A 3QGUA 2W7LA 3FDBA 5LH9A 4XAUA 3JU7A 1PMOA 2R5CA 3ATHA 3RCHA 3EIAA 5DJ9A 2BYLA 4WXFA 3E2ZB 3N7NA 1AIBA 1O61A 3H7FA 5DJ1A 3UE8A 3DR7A 4M2JA 1M32A 2ZP7A 2W7KA 3ELPA 2DKBA 1N31A 1AHGA 4EMYA 3GZDA 5HDMA 2QB2A 1P3WA 3BB8A 2CH1A 5G2PA 1IAYA 1GC0A 2HOXA 3N5MA 5EIGA 2AEUA 1JF9A 4B9BA 4NOGA 4XJOA 1AMQA 5G2QA 4H63Q 2ZUKA 2BWPA 5FT5A 2Q7WA 4A00A 3ZZJA 2VMOA 4LNLA 4BQ0A 4HVKA 1D7UA 2AEVA 5BJ3A 2GQNA 3N4SA 4A0RA 1CQ7A 2WK8A 2EO5A 1TASA 2C0RA 3L44A 1YJSA 3CQ6A 1DGEA 4RJ0A 5E5IA 2VMNA 4AH3A 3FVSA 3P1TA 3LG0A 3DZZA 1EJIA 3ECDA 1ARIA 3CBFA 4K2MA 3LWSA 4ZSYA 4BMKA 3MAUA 2CB1A 3E9KA 1CQ8A 3BWOA 2YRIA 3KKIA 3ASAA 2PB2A 1SFFA 1OATA 1UU2A 2AY2A 3CQ5A 4F4EA 2EH6A 4RKCA 4XJPA 4UHNA 3RQ1A 1G4VA 2XBNA 3QPGA 3AELA 1JS3A 1GC4A 3FVUA 4GE4A 1TOIA 1RV4A 3IF2A 4Y0DA 4KXKA 2BI3A 3I16A 3E2ZA 2EYQA 3FDDA 1O62A 3AENB 2HUFA 3KE3A 4HF8A 4M2KA 4MSOA 2YCTA 3B46A 3GSBA 1C0NA 4W5KA 4MKKA 5EAAA 4F5KA 2GB3A 3FZ7A 3HDOA 3QHXA 1IUGA 4OC9A 4H51A 2BI9A 1ASCA 1J32A 1AHXA 1GBNA 2BHXA 3PD6A 3UAKA 3NYSA 1QITA 1AAWA 4LW2A 5G09A 2V1PA 4F5LA 1BS0A 2JJEA 3G7QA 2CJGA 4BHDA 1M0QA 3NYUA 1OXOA 5TF5A 1I29A 4IY7A 3EZSA 2ZYJA 1IX6A 3WLXA 4MQRA 4WXGA 1S08A 4F5MA 2BIAA 2Z61A 1MGVA 2DGKA 3JZLA 4XQ2A 2VLHA 3TFUA 3WCOA 4UOYA 1AJSB 4Q31A 2CJDA 2HP2A 1DJ9A 3B8XA 3LY1A 3NX3A 1MDOA 3M5UA 5LHAA 4U2HA 1H1CA 2HORA 3A8UX 4LNJA 4A0FA 3MKJA 4I8AA 2VMPA 3EZ1A 4MGRA 4WYCA 2QSRA 1BJWA 2CTZA 2QBTA 2BI1A 3RBFA 3R4TA 3VK2A 1BQDA 4A6TA 1Z7DA 5K8BA 4F5HA 5BJ4A 4PIWA 1BW0A 3AEJA 4RITA 1YIYA 1MDXA 3OKSA 3UWCA 3AENA 1LK9A 1ASLA 3FQ7A 2X5DA 4F5FA 1AICA 1DJEA 2WK9A 1ASGA 1O4SA 1BJNA 3BC8A 1ARTA 1MLYA 1GC2A 3P6KA 1RVYA 2VI9A 2VMQA 1WYVA 4WYEA 2OQXA 4ADDA 4PFNA 2CY8A 4RKDA 2D66A 2CH2A 2HUIA 2OKJA 2VGUA 3AV7A 1M7YA 4JEVA 2YOBA 1CZEA 3AEOA 3FCRA 1SZSA 5E4ZA 4A72A 3K40A 3GETA 4Q6RA 3CAIA 1H0CA 4BA5A 4IXZA 2D7YA 4IX8A 2V0YA 5DX5A 5EUEA 1AY5A 3DYDA 4P7YA 1AJRA 2VGVA 1V2FA 1WKGA 3N0LA 3WGCA 2D7ZA 5G4IA 5M46A 3H9XA 1BKGA 1AAMA 1DKAA 2C81A 3FFRA 1LC8A 4B98A 2FKIA 1ASMA 3F6TA 3A9ZA 4WYFA 1PG8A 4A6RA 1DGDA 2Z9WA 1S0AA 1MAQA 4OMAA 2VMUA 3DU4A 1N2TA 4Y0HA 1BT4A 4GEBA 3HT4A 5AX8A 1EG5A 2G6WA 4WB0B 1CL2A 1BJOA
chains in the Genus database with same CATH topology
1IX7A 2E7UA 4JF0A 2D63A 1ZC9A 3ZRRA 4IYOB 2CSTA 4AO9A 1I48A 3DR4A 3BS8A 1ECXA 4A0GA 4QGRA 3DXVA 4ZSWA 3BV0A 4RJYA 3QBOA 4Q75A 4WYAA 3QI6A 1E5FA 4XJMA 3NUIA 2Z9XA 2F8JA 4GSAA 1V2EA 2VMYA 3I4JA 1MLZA 2YCNA 3ZRQA 4CVQA 2DKJA 2CINA 2BYJA 3IHJA 3T32A 4WLHA 4ATQA 3FRKA 2EGYA 1ASDA 1FG3A 4JEXA 5F9SA 1KMJA 4N0BA 1D7RA 1M0PA 2KFPA 3B1EA 4E3RA 1X29A 3AEJC 3D6KA 2A1VA 2BWNA 2JISA 1WYUB 3FQ8A 3NDNA 4WYGA 3FSLA 3I5TA 4F5IA 2R5EA 2Z1ZA 4PVFA 1DTYA 3DRDA 1V72A 1JS6A 1U08A 1WKHA 4WD2A 3WCNA 1S09A 1X2AA 3EI7A 4ZM3A 3NNKA 3RI6A 1ASEA 1PMMA 1WSTA 1ZODA 1PFFA 3K28A 3B1DA 4P3MA 2FNUA 4W91A 2CFBA 1B4XA 2DR1A 3VAXA 3VOMA 1AIAA 4ADBA 2JJHA 3AATA 2HP1A 2HZPA 4WB0A 3EI5A 4JE5A 3A2BA 3HVYA 4ISYA 1CZCA 1W23A 2YKXA 4ZASA 1Y4IA 5FT4A 4CBSA 2VMXA 3B1CA 4E77A 4ZDLA 4OT8A 2D61A 5KTBA 4LNMA 1VP4A 1D2FA 1IVRA 2Z20A 4MY5A 2VGWA 2AY4A 2D65A 3QN6A 5D95A 2YKVA 2YHKA 3EI6A 3G0TA 3WZFA 4CBRA 1TOKA 3ZRPA 3AOWA 1E5EA 2E7IA 1CQ6A 3FZ6A 3MC6A 5M4BA 1UKJA 2VGZA 2C7TA 3JW9A 4R5FA 2Z9UA 3F0HA 1D7SA 1I41A 4ITGA 4L0OA 5E3KA 2JG2A 5EUNA 5IWQA 2OGEA 1TPLA 2VLFA 5FT6A 1AY4A 1QGNA 3FZ8A 2R0TA 2VIAA 3DXWA 2WK7A 1WYUA 2YRRA 3HMUA 4PFFA 4XJLA 1C7OA 1GEXA 1TARA 2CANA 2VMRA 4OBUA 1YJZA 2W7IA 4DQ6A 3BWNA 3RUYA 2O7CA 3FD0A 3E77A 4AO4A 5HXXA 3BCAA 1ASBA 2OATA 4ZDPA 3VK4A 2W7MA 1LS3A 1GD9A 2TPLA 3TFTA 2ORDA 2YKUA 9AATA 1GCKA 2VMSA 3DODA 2ZJGA 3GBXA 3JWBA 1AX4A 3LVMA 4IXSA 4A6UA 4JEZA 2ZSLA 4K2BA 5F8VA 2GMUA 3ISLA 1VEFA 2Z1YA 2FYFA 2BI5A 1G7WA 3K7YA 4FL0A 2AY9A 2W8UA 1SZKA 1W7LA 2BIEA 2DOUA 1B9HA 2GMSA 3QM2A 4GE9A 4MQQA 5FT8A 1ARGA 5JAYA 1ASNA 1S06A 3II0A 1YAAA 1SZUA 3LV2A 3GR9A 4KAMA 1ORDA 2FNIA 2R5CB 4ZWMA 3RCHB 1GEYA 2EZ2A 4ADCA 1AMRA 1AMAA 2VMZA 3LVLB 3VK3A 1AJSA 3USFA 1GEWA 3PAAA 1ASFA 3CQ4A 4MKJA 1YJYA 1FG7A 1QJ5A 4W1WA 2VMWA 1TOEA 1ELQA 3W1IA 3FTBA 1G4XA 4EB7A 4CXRA 4RIZA 1AMSA 3WKSA 1I43A 3OP7A 2BKWA 1N8PA 5G0AA 4UHOA 3COGA 3HL2A 2YKYA 3N4XA 1AY8A 3PIUA 1SF2A 2Z67A 4UHMA 4WLJA 3TATA 1UU0A 2W7GA 2X5FA 2VI8A 1DJUA 3AEMA 4N0WA 5EQCA 1KL2A 3GZCA 3HLMA 1RVUA 1C9CA 2JGTA 3PJ0A 4BA4A 1AHFA 4FFCA 1SPAA 3GWPA 1IJIA 2D64A 2E54A 4DGTA 2CJHA 1TOJA 3NU8A 2W8WA 3PDXA 1YIZA 2JJGA 3TQXA 1KL1A 3MAFB 2W7JA 2C44A 1XI9A 4J5UA 4R8DA 1LW5A 2W8TA 3E2YA 1BJ4A 2O0RA 4WBTA 1KMKA 1LW4A 2PB0A 4R5ZA 3EIBA 1WYTB 4WYDA 3MC6C 2ZY3A 1YNUA 5EFSA 3H14A 1LC5A 2ZY4A 1LC7A 1S07A 4E1OA 4W8IA 1IAXA 1QIRA 2QMAA 3NYTA 3PGYA 4OCAA 1IX8A 4W1XA 1W7MA 3MBBA 2VMTA 2XH1A 4K2IA 4LC3A 3EI8A 1X28A 4EU1A 1DFOA 3MADA 3PD6B 3W1JA 2HOZA 2X8UA 3ELEA 2DGLA 3BWNC 4IW7A 8AATA 3PPLA 2AY3A 1EQBA 2NMPA 2X3LA 1M0OA 2ZSMA 2ZC0A 4XK1A 4OTLA 3L8AA 1T3IA 1MAPA 2W7EA 3GJUA 4WXBA 1AHYA 1ZOBA 4RLGA 3Q8NA 3LVKA 7AATA 1YOOA 3NUBA 3TCMA 1D7VA 2WKAA 2ZY5A 4RAEA 3BCXA 3E2FA 2FQ6A 5EUDA 2VIBA 2FN6A 4IYOA 1MDZA 4TMRA 3MAFA 3PDBB 2DGMA 5M4DA 4KYOA 3HBXA 1Z3ZA 3NRAA 4UQVA 2JJFA 1CS1A 2WB6A 2FM1A 1WYTA 3AOVA 1OXPA 4U1TA 3E6GA 2Z9VA 1CJ0A 1UU1A 4XEWA 4ZM4A 1C7GA 1C4KA 3A9YA 2W7HA 2VGSA 1X0MA 2BI2A 3FFHA 1B8GA 3ZZKA 4ADEA 3LVJA 5M49A 4GDYA 4CXQA 3JTXA 2W8JA 2R2NA 4JEYA 2W7FA 1WYVB 4R2NA 5D5SA 1C7NA 1O69A 2VYCA 2EZ1A 4J8LA 3N75A 4MQPA 2VGTA 4F5JA 1AKCA 4EFFA 1TOGA 3AEMC 5HHYA 1RV3A 4Y0IA 2W8VA 3BN1A 1OHYA 4O6ZA 4WP0A 3JWAA 3KGWA 2EPJA 1GC3A 4OYTA 1ARSA 4AOAA 1AHEA 2RFVA 4GE7A 4IXOA 3WKRA 1BQAA 1QISA 1ELUA 1M4NA 1QJ3A 5DB5A 3FVXA 5C6UA 4E3QA 3BCBA 2E7JA 3PDBA 1FC4A 2PO3A 4A0HA 2QB3A 4ZDOA 3R9AA 3F9TA 1B5PA 3FKDA 5EAVA 1AKBA 1B9IA 3KGXA 4AZJA 1OHVA 1KKPA 1QZ9A 3DC1A 4GRXA 3AEPA 4ZLVA 2BWOA 1LKCA 5J8QA 1J04A 4OBVA 4K05A 3GZDC 3EI9A 4M2MA 1TATA 2AY5A 1SVVA 3A9XA 1W7NA 3WY7A 2G7JA 1W3UA 1BJOB 4ATPA 2AY7A 3FQAA 5G4JA 1B5OA 2QLRA 2O1BA 2OKKA 2VMVA 3NTJA 4TN4A 5EIGB 3N4RA 1AKAA 2OGAA 1GDEA 4JF1A 1JG8A 2HOYA 4W1VA 1VJOA 2GSAA 4ITXA 4JE5D 4F5GA 3PA9A 1KKJA 1M0NA 1OHWA 3W1HA 3WGBA 2AATA 4EB5A 3HQTA 1V2DA 1IBJA 3ASBA 1XEYA 2BIGA 3RBLA 3EUCA 4RM1A 4LW4A 3WX9A 2AY1A 4JEWA 2D5YA 2YCPA 4AZKA 3ACZA 2AY8A 2ZY2A 2HUUA 3NU7A 2QA3A 1CL1A 1M6SA 4TV7A 4DBCA 3G8MA 4Q76A 3MEBA 5I92A 4ZAHA 4ZWVA 1ASAA 3VP6A 1G7XA 1ARHA 2W7DA 2AY6A 3QGUA 2W7LA 3FDBA 5LH9A 4XAUA 3JU7A 1PMOA 2R5CA 3ATHA 3RCHA 3EIAA 5DJ9A 2BYLA 4WXFA 3E2ZB 3N7NA 1AIBA 1O61A 3H7FA 5DJ1A 3UE8A 3DR7A 4M2JA 1M32A 2ZP7A 2W7KA 3ELPA 2DKBA 1N31A 1AHGA 4EMYA 3GZDA 5HDMA 2QB2A 1P3WA 3BB8A 2CH1A 5G2PA 1IAYA 1GC0A 2HOXA 3N5MA 5EIGA 2AEUA 1JF9A 4B9BA 4NOGA 4XJOA 1AMQA 5G2QA 4H63Q 2ZUKA 2BWPA 5FT5A 2Q7WA 4A00A 3ZZJA 2VMOA 4LNLA 4BQ0A 4HVKA 1D7UA 2AEVA 5BJ3A 2GQNA 3N4SA 4A0RA 1CQ7A 2WK8A 2EO5A 1TASA 2C0RA 3L44A 1YJSA 3CQ6A 1DGEA 4RJ0A 5E5IA 2VMNA 4AH3A 3FVSA 3P1TA 3LG0A 3DZZA 1EJIA 3ECDA 1ARIA 3CBFA 4K2MA 3LWSA 4ZSYA 4BMKA 3MAUA 2CB1A 3E9KA 1CQ8A 3BWOA 2YRIA 3KKIA 3ASAA 2PB2A 1SFFA 1OATA 1UU2A 2AY2A 3CQ5A 4F4EA 2EH6A 4RKCA 4XJPA 4UHNA 3RQ1A 1G4VA 2XBNA 3QPGA 3AELA 1JS3A 1GC4A 3FVUA 4GE4A 1TOIA 1RV4A 3IF2A 4Y0DA 4KXKA 2BI3A 3I16A 3E2ZA 2EYQA 3FDDA 1O62A 3AENB 2HUFA 3KE3A 4HF8A 4M2KA 4MSOA 2YCTA 3B46A 3GSBA 1C0NA 4W5KA 4MKKA 5EAAA 4F5KA 2GB3A 3FZ7A 3HDOA 3QHXA 1IUGA 4OC9A 4H51A 2BI9A 1ASCA 1J32A 1AHXA 1GBNA 2BHXA 3PD6A 3UAKA 3NYSA 1QITA 1AAWA 4LW2A 5G09A 2V1PA 4F5LA 1BS0A 2JJEA 3G7QA 2CJGA 4BHDA 1M0QA 3NYUA 1OXOA 5TF5A 1I29A 4IY7A 3EZSA 2ZYJA 1IX6A 3WLXA 4MQRA 4WXGA 1S08A 4F5MA 2BIAA 2Z61A 1MGVA 2DGKA 3JZLA 4XQ2A 2VLHA 3TFUA 3WCOA 4UOYA 1AJSB 4Q31A 2CJDA 2HP2A 1DJ9A 3B8XA 3LY1A 3NX3A 1MDOA 3M5UA 5LHAA 4U2HA 1H1CA 2HORA 3A8UX 4LNJA 4A0FA 3MKJA 4I8AA 2VMPA 3EZ1A 4MGRA 4WYCA 2QSRA 1BJWA 2CTZA 2QBTA 2BI1A 3RBFA 3R4TA 3VK2A 1BQDA 4A6TA 1Z7DA 5K8BA 4F5HA 5BJ4A 4PIWA 1BW0A 3AEJA 4RITA 1YIYA 1MDXA 3OKSA 3UWCA 3AENA 1LK9A 1ASLA 3FQ7A 2X5DA 4F5FA 1AICA 1DJEA 2WK9A 1ASGA 1O4SA 1BJNA 3BC8A 1ARTA 1MLYA 1GC2A 3P6KA 1RVYA 2VI9A 2VMQA 1WYVA 4WYEA 2OQXA 4ADDA 4PFNA 2CY8A 4RKDA 2D66A 2CH2A 2HUIA 2OKJA 2VGUA 3AV7A 1M7YA 4JEVA 2YOBA 1CZEA 3AEOA 3FCRA 1SZSA 5E4ZA 4A72A 3K40A 3GETA 4Q6RA 3CAIA 1H0CA 4BA5A 4IXZA 2D7YA 4IX8A 2V0YA 5DX5A 5EUEA 1AY5A 3DYDA 4P7YA 1AJRA 2VGVA 1V2FA 1WKGA 3N0LA 3WGCA 2D7ZA 5G4IA 5M46A 3H9XA 1BKGA 1AAMA 1DKAA 2C81A 3FFRA 1LC8A 4B98A 2FKIA 1ASMA 3F6TA 3A9ZA 4WYFA 1PG8A 4A6RA 1DGDA 2Z9WA 1S0AA 1MAQA 4OMAA 2VMUA 3DU4A 1N2TA 4Y0HA 1BT4A 4GEBA 3HT4A 5AX8A 1EG5A 2G6WA 4WB0B 1CL2A 1BJOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1IX7 A;  2E7U A;  4JF0 A;  2D63 A;  1ZC9 A;  3ZRR A;  4IYO B;  2CST A;  4AO9 A;  1I48 A;  3DR4 A;  3BS8 A;  1ECX A;  4A0G A;  4QGR A;  3DXV A;  4ZSW A;  3BV0 A;  4RJY A;  3QBO A;  4Q75 A;  4WYA A;  3QI6 A;  1E5F A;  4XJM A;  3NUI A;  2Z9X A;  2F8J A;  4GSA A;  1V2E A;  2VMY A;  3I4J A;  1MLZ A;  2YCN A;  3ZRQ A;  4CVQ A;  2DKJ A;  2CIN A;  2BYJ A;  3IHJ A;  3T32 A;  4WLH A;  4ATQ A;  3FRK A;  2EGY A;  1ASD A;  1FG3 A;  4JEX A;  5F9S A;  1KMJ A;  4N0B A;  1D7R A;  1M0P A;  3B1E A;  4E3R A;  1X29 A;  3AEJ C;  3D6K A;  2BWN A;  2JIS A;  1WYU B;  3FQ8 A;  3NDN A;  4WYG A;  3FSL A;  3I5T A;  4F5I A;  2R5E A;  2Z1Z A;  4PVF A;  1DTY A;  3DRD A;  1V72 A;  1JS6 A;  1U08 A;  1WKH A;  4WD2 A;  3WCN A;  1S09 A;  1X2A A;  3EI7 A;  4ZM3 A;  3NNK A;  3RI6 A;  1ASE A;  1PMM A;  1WST A;  1ZOD A;  1PFF A;  3K28 A;  3B1D A;  4P3M A;  2FNU A;  4W91 A;  2CFB A;  1B4X A;  2DR1 A;  3VAX A;  3VOM A;  1AIA A;  4ADB A;  2JJH A;  3AAT A;  2HP1 A;  2HZP A;  4WB0 A;  3EI5 A;  4JE5 A;  3A2B A;  3HVY A;  4ISY A;  1CZC A;  1W23 A;  2YKX A;  4ZAS A;  1Y4I A;  5FT4 A;  4CBS A;  2VMX A;  3B1C A;  4E77 A;  4ZDL A;  4OT8 A;  2D61 A;  4LNM A;  1VP4 A;  1D2F A;  1IVR A;  2Z20 A;  4MY5 A;  2VGW A;  2AY4 A;  2D65 A;  3QN6 A;  5D95 A;  2YKV A;  2YHK A;  3EI6 A;  3G0T A;  3WZF A;  4CBR A;  1TOK A;  3ZRP A;  3AOW A;  1E5E A;  2E7I A;  1CQ6 A;  3FZ6 A;  3MC6 A;  5M4B A;  1UKJ A;  2VGZ A;  2C7T A;  3JW9 A;  4R5F A;  2Z9U A;  3F0H A;  1D7S A;  1I41 A;  4ITG A;  4L0O A;  5E3K A;  2JG2 A;  5EUN A;  5IWQ A;  2OGE A;  1TPL A;  2VLF A;  5FT6 A;  1AY4 A;  1QGN A;  3FZ8 A;  2R0T A;  2VIA A;  3DXW A;  2WK7 A;  1WYU A;  2YRR A;  3HMU A;  4PFF A;  4XJL A;  1C7O A;  1GEX A;  1TAR A;  2CAN A;  2VMR A;  4OBU A;  1YJZ A;  2W7I A;  4DQ6 A;  3BWN A;  3RUY A;  2O7C A;  3FD0 A;  3E77 A;  4AO4 A;  5HXX A;  3BCA A;  1ASB A;  2OAT A;  4ZDP A;  3VK4 A;  2W7M A;  1LS3 A;  1GD9 A;  2TPL A;  3TFT A;  2ORD A;  2YKU A;  9AAT A;  1GCK A;  2VMS A;  3DOD A;  2ZJG A;  3GBX A;  3JWB A;  1AX4 A;  3LVM A;  4IXS A;  4A6U A;  4JEZ A;  2ZSL A;  4K2B A;  5F8V A;  2GMU A;  3ISL A;  1VEF A;  2Z1Y A;  2FYF A;  2BI5 A;  1G7W A;  3K7Y A;  4FL0 A;  2AY9 A;  2W8U A;  1SZK A;  1W7L A;  2BIE A;  2DOU A;  1B9H A;  2GMS A;  3QM2 A;  4GE9 A;  4MQQ A;  5FT8 A;  1ARG A;  5JAY A;  1ASN A;  1S06 A;  3II0 A;  1YAA A;  1SZU A;  3LV2 A;  3GR9 A;  4KAM A;  1ORD A;  2FNI A;  2R5C B;  4ZWM A;  3RCH B;  1GEY A;  2EZ2 A;  4ADC A;  1AMR A;  1AMA A;  2VMZ A;  3LVL B;  3VK3 A;  1AJS A;  3USF A;  1GEW A;  3PAA A;  1ASF A;  3CQ4 A;  4MKJ A;  1YJY A;  1FG7 A;  1QJ5 A;  4W1W A;  2VMW A;  1TOE A;  1ELQ A;  3W1I A;  3FTB A;  1G4X A;  4EB7 A;  4CXR A;  4RIZ A;  1AMS A;  3WKS A;  1I43 A;  3OP7 A;  2BKW A;  1N8P A;  5G0A A;  4UHO A;  3COG A;  3HL2 A;  2YKY A;  1AY8 A;  3PIU A;  1SF2 A;  2Z67 A;  4UHM A;  4WLJ A;  3TAT A;  1UU0 A;  2W7G A;  2X5F A;  2VI8 A;  1DJU A;  3AEM A;  4N0W A;  5EQC A;  1KL2 A;  3GZC A;  3HLM A;  1RVU A;  1C9C A;  2JGT A;  3PJ0 A;  4BA4 A;  1AHF A;  4FFC A;  1SPA A;  3GWP A;  1IJI A;  2D64 A;  2E54 A;  4DGT A;  2CJH A;  1TOJ A;  3NU8 A;  2W8W A;  3PDX A;  1YIZ A;  2JJG A;  3TQX A;  1KL1 A;  3MAF B;  2W7J A;  2C44 A;  1XI9 A;  4J5U A;  4R8D A;  1LW5 A;  2W8T A;  3E2Y A;  1BJ4 A;  2O0R A;  4WBT A;  1KMK A;  1LW4 A;  2PB0 A;  4R5Z A;  3EIB A;  1WYT B;  4WYD A;  3MC6 C;  2ZY3 A;  1YNU A;  5EFS A;  3H14 A;  1LC5 A;  2ZY4 A;  1LC7 A;  1S07 A;  4E1O A;  4W8I A;  1IAX A;  1QIR A;  2QMA A;  3NYT A;  3PGY A;  4OCA A;  1IX8 A;  4W1X A;  1W7M A;  3MBB A;  2VMT A;  2XH1 A;  4K2I A;  4LC3 A;  3EI8 A;  1X28 A;  4EU1 A;  1DFO A;  3MAD A;  3PD6 B;  3W1J A;  2HOZ A;  2X8U A;  3ELE A;  2DGL A;  3BWN C;  4IW7 A;  8AAT A;  3PPL A;  2AY3 A;  1EQB A;  2NMP A;  2X3L A;  1M0O A;  2ZSM A;  2ZC0 A;  4XK1 A;  4OTL A;  3L8A A;  1T3I A;  1MAP A;  2W7E A;  3GJU A;  4WXB A;  1AHY A;  1ZOB A;  4RLG A;  3Q8N A;  3LVK A;  7AAT A;  1YOO A;  3NUB A;  3TCM A;  1D7V A;  2WKA A;  2ZY5 A;  4RAE A;  3BCX A;  3E2F A;  2FQ6 A;  5EUD A;  2VIB A;  2FN6 A;  4IYO A;  1MDZ A;  4TMR A;  3MAF A;  3PDB B;  2DGM A;  5M4D A;  4KYO A;  3HBX A;  1Z3Z A;  3NRA A;  4UQV A;  2JJF A;  1CS1 A;  2FM1 A;  1WYT A;  3AOV A;  1OXP A;  4U1T A;  3E6G A;  2Z9V A;  1CJ0 A;  1UU1 A;  4XEW A;  4ZM4 A;  1C7G A;  1C4K A;  3A9Y A;  2W7H A;  2VGS A;  1X0M A;  2BI2 A;  3FFH A;  1B8G A;  3ZZK A;  4ADE A;  3LVJ A;  5M49 A;  4GDY A;  4CXQ A;  3JTX A;  2W8J A;  2R2N A;  4JEY A;  2W7F A;  1WYV B;  4R2N A;  5D5S A;  1C7N A;  1O69 A;  2VYC A;  2EZ1 A;  4J8L A;  3N75 A;  4MQP A;  2VGT A;  4F5J A;  1AKC A;  4EFF A;  1TOG A;  3AEM C;  5HHY A;  1RV3 A;  4Y0I A;  2W8V A;  3BN1 A;  1OHY A;  4O6Z A;  4WP0 A;  3JWA A;  3KGW A;  2EPJ A;  1GC3 A;  4OYT A;  1ARS A;  4AOA A;  1AHE A;  2RFV A;  4GE7 A;  4IXO A;  3WKR A;  1BQA A;  1QIS A;  1ELU A;  1M4N A;  1QJ3 A;  5DB5 A;  3FVX A;  5C6U A;  4E3Q A;  3BCB A;  2E7J A;  3PDB A;  1FC4 A;  2PO3 A;  4A0H A;  2QB3 A;  4ZDO A;  3R9A A;  3F9T A;  1B5P A;  3FKD A;  5EAV A;  1AKB A;  1B9I A;  3KGX A;  4AZJ A;  1OHV A;  1KKP A;  1QZ9 A;  3DC1 A;  4GRX A;  3AEP A;  4ZLV A;  2BWO A;  1LKC A;  5J8Q A;  1J04 A;  4OBV A;  3GZD C;  3EI9 A;  4M2M A;  1TAT A;  2AY5 A;  1SVV A;  3A9X A;  1W7N A;  3WY7 A;  1W3U A;  1BJO B;  4ATP A;  2AY7 A;  3FQA A;  5G4J A;  1B5O A;  2QLR A;  2O1B A;  2OKK A;  2VMV A;  3NTJ A;  4TN4 A;  5EIG B;  1AKA A;  2OGA A;  1GDE A;  4JF1 A;  1JG8 A;  2HOY A;  4W1V A;  1VJO A;  2GSA A;  4ITX A;  4JE5 D;  4F5G A;  3PA9 A;  1KKJ A;  1M0N A;  1OHW A;  3W1H A;  3WGB A;  2AAT A;  4EB5 A;  3HQT A;  1V2D A;  1IBJ A;  3ASB A;  1XEY A;  2BIG A;  3RBL A;  3EUC A;  4RM1 A;  4LW4 A;  3WX9 A;  2AY1 A;  4JEW A;  2D5Y A;  2YCP A;  4AZK A;  3ACZ A;  2AY8 A;  2ZY2 A;  2HUU A;  3NU7 A;  2QA3 A;  1CL1 A;  1M6S A;  4TV7 A;  4DBC A;  3G8M A;  4Q76 A;  3MEB A;  5I92 A;  4ZAH A;  4ZWV A;  1ASA A;  3VP6 A;  1G7X A;  1ARH A;  2W7D A;  2AY6 A;  3QGU A;  2W7L A;  3FDB A;  5LH9 A;  4XAU A;  3JU7 A;  1PMO A;  2R5C A;  3ATH A;  3RCH A;  3EIA A;  5DJ9 A;  2BYL A;  4WXF A;  3E2Z B;  1AIB A;  1O61 A;  3H7F A;  5DJ1 A;  3UE8 A;  3DR7 A;  4M2J A;  1M32 A;  2ZP7 A;  2W7K A;  3ELP A;  2DKB A;  1N31 A;  1AHG A;  4EMY A;  3GZD A;  5HDM A;  2QB2 A;  1P3W A;  3BB8 A;  2CH1 A;  5G2P A;  1IAY A;  1GC0 A;  2HOX A;  3N5M A;  5EIG A;  2AEU A;  1JF9 A;  4B9B A;  4NOG A;  4XJO A;  1AMQ A;  5G2Q A;  2ZUK A;  2BWP A;  5FT5 A;  2Q7W A;  4A00 A;  3ZZJ A;  2VMO A;  4LNL A;  4BQ0 A;  4HVK A;  1D7U A;  2AEV A;  5BJ3 A;  2GQN A;  4A0R A;  1CQ7 A;  2WK8 A;  2EO5 A;  1TAS A;  2C0R A;  3L44 A;  1YJS A;  3CQ6 A;  1DGE A;  4RJ0 A;  5E5I A;  2VMN A;  4AH3 A;  3FVS A;  3P1T A;  3LG0 A;  3DZZ A;  1EJI A;  3ECD A;  1ARI A;  3CBF A;  4K2M A;  3LWS A;  4ZSY A;  4BMK A;  3MAU A;  2CB1 A;  3E9K A;  1CQ8 A;  3BWO A;  2YRI A;  3KKI A;  3ASA A;  2PB2 A;  1SFF A;  1OAT A;  1UU2 A;  2AY2 A;  3CQ5 A;  4F4E A;  2EH6 A;  4RKC A;  4XJP A;  4UHN A;  3RQ1 A;  1G4V A;  2XBN A;  3QPG A;  3AEL A;  1JS3 A;  1GC4 A;  3FVU A;  4GE4 A;  1TOI A;  1RV4 A;  3IF2 A;  4Y0D A;  4KXK A;  2BI3 A;  3I16 A;  3E2Z A;  3FDD A;  1O62 A;  3AEN B;  2HUF A;  3KE3 A;  4HF8 A;  4M2K A;  4MSO A;  2YCT A;  3B46 A;  3GSB A;  1C0N A;  4W5K A;  4MKK A;  5EAA A;  4F5K A;  2GB3 A;  3FZ7 A;  3HDO A;  3QHX A;  1IUG A;  4OC9 A;  4H51 A;  2BI9 A;  1ASC A;  1J32 A;  1AHX A;  1GBN A;  2BHX A;  3PD6 A;  3UAK A;  3NYS A;  1QIT A;  1AAW A;  4LW2 A;  5G09 A;  2V1P A;  4F5L A;  1BS0 A;  2JJE A;  3G7Q A;  2CJG A;  4BHD A;  1M0Q A;  3NYU A;  1OXO A;  5TF5 A;  1I29 A;  4IY7 A;  3EZS A;  2ZYJ A;  1IX6 A;  3WLX A;  4MQR A;  4WXG A;  1S08 A;  4F5M A;  2BIA A;  2Z61 A;  1MGV A;  2DGK A;  3JZL A;  4XQ2 A;  2VLH A;  3TFU A;  3WCO A;  4UOY A;  1AJS B;  4Q31 A;  2CJD A;  2HP2 A;  1DJ9 A;  3B8X A;  3LY1 A;  3NX3 A;  1MDO A;  3M5U A;  5LHA A;  4U2H A;  1H1C A;  2HOR A;  3A8U X;  4LNJ A;  4A0F A;  3MKJ A;  4I8A A;  2VMP A;  3EZ1 A;  4MGR A;  4WYC A;  1BJW A;  2CTZ A;  2QBT A;  2BI1 A;  3RBF A;  3R4T A;  3VK2 A;  1BQD A;  4A6T A;  1Z7D A;  5K8B A;  4F5H A;  5BJ4 A;  4PIW A;  1BW0 A;  3AEJ A;  4RIT A;  1YIY A;  1MDX A;  3OKS A;  3UWC A;  3AEN A;  1LK9 A;  1ASL A;  3FQ7 A;  2X5D A;  4F5F A;  1AIC A;  1DJE A;  2WK9 A;  1ASG A;  1O4S A;  1BJN A;  3BC8 A;  1ART A;  1MLY A;  1GC2 A;  3P6K A;  1RVY A;  2VI9 A;  2VMQ A;  1WYV A;  4WYE A;  2OQX A;  4ADD A;  4PFN A;  2CY8 A;  4RKD A;  2D66 A;  2CH2 A;  2HUI A;  2OKJ A;  2VGU A;  3AV7 A;  1M7Y A;  4JEV A;  2YOB A;  1CZE A;  3AEO A;  3FCR A;  1SZS A;  5E4Z A;  4A72 A;  3K40 A;  3GET A;  4Q6R A;  3CAI A;  1H0C A;  4BA5 A;  4IXZ A;  2D7Y A;  4IX8 A;  2V0Y A;  5DX5 A;  5EUE A;  1AY5 A;  3DYD A;  4P7Y A;  1AJR A;  2VGV A;  1V2F A;  1WKG A;  3N0L A;  3WGC A;  2D7Z A;  5G4I A;  5M46 A;  1BKG A;  1AAM A;  1DKA A;  2C81 A;  3FFR A;  1LC8 A;  4B98 A;  1ASM A;  3F6T A;  3A9Z A;  4WYF A;  1PG8 A;  4A6R A;  1DGD A;  2Z9W A;  1S0A A;  1MAQ A;  4OMA A;  2VMU A;  3DU4 A;  1N2T A;  4Y0H A;  1BT4 A;  4GEB A;  3HT4 A;  5AX8 A;  1EG5 A;  2G6W A;  4WB0 B;  1CL2 A;  1BJO A; 
#chains in the Genus database with same CATH topology
 1IX7 A;  2E7U A;  4JF0 A;  2D63 A;  1ZC9 A;  3ZRR A;  4IYO B;  2CST A;  4AO9 A;  1I48 A;  3DR4 A;  3BS8 A;  1ECX A;  4A0G A;  4QGR A;  3DXV A;  4ZSW A;  3BV0 A;  4RJY A;  3QBO A;  4Q75 A;  4WYA A;  3QI6 A;  1E5F A;  4XJM A;  3NUI A;  2Z9X A;  2F8J A;  4GSA A;  1V2E A;  2VMY A;  3I4J A;  1MLZ A;  2YCN A;  3ZRQ A;  4CVQ A;  2DKJ A;  2CIN A;  2BYJ A;  3IHJ A;  3T32 A;  4WLH A;  4ATQ A;  3FRK A;  2EGY A;  1ASD A;  1FG3 A;  4JEX A;  5F9S A;  1KMJ A;  4N0B A;  1D7R A;  1M0P A;  2KFP A;  3B1E A;  4E3R A;  1X29 A;  3AEJ C;  3D6K A;  2A1V A;  2BWN A;  2JIS A;  1WYU B;  3FQ8 A;  3NDN A;  4WYG A;  3FSL A;  3I5T A;  4F5I A;  2R5E A;  2Z1Z A;  4PVF A;  1DTY A;  3DRD A;  1V72 A;  1JS6 A;  1U08 A;  1WKH A;  4WD2 A;  3WCN A;  1S09 A;  1X2A A;  3EI7 A;  4ZM3 A;  3NNK A;  3RI6 A;  1ASE A;  1PMM A;  1WST A;  1ZOD A;  1PFF A;  3K28 A;  3B1D A;  4P3M A;  2FNU A;  4W91 A;  2CFB A;  1B4X A;  2DR1 A;  3VAX A;  3VOM A;  1AIA A;  4ADB A;  2JJH A;  3AAT A;  2HP1 A;  2HZP A;  4WB0 A;  3EI5 A;  4JE5 A;  3A2B A;  3HVY A;  4ISY A;  1CZC A;  1W23 A;  2YKX A;  4ZAS A;  1Y4I A;  5FT4 A;  4CBS A;  2VMX A;  3B1C A;  4E77 A;  4ZDL A;  4OT8 A;  2D61 A;  5KTB A;  4LNM A;  1VP4 A;  1D2F A;  1IVR A;  2Z20 A;  4MY5 A;  2VGW A;  2AY4 A;  2D65 A;  3QN6 A;  5D95 A;  2YKV A;  2YHK A;  3EI6 A;  3G0T A;  3WZF A;  4CBR A;  1TOK A;  3ZRP A;  3AOW A;  1E5E A;  2E7I A;  1CQ6 A;  3FZ6 A;  3MC6 A;  5M4B A;  1UKJ A;  2VGZ A;  2C7T A;  3JW9 A;  4R5F A;  2Z9U A;  3F0H A;  1D7S A;  1I41 A;  4ITG A;  4L0O A;  5E3K A;  2JG2 A;  5EUN A;  5IWQ A;  2OGE A;  1TPL A;  2VLF A;  5FT6 A;  1AY4 A;  1QGN A;  3FZ8 A;  1KAF A;  2R0T A;  2VIA A;  3DXW A;  2WK7 A;  1WYU A;  2YRR A;  3HMU A;  4PFF A;  4XJL A;  1C7O A;  1GEX A;  1TAR A;  2CAN A;  2VMR A;  4OBU A;  1YJZ A;  2W7I A;  4DQ6 A;  3BWN A;  3RUY A;  2O7C A;  3FD0 A;  3E77 A;  4AO4 A;  5HXX A;  3BCA A;  1ASB A;  2OAT A;  4ZDP A;  3VK4 A;  2W7M A;  1LS3 A;  1GD9 A;  2TPL A;  3TFT A;  2ORD A;  2YKU A;  9AAT A;  1GCK A;  2VMS A;  3DOD A;  2ZJG A;  3GBX A;  3JWB A;  1AX4 A;  3LVM A;  4IXS A;  4A6U A;  4JEZ A;  2ZSL A;  4K2B A;  5F8V A;  2GMU A;  3ISL A;  1VEF A;  2Z1Y A;  2FYF A;  2BI5 A;  1G7W A;  3K7Y A;  4FL0 A;  2AY9 A;  2W8U A;  1SZK A;  1W7L A;  2BIE A;  2DOU A;  1B9H A;  2GMS A;  3QM2 A;  4GE9 A;  4MQQ A;  5FT8 A;  1ARG A;  5JAY A;  1ASN A;  1S06 A;  3II0 A;  1YAA A;  1SZU A;  3LV2 A;  3GR9 A;  4KAM A;  1ORD A;  2FNI A;  2R5C B;  4ZWM A;  3RCH B;  1GEY A;  2EZ2 A;  4ADC A;  1AMR A;  1AMA A;  2VMZ A;  3LVL B;  3VK3 A;  1AJS A;  3USF A;  1GEW A;  3PAA A;  1ASF A;  3CQ4 A;  4MKJ A;  1YJY A;  1FG7 A;  1QJ5 A;  4W1W A;  2VMW A;  1TOE A;  1ELQ A;  3W1I A;  3FTB A;  1G4X A;  4EB7 A;  4CXR A;  4RIZ A;  1AMS A;  3WKS A;  1I43 A;  3OP7 A;  2BKW A;  1N8P A;  5G0A A;  4UHO A;  3COG A;  3HL2 A;  2YKY A;  3N4X A;  1AY8 A;  3PIU A;  1SF2 A;  2Z67 A;  4UHM A;  4WLJ A;  3TAT A;  1UU0 A;  2W7G A;  2X5F A;  2VI8 A;  1DJU A;  3AEM A;  4N0W A;  5EQC A;  1KL2 A;  3GZC A;  3HLM A;  1RVU A;  1C9C A;  2JGT A;  3PJ0 A;  4BA4 A;  1AHF A;  4FFC A;  1SPA A;  3GWP A;  1IJI A;  2D64 A;  2E54 A;  4DGT A;  2CJH A;  1TOJ A;  3NU8 A;  2W8W A;  3PDX A;  1YIZ A;  2JJG A;  3TQX A;  1KL1 A;  3MAF B;  2W7J A;  2C44 A;  1XI9 A;  4J5U A;  4R8D A;  1LW5 A;  2W8T A;  3E2Y A;  1BJ4 A;  2O0R A;  4WBT A;  1KMK A;  1LW4 A;  2PB0 A;  4R5Z A;  3EIB A;  1WYT B;  4WYD A;  3MC6 C;  2ZY3 A;  1YNU A;  5EFS A;  3H14 A;  1LC5 A;  2ZY4 A;  1LC7 A;  1S07 A;  4E1O A;  4W8I A;  1IAX A;  1QIR A;  2QMA A;  3NYT A;  3PGY A;  4OCA A;  1IX8 A;  4W1X A;  1W7M A;  3MBB A;  2VMT A;  2XH1 A;  4K2I A;  4LC3 A;  3EI8 A;  1X28 A;  4EU1 A;  1DFO A;  3MAD A;  3PD6 B;  3W1J A;  2HOZ A;  2X8U A;  3ELE A;  2DGL A;  3BWN C;  4IW7 A;  8AAT A;  3PPL A;  2AY3 A;  1EQB A;  2NMP A;  2X3L A;  1M0O A;  2ZSM A;  2ZC0 A;  4XK1 A;  4OTL A;  3L8A A;  1T3I A;  1MAP A;  2W7E A;  3GJU A;  4WXB A;  1AHY A;  1ZOB A;  4RLG A;  3Q8N A;  3LVK A;  7AAT A;  1YOO A;  3NUB A;  3TCM A;  1D7V A;  2WKA A;  2ZY5 A;  4RAE A;  3BCX A;  3E2F A;  2FQ6 A;  5EUD A;  2VIB A;  2FN6 A;  4IYO A;  1MDZ A;  4TMR A;  3MAF A;  3PDB B;  2DGM A;  5M4D A;  4KYO A;  3HBX A;  1Z3Z A;  3NRA A;  4UQV A;  2JJF A;  1CS1 A;  2WB6 A;  2FM1 A;  1WYT A;  3AOV A;  1OXP A;  4U1T A;  3E6G A;  2Z9V A;  1CJ0 A;  1UU1 A;  4XEW A;  4ZM4 A;  1C7G A;  1C4K A;  3A9Y A;  2W7H A;  2VGS A;  1X0M A;  2BI2 A;  3FFH A;  1B8G A;  3ZZK A;  4ADE A;  3LVJ A;  5M49 A;  4GDY A;  4CXQ A;  3JTX A;  2W8J A;  2R2N A;  4JEY A;  2W7F A;  1WYV B;  4R2N A;  5D5S A;  1C7N A;  1O69 A;  2VYC A;  2EZ1 A;  4J8L A;  3N75 A;  4MQP A;  2VGT A;  4F5J A;  1AKC A;  4EFF A;  1TOG A;  3AEM C;  5HHY A;  1RV3 A;  4Y0I A;  2W8V A;  3BN1 A;  1OHY A;  4O6Z A;  4WP0 A;  3JWA A;  3KGW A;  2EPJ A;  1GC3 A;  4OYT A;  1ARS A;  4AOA A;  1AHE A;  2RFV A;  4GE7 A;  4IXO A;  3WKR A;  1BQA A;  1QIS A;  1ELU A;  1M4N A;  1QJ3 A;  5DB5 A;  3FVX A;  5C6U A;  4E3Q A;  3BCB A;  2E7J A;  3PDB A;  1FC4 A;  2PO3 A;  4A0H A;  2QB3 A;  4ZDO A;  3R9A A;  3F9T A;  1B5P A;  3FKD A;  5EAV A;  1AKB A;  1B9I A;  3KGX A;  4AZJ A;  1OHV A;  1KKP A;  1QZ9 A;  3DC1 A;  4GRX A;  3AEP A;  4ZLV A;  2BWO A;  1LKC A;  5J8Q A;  1J04 A;  4OBV A;  4K05 A;  3GZD C;  3EI9 A;  4M2M A;  1TAT A;  2AY5 A;  1SVV A;  3A9X A;  1W7N A;  3WY7 A;  2G7J A;  1W3U A;  1BJO B;  4ATP A;  2AY7 A;  3FQA A;  5G4J A;  1B5O A;  2QLR A;  2O1B A;  2OKK A;  2VMV A;  3NTJ A;  4TN4 A;  5EIG B;  3N4R A;  1AKA A;  2OGA A;  1GDE A;  4JF1 A;  1JG8 A;  2HOY A;  4W1V A;  1VJO A;  2GSA A;  4ITX A;  4JE5 D;  4F5G A;  3PA9 A;  1KKJ A;  1M0N A;  1OHW A;  3W1H A;  3WGB A;  2AAT A;  4EB5 A;  3HQT A;  1V2D A;  1IBJ A;  3ASB A;  1XEY A;  2BIG A;  3RBL A;  3EUC A;  4RM1 A;  4LW4 A;  3WX9 A;  2AY1 A;  4JEW A;  2D5Y A;  2YCP A;  4AZK A;  3ACZ A;  2AY8 A;  2ZY2 A;  2HUU A;  3NU7 A;  2QA3 A;  1CL1 A;  1M6S A;  4TV7 A;  4DBC A;  3G8M A;  4Q76 A;  3MEB A;  5I92 A;  4ZAH A;  4ZWV A;  1ASA A;  3VP6 A;  1G7X A;  1ARH A;  2W7D A;  2AY6 A;  3QGU A;  2W7L A;  3FDB A;  5LH9 A;  4XAU A;  3JU7 A;  1PMO A;  2R5C A;  3ATH A;  3RCH A;  3EIA A;  5DJ9 A;  2BYL A;  4WXF A;  3E2Z B;  3N7N A;  1AIB A;  1O61 A;  3H7F A;  5DJ1 A;  3UE8 A;  3DR7 A;  4M2J A;  1M32 A;  2ZP7 A;  2W7K A;  3ELP A;  2DKB A;  1N31 A;  1AHG A;  4EMY A;  3GZD A;  5HDM A;  2QB2 A;  1P3W A;  3BB8 A;  2CH1 A;  5G2P A;  1IAY A;  1GC0 A;  2HOX A;  3N5M A;  5EIG A;  2AEU A;  1JF9 A;  4B9B A;  4NOG A;  4XJO A;  1AMQ A;  5G2Q A;  4H63 Q;  2ZUK A;  2BWP A;  5FT5 A;  2Q7W A;  4A00 A;  3ZZJ A;  2VMO A;  4LNL A;  4BQ0 A;  4HVK A;  1D7U A;  2AEV A;  5BJ3 A;  2GQN A;  3N4S A;  4A0R A;  1CQ7 A;  2WK8 A;  2EO5 A;  1TAS A;  2C0R A;  3L44 A;  1YJS A;  3CQ6 A;  1DGE A;  4RJ0 A;  5E5I A;  2VMN A;  4AH3 A;  3FVS A;  3P1T A;  3LG0 A;  3DZZ A;  1EJI A;  3ECD A;  1ARI A;  3CBF A;  4K2M A;  3LWS A;  4ZSY A;  4BMK A;  3MAU A;  2CB1 A;  3E9K A;  1CQ8 A;  3BWO A;  2YRI A;  3KKI A;  3ASA A;  2PB2 A;  1SFF A;  1OAT A;  1UU2 A;  2AY2 A;  3CQ5 A;  4F4E A;  2EH6 A;  4RKC A;  4XJP A;  4UHN A;  3RQ1 A;  1G4V A;  2XBN A;  3QPG A;  3AEL A;  1JS3 A;  1GC4 A;  3FVU A;  4GE4 A;  1TOI A;  1RV4 A;  3IF2 A;  4Y0D A;  4KXK A;  2BI3 A;  3I16 A;  3E2Z A;  2EYQ A;  3FDD A;  1O62 A;  3AEN B;  2HUF A;  3KE3 A;  4HF8 A;  4M2K A;  4MSO A;  2YCT A;  3B46 A;  3GSB A;  1C0N A;  4W5K A;  4MKK A;  5EAA A;  4F5K A;  2GB3 A;  3FZ7 A;  3HDO A;  3QHX A;  1IUG A;  4OC9 A;  4H51 A;  2BI9 A;  1ASC A;  1J32 A;  1AHX A;  1GBN A;  2BHX A;  3PD6 A;  3UAK A;  3NYS A;  1QIT A;  1AAW A;  4LW2 A;  5G09 A;  2V1P A;  4F5L A;  1BS0 A;  2JJE A;  3G7Q A;  2CJG A;  4BHD A;  1M0Q A;  3NYU A;  1OXO A;  5TF5 A;  1I29 A;  4IY7 A;  3EZS A;  2ZYJ A;  1IX6 A;  3WLX A;  4MQR A;  4WXG A;  1S08 A;  4F5M A;  2BIA A;  2Z61 A;  1MGV A;  2DGK A;  3JZL A;  4XQ2 A;  2VLH A;  3TFU A;  3WCO A;  4UOY A;  1AJS B;  4Q31 A;  2CJD A;  2HP2 A;  1DJ9 A;  3B8X A;  3LY1 A;  3NX3 A;  1MDO A;  3M5U A;  5LHA A;  4U2H A;  1H1C A;  2HOR A;  3A8U X;  4LNJ A;  4A0F A;  3MKJ A;  4I8A A;  2VMP A;  3EZ1 A;  4MGR A;  4WYC A;  2QSR A;  1BJW A;  2CTZ A;  2QBT A;  2BI1 A;  3RBF A;  3R4T A;  3VK2 A;  1BQD A;  4A6T A;  1Z7D A;  5K8B A;  4F5H A;  5BJ4 A;  4PIW A;  1BW0 A;  3AEJ A;  4RIT A;  1YIY A;  1MDX A;  3OKS A;  3UWC A;  3AEN A;  1LK9 A;  1ASL A;  3FQ7 A;  2X5D A;  4F5F A;  1AIC A;  1DJE A;  2WK9 A;  1ASG A;  1O4S A;  1BJN A;  3BC8 A;  1ART A;  1MLY A;  1GC2 A;  3P6K A;  1RVY A;  2VI9 A;  2VMQ A;  1WYV A;  4WYE A;  2OQX A;  4ADD A;  4PFN A;  2CY8 A;  4RKD A;  2D66 A;  2CH2 A;  2HUI A;  2OKJ A;  2VGU A;  3AV7 A;  1M7Y A;  4JEV A;  2YOB A;  1CZE A;  3AEO A;  3FCR A;  1SZS A;  5E4Z A;  4A72 A;  3K40 A;  3GET A;  4Q6R A;  3CAI A;  1H0C A;  4BA5 A;  4IXZ A;  2D7Y A;  4IX8 A;  2V0Y A;  5DX5 A;  5EUE A;  1AY5 A;  3DYD A;  4P7Y A;  1AJR A;  2VGV A;  1V2F A;  1WKG A;  3N0L A;  3WGC A;  2D7Z A;  5G4I A;  5M46 A;  3H9X A;  1BKG A;  1AAM A;  1DKA A;  2C81 A;  3FFR A;  1LC8 A;  4B98 A;  2FKI A;  1ASM A;  3F6T A;  3A9Z A;  4WYF A;  1PG8 A;  4A6R A;  1DGD A;  2Z9W A;  1S0A A;  1MAQ A;  4OMA A;  2VMU A;  3DU4 A;  1N2T A;  4Y0H A;  1BT4 A;  4GEB A;  3HT4 A;  5AX8 A;  1EG5 A;  2G6W A;  4WB0 B;  1CL2 A;  1BJO A; 
#chains in the Genus database with same CATH homology
 1IX7 A;  2E7U A;  4JF0 A;  2D63 A;  1ZC9 A;  3ZRR A;  4IYO B;  2CST A;  4AO9 A;  1I48 A;  3DR4 A;  3BS8 A;  1ECX A;  4A0G A;  4QGR A;  3DXV A;  4ZSW A;  3BV0 A;  4RJY A;  3QBO A;  4Q75 A;  4WYA A;  3QI6 A;  1E5F A;  4XJM A;  3NUI A;  2Z9X A;  2F8J A;  4GSA A;  1V2E A;  2VMY A;  3I4J A;  1MLZ A;  2YCN A;  3ZRQ A;  4CVQ A;  2DKJ A;  2CIN A;  2BYJ A;  3IHJ A;  3T32 A;  4WLH A;  4ATQ A;  3FRK A;  2EGY A;  1ASD A;  1FG3 A;  4JEX A;  5F9S A;  1KMJ A;  4N0B A;  1D7R A;  1M0P A;  2KFP A;  3B1E A;  4E3R A;  1X29 A;  3AEJ C;  3D6K A;  2A1V A;  2BWN A;  2JIS A;  1WYU B;  3FQ8 A;  3NDN A;  4WYG A;  3FSL A;  3I5T A;  4F5I A;  2R5E A;  2Z1Z A;  4PVF A;  1DTY A;  3DRD A;  1V72 A;  1JS6 A;  1U08 A;  1WKH A;  4WD2 A;  3WCN A;  1S09 A;  1X2A A;  3EI7 A;  4ZM3 A;  3NNK A;  3RI6 A;  1ASE A;  1PMM A;  1WST A;  1ZOD A;  1PFF A;  3K28 A;  3B1D A;  4P3M A;  2FNU A;  4W91 A;  2CFB A;  1B4X A;  2DR1 A;  3VAX A;  3VOM A;  1AIA A;  4ADB A;  2JJH A;  3AAT A;  2HP1 A;  2HZP A;  4WB0 A;  3EI5 A;  4JE5 A;  3A2B A;  3HVY A;  4ISY A;  1CZC A;  1W23 A;  2YKX A;  4ZAS A;  1Y4I A;  5FT4 A;  4CBS A;  2VMX A;  3B1C A;  4E77 A;  4ZDL A;  4OT8 A;  2D61 A;  5KTB A;  4LNM A;  1VP4 A;  1D2F A;  1IVR A;  2Z20 A;  4MY5 A;  2VGW A;  2AY4 A;  2D65 A;  3QN6 A;  5D95 A;  2YKV A;  2YHK A;  3EI6 A;  3G0T A;  3WZF A;  4CBR A;  1TOK A;  3ZRP A;  3AOW A;  1E5E A;  2E7I A;  1CQ6 A;  3FZ6 A;  3MC6 A;  5M4B A;  1UKJ A;  2VGZ A;  2C7T A;  3JW9 A;  4R5F A;  2Z9U A;  3F0H A;  1D7S A;  1I41 A;  4ITG A;  4L0O A;  5E3K A;  2JG2 A;  5EUN A;  5IWQ A;  2OGE A;  1TPL A;  2VLF A;  5FT6 A;  1AY4 A;  1QGN A;  3FZ8 A;  2R0T A;  2VIA A;  3DXW A;  2WK7 A;  1WYU A;  2YRR A;  3HMU A;  4PFF A;  4XJL A;  1C7O A;  1GEX A;  1TAR A;  2CAN A;  2VMR A;  4OBU A;  1YJZ A;  2W7I A;  4DQ6 A;  3BWN A;  3RUY A;  2O7C A;  3FD0 A;  3E77 A;  4AO4 A;  5HXX A;  3BCA A;  1ASB A;  2OAT A;  4ZDP A;  3VK4 A;  2W7M A;  1LS3 A;  1GD9 A;  2TPL A;  3TFT A;  2ORD A;  2YKU A;  9AAT A;  1GCK A;  2VMS A;  3DOD A;  2ZJG A;  3GBX A;  3JWB A;  1AX4 A;  3LVM A;  4IXS A;  4A6U A;  4JEZ A;  2ZSL A;  4K2B A;  5F8V A;  2GMU A;  3ISL A;  1VEF A;  2Z1Y A;  2FYF A;  2BI5 A;  1G7W A;  3K7Y A;  4FL0 A;  2AY9 A;  2W8U A;  1SZK A;  1W7L A;  2BIE A;  2DOU A;  1B9H A;  2GMS A;  3QM2 A;  4GE9 A;  4MQQ A;  5FT8 A;  1ARG A;  5JAY A;  1ASN A;  1S06 A;  3II0 A;  1YAA A;  1SZU A;  3LV2 A;  3GR9 A;  4KAM A;  1ORD A;  2FNI A;  2R5C B;  4ZWM A;  3RCH B;  1GEY A;  2EZ2 A;  4ADC A;  1AMR A;  1AMA A;  2VMZ A;  3LVL B;  3VK3 A;  1AJS A;  3USF A;  1GEW A;  3PAA A;  1ASF A;  3CQ4 A;  4MKJ A;  1YJY A;  1FG7 A;  1QJ5 A;  4W1W A;  2VMW A;  1TOE A;  1ELQ A;  3W1I A;  3FTB A;  1G4X A;  4EB7 A;  4CXR A;  4RIZ A;  1AMS A;  3WKS A;  1I43 A;  3OP7 A;  2BKW A;  1N8P A;  5G0A A;  4UHO A;  3COG A;  3HL2 A;  2YKY A;  3N4X A;  1AY8 A;  3PIU A;  1SF2 A;  2Z67 A;  4UHM A;  4WLJ A;  3TAT A;  1UU0 A;  2W7G A;  2X5F A;  2VI8 A;  1DJU A;  3AEM A;  4N0W A;  5EQC A;  1KL2 A;  3GZC A;  3HLM A;  1RVU A;  1C9C A;  2JGT A;  3PJ0 A;  4BA4 A;  1AHF A;  4FFC A;  1SPA A;  3GWP A;  1IJI A;  2D64 A;  2E54 A;  4DGT A;  2CJH A;  1TOJ A;  3NU8 A;  2W8W A;  3PDX A;  1YIZ A;  2JJG A;  3TQX A;  1KL1 A;  3MAF B;  2W7J A;  2C44 A;  1XI9 A;  4J5U A;  4R8D A;  1LW5 A;  2W8T A;  3E2Y A;  1BJ4 A;  2O0R A;  4WBT A;  1KMK A;  1LW4 A;  2PB0 A;  4R5Z A;  3EIB A;  1WYT B;  4WYD A;  3MC6 C;  2ZY3 A;  1YNU A;  5EFS A;  3H14 A;  1LC5 A;  2ZY4 A;  1LC7 A;  1S07 A;  4E1O A;  4W8I A;  1IAX A;  1QIR A;  2QMA A;  3NYT A;  3PGY A;  4OCA A;  1IX8 A;  4W1X A;  1W7M A;  3MBB A;  2VMT A;  2XH1 A;  4K2I A;  4LC3 A;  3EI8 A;  1X28 A;  4EU1 A;  1DFO A;  3MAD A;  3PD6 B;  3W1J A;  2HOZ A;  2X8U A;  3ELE A;  2DGL A;  3BWN C;  4IW7 A;  8AAT A;  3PPL A;  2AY3 A;  1EQB A;  2NMP A;  2X3L A;  1M0O A;  2ZSM A;  2ZC0 A;  4XK1 A;  4OTL A;  3L8A A;  1T3I A;  1MAP A;  2W7E A;  3GJU A;  4WXB A;  1AHY A;  1ZOB A;  4RLG A;  3Q8N A;  3LVK A;  7AAT A;  1YOO A;  3NUB A;  3TCM A;  1D7V A;  2WKA A;  2ZY5 A;  4RAE A;  3BCX A;  3E2F A;  2FQ6 A;  5EUD A;  2VIB A;  2FN6 A;  4IYO A;  1MDZ A;  4TMR A;  3MAF A;  3PDB B;  2DGM A;  5M4D A;  4KYO A;  3HBX A;  1Z3Z A;  3NRA A;  4UQV A;  2JJF A;  1CS1 A;  2WB6 A;  2FM1 A;  1WYT A;  3AOV A;  1OXP A;  4U1T A;  3E6G A;  2Z9V A;  1CJ0 A;  1UU1 A;  4XEW A;  4ZM4 A;  1C7G A;  1C4K A;  3A9Y A;  2W7H A;  2VGS A;  1X0M A;  2BI2 A;  3FFH A;  1B8G A;  3ZZK A;  4ADE A;  3LVJ A;  5M49 A;  4GDY A;  4CXQ A;  3JTX A;  2W8J A;  2R2N A;  4JEY A;  2W7F A;  1WYV B;  4R2N A;  5D5S A;  1C7N A;  1O69 A;  2VYC A;  2EZ1 A;  4J8L A;  3N75 A;  4MQP A;  2VGT A;  4F5J A;  1AKC A;  4EFF A;  1TOG A;  3AEM C;  5HHY A;  1RV3 A;  4Y0I A;  2W8V A;  3BN1 A;  1OHY A;  4O6Z A;  4WP0 A;  3JWA A;  3KGW A;  2EPJ A;  1GC3 A;  4OYT A;  1ARS A;  4AOA A;  1AHE A;  2RFV A;  4GE7 A;  4IXO A;  3WKR A;  1BQA A;  1QIS A;  1ELU A;  1M4N A;  1QJ3 A;  5DB5 A;  3FVX A;  5C6U A;  4E3Q A;  3BCB A;  2E7J A;  3PDB A;  1FC4 A;  2PO3 A;  4A0H A;  2QB3 A;  4ZDO A;  3R9A A;  3F9T A;  1B5P A;  3FKD A;  5EAV A;  1AKB A;  1B9I A;  3KGX A;  4AZJ A;  1OHV A;  1KKP A;  1QZ9 A;  3DC1 A;  4GRX A;  3AEP A;  4ZLV A;  2BWO A;  1LKC A;  5J8Q A;  1J04 A;  4OBV A;  4K05 A;  3GZD C;  3EI9 A;  4M2M A;  1TAT A;  2AY5 A;  1SVV A;  3A9X A;  1W7N A;  3WY7 A;  2G7J A;  1W3U A;  1BJO B;  4ATP A;  2AY7 A;  3FQA A;  5G4J A;  1B5O A;  2QLR A;  2O1B A;  2OKK A;  2VMV A;  3NTJ A;  4TN4 A;  5EIG B;  3N4R A;  1AKA A;  2OGA A;  1GDE A;  4JF1 A;  1JG8 A;  2HOY A;  4W1V A;  1VJO A;  2GSA A;  4ITX A;  4JE5 D;  4F5G A;  3PA9 A;  1KKJ A;  1M0N A;  1OHW A;  3W1H A;  3WGB A;  2AAT A;  4EB5 A;  3HQT A;  1V2D A;  1IBJ A;  3ASB A;  1XEY A;  2BIG A;  3RBL A;  3EUC A;  4RM1 A;  4LW4 A;  3WX9 A;  2AY1 A;  4JEW A;  2D5Y A;  2YCP A;  4AZK A;  3ACZ A;  2AY8 A;  2ZY2 A;  2HUU A;  3NU7 A;  2QA3 A;  1CL1 A;  1M6S A;  4TV7 A;  4DBC A;  3G8M A;  4Q76 A;  3MEB A;  5I92 A;  4ZAH A;  4ZWV A;  1ASA A;  3VP6 A;  1G7X A;  1ARH A;  2W7D A;  2AY6 A;  3QGU A;  2W7L A;  3FDB A;  5LH9 A;  4XAU A;  3JU7 A;  1PMO A;  2R5C A;  3ATH A;  3RCH A;  3EIA A;  5DJ9 A;  2BYL A;  4WXF A;  3E2Z B;  3N7N A;  1AIB A;  1O61 A;  3H7F A;  5DJ1 A;  3UE8 A;  3DR7 A;  4M2J A;  1M32 A;  2ZP7 A;  2W7K A;  3ELP A;  2DKB A;  1N31 A;  1AHG A;  4EMY A;  3GZD A;  5HDM A;  2QB2 A;  1P3W A;  3BB8 A;  2CH1 A;  5G2P A;  1IAY A;  1GC0 A;  2HOX A;  3N5M A;  5EIG A;  2AEU A;  1JF9 A;  4B9B A;  4NOG A;  4XJO A;  1AMQ A;  5G2Q A;  4H63 Q;  2ZUK A;  2BWP A;  5FT5 A;  2Q7W A;  4A00 A;  3ZZJ A;  2VMO A;  4LNL A;  4BQ0 A;  4HVK A;  1D7U A;  2AEV A;  5BJ3 A;  2GQN A;  3N4S A;  4A0R A;  1CQ7 A;  2WK8 A;  2EO5 A;  1TAS A;  2C0R A;  3L44 A;  1YJS A;  3CQ6 A;  1DGE A;  4RJ0 A;  5E5I A;  2VMN A;  4AH3 A;  3FVS A;  3P1T A;  3LG0 A;  3DZZ A;  1EJI A;  3ECD A;  1ARI A;  3CBF A;  4K2M A;  3LWS A;  4ZSY A;  4BMK A;  3MAU A;  2CB1 A;  3E9K A;  1CQ8 A;  3BWO A;  2YRI A;  3KKI A;  3ASA A;  2PB2 A;  1SFF A;  1OAT A;  1UU2 A;  2AY2 A;  3CQ5 A;  4F4E A;  2EH6 A;  4RKC A;  4XJP A;  4UHN A;  3RQ1 A;  1G4V A;  2XBN A;  3QPG A;  3AEL A;  1JS3 A;  1GC4 A;  3FVU A;  4GE4 A;  1TOI A;  1RV4 A;  3IF2 A;  4Y0D A;  4KXK A;  2BI3 A;  3I16 A;  3E2Z A;  2EYQ A;  3FDD A;  1O62 A;  3AEN B;  2HUF A;  3KE3 A;  4HF8 A;  4M2K A;  4MSO A;  2YCT A;  3B46 A;  3GSB A;  1C0N A;  4W5K A;  4MKK A;  5EAA A;  4F5K A;  2GB3 A;  3FZ7 A;  3HDO A;  3QHX A;  1IUG A;  4OC9 A;  4H51 A;  2BI9 A;  1ASC A;  1J32 A;  1AHX A;  1GBN A;  2BHX A;  3PD6 A;  3UAK A;  3NYS A;  1QIT A;  1AAW A;  4LW2 A;  5G09 A;  2V1P A;  4F5L A;  1BS0 A;  2JJE A;  3G7Q A;  2CJG A;  4BHD A;  1M0Q A;  3NYU A;  1OXO A;  5TF5 A;  1I29 A;  4IY7 A;  3EZS A;  2ZYJ A;  1IX6 A;  3WLX A;  4MQR A;  4WXG A;  1S08 A;  4F5M A;  2BIA A;  2Z61 A;  1MGV A;  2DGK A;  3JZL A;  4XQ2 A;  2VLH A;  3TFU A;  3WCO A;  4UOY A;  1AJS B;  4Q31 A;  2CJD A;  2HP2 A;  1DJ9 A;  3B8X A;  3LY1 A;  3NX3 A;  1MDO A;  3M5U A;  5LHA A;  4U2H A;  1H1C A;  2HOR A;  3A8U X;  4LNJ A;  4A0F A;  3MKJ A;  4I8A A;  2VMP A;  3EZ1 A;  4MGR A;  4WYC A;  2QSR A;  1BJW A;  2CTZ A;  2QBT A;  2BI1 A;  3RBF A;  3R4T A;  3VK2 A;  1BQD A;  4A6T A;  1Z7D A;  5K8B A;  4F5H A;  5BJ4 A;  4PIW A;  1BW0 A;  3AEJ A;  4RIT A;  1YIY A;  1MDX A;  3OKS A;  3UWC A;  3AEN A;  1LK9 A;  1ASL A;  3FQ7 A;  2X5D A;  4F5F A;  1AIC A;  1DJE A;  2WK9 A;  1ASG A;  1O4S A;  1BJN A;  3BC8 A;  1ART A;  1MLY A;  1GC2 A;  3P6K A;  1RVY A;  2VI9 A;  2VMQ A;  1WYV A;  4WYE A;  2OQX A;  4ADD A;  4PFN A;  2CY8 A;  4RKD A;  2D66 A;  2CH2 A;  2HUI A;  2OKJ A;  2VGU A;  3AV7 A;  1M7Y A;  4JEV A;  2YOB A;  1CZE A;  3AEO A;  3FCR A;  1SZS A;  5E4Z A;  4A72 A;  3K40 A;  3GET A;  4Q6R A;  3CAI A;  1H0C A;  4BA5 A;  4IXZ A;  2D7Y A;  4IX8 A;  2V0Y A;  5DX5 A;  5EUE A;  1AY5 A;  3DYD A;  4P7Y A;  1AJR A;  2VGV A;  1V2F A;  1WKG A;  3N0L A;  3WGC A;  2D7Z A;  5G4I A;  5M46 A;  3H9X A;  1BKG A;  1AAM A;  1DKA A;  2C81 A;  3FFR A;  1LC8 A;  4B98 A;  2FKI A;  1ASM A;  3F6T A;  3A9Z A;  4WYF A;  1PG8 A;  4A6R A;  1DGD A;  2Z9W A;  1S0A A;  1MAQ A;  4OMA A;  2VMU A;  3DU4 A;  1N2T A;  4Y0H A;  1BT4 A;  4GEB A;  3HT4 A;  5AX8 A;  1EG5 A;  2G6W A;  4WB0 B;  1CL2 A;  1BJO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...