1I48A

Cystathionine gamma-synthase in complex with the inhibitor ctcpo
Total Genus 128
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
128
sequence length
396
structure length
396
Chain Sequence
YASFLNSDGSVAIHAGERLGRGIVTDAITTPVVNTSAYFFNKTSELIDFKEKRRASFEYGRYGNPTTVVLEEKISALEGAESTLLMASGMCASTVMLLALVPAGGHIVTTTDCYRKTRIFIETILPKMGITATVIDPADVGALELALNQKKVNLFFTESPTNPFLRCVDIELVSKLCHEKGALVCIDGTFATPLNQKALALGADLVLHSATKFLGGHNDVLAGCISGPLKLVSEIRNLHHILGGALNPNAAYLIIRGMKTLHLRVQQQNSTALRMAEILEAHPKVRHVYYPGLQSHPEHHIAKKQMTGFGGAVSFEVDGDLLTTAKFVDALKIPYIAPSFGGCESIVDQPAIMSYWDLSQSDRAKYGIMDNLVRFSFGVEDFDDLKADILQALDSI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CYSTATHIONINE GAMMA-SYNTHASE
publication title Crystal structures of cystathionine gamma-synthase inhibitor complexes rationalize the increased affinity of a novel inhibitor.
pubmed doi rcsb
source organism Nicotiana tabacum
molecule tags Lyase
total genus 128
structure length 396
sequence length 396
chains with identical sequence B, C, D, E, F, G, H, I, J, K, L
ec nomenclature ec 4.2.99.9: Transferred entry: 2.5.1.48.
pdb deposition date 2001-02-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01053 Cys_Met_Meta_PP Cys/Met metabolism PLP-dependent enzyme
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.640.10 Alpha Beta 3-Layer(aba) Sandwich Aspartate Aminotransferase; domain 2 Type I PLP-dependent aspartate aminotransferase-like (Major domain) 1i48A01
3.90.1150.10 Alpha Beta Alpha-Beta Complex Aspartate Aminotransferase, domain 1 Aspartate Aminotransferase, domain 1 1i48A02
3GZDA 3WGBA 1OXPA 1BJOA 2XH1A 4AO9A 3BC8A 4DBCA 4EU1A 5J8QA 3CQ4A 2PB0A 1BJWA 2GSAA 1DKAA 3A2BA 5G0AA 4WLHA 1LS3A 3QM2A 4IYOA 1X28A 3FCRA 1AIAA 2BI9A 3HVYA 5M4BA 4PVFA 5EUDA 4BA4A 1JS3A 3II0A 2R5CA 3R9AA 2R0TA 3KE3A 3FFRA 1IX8A 1P3WA 3RBLA 3USFA 3FDBA 1JG8A 2VMPA 4OMAA 2E7UA 3PAAA 1LC7A 4F4EA 2VGVA 5G2QA 5DB5A 4ATPA 4BHDA 1I41A 1MGVA 1FC4A 3E9KA 2ZY5A 3GETA 1Z7DA 4JE5A 1AMRA 4F5LA 1AKBA 4F5IA 3R4TA 4RLGA 3IF2A 4CXQA 3B1CA 3P1TA 3LVMA 3KKIA 2BYLA 1ZC9A 3OKSA 3WCNA 1W7MA 2VIBA 1PG8A 2HOZA 2W8TA 2DKJA 2DOUA 4F5GA 1B5PA 3AELA 5DX5A 5E3KA 4ZSYA 9AATA 2JISA 3DR7A 3QPGA 4W1VA 4JE5D 1AX4A 1LC8A 4OBVA 4JEZA 3VK2A 3EI7A 5HXXA 2YKUA 5EQCA 1H0CA 1M0OA 4ZSWA 4AZJA 5D5SA 3GSBA 3H7FA 4CXRA 2X3LA 2W7DA 2O0RA 2X8UA 4W8IA 2R2NA 3K28A 1QIRA 5BJ3A 5EUNA 4IY7A 1EQBA 4A6TA 4ZDPA 1WYUB 7AATA 1YAAA 3BWOA 1OXOA 3ASAA 1C7GA 2GMSA 3N0LA 2ZY3A 1B4XA 4K2IA 4TMRA 1WYTB 1ZOBA 2JGTA 2JG2A 5E4ZA 2ZUKA 3FQ7A 1IX6A 2OGAA 2YCPA 3EUCA 1MLZA 1SF2A 2ZSLA 3MAUA 2W7KA 4W5KA 1YNUA 2FNIA 3IHJA 3LWSA 4MQPA 2GMUA 1BQDA 1OATA 2D63A 4Y0IA 1YOOA 4JEXA 2BI5A 2CH1A 1O4SA 3DYDA 5EAVA 4MQQA 2EO5A 2E7IA 3COGA 4XAUA 1AY4A 2QBTA 1T3IA 2Z9WA 4ITXA 2WK9A 4JEWA 4RJYA 1ASGA 4A0RA 4OYTA 1JF9A 1S09A 1ORDA 2Z9VA 4E3RA 2QB2A 3EI8A 4MSOA 4ZWVA 2BWNA 1GEWA 1AJSA 2CFBA 2JJGA 3NU8A 4Y0HA 3W1IA 5C6UA 4A0FA 5M46A 3EZ1A 4IXZA 3FSLA 2QMAA 1U08A 2AY2A 3MADA 2CINA 4F5KA 2AY3A 2CJGA 3HL2A 2W8JA 3I4JA 3KGXA 3CQ5A 4GRXA 2DGLA 2HP2A 4CBSA 3FDDA 1I43A 3F6TA 3T32A 4IX8A 1VEFA 3L44A 4LNMA 3LVKA 2HUIA 3PD6B 5D95A 4UHNA 1BT4A 1CZCA 1V2FA 2PO3A 2BI1A 3AENB 2BI2A 2D5YA 1WSTA 3HDOA 2YOBA 3AOWA 4EB5A 2CJHA 1C7NA 1WYUA 2CB1A 3A9XA 2VMOA 3JWAA 3NNKA 1E5EA 4RAEA 2JJHA 2DKBA 3PGYA 1I48A 4LNLA 4UHMA 1ELQA 2R5EA 2RFVA 4A0GA 1CQ8A 2W7HA 4Y0DA 2OGEA 4XJOA 3JTXA 4OT8A 4U2HA 2VMZA 1M7YA 2BWOA 1AY5A 1C9CA 2W7EA 3HBXA 1TASA 2W8VA 1CJ0A 1M6SA 3WX9A 5FT4A 2BWPA 1SVVA 2X5DA 2ZY4A 4WYGA 3TFTA 4P7YA 1SFFA 1YJZA 3BCXA 2VI8A 1KL2A 4MKKA 2ORDA 4WB0A 5DJ9A 1FG3A 3B8XA 1D7RA 1AHXA 2VMQA 1GBNA 2D65A 2D64A 2VYCA 3MAFA 4RM1A 1O69A 4F5JA 1B8GA 3WZFA 2CANA 3EIBA 4WBTA 4W91A 2V1PA 1D7SA 1V2DA 1RVYA 3A8UX 2Z67A 2FM1A 1TOKA 2D66A 4DGTA 3ZRPA 4J8LA 3HLMA 5FT5A 1DGEA 1AHFA 4IXOA 2AEVA 3CQ6A 1E5FA 2VMTA 1SZUA 3PD6A 1YIZA 2X5FA 1OHYA 4R8DA 2GB3A 5K8BA 3B1DA 4ITGA 2AY7A 4P3MA 3FZ8A 1ASAA 1DGDA 1S07A 3BN1A 2OKJA 1O61A 4CVQA 3FTBA 5EIGB 2DR1A 4I8AA 2Q7WA 1I29A 1KKJA 1AMAA 1GC0A 5E5IA 1YJSA 1GDEA 3HQTA 2VGUA 1AJRA 3QI6A 5G09A 2W7GA 1ARIA 1X0MA 3AEMC 3TFUA 4AH3A 4E3QA 4GSAA 1ASFA 1DTYA 3DC1A 3MKJA 4JF1A 1W7LA 2AY5A 2QB3A 1M0PA 1Z3ZA 3LY1A 3NTJA 4OC9A 3K7YA 3H14A 2WK7A 1B5OA 2YRIA 2W7LA 1UU0A 1IAXA 2W7FA 3FRKA 3QN6A 3CBFA 3E2FA 4MY5A 1IVRA 4L0OA 3AATA 4WXFA 2PB2A 2BYJA 5HHYA 1YJYA 4GE9A 4K2BA 4EB7A 1QJ5A 2Z1ZA 2W7IA 2VLHA 3VP6A 1ASNA 1PMOA 3AEMA 2VGSA 4FFCA 1CL1A 4RJ0A 4A6RA 3PJ0A 4HVKA 1AKAA 2VMRA 4TN4A 2AY4A 1WYVB 3UAKA 2CSTA 3A9ZA 4ISYA 3E2ZB 5EIGA 4Q6RA 2EZ1A 2BIAA 1N31A 4OCAA 4WXBA 5I92A 1ARTA 1IUGA 1DJEA 4FL0A 1BS0A 1TOIA 2HOXA 3LVJA 3N5MA 3PDBB 2C0RA 4IW7A 2CJDA 5BJ4A 2JJEA 2YHKA 3QHXA 3TATA 1W3UA 4R5ZA 2VGWA 1CQ7A 1YIYA 2Z9UA 3ISLA 2VGZA 2ZP7A 1Y4IA 3CAIA 3JWBA 2NMPA 2VGTA 1S0AA 4WP0A 2C7TA 4GEBA 1GEYA 1TATA 2VMXA 1ARHA 1ASLA 1D7VA 1W7NA 2HP1A 2YKYA 3EI9A 3PPLA 4RITA 3ZRQA 4JEYA 4ZDOA 4WD2A 1BJ4A 5G2PA 1EG5A 3E2YA 3JU7A 2JJFA 3WKRA 3FQ8A 1C0NA 4M2JA 1N2TA 3LVLB 3DR4A 2D61A 4LW2A 1KL1A 1SZSA 1UKJA 3MC6C 4BA5A 1AIBA 1J04A 4MQRA 4N0BA 1DFOA 4MKJA 5IWQA 3ATHA 3I5TA 4EMYA 1M4NA 1BJOB 1O62A 1WYTA 1AAWA 1TOJA 5EUEA 3ZZJA 4KXKA 5LHAA 1QJ3A 1M0NA 1UU1A 4UQVA 2XBNA 1IBJA 2TPLA 1GEXA 1GC4A 3PIUA 1AHYA 2YKXA 3BB8A 4IYOB 2ZY2A 3W1HA 3NUBA 3UE8A 1ASCA 4XQ2A 3EZSA 2HORA 3PDBA 1D2FA 4MGRA 4W1WA 2AY8A 1S06A 2VMNA 1LW5A 2CY8A 3EI6A 3MC6A 3OP7A 3L8AA 1IJIA 1TOGA 1OHVA 3BV0A 3FZ7A 4CBRA 4XJMA 2ZJGA 4WYDA 3RI6A 1G4VA 5M49A 2VMSA 3G0TA 1EJIA 4GE7A 4F5HA 4R5FA 2YCNA 4ADEA 4NOGA 4WLJA 4N0WA 4AO4A 4R2NA 2DGMA 4ADBA 3N75A 2G6WA 3E77A 1BKGA 4WXGA 3RCHB 2QA3A 2AY9A 4F5MA 3NUIA 3QBOA 1LKCA 1DJUA 4O6ZA 3VAXA 1MLYA 1PFFA 1RV4A 1MAPA 1AY8A 2QLRA 1PMMA 3G8MA 4KAMA 4ZDLA 5TF5A 3WY7A 2EPJA 2AATA 1AAMA 3AENA 3AV7A 2WK8A 4Q76A 5JAYA 3P6KA 1B9IA 2W8UA 2Z9XA 1AHEA 1X2AA 3VOMA 3PA9A 3ZRRA 4QGRA 2HUUA 3DXWA 4J5UA 4H51A 1J32A 1MDZA 4JEVA 4UOYA 3MEBA 2W7MA 3FFHA 2Z20A 4AOAA 4TV7A 3RQ1A 1RVUA 1S08A 1LC5A 3F0HA 3TCMA 4LC3A 4IXSA 3DZZA 2FQ6A 2FYFA 2GQNA 3LG0A 1BQAA 3NYSA 4ZM3A 2DGKA 3ASBA 3DU4A 3FD0A 5G4IA 3QGUA 4A00A 4PFFA 3NU7A 4ADDA 3FQAA 3WLXA 3AOVA 4Q31A 3FVXA 1M0QA 2E54A 4XJPA 4KYOA 3ELPA 5G4JA 4XK1A 3FKDA 5FT6A 2FNUA 4WYEA 4A0HA 3NX3A 2AEUA 4ZWMA 3RCHA 4K2MA 3JW9A 2BKWA 3GBXA 1SPAA 2W8WA 3UWCA 1MDXA 1AHGA 2VMVA 1IX7A 2OQXA 1AJSB 1CZEA 1TPLA 2W7JA 4PFNA 2VMWA 1DJ9A 3LV2A 3BS8A 3ECDA 1WKHA 4RIZA 5HDMA 3AEOA 1XI9A 2AY1A 2BHXA 1LW4A 2YCTA 1C7OA 3FVSA 2YKVA 1IAYA 1XEYA 3FVUA 3DRDA 5LH9A 5F9SA 4M2KA 2VIAA 1BW0A 1ARSA 1GC3A 1MAQA 2CH2A 2VI9A 3HT4A 4OTLA 1QITA 3DXVA 4GE4A 4W1XA 4UHOA 2OATA 2EGYA 1AMSA 4HF8A 1CL2A 1LK9A 3NDNA 2OKKA 4OBUA 3EIAA 1ASEA 3G7QA 3K40A 3RBFA 3BCBA 3PDXA 4ZM4A 2EH6A 3GZCA 3AEJC 3GR9A 4BQ0A 4DQ6A 2HOYA 4BMKA 2O1BA 4E1OA 1G7XA 1B9HA 1AMQA 2HUFA 2VMUA 3E6GA 3DODA 3ZZKA 4ZAHA 1AKCA 4B9BA 1ARGA 2ZYJA 4WYCA 1GD9A 1CS1A 4ATQA 1H1CA 5AX8A 4WYFA 2V0YA 4M2MA 3VK3A 2HZPA 1TARA 2D7ZA 3WKSA 1MDOA 1V72A 3BCAA 3MBBA 3NYTA 1ASMA 3KGWA 1KMJA 2Z1YA 4Q75A 1RV3A 1ASBA 4WB0B 2BIGA 4B98A 3AEJA 2AY6A 1ASDA 3MAFB 4LW4A 3VK4A 4LNJA 4JF0A 4AZKA 1QISA 1JS6A 2F8JA 1V2EA 4A6UA 1VP4A 1BJNA 1WYVA 3HMUA 1QGNA 1KMKA 4RKCA 4GDYA 1QZ9A 3BWNC 5DJ1A 3E2ZA 1CQ6A 1KKPA 3F9TA 1WKGA 3TQXA 4A72A 1W23A 2E7JA 3GWPA 1TOEA 2R5CB 5F8VA 2D7YA 1GC2A 3WGCA 2VLFA 4WYAA 1C4KA 3WCOA 2BI3A 2WKAA 3AEPA 1UU2A 3B1EA 1X29A 3B46A 4ADCA 3GZDC 2Z61A 4E77A 2ZC0A 3A9YA 2FN6A 5FT8A 4RKDA 4XEWA 5EFSA 3ACZA 3ELEA 1ECXA 5M4DA 2C81A 1G4XA 1VJOA 1N8PA 3FZ6A 2ZSMA 3I16A 4EFFA 3M5UA 4U1TA 8AATA 3RUYA 3JZLA 4ZLVA 2EZ2A 4PIWA 3BWNA 1ELUA 3D6KA 2BIEA 1AICA 3NRAA 5EAAA 2VMYA 1G7WA 2YRRA 3Q8NA 1D7UA 3W1JA 2CTZA 1SZKA 1FG7A 2O7CA 4ZASA 4XJLA 3GJUA 1GCKA 3NYUA 2C44A 1OHWA 3EI5A 4F5FA 1M32A 1ZODA
chains in the Genus database with same CATH superfamily
4K05A 3GZDA 3WGBA 1OXPA 1BJOA 2XH1A 4AO9A 3BC8A 4DBCA 4EU1A 5J8QA 3CQ4A 2PB0A 1BJWA 2GSAA 1DKAA 3A2BA 5G0AA 4WLHA 1LS3A 3QM2A 4IYOA 1X28A 3FCRA 1AIAA 2BI9A 3HVYA 5M4BA 4PVFA 5EUDA 4BA4A 1JS3A 3II0A 2R5CA 3R9AA 2R0TA 3KE3A 3FFRA 1IX8A 1P3WA 3RBLA 3USFA 3FDBA 1JG8A 2VMPA 4OMAA 2E7UA 3PAAA 1LC7A 2A1VA 4F4EA 2VGVA 5G2QA 5DB5A 4ATPA 3H9XA 4BHDA 1I41A 1MGVA 1FC4A 3E9KA 2ZY5A 3GETA 1Z7DA 4JE5A 1AMRA 4F5LA 1AKBA 4F5IA 3R4TA 4RLGA 3IF2A 4CXQA 3B1CA 3P1TA 3LVMA 3KKIA 2BYLA 1ZC9A 3OKSA 3WCNA 1W7MA 2VIBA 1PG8A 2HOZA 2W8TA 2DKJA 2DOUA 4F5GA 3N4SA 1B5PA 3AELA 5DX5A 5E3KA 4ZSYA 9AATA 2JISA 3DR7A 3QPGA 4W1VA 4JE5D 1AX4A 1LC8A 4OBVA 4JEZA 3VK2A 3EI7A 5HXXA 2YKUA 5EQCA 1H0CA 1M0OA 4ZSWA 4AZJA 5D5SA 3GSBA 3H7FA 4CXRA 2X3LA 2W7DA 2O0RA 2X8UA 4W8IA 2R2NA 3K28A 1QIRA 5BJ3A 5EUNA 4IY7A 1EQBA 4A6TA 4ZDPA 1WYUB 7AATA 1YAAA 3BWOA 1OXOA 3ASAA 1C7GA 2GMSA 3N0LA 2ZY3A 1B4XA 4K2IA 4TMRA 1WYTB 1ZOBA 2JGTA 2JG2A 5E4ZA 2ZUKA 3FQ7A 1IX6A 2OGAA 2YCPA 3EUCA 1MLZA 1SF2A 2ZSLA 3MAUA 2W7KA 4W5KA 1YNUA 3N7NA 2FNIA 3IHJA 3LWSA 4MQPA 2GMUA 1BQDA 1OATA 2D63A 4Y0IA 1YOOA 4JEXA 2BI5A 2CH1A 1O4SA 3DYDA 5EAVA 4MQQA 2EO5A 2E7IA 3COGA 4XAUA 1AY4A 2QBTA 1T3IA 2Z9WA 4ITXA 2WK9A 4JEWA 4RJYA 1ASGA 4A0RA 4OYTA 1JF9A 1S09A 1ORDA 2Z9VA 4E3RA 2QB2A 3EI8A 4MSOA 4ZWVA 2BWNA 1GEWA 1AJSA 2CFBA 2JJGA 3NU8A 4Y0HA 3W1IA 5C6UA 4A0FA 5M46A 3EZ1A 4IXZA 3FSLA 2QMAA 1U08A 2AY2A 3MADA 2CINA 4F5KA 2AY3A 2CJGA 3HL2A 2W8JA 3I4JA 3KGXA 3CQ5A 2G7JA 4GRXA 2DGLA 2HP2A 4CBSA 3FDDA 1I43A 3F6TA 3T32A 4IX8A 1VEFA 3L44A 4LNMA 3LVKA 2HUIA 3PD6B 5D95A 4UHNA 1BT4A 1CZCA 1V2FA 2PO3A 2BI1A 3AENB 2BI2A 2D5YA 1WSTA 3HDOA 2YOBA 3AOWA 4EB5A 2CJHA 1C7NA 1WYUA 2CB1A 3A9XA 2VMOA 3JWAA 3NNKA 1E5EA 4RAEA 2JJHA 2DKBA 3PGYA 1I48A 4LNLA 4UHMA 1ELQA 2R5EA 2RFVA 4A0GA 1CQ8A 2W7HA 4Y0DA 2KFPA 2OGEA 4XJOA 3JTXA 4OT8A 4U2HA 2VMZA 1M7YA 2BWOA 1AY5A 1C9CA 2W7EA 3HBXA 1TASA 2W8VA 1CJ0A 1M6SA 3WX9A 5FT4A 2BWPA 1SVVA 2X5DA 2ZY4A 4WYGA 3TFTA 4P7YA 1SFFA 1YJZA 3BCXA 2VI8A 1KL2A 4MKKA 2ORDA 4WB0A 5DJ9A 2EYQA 1FG3A 3B8XA 1D7RA 1AHXA 2VMQA 1GBNA 2D65A 2D64A 2VYCA 3MAFA 4RM1A 1O69A 4F5JA 1B8GA 3WZFA 2CANA 3EIBA 4WBTA 4W91A 2V1PA 1D7SA 1V2DA 1RVYA 3A8UX 2Z67A 2FM1A 1TOKA 2D66A 4DGTA 3ZRPA 4J8LA 3HLMA 5FT5A 1DGEA 1AHFA 4IXOA 2AEVA 3CQ6A 1E5FA 2VMTA 1SZUA 3PD6A 1YIZA 2X5FA 1OHYA 4R8DA 2GB3A 5K8BA 3B1DA 4ITGA 2AY7A 4P3MA 3FZ8A 1ASAA 1DGDA 1S07A 3BN1A 2OKJA 1O61A 4CVQA 3FTBA 5EIGB 2DR1A 4I8AA 2Q7WA 1I29A 1KKJA 1AMAA 1GC0A 5E5IA 1YJSA 1GDEA 3HQTA 2VGUA 2FKIA 1AJRA 3QI6A 5G09A 2W7GA 1ARIA 1X0MA 3AEMC 3TFUA 4AH3A 5KTBA 4E3QA 4GSAA 1ASFA 1DTYA 3DC1A 3MKJA 4JF1A 1W7LA 2AY5A 2QB3A 1M0PA 1Z3ZA 3LY1A 3NTJA 4OC9A 3K7YA 3H14A 2WK7A 1B5OA 2YRIA 2W7LA 1UU0A 1IAXA 2W7FA 3FRKA 3QN6A 3CBFA 3E2FA 4MY5A 1IVRA 4L0OA 3AATA 4WXFA 2PB2A 2BYJA 5HHYA 1YJYA 4GE9A 4K2BA 4EB7A 1QJ5A 2Z1ZA 2W7IA 2VLHA 3VP6A 1ASNA 1PMOA 3AEMA 2VGSA 4FFCA 1CL1A 4RJ0A 4A6RA 3PJ0A 4HVKA 1AKAA 2VMRA 4TN4A 2AY4A 1WYVB 3UAKA 2CSTA 3A9ZA 4ISYA 3E2ZB 5EIGA 4Q6RA 2EZ1A 2BIAA 1N31A 4OCAA 4WXBA 2WB6A 5I92A 1ARTA 1IUGA 1DJEA 4FL0A 1BS0A 1TOIA 2HOXA 3LVJA 3N5MA 3PDBB 2C0RA 4IW7A 2CJDA 5BJ4A 2JJEA 2YHKA 3QHXA 3TATA 1W3UA 4R5ZA 2VGWA 1CQ7A 1YIYA 2Z9UA 3ISLA 2VGZA 2ZP7A 1Y4IA 3CAIA 3JWBA 2NMPA 2VGTA 1S0AA 4WP0A 2C7TA 4GEBA 1GEYA 1TATA 2VMXA 1ARHA 1ASLA 1D7VA 1W7NA 2HP1A 2YKYA 3EI9A 3PPLA 4RITA 3ZRQA 4JEYA 4ZDOA 4WD2A 1KAFA 1BJ4A 5G2PA 1EG5A 3E2YA 3JU7A 2JJFA 3WKRA 3FQ8A 1C0NA 4M2JA 1N2TA 3LVLB 3DR4A 2D61A 4LW2A 1KL1A 1SZSA 1UKJA 3MC6C 4BA5A 1AIBA 1J04A 4MQRA 4N0BA 1DFOA 4MKJA 5IWQA 3ATHA 3I5TA 4EMYA 1M4NA 1BJOB 1O62A 1WYTA 1AAWA 1TOJA 5EUEA 3ZZJA 4KXKA 5LHAA 1QJ3A 1M0NA 1UU1A 4UQVA 2XBNA 1IBJA 2TPLA 1GEXA 1GC4A 3PIUA 1AHYA 2YKXA 3BB8A 4IYOB 2ZY2A 3W1HA 3NUBA 3UE8A 1ASCA 4XQ2A 3EZSA 2HORA 3PDBA 1D2FA 4MGRA 4W1WA 2AY8A 1S06A 2VMNA 1LW5A 2CY8A 3EI6A 3MC6A 3OP7A 3L8AA 1IJIA 1TOGA 1OHVA 3BV0A 3FZ7A 4CBRA 4XJMA 2ZJGA 4WYDA 3RI6A 1G4VA 5M49A 2VMSA 3G0TA 1EJIA 4GE7A 4F5HA 4R5FA 2YCNA 4ADEA 4NOGA 4WLJA 4N0WA 4AO4A 4R2NA 2DGMA 4ADBA 3N75A 2G6WA 3E77A 1BKGA 4WXGA 3RCHB 2QA3A 2AY9A 4F5MA 3NUIA 3QBOA 1LKCA 1DJUA 4O6ZA 3VAXA 4H63Q 1MLYA 1PFFA 1RV4A 1MAPA 1AY8A 2QLRA 1PMMA 3G8MA 4KAMA 4ZDLA 5TF5A 3WY7A 2EPJA 2AATA 1AAMA 3AENA 3N4XA 3AV7A 2WK8A 4Q76A 5JAYA 3P6KA 1B9IA 2W8UA 2Z9XA 1AHEA 1X2AA 3VOMA 3PA9A 3ZRRA 4QGRA 2HUUA 3DXWA 4J5UA 4H51A 1J32A 1MDZA 4JEVA 4UOYA 3MEBA 2W7MA 3FFHA 2Z20A 4AOAA 4TV7A 3RQ1A 1RVUA 1S08A 1LC5A 3F0HA 3TCMA 4LC3A 4IXSA 3DZZA 2FQ6A 2FYFA 2GQNA 3LG0A 1BQAA 3NYSA 4ZM3A 2DGKA 3ASBA 3DU4A 3FD0A 5G4IA 3QGUA 4A00A 4PFFA 3NU7A 4ADDA 3FQAA 3WLXA 3AOVA 4Q31A 3FVXA 3N4RA 1M0QA 2E54A 4XJPA 4KYOA 3ELPA 5G4JA 4XK1A 3FKDA 5FT6A 2FNUA 4WYEA 4A0HA 3NX3A 2AEUA 4ZWMA 3RCHA 4K2MA 3JW9A 2BKWA 3GBXA 1SPAA 2W8WA 3UWCA 1MDXA 1AHGA 2VMVA 1IX7A 2OQXA 1AJSB 1CZEA 1TPLA 2W7JA 4PFNA 2VMWA 1DJ9A 3LV2A 3BS8A 3ECDA 1WKHA 4RIZA 5HDMA 3AEOA 1XI9A 2AY1A 2BHXA 1LW4A 2YCTA 1C7OA 3FVSA 2YKVA 1IAYA 1XEYA 3FVUA 3DRDA 5LH9A 5F9SA 4M2KA 2VIAA 1BW0A 1ARSA 1GC3A 1MAQA 2CH2A 2VI9A 3HT4A 4OTLA 1QITA 3DXVA 4GE4A 4W1XA 4UHOA 2OATA 2EGYA 1AMSA 4HF8A 1CL2A 1LK9A 3NDNA 2OKKA 4OBUA 3EIAA 1ASEA 3G7QA 3K40A 3RBFA 3BCBA 3PDXA 4ZM4A 2EH6A 3GZCA 3AEJC 3GR9A 4BQ0A 4DQ6A 2HOYA 4BMKA 2O1BA 4E1OA 1G7XA 1B9HA 1AMQA 2HUFA 2VMUA 3E6GA 3DODA 3ZZKA 4ZAHA 1AKCA 4B9BA 1ARGA 2ZYJA 4WYCA 1GD9A 1CS1A 4ATQA 1H1CA 5AX8A 4WYFA 2QSRA 2V0YA 4M2MA 3VK3A 2HZPA 1TARA 2D7ZA 3WKSA 1MDOA 1V72A 3BCAA 3MBBA 3NYTA 1ASMA 3KGWA 1KMJA 2Z1YA 4Q75A 1RV3A 1ASBA 4WB0B 2BIGA 4B98A 3AEJA 2AY6A 1ASDA 3MAFB 4LW4A 3VK4A 4LNJA 4JF0A 4AZKA 1QISA 1JS6A 2F8JA 1V2EA 4A6UA 1VP4A 1BJNA 1WYVA 3HMUA 1QGNA 1KMKA 4RKCA 4GDYA 1QZ9A 3BWNC 5DJ1A 3E2ZA 1CQ6A 1KKPA 3F9TA 1WKGA 3TQXA 4A72A 1W23A 2E7JA 3GWPA 1TOEA 2R5CB 5F8VA 2D7YA 1GC2A 3WGCA 2VLFA 4WYAA 1C4KA 3WCOA 2BI3A 2WKAA 3AEPA 1UU2A 3B1EA 1X29A 3B46A 4ADCA 3GZDC 2Z61A 4E77A 2ZC0A 3A9YA 2FN6A 5FT8A 4RKDA 4XEWA 5EFSA 3ACZA 3ELEA 1ECXA 5M4DA 2C81A 1G4XA 1VJOA 1N8PA 3FZ6A 2ZSMA 3I16A 4EFFA 3M5UA 4U1TA 8AATA 3RUYA 3JZLA 4ZLVA 2EZ2A 4PIWA 3BWNA 1ELUA 3D6KA 2BIEA 1AICA 3NRAA 5EAAA 2VMYA 1G7WA 2YRRA 3Q8NA 1D7UA 3W1JA 2CTZA 1SZKA 1FG7A 2O7CA 4ZASA 4XJLA 3GJUA 1GCKA 3NYUA 2C44A 1OHWA 3EI5A 4F5FA 1M32A 1ZODA
chains in the Genus database with same CATH topology
4K05A 3GZDA 3WGBA 1OXPA 1BJOA 2XH1A 4AO9A 3BC8A 4DBCA 4EU1A 5J8QA 3CQ4A 2PB0A 1BJWA 2GSAA 1DKAA 3A2BA 5G0AA 4WLHA 1LS3A 3QM2A 4IYOA 1X28A 3FCRA 1AIAA 2BI9A 3HVYA 5M4BA 4PVFA 5EUDA 4BA4A 1JS3A 3II0A 2R5CA 3R9AA 2R0TA 3KE3A 3FFRA 1IX8A 1P3WA 3RBLA 3USFA 3FDBA 1JG8A 2VMPA 4OMAA 2E7UA 3PAAA 1LC7A 2A1VA 4F4EA 2VGVA 5G2QA 5DB5A 4ATPA 3H9XA 4BHDA 1I41A 1MGVA 1FC4A 3E9KA 2ZY5A 3GETA 1Z7DA 4JE5A 1AMRA 4F5LA 1AKBA 4F5IA 3R4TA 4RLGA 3IF2A 4CXQA 3B1CA 3P1TA 3LVMA 3KKIA 2BYLA 1ZC9A 3OKSA 3WCNA 1W7MA 2VIBA 1PG8A 2HOZA 2W8TA 2DKJA 2DOUA 4F5GA 3N4SA 1B5PA 3AELA 5DX5A 5E3KA 4ZSYA 9AATA 2JISA 3DR7A 3QPGA 4W1VA 4JE5D 1AX4A 1LC8A 4OBVA 4JEZA 3VK2A 3EI7A 5HXXA 2YKUA 5EQCA 1H0CA 1M0OA 4ZSWA 4AZJA 5D5SA 3GSBA 3H7FA 4CXRA 2X3LA 2W7DA 2O0RA 2X8UA 4W8IA 2R2NA 3K28A 1QIRA 5BJ3A 5EUNA 4IY7A 1EQBA 4A6TA 4ZDPA 1WYUB 7AATA 1YAAA 3BWOA 1OXOA 3ASAA 1C7GA 2GMSA 3N0LA 2ZY3A 1B4XA 4K2IA 4TMRA 1WYTB 1ZOBA 2JGTA 2JG2A 5E4ZA 2ZUKA 3FQ7A 1IX6A 2OGAA 2YCPA 3EUCA 1MLZA 1SF2A 2ZSLA 3MAUA 2W7KA 4W5KA 1YNUA 3N7NA 2FNIA 3IHJA 3LWSA 4MQPA 2GMUA 1BQDA 1OATA 2D63A 4Y0IA 1YOOA 4JEXA 2BI5A 2CH1A 1O4SA 3DYDA 5EAVA 4MQQA 2EO5A 2E7IA 3COGA 4XAUA 1AY4A 2QBTA 1T3IA 2Z9WA 4ITXA 2WK9A 4JEWA 4RJYA 1ASGA 4A0RA 4OYTA 1JF9A 1S09A 1ORDA 2Z9VA 4E3RA 2QB2A 3EI8A 4MSOA 4ZWVA 2BWNA 1GEWA 1AJSA 2CFBA 2JJGA 3NU8A 4Y0HA 3W1IA 5C6UA 4A0FA 5M46A 3EZ1A 4IXZA 3FSLA 2QMAA 1U08A 2AY2A 3MADA 2CINA 4F5KA 2AY3A 2CJGA 3HL2A 2W8JA 3I4JA 3KGXA 3CQ5A 2G7JA 4GRXA 2DGLA 2HP2A 4CBSA 3FDDA 1I43A 3F6TA 3T32A 4IX8A 1VEFA 3L44A 4LNMA 3LVKA 2HUIA 3PD6B 5D95A 4UHNA 1BT4A 1CZCA 1V2FA 2PO3A 2BI1A 3AENB 2BI2A 2D5YA 1WSTA 3HDOA 2YOBA 3AOWA 4EB5A 2CJHA 1C7NA 1WYUA 2CB1A 3A9XA 2VMOA 3JWAA 3NNKA 1E5EA 4RAEA 2JJHA 2DKBA 3PGYA 1I48A 4LNLA 4UHMA 1ELQA 2R5EA 2RFVA 4A0GA 1CQ8A 2W7HA 4Y0DA 2KFPA 2OGEA 4XJOA 3JTXA 4OT8A 4U2HA 2VMZA 1M7YA 2BWOA 1AY5A 1C9CA 2W7EA 3HBXA 1TASA 2W8VA 1CJ0A 1M6SA 3WX9A 5FT4A 2BWPA 1SVVA 2X5DA 2ZY4A 4WYGA 3TFTA 4P7YA 1SFFA 1YJZA 3BCXA 2VI8A 1KL2A 4MKKA 2ORDA 4WB0A 5DJ9A 2EYQA 1FG3A 3B8XA 1D7RA 1AHXA 2VMQA 1GBNA 2D65A 2D64A 2VYCA 3MAFA 4RM1A 1O69A 4F5JA 1B8GA 3WZFA 2CANA 3EIBA 4WBTA 4W91A 2V1PA 1D7SA 1V2DA 1RVYA 3A8UX 2Z67A 2FM1A 1TOKA 2D66A 4DGTA 3ZRPA 4J8LA 3HLMA 5FT5A 1DGEA 1AHFA 4IXOA 2AEVA 3CQ6A 1E5FA 2VMTA 1SZUA 3PD6A 1YIZA 2X5FA 1OHYA 4R8DA 2GB3A 5K8BA 3B1DA 4ITGA 2AY7A 4P3MA 3FZ8A 1ASAA 1DGDA 1S07A 3BN1A 2OKJA 1O61A 4CVQA 3FTBA 5EIGB 2DR1A 4I8AA 2Q7WA 1I29A 1KKJA 1AMAA 1GC0A 5E5IA 1YJSA 1GDEA 3HQTA 2VGUA 2FKIA 1AJRA 3QI6A 5G09A 2W7GA 1ARIA 1X0MA 3AEMC 3TFUA 4AH3A 5KTBA 4E3QA 4GSAA 1ASFA 1DTYA 3DC1A 3MKJA 4JF1A 1W7LA 2AY5A 2QB3A 1M0PA 1Z3ZA 3LY1A 3NTJA 4OC9A 3K7YA 3H14A 2WK7A 1B5OA 2YRIA 2W7LA 1UU0A 1IAXA 2W7FA 3FRKA 3QN6A 3CBFA 3E2FA 4MY5A 1IVRA 4L0OA 3AATA 4WXFA 2PB2A 2BYJA 5HHYA 1YJYA 4GE9A 4K2BA 4EB7A 1QJ5A 2Z1ZA 2W7IA 2VLHA 3VP6A 1ASNA 1PMOA 3AEMA 2VGSA 4FFCA 1CL1A 4RJ0A 4A6RA 3PJ0A 4HVKA 1AKAA 2VMRA 4TN4A 2AY4A 1WYVB 3UAKA 2CSTA 3A9ZA 4ISYA 3E2ZB 5EIGA 4Q6RA 2EZ1A 2BIAA 1N31A 4OCAA 4WXBA 2WB6A 5I92A 1ARTA 1IUGA 1DJEA 4FL0A 1BS0A 1TOIA 2HOXA 3LVJA 3N5MA 3PDBB 2C0RA 4IW7A 2CJDA 5BJ4A 2JJEA 2YHKA 3QHXA 3TATA 1W3UA 4R5ZA 2VGWA 1CQ7A 1YIYA 2Z9UA 3ISLA 2VGZA 2ZP7A 1Y4IA 3CAIA 3JWBA 2NMPA 2VGTA 1S0AA 4WP0A 2C7TA 4GEBA 1GEYA 1TATA 2VMXA 1ARHA 1ASLA 1D7VA 1W7NA 2HP1A 2YKYA 3EI9A 3PPLA 4RITA 3ZRQA 4JEYA 4ZDOA 4WD2A 1BJ4A 5G2PA 1EG5A 3E2YA 3JU7A 2JJFA 3WKRA 3FQ8A 1C0NA 4M2JA 1N2TA 3LVLB 3DR4A 2D61A 4LW2A 1KL1A 1SZSA 1UKJA 3MC6C 4BA5A 1AIBA 1J04A 4MQRA 4N0BA 1DFOA 4MKJA 5IWQA 3ATHA 3I5TA 4EMYA 1M4NA 1BJOB 1O62A 1WYTA 1AAWA 1TOJA 5EUEA 3ZZJA 4KXKA 5LHAA 1QJ3A 1M0NA 1UU1A 4UQVA 2XBNA 1IBJA 2TPLA 1GEXA 1GC4A 3PIUA 1AHYA 2YKXA 3BB8A 4IYOB 2ZY2A 3W1HA 3NUBA 3UE8A 1ASCA 4XQ2A 3EZSA 2HORA 3PDBA 1D2FA 4MGRA 4W1WA 2AY8A 1S06A 2VMNA 1LW5A 2CY8A 3EI6A 3MC6A 3OP7A 3L8AA 1IJIA 1TOGA 1OHVA 3BV0A 3FZ7A 4CBRA 4XJMA 2ZJGA 4WYDA 3RI6A 1G4VA 5M49A 2VMSA 3G0TA 1EJIA 4GE7A 4F5HA 4R5FA 2YCNA 4ADEA 4NOGA 4WLJA 4N0WA 4AO4A 4R2NA 2DGMA 4ADBA 3N75A 2G6WA 3E77A 1BKGA 4WXGA 3RCHB 2QA3A 2AY9A 4F5MA 3NUIA 3QBOA 1LKCA 1DJUA 4O6ZA 3VAXA 4H63Q 1MLYA 1PFFA 1RV4A 1MAPA 1AY8A 2QLRA 1PMMA 3G8MA 4KAMA 4ZDLA 5TF5A 3WY7A 2EPJA 2AATA 1AAMA 3AENA 3N4XA 3AV7A 2WK8A 4Q76A 5JAYA 3P6KA 1B9IA 2W8UA 2Z9XA 1AHEA 1X2AA 3VOMA 3PA9A 3ZRRA 4QGRA 2HUUA 3DXWA 4J5UA 4H51A 1J32A 1MDZA 4JEVA 4UOYA 3MEBA 2W7MA 3FFHA 2Z20A 4AOAA 4TV7A 3RQ1A 1RVUA 1S08A 1LC5A 3F0HA 3TCMA 4LC3A 4IXSA 3DZZA 2FQ6A 2FYFA 2GQNA 3LG0A 1BQAA 3NYSA 4ZM3A 2DGKA 3ASBA 3DU4A 3FD0A 5G4IA 3QGUA 4A00A 4PFFA 3NU7A 4ADDA 3FQAA 3WLXA 3AOVA 4Q31A 3FVXA 3N4RA 1M0QA 2E54A 4XJPA 4KYOA 3ELPA 5G4JA 4XK1A 3FKDA 5FT6A 2FNUA 4WYEA 4A0HA 3NX3A 2AEUA 4ZWMA 3RCHA 4K2MA 3JW9A 2BKWA 3GBXA 1SPAA 2W8WA 3UWCA 1MDXA 1AHGA 2VMVA 1IX7A 2OQXA 1AJSB 1CZEA 1TPLA 2W7JA 4PFNA 2VMWA 1DJ9A 3LV2A 3BS8A 3ECDA 1WKHA 4RIZA 5HDMA 3AEOA 1XI9A 2AY1A 2BHXA 1LW4A 2YCTA 1C7OA 3FVSA 2YKVA 1IAYA 1XEYA 3FVUA 3DRDA 5LH9A 5F9SA 4M2KA 2VIAA 1BW0A 1ARSA 1GC3A 1MAQA 2CH2A 2VI9A 3HT4A 4OTLA 1QITA 3DXVA 4GE4A 4W1XA 4UHOA 2OATA 2EGYA 1AMSA 4HF8A 1CL2A 1LK9A 3NDNA 2OKKA 4OBUA 3EIAA 1ASEA 3G7QA 3K40A 3RBFA 3BCBA 3PDXA 4ZM4A 2EH6A 3GZCA 3AEJC 3GR9A 4BQ0A 4DQ6A 2HOYA 4BMKA 2O1BA 4E1OA 1G7XA 1B9HA 1AMQA 2HUFA 2VMUA 3E6GA 3DODA 3ZZKA 4ZAHA 1AKCA 4B9BA 1ARGA 2ZYJA 4WYCA 1GD9A 1CS1A 4ATQA 1H1CA 5AX8A 4WYFA 2QSRA 2V0YA 4M2MA 3VK3A 2HZPA 1TARA 2D7ZA 3WKSA 1MDOA 1V72A 3BCAA 3MBBA 3NYTA 1ASMA 3KGWA 1KMJA 2Z1YA 4Q75A 1RV3A 1ASBA 4WB0B 2BIGA 4B98A 3AEJA 2AY6A 1ASDA 3MAFB 4LW4A 3VK4A 4LNJA 4JF0A 4AZKA 1QISA 1JS6A 2F8JA 1V2EA 4A6UA 1VP4A 1BJNA 1WYVA 3HMUA 1QGNA 1KMKA 4RKCA 4GDYA 1QZ9A 3BWNC 5DJ1A 3E2ZA 1CQ6A 1KKPA 3F9TA 1WKGA 3TQXA 4A72A 1W23A 2E7JA 3GWPA 1TOEA 2R5CB 5F8VA 2D7YA 1GC2A 3WGCA 2VLFA 4WYAA 1C4KA 3WCOA 2BI3A 2WKAA 3AEPA 1UU2A 3B1EA 1X29A 3B46A 4ADCA 3GZDC 2Z61A 4E77A 2ZC0A 3A9YA 2FN6A 5FT8A 4RKDA 4XEWA 5EFSA 3ACZA 3ELEA 1ECXA 5M4DA 2C81A 1G4XA 1VJOA 1N8PA 3FZ6A 2ZSMA 3I16A 4EFFA 3M5UA 4U1TA 8AATA 3RUYA 3JZLA 4ZLVA 2EZ2A 4PIWA 3BWNA 1ELUA 3D6KA 2BIEA 1AICA 3NRAA 5EAAA 2VMYA 1G7WA 2YRRA 3Q8NA 1D7UA 3W1JA 2CTZA 1SZKA 1FG7A 2O7CA 4ZASA 4XJLA 3GJUA 1GCKA 3NYUA 2C44A 1OHWA 3EI5A 4F5FA 1M32A 1ZODA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3GZD A;  3WGB A;  1OXP A;  1BJO A;  2XH1 A;  4AO9 A;  3BC8 A;  4DBC A;  4EU1 A;  5J8Q A;  3CQ4 A;  2PB0 A;  1BJW A;  2GSA A;  1DKA A;  3A2B A;  5G0A A;  4WLH A;  1LS3 A;  3QM2 A;  4IYO A;  1X28 A;  3FCR A;  1AIA A;  2BI9 A;  3HVY A;  5M4B A;  4PVF A;  5EUD A;  4BA4 A;  1JS3 A;  3II0 A;  2R5C A;  3R9A A;  2R0T A;  3KE3 A;  3FFR A;  1IX8 A;  1P3W A;  3RBL A;  3USF A;  3FDB A;  1JG8 A;  2VMP A;  4OMA A;  2E7U A;  3PAA A;  1LC7 A;  4F4E A;  2VGV A;  5G2Q A;  5DB5 A;  4ATP A;  4BHD A;  1I41 A;  1MGV A;  1FC4 A;  3E9K A;  2ZY5 A;  3GET A;  1Z7D A;  4JE5 A;  1AMR A;  4F5L A;  1AKB A;  4F5I A;  3R4T A;  4RLG A;  3IF2 A;  4CXQ A;  3B1C A;  3P1T A;  3LVM A;  3KKI A;  2BYL A;  1ZC9 A;  3OKS A;  3WCN A;  1W7M A;  2VIB A;  1PG8 A;  2HOZ A;  2W8T A;  2DKJ A;  2DOU A;  4F5G A;  1B5P A;  3AEL A;  5DX5 A;  5E3K A;  4ZSY A;  9AAT A;  2JIS A;  3DR7 A;  3QPG A;  4W1V A;  4JE5 D;  1AX4 A;  1LC8 A;  4OBV A;  4JEZ A;  3VK2 A;  3EI7 A;  5HXX A;  2YKU A;  5EQC A;  1H0C A;  1M0O A;  4ZSW A;  4AZJ A;  5D5S A;  3GSB A;  3H7F A;  4CXR A;  2X3L A;  2W7D A;  2O0R A;  2X8U A;  4W8I A;  2R2N A;  3K28 A;  1QIR A;  5BJ3 A;  5EUN A;  4IY7 A;  1EQB A;  4A6T A;  4ZDP A;  1WYU B;  7AAT A;  1YAA A;  3BWO A;  1OXO A;  3ASA A;  1C7G A;  2GMS A;  3N0L A;  2ZY3 A;  1B4X A;  4K2I A;  4TMR A;  1WYT B;  1ZOB A;  2JGT A;  2JG2 A;  5E4Z A;  2ZUK A;  3FQ7 A;  1IX6 A;  2OGA A;  2YCP A;  3EUC A;  1MLZ A;  1SF2 A;  2ZSL A;  3MAU A;  2W7K A;  4W5K A;  1YNU A;  2FNI A;  3IHJ A;  3LWS A;  4MQP A;  2GMU A;  1BQD A;  1OAT A;  2D63 A;  4Y0I A;  1YOO A;  4JEX A;  2BI5 A;  2CH1 A;  1O4S A;  3DYD A;  5EAV A;  4MQQ A;  2EO5 A;  2E7I A;  3COG A;  4XAU A;  1AY4 A;  2QBT A;  1T3I A;  2Z9W A;  4ITX A;  2WK9 A;  4JEW A;  4RJY A;  1ASG A;  4A0R A;  4OYT A;  1JF9 A;  1S09 A;  1ORD A;  2Z9V A;  4E3R A;  2QB2 A;  3EI8 A;  4MSO A;  4ZWV A;  2BWN A;  1GEW A;  1AJS A;  2CFB A;  2JJG A;  3NU8 A;  4Y0H A;  3W1I A;  5C6U A;  4A0F A;  5M46 A;  3EZ1 A;  4IXZ A;  3FSL A;  2QMA A;  1U08 A;  2AY2 A;  3MAD A;  2CIN A;  4F5K A;  2AY3 A;  2CJG A;  3HL2 A;  2W8J A;  3I4J A;  3KGX A;  3CQ5 A;  4GRX A;  2DGL A;  2HP2 A;  4CBS A;  3FDD A;  1I43 A;  3F6T A;  3T32 A;  4IX8 A;  1VEF A;  3L44 A;  4LNM A;  3LVK A;  2HUI A;  3PD6 B;  5D95 A;  4UHN A;  1BT4 A;  1CZC A;  1V2F A;  2PO3 A;  2BI1 A;  3AEN B;  2BI2 A;  2D5Y A;  1WST A;  3HDO A;  2YOB A;  3AOW A;  4EB5 A;  2CJH A;  1C7N A;  1WYU A;  2CB1 A;  3A9X A;  2VMO A;  3JWA A;  3NNK A;  1E5E A;  4RAE A;  2JJH A;  2DKB A;  3PGY A;  1I48 A;  4LNL A;  4UHM A;  1ELQ A;  2R5E A;  2RFV A;  4A0G A;  1CQ8 A;  2W7H A;  4Y0D A;  2OGE A;  4XJO A;  3JTX A;  4OT8 A;  4U2H A;  2VMZ A;  1M7Y A;  2BWO A;  1AY5 A;  1C9C A;  2W7E A;  3HBX A;  1TAS A;  2W8V A;  1CJ0 A;  1M6S A;  3WX9 A;  5FT4 A;  2BWP A;  1SVV A;  2X5D A;  2ZY4 A;  4WYG A;  3TFT A;  4P7Y A;  1SFF A;  1YJZ A;  3BCX A;  2VI8 A;  1KL2 A;  4MKK A;  2ORD A;  4WB0 A;  5DJ9 A;  1FG3 A;  3B8X A;  1D7R A;  1AHX A;  2VMQ A;  1GBN A;  2D65 A;  2D64 A;  2VYC A;  3MAF A;  4RM1 A;  1O69 A;  4F5J A;  1B8G A;  3WZF A;  2CAN A;  3EIB A;  4WBT A;  4W91 A;  2V1P A;  1D7S A;  1V2D A;  1RVY A;  3A8U X;  2Z67 A;  2FM1 A;  1TOK A;  2D66 A;  4DGT A;  3ZRP A;  4J8L A;  3HLM A;  5FT5 A;  1DGE A;  1AHF A;  4IXO A;  2AEV A;  3CQ6 A;  1E5F A;  2VMT A;  1SZU A;  3PD6 A;  1YIZ A;  2X5F A;  1OHY A;  4R8D A;  2GB3 A;  5K8B A;  3B1D A;  4ITG A;  2AY7 A;  4P3M A;  3FZ8 A;  1ASA A;  1DGD A;  1S07 A;  3BN1 A;  2OKJ A;  1O61 A;  4CVQ A;  3FTB A;  5EIG B;  2DR1 A;  4I8A A;  2Q7W A;  1I29 A;  1KKJ A;  1AMA A;  1GC0 A;  5E5I A;  1YJS A;  1GDE A;  3HQT A;  2VGU A;  1AJR A;  3QI6 A;  5G09 A;  2W7G A;  1ARI A;  1X0M A;  3AEM C;  3TFU A;  4AH3 A;  4E3Q A;  4GSA A;  1ASF A;  1DTY A;  3DC1 A;  3MKJ A;  4JF1 A;  1W7L A;  2AY5 A;  2QB3 A;  1M0P A;  1Z3Z A;  3LY1 A;  3NTJ A;  4OC9 A;  3K7Y A;  3H14 A;  2WK7 A;  1B5O A;  2YRI A;  2W7L A;  1UU0 A;  1IAX A;  2W7F A;  3FRK A;  3QN6 A;  3CBF A;  3E2F A;  4MY5 A;  1IVR A;  4L0O A;  3AAT A;  4WXF A;  2PB2 A;  2BYJ A;  5HHY A;  1YJY A;  4GE9 A;  4K2B A;  4EB7 A;  1QJ5 A;  2Z1Z A;  2W7I A;  2VLH A;  3VP6 A;  1ASN A;  1PMO A;  3AEM A;  2VGS A;  4FFC A;  1CL1 A;  4RJ0 A;  4A6R A;  3PJ0 A;  4HVK A;  1AKA A;  2VMR A;  4TN4 A;  2AY4 A;  1WYV B;  3UAK A;  2CST A;  3A9Z A;  4ISY A;  3E2Z B;  5EIG A;  4Q6R A;  2EZ1 A;  2BIA A;  1N31 A;  4OCA A;  4WXB A;  5I92 A;  1ART A;  1IUG A;  1DJE A;  4FL0 A;  1BS0 A;  1TOI A;  2HOX A;  3LVJ A;  3N5M A;  3PDB B;  2C0R A;  4IW7 A;  2CJD A;  5BJ4 A;  2JJE A;  2YHK A;  3QHX A;  3TAT A;  1W3U A;  4R5Z A;  2VGW A;  1CQ7 A;  1YIY A;  2Z9U A;  3ISL A;  2VGZ A;  2ZP7 A;  1Y4I A;  3CAI A;  3JWB A;  2NMP A;  2VGT A;  1S0A A;  4WP0 A;  2C7T A;  4GEB A;  1GEY A;  1TAT A;  2VMX A;  1ARH A;  1ASL A;  1D7V A;  1W7N A;  2HP1 A;  2YKY A;  3EI9 A;  3PPL A;  4RIT A;  3ZRQ A;  4JEY A;  4ZDO A;  4WD2 A;  1BJ4 A;  5G2P A;  1EG5 A;  3E2Y A;  3JU7 A;  2JJF A;  3WKR A;  3FQ8 A;  1C0N A;  4M2J A;  1N2T A;  3LVL B;  3DR4 A;  2D61 A;  4LW2 A;  1KL1 A;  1SZS A;  1UKJ A;  3MC6 C;  4BA5 A;  1AIB A;  1J04 A;  4MQR A;  4N0B A;  1DFO A;  4MKJ A;  5IWQ A;  3ATH A;  3I5T A;  4EMY A;  1M4N A;  1BJO B;  1O62 A;  1WYT A;  1AAW A;  1TOJ A;  5EUE A;  3ZZJ A;  4KXK A;  5LHA A;  1QJ3 A;  1M0N A;  1UU1 A;  4UQV A;  2XBN A;  1IBJ A;  2TPL A;  1GEX A;  1GC4 A;  3PIU A;  1AHY A;  2YKX A;  3BB8 A;  4IYO B;  2ZY2 A;  3W1H A;  3NUB A;  3UE8 A;  1ASC A;  4XQ2 A;  3EZS A;  2HOR A;  3PDB A;  1D2F A;  4MGR A;  4W1W A;  2AY8 A;  1S06 A;  2VMN A;  1LW5 A;  2CY8 A;  3EI6 A;  3MC6 A;  3OP7 A;  3L8A A;  1IJI A;  1TOG A;  1OHV A;  3BV0 A;  3FZ7 A;  4CBR A;  4XJM A;  2ZJG A;  4WYD A;  3RI6 A;  1G4V A;  5M49 A;  2VMS A;  3G0T A;  1EJI A;  4GE7 A;  4F5H A;  4R5F A;  2YCN A;  4ADE A;  4NOG A;  4WLJ A;  4N0W A;  4AO4 A;  4R2N A;  2DGM A;  4ADB A;  3N75 A;  2G6W A;  3E77 A;  1BKG A;  4WXG A;  3RCH B;  2QA3 A;  2AY9 A;  4F5M A;  3NUI A;  3QBO A;  1LKC A;  1DJU A;  4O6Z A;  3VAX A;  1MLY A;  1PFF A;  1RV4 A;  1MAP A;  1AY8 A;  2QLR A;  1PMM A;  3G8M A;  4KAM A;  4ZDL A;  5TF5 A;  3WY7 A;  2EPJ A;  2AAT A;  1AAM A;  3AEN A;  3AV7 A;  2WK8 A;  4Q76 A;  5JAY A;  3P6K A;  1B9I A;  2W8U A;  2Z9X A;  1AHE A;  1X2A A;  3VOM A;  3PA9 A;  3ZRR A;  4QGR A;  2HUU A;  3DXW A;  4J5U A;  4H51 A;  1J32 A;  1MDZ A;  4JEV A;  4UOY A;  3MEB A;  2W7M A;  3FFH A;  2Z20 A;  4AOA A;  4TV7 A;  3RQ1 A;  1RVU A;  1S08 A;  1LC5 A;  3F0H A;  3TCM A;  4LC3 A;  4IXS A;  3DZZ A;  2FQ6 A;  2FYF A;  2GQN A;  3LG0 A;  1BQA A;  3NYS A;  4ZM3 A;  2DGK A;  3ASB A;  3DU4 A;  3FD0 A;  5G4I A;  3QGU A;  4A00 A;  4PFF A;  3NU7 A;  4ADD A;  3FQA A;  3WLX A;  3AOV A;  4Q31 A;  3FVX A;  1M0Q A;  2E54 A;  4XJP A;  4KYO A;  3ELP A;  5G4J A;  4XK1 A;  3FKD A;  5FT6 A;  2FNU A;  4WYE A;  4A0H A;  3NX3 A;  2AEU A;  4ZWM A;  3RCH A;  4K2M A;  3JW9 A;  2BKW A;  3GBX A;  1SPA A;  2W8W A;  3UWC A;  1MDX A;  1AHG A;  2VMV A;  1IX7 A;  2OQX A;  1AJS B;  1CZE A;  1TPL A;  2W7J A;  4PFN A;  2VMW A;  1DJ9 A;  3LV2 A;  3BS8 A;  3ECD A;  1WKH A;  4RIZ A;  5HDM A;  3AEO A;  1XI9 A;  2AY1 A;  2BHX A;  1LW4 A;  2YCT A;  1C7O A;  3FVS A;  2YKV A;  1IAY A;  1XEY A;  3FVU A;  3DRD A;  5LH9 A;  5F9S A;  4M2K A;  2VIA A;  1BW0 A;  1ARS A;  1GC3 A;  1MAQ A;  2CH2 A;  2VI9 A;  3HT4 A;  4OTL A;  1QIT A;  3DXV A;  4GE4 A;  4W1X A;  4UHO A;  2OAT A;  2EGY A;  1AMS A;  4HF8 A;  1CL2 A;  1LK9 A;  3NDN A;  2OKK A;  4OBU A;  3EIA A;  1ASE A;  3G7Q A;  3K40 A;  3RBF A;  3BCB A;  3PDX A;  4ZM4 A;  2EH6 A;  3GZC A;  3AEJ C;  3GR9 A;  4BQ0 A;  4DQ6 A;  2HOY A;  4BMK A;  2O1B A;  4E1O A;  1G7X A;  1B9H A;  1AMQ A;  2HUF A;  2VMU A;  3E6G A;  3DOD A;  3ZZK A;  4ZAH A;  1AKC A;  4B9B A;  1ARG A;  2ZYJ A;  4WYC A;  1GD9 A;  1CS1 A;  4ATQ A;  1H1C A;  5AX8 A;  4WYF A;  2V0Y A;  4M2M A;  3VK3 A;  2HZP A;  1TAR A;  2D7Z A;  3WKS A;  1MDO A;  1V72 A;  3BCA A;  3MBB A;  3NYT A;  1ASM A;  3KGW A;  1KMJ A;  2Z1Y A;  4Q75 A;  1RV3 A;  1ASB A;  4WB0 B;  2BIG A;  4B98 A;  3AEJ A;  2AY6 A;  1ASD A;  3MAF B;  4LW4 A;  3VK4 A;  4LNJ A;  4JF0 A;  4AZK A;  1QIS A;  1JS6 A;  2F8J A;  1V2E A;  4A6U A;  1VP4 A;  1BJN A;  1WYV A;  3HMU A;  1QGN A;  1KMK A;  4RKC A;  4GDY A;  1QZ9 A;  3BWN C;  5DJ1 A;  3E2Z A;  1CQ6 A;  1KKP A;  3F9T A;  1WKG A;  3TQX A;  4A72 A;  1W23 A;  2E7J A;  3GWP A;  1TOE A;  2R5C B;  5F8V A;  2D7Y A;  1GC2 A;  3WGC A;  2VLF A;  4WYA A;  1C4K A;  3WCO A;  2BI3 A;  2WKA A;  3AEP A;  1UU2 A;  3B1E A;  1X29 A;  3B46 A;  4ADC A;  3GZD C;  2Z61 A;  4E77 A;  2ZC0 A;  3A9Y A;  2FN6 A;  5FT8 A;  4RKD A;  4XEW A;  5EFS A;  3ACZ A;  3ELE A;  1ECX A;  5M4D A;  2C81 A;  1G4X A;  1VJO A;  1N8P A;  3FZ6 A;  2ZSM A;  3I16 A;  4EFF A;  3M5U A;  4U1T A;  8AAT A;  3RUY A;  3JZL A;  4ZLV A;  2EZ2 A;  4PIW A;  3BWN A;  1ELU A;  3D6K A;  2BIE A;  1AIC A;  3NRA A;  5EAA A;  2VMY A;  1G7W A;  2YRR A;  3Q8N A;  1D7U A;  3W1J A;  2CTZ A;  1SZK A;  1FG7 A;  2O7C A;  4ZAS A;  4XJL A;  3GJU A;  1GCK A;  3NYU A;  2C44 A;  1OHW A;  3EI5 A;  4F5F A;  1M32 A;  1ZOD A; 
#chains in the Genus database with same CATH topology
 4K05 A;  3GZD A;  3WGB A;  1OXP A;  1BJO A;  2XH1 A;  4AO9 A;  3BC8 A;  4DBC A;  4EU1 A;  5J8Q A;  3CQ4 A;  2PB0 A;  1BJW A;  2GSA A;  1DKA A;  3A2B A;  5G0A A;  4WLH A;  1LS3 A;  3QM2 A;  4IYO A;  1X28 A;  3FCR A;  1AIA A;  2BI9 A;  3HVY A;  5M4B A;  4PVF A;  5EUD A;  4BA4 A;  1JS3 A;  3II0 A;  2R5C A;  3R9A A;  2R0T A;  3KE3 A;  3FFR A;  1IX8 A;  1P3W A;  3RBL A;  3USF A;  3FDB A;  1JG8 A;  2VMP A;  4OMA A;  2E7U A;  3PAA A;  1LC7 A;  2A1V A;  4F4E A;  2VGV A;  5G2Q A;  5DB5 A;  4ATP A;  3H9X A;  4BHD A;  1I41 A;  1MGV A;  1FC4 A;  3E9K A;  2ZY5 A;  3GET A;  1Z7D A;  4JE5 A;  1AMR A;  4F5L A;  1AKB A;  4F5I A;  3R4T A;  4RLG A;  3IF2 A;  4CXQ A;  3B1C A;  3P1T A;  3LVM A;  3KKI A;  2BYL A;  1ZC9 A;  3OKS A;  3WCN A;  1W7M A;  2VIB A;  1PG8 A;  2HOZ A;  2W8T A;  2DKJ A;  2DOU A;  4F5G A;  3N4S A;  1B5P A;  3AEL A;  5DX5 A;  5E3K A;  4ZSY A;  9AAT A;  2JIS A;  3DR7 A;  3QPG A;  4W1V A;  4JE5 D;  1AX4 A;  1LC8 A;  4OBV A;  4JEZ A;  3VK2 A;  3EI7 A;  5HXX A;  2YKU A;  5EQC A;  1H0C A;  1M0O A;  4ZSW A;  4AZJ A;  5D5S A;  3GSB A;  3H7F A;  4CXR A;  2X3L A;  2W7D A;  2O0R A;  2X8U A;  4W8I A;  2R2N A;  3K28 A;  1QIR A;  5BJ3 A;  5EUN A;  4IY7 A;  1EQB A;  4A6T A;  4ZDP A;  1WYU B;  7AAT A;  1YAA A;  3BWO A;  1OXO A;  3ASA A;  1C7G A;  2GMS A;  3N0L A;  2ZY3 A;  1B4X A;  4K2I A;  4TMR A;  1WYT B;  1ZOB A;  2JGT A;  2JG2 A;  5E4Z A;  2ZUK A;  3FQ7 A;  1IX6 A;  2OGA A;  2YCP A;  3EUC A;  1MLZ A;  1SF2 A;  2ZSL A;  3MAU A;  2W7K A;  4W5K A;  1YNU A;  3N7N A;  2FNI A;  3IHJ A;  3LWS A;  4MQP A;  2GMU A;  1BQD A;  1OAT A;  2D63 A;  4Y0I A;  1YOO A;  4JEX A;  2BI5 A;  2CH1 A;  1O4S A;  3DYD A;  5EAV A;  4MQQ A;  2EO5 A;  2E7I A;  3COG A;  4XAU A;  1AY4 A;  2QBT A;  1T3I A;  2Z9W A;  4ITX A;  2WK9 A;  4JEW A;  4RJY A;  1ASG A;  4A0R A;  4OYT A;  1JF9 A;  1S09 A;  1ORD A;  2Z9V A;  4E3R A;  2QB2 A;  3EI8 A;  4MSO A;  4ZWV A;  2BWN A;  1GEW A;  1AJS A;  2CFB A;  2JJG A;  3NU8 A;  4Y0H A;  3W1I A;  5C6U A;  4A0F A;  5M46 A;  3EZ1 A;  4IXZ A;  3FSL A;  2QMA A;  1U08 A;  2AY2 A;  3MAD A;  2CIN A;  4F5K A;  2AY3 A;  2CJG A;  3HL2 A;  2W8J A;  3I4J A;  3KGX A;  3CQ5 A;  2G7J A;  4GRX A;  2DGL A;  2HP2 A;  4CBS A;  3FDD A;  1I43 A;  3F6T A;  3T32 A;  4IX8 A;  1VEF A;  3L44 A;  4LNM A;  3LVK A;  2HUI A;  3PD6 B;  5D95 A;  4UHN A;  1BT4 A;  1CZC A;  1V2F A;  2PO3 A;  2BI1 A;  3AEN B;  2BI2 A;  2D5Y A;  1WST A;  3HDO A;  2YOB A;  3AOW A;  4EB5 A;  2CJH A;  1C7N A;  1WYU A;  2CB1 A;  3A9X A;  2VMO A;  3JWA A;  3NNK A;  1E5E A;  4RAE A;  2JJH A;  2DKB A;  3PGY A;  1I48 A;  4LNL A;  4UHM A;  1ELQ A;  2R5E A;  2RFV A;  4A0G A;  1CQ8 A;  2W7H A;  4Y0D A;  2KFP A;  2OGE A;  4XJO A;  3JTX A;  4OT8 A;  4U2H A;  2VMZ A;  1M7Y A;  2BWO A;  1AY5 A;  1C9C A;  2W7E A;  3HBX A;  1TAS A;  2W8V A;  1CJ0 A;  1M6S A;  3WX9 A;  5FT4 A;  2BWP A;  1SVV A;  2X5D A;  2ZY4 A;  4WYG A;  3TFT A;  4P7Y A;  1SFF A;  1YJZ A;  3BCX A;  2VI8 A;  1KL2 A;  4MKK A;  2ORD A;  4WB0 A;  5DJ9 A;  2EYQ A;  1FG3 A;  3B8X A;  1D7R A;  1AHX A;  2VMQ A;  1GBN A;  2D65 A;  2D64 A;  2VYC A;  3MAF A;  4RM1 A;  1O69 A;  4F5J A;  1B8G A;  3WZF A;  2CAN A;  3EIB A;  4WBT A;  4W91 A;  2V1P A;  1D7S A;  1V2D A;  1RVY A;  3A8U X;  2Z67 A;  2FM1 A;  1TOK A;  2D66 A;  4DGT A;  3ZRP A;  4J8L A;  3HLM A;  5FT5 A;  1DGE A;  1AHF A;  4IXO A;  2AEV A;  3CQ6 A;  1E5F A;  2VMT A;  1SZU A;  3PD6 A;  1YIZ A;  2X5F A;  1OHY A;  4R8D A;  2GB3 A;  5K8B A;  3B1D A;  4ITG A;  2AY7 A;  4P3M A;  3FZ8 A;  1ASA A;  1DGD A;  1S07 A;  3BN1 A;  2OKJ A;  1O61 A;  4CVQ A;  3FTB A;  5EIG B;  2DR1 A;  4I8A A;  2Q7W A;  1I29 A;  1KKJ A;  1AMA A;  1GC0 A;  5E5I A;  1YJS A;  1GDE A;  3HQT A;  2VGU A;  2FKI A;  1AJR A;  3QI6 A;  5G09 A;  2W7G A;  1ARI A;  1X0M A;  3AEM C;  3TFU A;  4AH3 A;  5KTB A;  4E3Q A;  4GSA A;  1ASF A;  1DTY A;  3DC1 A;  3MKJ A;  4JF1 A;  1W7L A;  2AY5 A;  2QB3 A;  1M0P A;  1Z3Z A;  3LY1 A;  3NTJ A;  4OC9 A;  3K7Y A;  3H14 A;  2WK7 A;  1B5O A;  2YRI A;  2W7L A;  1UU0 A;  1IAX A;  2W7F A;  3FRK A;  3QN6 A;  3CBF A;  3E2F A;  4MY5 A;  1IVR A;  4L0O A;  3AAT A;  4WXF A;  2PB2 A;  2BYJ A;  5HHY A;  1YJY A;  4GE9 A;  4K2B A;  4EB7 A;  1QJ5 A;  2Z1Z A;  2W7I A;  2VLH A;  3VP6 A;  1ASN A;  1PMO A;  3AEM A;  2VGS A;  4FFC A;  1CL1 A;  4RJ0 A;  4A6R A;  3PJ0 A;  4HVK A;  1AKA A;  2VMR A;  4TN4 A;  2AY4 A;  1WYV B;  3UAK A;  2CST A;  3A9Z A;  4ISY A;  3E2Z B;  5EIG A;  4Q6R A;  2EZ1 A;  2BIA A;  1N31 A;  4OCA A;  4WXB A;  2WB6 A;  5I92 A;  1ART A;  1IUG A;  1DJE A;  4FL0 A;  1BS0 A;  1TOI A;  2HOX A;  3LVJ A;  3N5M A;  3PDB B;  2C0R A;  4IW7 A;  2CJD A;  5BJ4 A;  2JJE A;  2YHK A;  3QHX A;  3TAT A;  1W3U A;  4R5Z A;  2VGW A;  1CQ7 A;  1YIY A;  2Z9U A;  3ISL A;  2VGZ A;  2ZP7 A;  1Y4I A;  3CAI A;  3JWB A;  2NMP A;  2VGT A;  1S0A A;  4WP0 A;  2C7T A;  4GEB A;  1GEY A;  1TAT A;  2VMX A;  1ARH A;  1ASL A;  1D7V A;  1W7N A;  2HP1 A;  2YKY A;  3EI9 A;  3PPL A;  4RIT A;  3ZRQ A;  4JEY A;  4ZDO A;  4WD2 A;  1KAF A;  1BJ4 A;  5G2P A;  1EG5 A;  3E2Y A;  3JU7 A;  2JJF A;  3WKR A;  3FQ8 A;  1C0N A;  4M2J A;  1N2T A;  3LVL B;  3DR4 A;  2D61 A;  4LW2 A;  1KL1 A;  1SZS A;  1UKJ A;  3MC6 C;  4BA5 A;  1AIB A;  1J04 A;  4MQR A;  4N0B A;  1DFO A;  4MKJ A;  5IWQ A;  3ATH A;  3I5T A;  4EMY A;  1M4N A;  1BJO B;  1O62 A;  1WYT A;  1AAW A;  1TOJ A;  5EUE A;  3ZZJ A;  4KXK A;  5LHA A;  1QJ3 A;  1M0N A;  1UU1 A;  4UQV A;  2XBN A;  1IBJ A;  2TPL A;  1GEX A;  1GC4 A;  3PIU A;  1AHY A;  2YKX A;  3BB8 A;  4IYO B;  2ZY2 A;  3W1H A;  3NUB A;  3UE8 A;  1ASC A;  4XQ2 A;  3EZS A;  2HOR A;  3PDB A;  1D2F A;  4MGR A;  4W1W A;  2AY8 A;  1S06 A;  2VMN A;  1LW5 A;  2CY8 A;  3EI6 A;  3MC6 A;  3OP7 A;  3L8A A;  1IJI A;  1TOG A;  1OHV A;  3BV0 A;  3FZ7 A;  4CBR A;  4XJM A;  2ZJG A;  4WYD A;  3RI6 A;  1G4V A;  5M49 A;  2VMS A;  3G0T A;  1EJI A;  4GE7 A;  4F5H A;  4R5F A;  2YCN A;  4ADE A;  4NOG A;  4WLJ A;  4N0W A;  4AO4 A;  4R2N A;  2DGM A;  4ADB A;  3N75 A;  2G6W A;  3E77 A;  1BKG A;  4WXG A;  3RCH B;  2QA3 A;  2AY9 A;  4F5M A;  3NUI A;  3QBO A;  1LKC A;  1DJU A;  4O6Z A;  3VAX A;  4H63 Q;  1MLY A;  1PFF A;  1RV4 A;  1MAP A;  1AY8 A;  2QLR A;  1PMM A;  3G8M A;  4KAM A;  4ZDL A;  5TF5 A;  3WY7 A;  2EPJ A;  2AAT A;  1AAM A;  3AEN A;  3N4X A;  3AV7 A;  2WK8 A;  4Q76 A;  5JAY A;  3P6K A;  1B9I A;  2W8U A;  2Z9X A;  1AHE A;  1X2A A;  3VOM A;  3PA9 A;  3ZRR A;  4QGR A;  2HUU A;  3DXW A;  4J5U A;  4H51 A;  1J32 A;  1MDZ A;  4JEV A;  4UOY A;  3MEB A;  2W7M A;  3FFH A;  2Z20 A;  4AOA A;  4TV7 A;  3RQ1 A;  1RVU A;  1S08 A;  1LC5 A;  3F0H A;  3TCM A;  4LC3 A;  4IXS A;  3DZZ A;  2FQ6 A;  2FYF A;  2GQN A;  3LG0 A;  1BQA A;  3NYS A;  4ZM3 A;  2DGK A;  3ASB A;  3DU4 A;  3FD0 A;  5G4I A;  3QGU A;  4A00 A;  4PFF A;  3NU7 A;  4ADD A;  3FQA A;  3WLX A;  3AOV A;  4Q31 A;  3FVX A;  3N4R A;  1M0Q A;  2E54 A;  4XJP A;  4KYO A;  3ELP A;  5G4J A;  4XK1 A;  3FKD A;  5FT6 A;  2FNU A;  4WYE A;  4A0H A;  3NX3 A;  2AEU A;  4ZWM A;  3RCH A;  4K2M A;  3JW9 A;  2BKW A;  3GBX A;  1SPA A;  2W8W A;  3UWC A;  1MDX A;  1AHG A;  2VMV A;  1IX7 A;  2OQX A;  1AJS B;  1CZE A;  1TPL A;  2W7J A;  4PFN A;  2VMW A;  1DJ9 A;  3LV2 A;  3BS8 A;  3ECD A;  1WKH A;  4RIZ A;  5HDM A;  3AEO A;  1XI9 A;  2AY1 A;  2BHX A;  1LW4 A;  2YCT A;  1C7O A;  3FVS A;  2YKV A;  1IAY A;  1XEY A;  3FVU A;  3DRD A;  5LH9 A;  5F9S A;  4M2K A;  2VIA A;  1BW0 A;  1ARS A;  1GC3 A;  1MAQ A;  2CH2 A;  2VI9 A;  3HT4 A;  4OTL A;  1QIT A;  3DXV A;  4GE4 A;  4W1X A;  4UHO A;  2OAT A;  2EGY A;  1AMS A;  4HF8 A;  1CL2 A;  1LK9 A;  3NDN A;  2OKK A;  4OBU A;  3EIA A;  1ASE A;  3G7Q A;  3K40 A;  3RBF A;  3BCB A;  3PDX A;  4ZM4 A;  2EH6 A;  3GZC A;  3AEJ C;  3GR9 A;  4BQ0 A;  4DQ6 A;  2HOY A;  4BMK A;  2O1B A;  4E1O A;  1G7X A;  1B9H A;  1AMQ A;  2HUF A;  2VMU A;  3E6G A;  3DOD A;  3ZZK A;  4ZAH A;  1AKC A;  4B9B A;  1ARG A;  2ZYJ A;  4WYC A;  1GD9 A;  1CS1 A;  4ATQ A;  1H1C A;  5AX8 A;  4WYF A;  2QSR A;  2V0Y A;  4M2M A;  3VK3 A;  2HZP A;  1TAR A;  2D7Z A;  3WKS A;  1MDO A;  1V72 A;  3BCA A;  3MBB A;  3NYT A;  1ASM A;  3KGW A;  1KMJ A;  2Z1Y A;  4Q75 A;  1RV3 A;  1ASB A;  4WB0 B;  2BIG A;  4B98 A;  3AEJ A;  2AY6 A;  1ASD A;  3MAF B;  4LW4 A;  3VK4 A;  4LNJ A;  4JF0 A;  4AZK A;  1QIS A;  1JS6 A;  2F8J A;  1V2E A;  4A6U A;  1VP4 A;  1BJN A;  1WYV A;  3HMU A;  1QGN A;  1KMK A;  4RKC A;  4GDY A;  1QZ9 A;  3BWN C;  5DJ1 A;  3E2Z A;  1CQ6 A;  1KKP A;  3F9T A;  1WKG A;  3TQX A;  4A72 A;  1W23 A;  2E7J A;  3GWP A;  1TOE A;  2R5C B;  5F8V A;  2D7Y A;  1GC2 A;  3WGC A;  2VLF A;  4WYA A;  1C4K A;  3WCO A;  2BI3 A;  2WKA A;  3AEP A;  1UU2 A;  3B1E A;  1X29 A;  3B46 A;  4ADC A;  3GZD C;  2Z61 A;  4E77 A;  2ZC0 A;  3A9Y A;  2FN6 A;  5FT8 A;  4RKD A;  4XEW A;  5EFS A;  3ACZ A;  3ELE A;  1ECX A;  5M4D A;  2C81 A;  1G4X A;  1VJO A;  1N8P A;  3FZ6 A;  2ZSM A;  3I16 A;  4EFF A;  3M5U A;  4U1T A;  8AAT A;  3RUY A;  3JZL A;  4ZLV A;  2EZ2 A;  4PIW A;  3BWN A;  1ELU A;  3D6K A;  2BIE A;  1AIC A;  3NRA A;  5EAA A;  2VMY A;  1G7W A;  2YRR A;  3Q8N A;  1D7U A;  3W1J A;  2CTZ A;  1SZK A;  1FG7 A;  2O7C A;  4ZAS A;  4XJL A;  3GJU A;  1GCK A;  3NYU A;  2C44 A;  1OHW A;  3EI5 A;  4F5F A;  1M32 A;  1ZOD A; 
#chains in the Genus database with same CATH homology
 4K05 A;  3GZD A;  3WGB A;  1OXP A;  1BJO A;  2XH1 A;  4AO9 A;  3BC8 A;  4DBC A;  4EU1 A;  5J8Q A;  3CQ4 A;  2PB0 A;  1BJW A;  2GSA A;  1DKA A;  3A2B A;  5G0A A;  4WLH A;  1LS3 A;  3QM2 A;  4IYO A;  1X28 A;  3FCR A;  1AIA A;  2BI9 A;  3HVY A;  5M4B A;  4PVF A;  5EUD A;  4BA4 A;  1JS3 A;  3II0 A;  2R5C A;  3R9A A;  2R0T A;  3KE3 A;  3FFR A;  1IX8 A;  1P3W A;  3RBL A;  3USF A;  3FDB A;  1JG8 A;  2VMP A;  4OMA A;  2E7U A;  3PAA A;  1LC7 A;  2A1V A;  4F4E A;  2VGV A;  5G2Q A;  5DB5 A;  4ATP A;  3H9X A;  4BHD A;  1I41 A;  1MGV A;  1FC4 A;  3E9K A;  2ZY5 A;  3GET A;  1Z7D A;  4JE5 A;  1AMR A;  4F5L A;  1AKB A;  4F5I A;  3R4T A;  4RLG A;  3IF2 A;  4CXQ A;  3B1C A;  3P1T A;  3LVM A;  3KKI A;  2BYL A;  1ZC9 A;  3OKS A;  3WCN A;  1W7M A;  2VIB A;  1PG8 A;  2HOZ A;  2W8T A;  2DKJ A;  2DOU A;  4F5G A;  3N4S A;  1B5P A;  3AEL A;  5DX5 A;  5E3K A;  4ZSY A;  9AAT A;  2JIS A;  3DR7 A;  3QPG A;  4W1V A;  4JE5 D;  1AX4 A;  1LC8 A;  4OBV A;  4JEZ A;  3VK2 A;  3EI7 A;  5HXX A;  2YKU A;  5EQC A;  1H0C A;  1M0O A;  4ZSW A;  4AZJ A;  5D5S A;  3GSB A;  3H7F A;  4CXR A;  2X3L A;  2W7D A;  2O0R A;  2X8U A;  4W8I A;  2R2N A;  3K28 A;  1QIR A;  5BJ3 A;  5EUN A;  4IY7 A;  1EQB A;  4A6T A;  4ZDP A;  1WYU B;  7AAT A;  1YAA A;  3BWO A;  1OXO A;  3ASA A;  1C7G A;  2GMS A;  3N0L A;  2ZY3 A;  1B4X A;  4K2I A;  4TMR A;  1WYT B;  1ZOB A;  2JGT A;  2JG2 A;  5E4Z A;  2ZUK A;  3FQ7 A;  1IX6 A;  2OGA A;  2YCP A;  3EUC A;  1MLZ A;  1SF2 A;  2ZSL A;  3MAU A;  2W7K A;  4W5K A;  1YNU A;  3N7N A;  2FNI A;  3IHJ A;  3LWS A;  4MQP A;  2GMU A;  1BQD A;  1OAT A;  2D63 A;  4Y0I A;  1YOO A;  4JEX A;  2BI5 A;  2CH1 A;  1O4S A;  3DYD A;  5EAV A;  4MQQ A;  2EO5 A;  2E7I A;  3COG A;  4XAU A;  1AY4 A;  2QBT A;  1T3I A;  2Z9W A;  4ITX A;  2WK9 A;  4JEW A;  4RJY A;  1ASG A;  4A0R A;  4OYT A;  1JF9 A;  1S09 A;  1ORD A;  2Z9V A;  4E3R A;  2QB2 A;  3EI8 A;  4MSO A;  4ZWV A;  2BWN A;  1GEW A;  1AJS A;  2CFB A;  2JJG A;  3NU8 A;  4Y0H A;  3W1I A;  5C6U A;  4A0F A;  5M46 A;  3EZ1 A;  4IXZ A;  3FSL A;  2QMA A;  1U08 A;  2AY2 A;  3MAD A;  2CIN A;  4F5K A;  2AY3 A;  2CJG A;  3HL2 A;  2W8J A;  3I4J A;  3KGX A;  3CQ5 A;  2G7J A;  4GRX A;  2DGL A;  2HP2 A;  4CBS A;  3FDD A;  1I43 A;  3F6T A;  3T32 A;  4IX8 A;  1VEF A;  3L44 A;  4LNM A;  3LVK A;  2HUI A;  3PD6 B;  5D95 A;  4UHN A;  1BT4 A;  1CZC A;  1V2F A;  2PO3 A;  2BI1 A;  3AEN B;  2BI2 A;  2D5Y A;  1WST A;  3HDO A;  2YOB A;  3AOW A;  4EB5 A;  2CJH A;  1C7N A;  1WYU A;  2CB1 A;  3A9X A;  2VMO A;  3JWA A;  3NNK A;  1E5E A;  4RAE A;  2JJH A;  2DKB A;  3PGY A;  1I48 A;  4LNL A;  4UHM A;  1ELQ A;  2R5E A;  2RFV A;  4A0G A;  1CQ8 A;  2W7H A;  4Y0D A;  2KFP A;  2OGE A;  4XJO A;  3JTX A;  4OT8 A;  4U2H A;  2VMZ A;  1M7Y A;  2BWO A;  1AY5 A;  1C9C A;  2W7E A;  3HBX A;  1TAS A;  2W8V A;  1CJ0 A;  1M6S A;  3WX9 A;  5FT4 A;  2BWP A;  1SVV A;  2X5D A;  2ZY4 A;  4WYG A;  3TFT A;  4P7Y A;  1SFF A;  1YJZ A;  3BCX A;  2VI8 A;  1KL2 A;  4MKK A;  2ORD A;  4WB0 A;  5DJ9 A;  2EYQ A;  1FG3 A;  3B8X A;  1D7R A;  1AHX A;  2VMQ A;  1GBN A;  2D65 A;  2D64 A;  2VYC A;  3MAF A;  4RM1 A;  1O69 A;  4F5J A;  1B8G A;  3WZF A;  2CAN A;  3EIB A;  4WBT A;  4W91 A;  2V1P A;  1D7S A;  1V2D A;  1RVY A;  3A8U X;  2Z67 A;  2FM1 A;  1TOK A;  2D66 A;  4DGT A;  3ZRP A;  4J8L A;  3HLM A;  5FT5 A;  1DGE A;  1AHF A;  4IXO A;  2AEV A;  3CQ6 A;  1E5F A;  2VMT A;  1SZU A;  3PD6 A;  1YIZ A;  2X5F A;  1OHY A;  4R8D A;  2GB3 A;  5K8B A;  3B1D A;  4ITG A;  2AY7 A;  4P3M A;  3FZ8 A;  1ASA A;  1DGD A;  1S07 A;  3BN1 A;  2OKJ A;  1O61 A;  4CVQ A;  3FTB A;  5EIG B;  2DR1 A;  4I8A A;  2Q7W A;  1I29 A;  1KKJ A;  1AMA A;  1GC0 A;  5E5I A;  1YJS A;  1GDE A;  3HQT A;  2VGU A;  2FKI A;  1AJR A;  3QI6 A;  5G09 A;  2W7G A;  1ARI A;  1X0M A;  3AEM C;  3TFU A;  4AH3 A;  5KTB A;  4E3Q A;  4GSA A;  1ASF A;  1DTY A;  3DC1 A;  3MKJ A;  4JF1 A;  1W7L A;  2AY5 A;  2QB3 A;  1M0P A;  1Z3Z A;  3LY1 A;  3NTJ A;  4OC9 A;  3K7Y A;  3H14 A;  2WK7 A;  1B5O A;  2YRI A;  2W7L A;  1UU0 A;  1IAX A;  2W7F A;  3FRK A;  3QN6 A;  3CBF A;  3E2F A;  4MY5 A;  1IVR A;  4L0O A;  3AAT A;  4WXF A;  2PB2 A;  2BYJ A;  5HHY A;  1YJY A;  4GE9 A;  4K2B A;  4EB7 A;  1QJ5 A;  2Z1Z A;  2W7I A;  2VLH A;  3VP6 A;  1ASN A;  1PMO A;  3AEM A;  2VGS A;  4FFC A;  1CL1 A;  4RJ0 A;  4A6R A;  3PJ0 A;  4HVK A;  1AKA A;  2VMR A;  4TN4 A;  2AY4 A;  1WYV B;  3UAK A;  2CST A;  3A9Z A;  4ISY A;  3E2Z B;  5EIG A;  4Q6R A;  2EZ1 A;  2BIA A;  1N31 A;  4OCA A;  4WXB A;  2WB6 A;  5I92 A;  1ART A;  1IUG A;  1DJE A;  4FL0 A;  1BS0 A;  1TOI A;  2HOX A;  3LVJ A;  3N5M A;  3PDB B;  2C0R A;  4IW7 A;  2CJD A;  5BJ4 A;  2JJE A;  2YHK A;  3QHX A;  3TAT A;  1W3U A;  4R5Z A;  2VGW A;  1CQ7 A;  1YIY A;  2Z9U A;  3ISL A;  2VGZ A;  2ZP7 A;  1Y4I A;  3CAI A;  3JWB A;  2NMP A;  2VGT A;  1S0A A;  4WP0 A;  2C7T A;  4GEB A;  1GEY A;  1TAT A;  2VMX A;  1ARH A;  1ASL A;  1D7V A;  1W7N A;  2HP1 A;  2YKY A;  3EI9 A;  3PPL A;  4RIT A;  3ZRQ A;  4JEY A;  4ZDO A;  4WD2 A;  1BJ4 A;  5G2P A;  1EG5 A;  3E2Y A;  3JU7 A;  2JJF A;  3WKR A;  3FQ8 A;  1C0N A;  4M2J A;  1N2T A;  3LVL B;  3DR4 A;  2D61 A;  4LW2 A;  1KL1 A;  1SZS A;  1UKJ A;  3MC6 C;  4BA5 A;  1AIB A;  1J04 A;  4MQR A;  4N0B A;  1DFO A;  4MKJ A;  5IWQ A;  3ATH A;  3I5T A;  4EMY A;  1M4N A;  1BJO B;  1O62 A;  1WYT A;  1AAW A;  1TOJ A;  5EUE A;  3ZZJ A;  4KXK A;  5LHA A;  1QJ3 A;  1M0N A;  1UU1 A;  4UQV A;  2XBN A;  1IBJ A;  2TPL A;  1GEX A;  1GC4 A;  3PIU A;  1AHY A;  2YKX A;  3BB8 A;  4IYO B;  2ZY2 A;  3W1H A;  3NUB A;  3UE8 A;  1ASC A;  4XQ2 A;  3EZS A;  2HOR A;  3PDB A;  1D2F A;  4MGR A;  4W1W A;  2AY8 A;  1S06 A;  2VMN A;  1LW5 A;  2CY8 A;  3EI6 A;  3MC6 A;  3OP7 A;  3L8A A;  1IJI A;  1TOG A;  1OHV A;  3BV0 A;  3FZ7 A;  4CBR A;  4XJM A;  2ZJG A;  4WYD A;  3RI6 A;  1G4V A;  5M49 A;  2VMS A;  3G0T A;  1EJI A;  4GE7 A;  4F5H A;  4R5F A;  2YCN A;  4ADE A;  4NOG A;  4WLJ A;  4N0W A;  4AO4 A;  4R2N A;  2DGM A;  4ADB A;  3N75 A;  2G6W A;  3E77 A;  1BKG A;  4WXG A;  3RCH B;  2QA3 A;  2AY9 A;  4F5M A;  3NUI A;  3QBO A;  1LKC A;  1DJU A;  4O6Z A;  3VAX A;  4H63 Q;  1MLY A;  1PFF A;  1RV4 A;  1MAP A;  1AY8 A;  2QLR A;  1PMM A;  3G8M A;  4KAM A;  4ZDL A;  5TF5 A;  3WY7 A;  2EPJ A;  2AAT A;  1AAM A;  3AEN A;  3N4X A;  3AV7 A;  2WK8 A;  4Q76 A;  5JAY A;  3P6K A;  1B9I A;  2W8U A;  2Z9X A;  1AHE A;  1X2A A;  3VOM A;  3PA9 A;  3ZRR A;  4QGR A;  2HUU A;  3DXW A;  4J5U A;  4H51 A;  1J32 A;  1MDZ A;  4JEV A;  4UOY A;  3MEB A;  2W7M A;  3FFH A;  2Z20 A;  4AOA A;  4TV7 A;  3RQ1 A;  1RVU A;  1S08 A;  1LC5 A;  3F0H A;  3TCM A;  4LC3 A;  4IXS A;  3DZZ A;  2FQ6 A;  2FYF A;  2GQN A;  3LG0 A;  1BQA A;  3NYS A;  4ZM3 A;  2DGK A;  3ASB A;  3DU4 A;  3FD0 A;  5G4I A;  3QGU A;  4A00 A;  4PFF A;  3NU7 A;  4ADD A;  3FQA A;  3WLX A;  3AOV A;  4Q31 A;  3FVX A;  3N4R A;  1M0Q A;  2E54 A;  4XJP A;  4KYO A;  3ELP A;  5G4J A;  4XK1 A;  3FKD A;  5FT6 A;  2FNU A;  4WYE A;  4A0H A;  3NX3 A;  2AEU A;  4ZWM A;  3RCH A;  4K2M A;  3JW9 A;  2BKW A;  3GBX A;  1SPA A;  2W8W A;  3UWC A;  1MDX A;  1AHG A;  2VMV A;  1IX7 A;  2OQX A;  1AJS B;  1CZE A;  1TPL A;  2W7J A;  4PFN A;  2VMW A;  1DJ9 A;  3LV2 A;  3BS8 A;  3ECD A;  1WKH A;  4RIZ A;  5HDM A;  3AEO A;  1XI9 A;  2AY1 A;  2BHX A;  1LW4 A;  2YCT A;  1C7O A;  3FVS A;  2YKV A;  1IAY A;  1XEY A;  3FVU A;  3DRD A;  5LH9 A;  5F9S A;  4M2K A;  2VIA A;  1BW0 A;  1ARS A;  1GC3 A;  1MAQ A;  2CH2 A;  2VI9 A;  3HT4 A;  4OTL A;  1QIT A;  3DXV A;  4GE4 A;  4W1X A;  4UHO A;  2OAT A;  2EGY A;  1AMS A;  4HF8 A;  1CL2 A;  1LK9 A;  3NDN A;  2OKK A;  4OBU A;  3EIA A;  1ASE A;  3G7Q A;  3K40 A;  3RBF A;  3BCB A;  3PDX A;  4ZM4 A;  2EH6 A;  3GZC A;  3AEJ C;  3GR9 A;  4BQ0 A;  4DQ6 A;  2HOY A;  4BMK A;  2O1B A;  4E1O A;  1G7X A;  1B9H A;  1AMQ A;  2HUF A;  2VMU A;  3E6G A;  3DOD A;  3ZZK A;  4ZAH A;  1AKC A;  4B9B A;  1ARG A;  2ZYJ A;  4WYC A;  1GD9 A;  1CS1 A;  4ATQ A;  1H1C A;  5AX8 A;  4WYF A;  2QSR A;  2V0Y A;  4M2M A;  3VK3 A;  2HZP A;  1TAR A;  2D7Z A;  3WKS A;  1MDO A;  1V72 A;  3BCA A;  3MBB A;  3NYT A;  1ASM A;  3KGW A;  1KMJ A;  2Z1Y A;  4Q75 A;  1RV3 A;  1ASB A;  4WB0 B;  2BIG A;  4B98 A;  3AEJ A;  2AY6 A;  1ASD A;  3MAF B;  4LW4 A;  3VK4 A;  4LNJ A;  4JF0 A;  4AZK A;  1QIS A;  1JS6 A;  2F8J A;  1V2E A;  4A6U A;  1VP4 A;  1BJN A;  1WYV A;  3HMU A;  1QGN A;  1KMK A;  4RKC A;  4GDY A;  1QZ9 A;  3BWN C;  5DJ1 A;  3E2Z A;  1CQ6 A;  1KKP A;  3F9T A;  1WKG A;  3TQX A;  4A72 A;  1W23 A;  2E7J A;  3GWP A;  1TOE A;  2R5C B;  5F8V A;  2D7Y A;  1GC2 A;  3WGC A;  2VLF A;  4WYA A;  1C4K A;  3WCO A;  2BI3 A;  2WKA A;  3AEP A;  1UU2 A;  3B1E A;  1X29 A;  3B46 A;  4ADC A;  3GZD C;  2Z61 A;  4E77 A;  2ZC0 A;  3A9Y A;  2FN6 A;  5FT8 A;  4RKD A;  4XEW A;  5EFS A;  3ACZ A;  3ELE A;  1ECX A;  5M4D A;  2C81 A;  1G4X A;  1VJO A;  1N8P A;  3FZ6 A;  2ZSM A;  3I16 A;  4EFF A;  3M5U A;  4U1T A;  8AAT A;  3RUY A;  3JZL A;  4ZLV A;  2EZ2 A;  4PIW A;  3BWN A;  1ELU A;  3D6K A;  2BIE A;  1AIC A;  3NRA A;  5EAA A;  2VMY A;  1G7W A;  2YRR A;  3Q8N A;  1D7U A;  3W1J A;  2CTZ A;  1SZK A;  1FG7 A;  2O7C A;  4ZAS A;  4XJL A;  3GJU A;  1GCK A;  3NYU A;  2C44 A;  1OHW A;  3EI5 A;  4F5F A;  1M32 A;  1ZOD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...