1I4AA

Crystal structure of phosphorylation-mimicking mutant t6d of annexin iv
Total Genus 131
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
131
sequence length
309
structure length
309
Chain Sequence
ASGFNAAEDAQTLRKAMKGLGTDEDAIINVLAYRSTAQRQEIRTAYKTTIGRDLMDDLKSELSGNFEQVILGMMTPTVLYDVQELRKAMKGAGTDEGCLIEILASRTPEEIRRINQTYQLQYGRSLEDDIRSDTSFMFQRVLVSLSAGGRDESNYLDDALMRQDAQDLYEAGEKKWGTDEVKFLTVLCSRNRNHLLHVFDEYKRIAQKDIEQSIKSETSGSFEDALLAIVKCMRNKSAYFAERLYKSMKGLGTDDDTLIRVMVSRAEIDMLDIRANFKRLYGKSLYSFIKGDTSGDYRKVLLILCGGDD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ANNEXIN IV
publication title Phosphorylation mutants elucidate the mechanism of annexin IV-mediated membrane aggregation.
pubmed doi rcsb
source organism Bos taurus
molecule tags Metal binding protein
total genus 131
structure length 309
sequence length 309
ec nomenclature
pdb deposition date 2001-02-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00191 Annexin Annexin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.220.10 Mainly Alpha Orthogonal Bundle Annexin V; domain 1 Annexin 1i4aA02
1.10.220.10 Mainly Alpha Orthogonal Bundle Annexin V; domain 1 Annexin 1i4aA01
1.10.220.10 Mainly Alpha Orthogonal Bundle Annexin V; domain 1 Annexin 1i4aA04
1.10.220.10 Mainly Alpha Orthogonal Bundle Annexin V; domain 1 Annexin 1i4aA03
2HYWA 1HVDA 1M9IA 1N41A 2HYVA 2RANA 2ZHJA 1BC3A 2XO2A 3BRXA 1A8AA 2IE7A 1HVGA 4EVFA 1HVFA 1AOWA 1YIIA 1YJ0A 4X9PA 1YCNA 1AVHA 1MCXA 1ANXA 1A8BA 1AVRA 1DK5A 2IE6A 1I4AA 2IICA 2II2A 1W3WA 2H0MA 2H0LA 1AXNA 1ANWA 1BC0A 4MDVA 1N00A 1BO9A 1N42A 4MDUA 1XJLA 1G5NA 1W45A 1ALAA 1DM5A 1BCZA 1SAVA 1AEIA 1AIIA 2ZHIA 2HYUA 2Q4CA 1W7BA 1AVCA 1N44A 1HM6A 2H0KA 2ZOCA 1ANNA 2XO3A 4EVHA 1BC1A 1HAKA 1HVEA 1BCWA 1BCYA 4HREA
chains in the Genus database with same CATH superfamily
1HVDA 1M9IA 1N41A 1BC3A 2XO2A 2IE7A 1HVFA 1AOWA 4KN4X 4JWLA 1YCNA 4C0AA 1ANXA 3ABOA 4JXHA 2II2A 1AXNA 1BC0A 1N42A 4FQ0C 1ALAA 1AIIA 2Q4CA 1UPTB 3LTLA 4D7RA 1HAKA 1A8BA 2HYVA 4EVFA 3SOHB 1XSZA 1YIIA 2VXGA 3ANYA 2IICA 1I4AA 3USWA 2H0MA 1KU1A 2HSNA 3ABQA 1ANWA 1BC9A 4KMUX 1R8SE 3L8NA 1AVCA 4FHRB 2H0KA 3ABRA 4Z21A 1YGMA 4JMOA 3TW5A 4EVHA 3AJCA 3ABSA 1BC1A 1PBVA 1HVEA 1BCYA 4HREA 4MDVA 2ZHJA 3BRXA 4A4PA 1HVGA 1S9DE 1RE0B 2OY9A 2R0DA 1YJ0A 4D7QA 1QC7A 1DK5A 1AVRA 2IE6A 4JMIA 1W3WA 2H0LA 1BO9A 4MDUA 1XJLA 1W45A 1XT0B 4Q2SA 1DM5A 1BCZA 1SAVA 1AEIA 2ZHIA 2ZOCA 1ANNA 3AO0A 4JK1X 1BCWA 2HYWA 1LKVX 1R8QE 1R4AE 2RANA 1Q8DA 1A8AA 3SWVA 4X9PA 1AVHA 1MCXA 3HJLA 4OIYA 3USYA 1C1KA 1N00A 2R09A 1G5NA 1R8ME 4L5MA 2K6XA 2QEZA 2HYUA 1W7BA 1N44A 1HM6A 4KN7X 2XO3A 4C7PA
chains in the Genus database with same CATH topology
2HYWA 1HVDA 1M9IA 1N41A 2HYVA 2RANA 2ZHJA 1BC3A 2XO2A 3BRXA 1A8AA 2IE7A 1HVGA 4EVFA 1HVFA 1AOWA 1YIIA 1YJ0A 4X9PA 1YCNA 1AVHA 1MCXA 1ANXA 1A8BA 1AVRA 1DK5A 2IE6A 1I4AA 2IICA 2II2A 1W3WA 2H0MA 2H0LA 1AXNA 1ANWA 1BC0A 4MDVA 1N00A 1BO9A 1N42A 4MDUA 1XJLA 1G5NA 1W45A 1ALAA 1DM5A 1BCZA 1SAVA 1AEIA 1AIIA 2ZHIA 2HYUA 2Q4CA 1W7BA 1AVCA 1N44A 1HM6A 2H0KA 2ZOCA 1ANNA 2XO3A 4EVHA 1BC1A 1HAKA 1HVEA 1BCWA 1BCYA 4HREA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2HYW A;  1HVD A;  1M9I A;  1N41 A;  2HYV A;  2RAN A;  2ZHJ A;  1BC3 A;  2XO2 A;  3BRX A;  1A8A A;  2IE7 A;  1HVG A;  4EVF A;  1HVF A;  1AOW A;  1YII A;  1YJ0 A;  4X9P A;  1YCN A;  1AVH A;  1MCX A;  1ANX A;  1A8B A;  1AVR A;  1DK5 A;  2IE6 A;  1I4A A;  2IIC A;  2II2 A;  1W3W A;  2H0M A;  2H0L A;  1AXN A;  1ANW A;  1BC0 A;  4MDV A;  1N00 A;  1BO9 A;  1N42 A;  4MDU A;  1XJL A;  1G5N A;  1W45 A;  1ALA A;  1DM5 A;  1BCZ A;  1SAV A;  1AEI A;  1AII A;  2ZHI A;  2HYU A;  2Q4C A;  1W7B A;  1AVC A;  1N44 A;  1HM6 A;  2H0K A;  2ZOC A;  1ANN A;  2XO3 A;  4EVH A;  1BC1 A;  1HAK A;  1HVE A;  1BCW A;  1BCY A;  4HRE A; 
#chains in the Genus database with same CATH topology
 1HVD A;  1M9I A;  1N41 A;  1BC3 A;  2XO2 A;  2IE7 A;  1HVF A;  1AOW A;  4KN4 X;  4JWL A;  1YCN A;  4C0A A;  1ANX A;  3ABO A;  4JXH A;  2II2 A;  1AXN A;  1BC0 A;  1N42 A;  4FQ0 C;  1ALA A;  1AII A;  2Q4C A;  1UPT B;  3LTL A;  4D7R A;  1HAK A;  1A8B A;  2HYV A;  4EVF A;  3SOH B;  1XSZ A;  1YII A;  2VXG A;  3ANY A;  2IIC A;  1I4A A;  3USW A;  2H0M A;  1KU1 A;  2HSN A;  3ABQ A;  1ANW A;  1BC9 A;  4KMU X;  1R8S E;  3L8N A;  1AVC A;  4FHR B;  2H0K A;  3ABR A;  4Z21 A;  1YGM A;  4JMO A;  3TW5 A;  4EVH A;  3AJC A;  3ABS A;  1BC1 A;  1PBV A;  1HVE A;  1BCY A;  4HRE A;  4MDV A;  2ZHJ A;  3BRX A;  4A4P A;  1HVG A;  1S9D E;  1RE0 B;  2OY9 A;  2R0D A;  1YJ0 A;  4D7Q A;  1QC7 A;  1DK5 A;  1AVR A;  2IE6 A;  4JMI A;  1W3W A;  2H0L A;  1BO9 A;  4MDU A;  1XJL A;  1W45 A;  1XT0 B;  4Q2S A;  1DM5 A;  1BCZ A;  1SAV A;  1AEI A;  2ZHI A;  2ZOC A;  1ANN A;  3AO0 A;  4JK1 X;  1BCW A;  2HYW A;  1LKV X;  1R8Q E;  1R4A E;  2RAN A;  1Q8D A;  1A8A A;  3SWV A;  4X9P A;  1AVH A;  1MCX A;  3HJL A;  4OIY A;  3USY A;  1C1K A;  1N00 A;  2R09 A;  1G5N A;  1R8M E;  4L5M A;  2K6X A;  2QEZ A;  2HYU A;  1W7B A;  1N44 A;  1HM6 A;  4KN7 X;  2XO3 A;  4C7P A; 
#chains in the Genus database with same CATH homology
 2HYW A;  1HVD A;  1M9I A;  1N41 A;  2HYV A;  2RAN A;  2ZHJ A;  1BC3 A;  2XO2 A;  3BRX A;  1A8A A;  2IE7 A;  1HVG A;  4EVF A;  1HVF A;  1AOW A;  1YII A;  1YJ0 A;  4X9P A;  1YCN A;  1AVH A;  1MCX A;  1ANX A;  1A8B A;  1AVR A;  1DK5 A;  2IE6 A;  1I4A A;  2IIC A;  2II2 A;  1W3W A;  2H0M A;  2H0L A;  1AXN A;  1ANW A;  1BC0 A;  4MDV A;  1N00 A;  1BO9 A;  1N42 A;  4MDU A;  1XJL A;  1G5N A;  1W45 A;  1ALA A;  1DM5 A;  1BCZ A;  1SAV A;  1AEI A;  1AII A;  2ZHI A;  2HYU A;  2Q4C A;  1W7B A;  1AVC A;  1N44 A;  1HM6 A;  2H0K A;  2ZOC A;  1ANN A;  2XO3 A;  4EVH A;  1BC1 A;  1HAK A;  1HVE A;  1BCW A;  1BCY A;  4HRE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...