1I4EB

Crystal structure of the caspase-8/p35 complex
Total Genus 65
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
65
sequence length
258
structure length
243
Chain Sequence
LDKVYQMKSKPRGYCLIINNHNFAKAREKVPKLHSIRDRNGTHLDAGALTTTFEELHFEIKPHHDCTVEQIYEILKIYQLMDHSNMDCFICCILSHGDKGIIYGTDGQEAPIYELTSQFTGLKCPSLAGKPKVFFIQACQGDNYQKGIPVETDTRYIPDEADFLLGMATVNNCVSYRNPAEGTWYIQSLCQSLRERCPRGDDILTILTEVNYEVSNKDDKKNMGKQMPQPTFTLRKKLVFPSD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Covalent inhibition revealed by the crystal structure of the caspase-8/p35 complex.
pubmed doi rcsb
source organism Autographa californica nucleopolyhedrovirus
molecule tags Apoptosis/hydrolase
molecule keywords Early 35 kDa protein
total genus 65
structure length 243
sequence length 258
ec nomenclature ec 3.4.22.61: Caspase-8.
pdb deposition date 2001-02-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00656 Peptidase_C14 Caspase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1460 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1i4eB00
3R6LA 1IBCA 2H48A 4QU0A 1ICEA 3V4LA 4D3ZA 4HVAA 4NBKA 4JJEA 2HBZA 4FXOA 3RJMA 1CP3A 3IBFA 4JR0A 1RHQA 4QUGA 5I9BA 3S70A 4JJ7A 1I4EB 5LUAA 2P2CA 3GJSA 4ZVUA 4ZVSA 2J31A 3V4OA 2C2OA 4QUIA 4PRZA 3KJFA 4QUHA 1NW9B 1RWNA 1RWMA 2CJYA 2HBQA 3P4UA 4ZVPA 5IABA 4D3YA 3KJNA 3H0EA 3R5KA 3DEIA 4DCOA 1QDUA 2CJXA 4JR2A 1PYOA 2DKOA 4QTYA 4PS1A 3SIPA 2QL5A 3D6MA 2C2ZA 2QLJA 4IEFB 1K86A 2H54A 3PCXA 5I9TA 3R7NA 4EHHA 4M9RA 3PD1A 4QU5A 1RWOA 2K7ZA 3EDQA 1RHUA 4FDLA 4NBNA 4EHAA 1NMEA 2AR9A 5IBCA 2H5JA 3V3KA 1NMQA 4HQ0A 3UO8B 2Y1LA 2WDPA 4ZVRA 3R7BA 3H11B 5IAEA 3D6FA 3V6LA 4QU8A 4EHNA 4QUEA 4D3XA 1K88A 2C2MA 2CNKA 3DEHA 5JFTA 5IBPA 3NR2A 2CNOA 2FQQA 3OD5A 3SIRA 1QTNA 2XZDA 1CVRA 1SC3A 4FEAA 5LU9A 3H13A 4PRYA 4I1RA 4NOMA 4QULA 4JQZA 3R7SA 2XYPA 1RHKA 1NMSA 5IANA 1F1JA 5IAJA 4EHFA 4ZVQA 3R5JA 4N6NA 2J30A 2H4YA 2XYGA 2XZTA 4NBLA 4EHKA 1SC1A 4N6OA 3P45A 3S8EA 3GJQA 3K7EA 4NOKA 4ZVOA 4QUDA 3ITNA 3H1PA 4AWBA 1SHLA 1RWVA 1GQFA 3DEJA 5IAGA 4DCJA 2QLBA 4IYRA 4QTXA 1I4OA 4LSZA 2CDRA 1JXQA 1I51A 1RE1A 3QNWA 3IBCA 3UOAB 1BMQA 5IARA 4EHLA 2H65A 1PAUA 4NOLA 1KMCA 1M72A 4EHDA 4EJFA 4QUJA 4JB8A 1RHRA 3NKFA 4AW9A 3PD0A 4N6GA 5IC6A 3H11A 3R6GA 3EDRA 5LU8A 3E4CA 1F9EA 2NN3C 1QX3A 2XYHA 3GJTA 5IC4A 2J33A 4HQRA 2CNLA 4JJ8A 4JR1A 3V55A 4QUBA 1RWWA 1SHJA 4N5DA 1I3OA 2H4WA 3NS7A 5IBRA 2QL7A 4I1PA 3GJRA 3KJQA 4AWAA 2H5IA 2J32A 3D6HA 4QU9A 4NOJA 5LUBA 4FGUA 2HBRA 2C1EA 2H51A 4DCPA 3DEKA 3BIJA 1RHJA 2HBYA 4N7JA 1RHMA 1RWKA 5IAKA 1SC4A 1RWPA 2Y0BA 4JQYA 1RWXA 5K20A 1GFWA 2QL9A 2FP3A 5IASA 2QLFA 2FUNB 2CNNA 4ZVTA 5H0IA 4N7MA 3V6MA 4QUAA 4PS0A 2C2KA
chains in the Genus database with same CATH superfamily
2GPTA 1BXKA 4CDMA 2XQVA 3IL2A 4Q1CA 2FVYA 1FVHA 2G9NA 2JFQA 1N1DA 4YHBA 4DSZA 1PE0A 1HDRA 1V8ZA 2VRCD 4HS9A 4P3PA 5TB5A 3TK1A 3RYCA 1YA6A 1Z8FA 2D0PB 2O2EA 3AW8A 1F8YA 1U7HA 4UNSA 1XZEA 3JQBC 1NWCA 3U4DA 2PTGA 3BWXA 3COZA 4Z8XA 4BATA 2BM1A 2O2CA 1RLMA 3IQHX 3TQTA 1IVSA 4PANA 4D3YA 2PFSA 3KLPX 4GMHA 3BCRA 3C97A 4NCJA 4WQMA 4C14A 3IT1A 1K08A 1Y7LA 1OFIA 1GJRA 3A9RA 3OOSA 4BKQA 4O4HB 4Q4HB 3KT3A 4D6PA 1K2VN 3H83A 4WOKA 4BO4A 1RT9A 1RWOA 4Q24A 1N5DA 3WWYA 1AZSC 1J23A 4N76A 3I62A 3NWOA 3T52A 4QTZA 2FFBA 2EW8A 3WG9A 1SG0A 3I1JA 1OROA 4XUGB 2MR5A 2G82A 3IUBA 1WD7A 5IAEA 3P9SA 4LQ4A 1SFRA 1CRWG 2PGNA 1J8FA 4JLOA 3KQNA 3AL0C 1X80B 1VKRA 5TQ2B 3FPGA 4H6PA 2K4MA 3JWJA 5EPUA 4CKWA 2PH7A 3TW4A 1WBDA 4D99A 1EFDN 4I1RA 5B36A 2AC7A 3RAEC 1DE0A 1T4GA 5FFFA 4XA8A 2XYPA 5A0FA 2J0VA 5JD3A 2XQFA 3BF7A 5CB4F 1KZYC 3KHKA 4HAYA 4H4DA 3DCYA 4RNDB 1E7RA 1FQOA 3WNCA 1QC5A 4R0MA 8ADHA 3A7EA 2HPZA 5IH3A 1JXAA 1IAQA 2WKPA 3OOWA 3T54A 4C06A 1FA9A 2YNMC 4KPUB 2E85A 2JA2A 3LAWA 2H29A 3OD1A 4PX2A 2BEWA 4LJLA 4EUSA 5KQPA 5JHHB 3BBPA 5CTAA 1I5RA 1XLTC 4LSZA 3ZBQA 4RD3A 4DDVA 1E2EA 5LIPA 2IJGX 1HL3A 1WCXA 1OAOC 2F00A 1BXZA 4O1MA 3M4NA 2VAXA 4DUYB 2O2DA 3QVXA 2AOVA 1EXDA 5CVDA 2AFRA 4QUJA 1ENYA 4K86A 1NQUA 1M3SA 2I3AA 2PNFA 1DMRA 1BVRA 1HYGA 1N5LA 3FMOB 2QVGA 3VU3A 4FZRA 4HNAA 1B6GA 1EVQA 3T1NA 1X2EA 1ZD4A 3KQLA 4N01A 3ZTTA 2OXEA 2IYPA 1CZLA 4DEVA 2OCIA 1RJDA 1SHJA 4JX8A 4RFLA 4EB3A 1OF1A 5KNBD 3PJGA 2CVZA 4LV5B 5E4TA 3CSSA 3E9YA 5AJVB 4IVQA 4BYMA 5I48A 3DBLB 3PI7A 1JFFB 2V7QA 1RMQA 3AIIA 1V4VA 4KBFA 5JZ9A 3G8AA 1ZWLA 2ZTHA 5EJIA 1GO2A 1V4NA 4HD8A 2JA1A 2IVFA 3GLFB 3ZY3A 1QO7A 3COPA 2YHSA 3E81A 1OBVA 3K0HA 4N0EA 4W4TA 4YPVA 1P7VA 2WWTA 3LT1A 5JYCA 1NN0A 1J00A 1FCJA 4K26A 2D2XA 4DDKA 2I66A 1BYUA 4TSRA 1Z7GA 3MTGA 4E11A 5LU9A 4W5QA 1EXNA 4Z9AA 3W8RA 2JW5A 4R2HA 4RL6A 3VJKA 3OBBA 5B2ZA 4DIOA 5LP6B 4HGOA 1HE4A 3EZLA 2RONA 3PNKA 4H7IA 5G2OA 4RHEA 5JZOA 1I5EA 3QV2A 4RQUA 1MG5A 5F4BA 1LB1B 1YU9A 3E1KA 3VKVA 1YKSA 2BJWA 2A0KA 4R5HA 4JJ7A 5IG2A 2FE4A 3O5AA 1E4EB 1W87A 4LY6A 2FWPA 2XNDD 1LPMA 5KSPA 4B5KA 1Z0ZA 5L3SB 4NJOA 2G40A 2FMKA 4DC1A 2VT7A 1W581 4OFWA 2VC2B 2NPIA 3M9XA 5AJXA 5HIIA 1DXQA 3LCRA 3FRHA 4JZYA 1QM5A 1GWNA 4IRMA 4BVEA 4PC1A 3DOUA 4E7PA 1T2DA 2MYNA 1J0BA 4PC7A 4XIYA 3H18A 1RHUA 3TQQA 1NP3A 2OVFA 3FSGA 2OBNA 2BFMA 2PS1A 2R7KA 4BBZA 1ADYA 3DLIA 3S2FA 4LCEA 1OBOA 3ZDRA 3CVYA 3IMCA 5F1PA 1L2TA 3H1FA 2BT4A 4F3CA 2JFPA 3W2FA 2AN9A 1EK1A 2I1WA 3SOZA 4OHBA 3DE2X 5DWVA 2RH9B 4YRNA 1BMFA 2I0FA 2GVDC 4FYHA 2GRAA 3SZRA 4CEHA 1A9YA 3IRVA 4WEOA 2WSLA 1EUCA 1GGKA 3F8WA 3HA7A 2GAFA 3MQFA 4GBED 4I5IA 4CMKA 2JFVA 3GJ4A 1Z4NA 1GDTA 2VF8A 1GAJA 2VYNA 1DG1G 3VR0A 5C7LO 2XZOA 5C4MA 2HUNA 2PKYX 2PM8A 2VAPA 4PW0A 4W9NC 3ZLBA 1NG9A 4LRXA 1QIMA 1LLDA 2JFXA 1P5ZB 4BNFA 3OY7A 1OI4A 4DLSA 3IX7A 5CDFE 3KLOA 3ZDQA 3P19A 1E2QA 3ISJA 1NZJA 1U3WA 2DLDA 1Q83A 1KP2A 3AP3A 2BGRA 3AWIA 3JD3A 1JR3E 1W75A 4V2UA 4TLBA 4YP9A 2V7UA 4KWIA 5HYVA 4HDSB 4HMQA 1V1RA 3EY4A 1N4DA 4FLEA 1YWGO 2R25B 1PJAA 4EGJA 4EH1A 3NDJA 4LTDA 3R0VA 2CXRA 1TC1A 4RNCA 4RZUA 1ZN8A 4MUIA 4PQYA 4BFZA 2AD1A 3MCWA 1FZQA 4DMGA 3R8FA 3SYRA 4NY1A 5A3SA 1PYGA 3AKZA 1SOVA 3SHWA 2NU7B 3ZWMA 3A9UA 4RX1A 3VPCA 1JZSA 4L6AA 4QWMA 1FS4A 3EA5A 4PEVA 4F4FA 5A4JA 1LF0A 1XYYA 4WKCA 4BTLA 4BXOB 1ZIYA 4ZEMA 4MIYA 2DR0A 2FSPA 3O8CA 2ZBEA 3D7RA 3EUWA 4NU5A 3K3PA 3R4VA 1U3UA 4B48A 4K9KA 4GZ6A 1C8LA 3QEMA 3OUUA 3QXCA 2MR6A 1JHPA 1YZ3A 3M70A 2OCYC 2EZTA 2X22A 2J32A 3P2IA 1POWA 3LHIA 2O0KA 4L5AA 1C4OA 5C2JB 3JRNA 1WDTA 5TGTA 4LC1A 1SVMA 3X44A 5ITZB 1EDZA 4MP8A 1RJFA 1I2MA 2C2WA 2IXGA 3ETHA 5CVJA 5JSZA 1FSPA 1D4FA 4WZBA 3M4JA 4MRMA 1T6XA 4TKLA 1GYQA 3ZS9A 4AZ0A 5IRCD 5DTMA 2ALJA 4AYXA 2FPPB 3M6IA 4RDIA 3AONB 3VSBA 4FOSA 4MVCA 3FVQA 4F96A 1LX6A 4HVAA 4Q3BA 2QUHA 1MRZA 1YNSA 1HE1C 2PKEA 5E6RB 3MVEA 4O2AB 1HQKA 3HWX1 4ARZA 1WMDA 3O82A 2R5NA 5KNDH 3DR3A 1KOJA 2Q5FA 1OXKB 5J43A 1HTBA 1S2MA 2IDJA 3C16C 3EQ7A 3Q15C 4RQBA 1UOOA 3ZWPA 1FX0B 3GH1A 2Q21A 3WKEA 4YJ2A 5IKOA 1CXZA 1Z16A 4U39A 2EL9A 1E8DA 3K8YA 3WWZA 2JVIA 3T9BA 4ENPA 2VI5A 2VXYA 3NT4A 4P2GA 3D6MA 5L7YA 3K30A 3BB4A 3E27A 2B0CA 5AI4A 3K9BA 4M9RA 4RLQA 3JD0A 3QKIA 1KEWA 1JQAA 1Z8NA 2ORED 1EGHA 1TYDE 3N0VA 1PZMA 2D1SA 3DXZA 4A6XA 1Q0ZA 2XWBF 2J6HA 2WKWA 2C84A 2W43A 3BTVA 3E1SA 2OQRA 1QQ5A 4MW1A 1C8BA 4A0FA 1IZ9A 2F1HA 2UYQA 3IAM1 2H1LA 1NJGA 4YRKA 3JARB 1S3IA 2OGWA 1OGIA 1JPNA 4LYGA 4KKVA 4Q9LA 4QSHA 1M2JA 1SPBS 2DQYA 5F64A 5KCZA 4QNMA 3TX2A 1NFFA 4DV4B 2GXAA 3U39A 3SQWA 1XMQB 1EAYA 4ZQIA 3IYLW 5FX2A 3R3SA 5IEJA 4WACA 1E1LA 4F5ZA 1GQRA 4GKBA 3B89A 5TMEA 4BQRA 4HNHA 1YZVA 3OHSX 1VXOA 3DDZX 2CBZA 3QPWA 4OA5A 4QATA 4R2MA 3ZD6A 1MDFA 4ZVQA 2KSQA 5CCXA 1G20E 1CUEA 3WKBA 1SZJG 4H7EA 4LXQA 2QD4A 3N2NA 3DWEX 3KAJA 3G3EA 1WLSA 5FI1B 3SHTA 1WHSA 5AJHA 3T61A 4DUGD 5AKXA 4RABA 3L7CA 3HP1A 2O7VA 3NBAA 4JC4A 1J0AA 2HSZA 4NYIQ 2BKEA 2O1WA 1G7RA 1R6VA 4FB5A 2Z98A 4MSUA 1OYWA 4W1RA 5AVOA 2JIQA 3QUBA 2HRBA 3O8LA 3OG9A 1JGTA 1XAJA 1NJ2A 4JBNA 4HPJB 2FWIA 3AUYA 4HN4B 1E9EA 1XF9A 1YHYA 3NM4A 3NZEA 3A1DA 4K6FA 4E5MA 4RCYA 3ZWDA 3A1WA 4JT4A 4OQFA 2VHYA 3MXOA 2K7FA 2G9QA 4TLCA 3OQ1A 5CG2A 2IZ6A 2DH5A 3PNQA 3RJTA 2QL7A 4AU1A 4NCAA 3BMOA 1RRPA 4KRGA 1XTVA 5JSHA 4G81A 3RBXA 1HR0B 5CR9A 4S3MA 4ZEXA 1PGJA 1UM8A 4BO7A 1Q0RA 1UCFA 2NXWA 3ZH9B 1T8PA 2IYOA 4ND8B 3UV6A 1MNQA 1QCCA 2CUKA 4KIUA 1D5WA 2OILA 1OAOA 3O8OA 5A4FS 4GNRA 2I7VA 2X0RA 2G67A 3H19A 4G23A 4Q15A 3K8ZA 1V41E 4WOJA 4W5OA 1WF3A 4KOEC 3LSYA 3R5XA 4OSEA 5AQEA 4OLHA 3K9WA 5BT8A 1BX0A 2J9FA 1YCDA 1HKUA 4RH1A 4AJ4A 4QFDA 1JSCA 1ISFA 3BD7A 5BVHB 5HS6A 4C4YA 3IBFA 4CCAA 1UDRA 5TY0A 1F4PA 4XVQA 4XTCS 1EVEA 5F7XA 4FHEA 2JLBA 3G17A 4DLZA 2ZE5A 1FNCA 2ZSIA 1C7JA 4UEKA 2JD2A 2OYCA 4AX8A 5HKKA 4G24A 1AQUA 4BFVA 3TQSA 1XVVA 2IXEA 4IIGA 1Z74A 4E5SA 4W9MC 2NU8B 1ZN9A 1BDJA 1XDWA 2DKOA 4LXHA 2ANCA 4RORA 4LXTA 1DRJA 3AZOA 5J47A 3H9QA 5HXAA 4XOIA 2OPHA 3U44A 4QTTB 3TTUA 3UWOA 1M1NB 1P5JA 1U2SA 3NH9A 5AESA 1YJCA 5JSZB 2HIHA 3D5TA 4Q4CA 2CE7A 4ML3A 4TLAA 1V3VA 4GXRA 1R8XA 1YZGA 4E5KA 2IHJA 4ZT4A 4EP1A 2JFFA 1TEVA 1KFKB 2EBUA 3CLRD 3D2CA 1GARA 2GK4A 3VYWA 1KR2A 3EH2A 3AR2A 3W4IA 4R3UC 1XCPA 4RWEA 3H97A 4LYAA 4ARZB 5HFAA 2YMPA 1VZ3A 2ES4A 2BHNA 2I87A 2ZRMA 3F90A 4FCWA 3IPXA 2AFIA 2JIRA 3P0FA 1MPXA 5CT6A 4O2LA 4LFBB 1P7PA 2UVPA 5D01A 1XNGA 4KXNA 1LJLA 4JYCA 3I73A 4YCDA 3ZUGA 1SBNE 1U1IA 3OJXA 4L5BA 4B6EA 1O9HA 4L7VA 3FWHA 3F46A 4FKBA 2GCGA 4IJMA 4P9NA 5DBGA 2E82A 2VTBA 3B51X 4DPMA 4IIJF 1JBQA 4KR0A 4HLCA 1SIWA 1GCOA 1OE0A 3K9FC 2OHIA 4F84A 1EFPA 1ISSA 2AMLA 1Z9BA 1JEAA 2BTQB 2LBPA 4HWKA 5EJGA 4GMGA 4WXMA 1HMPA 2OC4A 1TMGE 3RRMA 3PLAE 1PYDA 2VBFA 5L45A 2MSLA 2C57A 1Y7HA 2XJ4A 3HBMA 2D5IA 4A92A 4L74A 4LYYA 2QXTA 4Z4CA 1T9GR 4IINA 3AEUA 2HIAA 1YXMA 5U9CA 2CFTA 3DMHA 3W2IA 4O2RA 3SP1A 1IWBB 1DAPA 4TVBA 2ZBQA 3LFTA 4XWKA 4D9MA 3KR9A 2NXNA 1HT1E 5IJZA 4HX2A 4R1MA 3FSRA 5CW2A 5KQMA 1I10A 2VQEB 4CM7A 3ODGA 1WDKA 1EH5A 3HL0A 2AVDA 4Y6SA 1MORA 3WGVA 5JXJA 1JX6A 2P6OA 2A9OA 1ZM9A 2Q1WA 2HW8A 4OUKX 1DRUA 1UKBA 3ZNPA 4AKTA 3ICPA 4KQXA 4I3HA 5CDTA 1NGSA 4JROA 5FHQA 4XX0B 5EFZA 4EB6A 2YL2A 5ALFA 1HDOA 1V26A 1CUSA 1LBEA 4JOQA 2SECE 1RBZA 1ZM4A 4HGQA 3GQVA 3PFBA 4CCWA 1W9HA 4K87A 1ULSA 1Y1SA 3MBKA 4WXEA 1KI8A 3IV7A 1I8TA 2RFLA 3A32A 4BIIA 1MA3A 2FPSA 1HQDA 3DAOA 1MEEA 1BA2A 4US0R 3GT0A 4GZMA 1DTWA 3A28A 1NUTA 1ZK2A 1QORA 1U0SY 1YJXA 1HO3A 3JX9A 2F1OA 5CVUA 2FMHA 4HQOA 4BO1A 1WOMA 4JUFA 3ENQA 5JFOA 1TAUA 1IEWA 2O2IA 3GGGA 2YXPX 4NWIA 1HYQA 1MBZA 1YKFA 4NZOA 3CMCO 1ZPDA 2ARKA 3A1SA 4U00A 5T6MA 3SKYA 4EY8A 4TVSA 2QQEA 2AN5A 2NG1A 2QV7A 2FPMA 4X91A 4UCFA 4EJSC 4MQFA 4OJKA 1UC4B 3S1SA 1NI3A 4DBLE 5ALYA 1W48A 4K40A 2EBHX 4R05A 2QMYA 2VHZA 4LCBA 3GDFA 3K0KA 3NT5A 4X90A 4YMGA 3FIUA 1N4AA 1TJ5A 1VSUA 3KG2A 4XQEA 4YFVA 4U6SA 3Q7RA 4WY2A 1LPOA 3QKSB 1C7EA 1CUCA 4IILA 1IM2A 3A11A 1ZXLA 3H87A 3WGHA 1OXTA 1Y7PA 1WZCA 4XJVA 3D5QA 5CW1A 2GTIA 4QGGA 2BUCA 2ZS9A 4LHWA 5BWCA 1XLTA 1ZQ9A 4DQKA 1I1NA 1O97D 3IDFA 3R7BA 1XNRB 3OIDA 4RIHA 3SS9X 1ZM2A 4ZO7A 2AH5A 4XIJA 4DQVA 1H1LB 2J9FB 1R9NA 3BMQA 5HE8A 3OOHA 2GHTA 1QHXA 3FRJA 4XOUA 1IUKA 3ONVA 1Q3HA 1OB2A 3IMGA 3J81k 3K0FA 4ALJA 5KTYA 1P1IA 3GFSA 3OWHA 4J8PA 4H6VA 4JQZA 3KKLA 4P3XA 1XRMA 2P75A 5K8LA 2AJBA 3HYNA 4RZ3A 5HBRA 1WZ2A 3N2ZB 3KALA 4JUIA 3SNKA 5E1DA 3ZGXA 3CN9A 3HVRA 4Q7LA 5E1MA 2BKUA 3CLSC 2I80A 4W7IA 4C4XA 5J4KA 1JPJA 1R6UA 1F60A 2R8ZA 4LFAB 1F2DA 2BGMA 3QFFA 1QDLB 5CRIA 4IXWA 3E61A 5A9TA 5KX5B 3DVAA 2BDEA 3HRKA 5LM3A 3REQB 1ISRA 5E4YA 1JE1A 2ECFA 4MKIA 3AV0B 1E3WA 2BFFA 1YS1X 3C7KA 3A1TA 3PGLA 4KAAA 4RMHA 1V3QE 1XU4A 1SO8A 2BCJQ 1XU9A 2D06A 3ESXA 4QDOA 5AO9A 3PKIA 3RTAA 3EAQA 5K9ZA 1YOVA 5FWXB 3BCUA 3ICEA 1IOVA 5BN5B 3QM1A 3JD1A 3K2QA 4WGFA 4JVSB 3UGQA 3F49S 5DM60 2E4VA 2VDRB 4F2GA 5LNK1 1Y6JA 2Q6VA 1QG4A 3HL4A 3J7TA 4G4IA 1XTUA 4H15A 4BWFB 2BSQA 4TXHA 1JH8A 3UMSA 4F06A 3NIGB 2QIPA 3AX6A 3NHMA 4L50A 3L3BA 3ABQB 4O02B 3WLJA 5AW2A 2C5LA 1U0LA 1PVVA 2IIPA 5J5CA 4PX5A 4Z4EA 2MJLA 1VJTA 2WHXA 9LDBA 1QTQA 1G55A 5A5FA 2Q2VA 3B5IA 1QYCA 2TMDA 3OY2A 3Q3EA 5A5VA 4BGDA 1ZH8A 4OEHA 5J2UA 3V4ZA 4KXVA 3HJHA 2YJ5A 2CXSA 3ZYZA 1QMGA 1XB2A 3K72B 4NS4A 4R0VA 1XO1A 2B4QA 4Q9DA 4IVPA 3LSTA 2A58A 2XCRB 2H1WA 1XKXA 4QXRA 4KN6A 2OHGA 4YT5A 3T7AA 4WZBE 1CDOA 3CX8A 1JFSA 1C8KA 1RQXA 2QMUA 3PDIA 4NLLA 3VVCA 2Y1OA 3DLBA 3WL3A 5F2KA 1VTKA 5BOSB 2FEXA 4NMHA 1XDUA 2EX1A 1BXRB 1T0HB 3RSFA 5HIKA 1T2CA 2WUVA 1LZKA 1X7WA 2C9ZA 2JGMA 3BCHA 2BTOA 1A76A 1SCUB 3E8XA 4BB0A 1C4KA 2PLNA 4Q03A 3QUSA 2DFDA 1ISMA 1MN6A 4ZVPA 3CNOA 4BZXA 2GBLA 1SCNE 3H2IA 5DBIA 2WF6A 3MTJA 5G0WA 1RLTA 1O2DA 4Q9KA 1S9HA 3C1UA 3T7JA 2C2ZA 4JYPA 3R6DA 4TKUA 4MW2A 3VHXA 1KY3A 1L9XA 2JI4A 4N5MA 3DKPA 3H8WA 1GN9A 4KO2S 1AHPA 1SR8A 3LUPA 4R1TA 1ICIA 1N1MA 3PXCX 2C9YA 5EJ2A 4F46A 3U9TA 1BE6A 3M5WA 2ZSAA 4GFDA 1H66A 3IEVA 2NO4A 4O2BB 1FTYA 1U9JA 1FMLA 1XIVA 4MUKA 1ESZA 2BIFA 4WMLA 3V6LA 10MHA 2C7QA 1WCWA 2AYXA 5KSZA 2FNAA 5EZYB 4HGPA 1CJBA 5I45A 3DMTC 1U0OC 2CWWA 2J5QA 5JJBA 2VP2A 1A4XA 3AFHA 3MD0A 4QE3A 4I4TB 1UK6A 2RGRA 1P62B 1LQTA 2A5LA 3QEOA 4GDFA 1EX1A 1H8HD 2C4VA 2H2AA 3L8CA 3A4IA 3TD9A 4X7MA 3UICA 1KTVA 1YQ9A 4L3OA 3UJHA 4U6NA 4R1QA 4G26A 1BWPA 4XGNA 1TL7C 2IYXA 4HAOA 4TMYA 3GLQA 3VGJA 3G9TA 2Q9UA 3GMTA 4F97A 1KTIA 1KI6A 1QCYA 1BA3A 3MAGA 4LDJA 4OL9A 4TLMB 2X8LA 5ALRA 3PDJA 4BAGA 2C20A 2YMMA 3V7FA 3EIFA 4BKMA 3UK1A 5IM4A 5F33A 4GKAA 4PZDA 3MQ4A 4U7FA 5I4IA 1VLQA 1F0KA 2E89A 4DA4A 3BDAA 5CIQA 3F5MA 2R68A 2HA7A 2ZJOA 1E3QA 3ND5A 2IPMA 1NDHA 1MAHA 1NYRA 3LC2O 3E7PA 1A0OA 4HWGA 5K3CA 3GRKA 7ADHA 4I4LA 1ZAYA 4PQRA 4KSCA 3KQTA 4CGYA 5ALMA 3H1GA 2OV2A 5CDYA 4MWTA 1C9YA 4RY0A 3VBEA 3CMMA 2QSYA 2AQ8A 1EA5A 4IM7A 2ZUTA 1T2UA 2ZQYA 1KJQA 4G1BA 2P9HA 4JEHA 4CTNA 4WKBA 1H23A 3BIFA 3BWCA 3CF2A 1QB7A 1GG9A 3I23A 2YVQA 3KJHA 5DJ5A 2OE2A 1XPUA 2ZYSA 4XQCA 5KMGA 1LA2A 4QRHA 1QAMA 3SQDA 3AKDA 1R4NB 2ZRFA 2CXXA 4N18A 3FWYA 4JLVA 3IXQA 5ALDA 4TTIA 4QGBA 1M7BA 4KPGA 4KMSA 3AB3A 1GLVA 4JI6B 2PWZA 3NBKA 4UHHA 5FO0A 1W88A 3TTWA 5IZCC 1J0EA 3PIRA 3OQIA 5DASA 3ZU2A 1CZNA 2DP4E 4O08A 3ASYA 4Y9TA 2C04A 2X9LA 3KJIA 3PEUA 1HSZA 3FPEA 3QE0A 2ZSKA 4C0QC 1E6UA 3M4YA 3ZWKA 4OOFA 4G07A 4UQOA 3VR1A 1EFUA 4DKXA 4XRRA 3L01A 1T5SA 3F5SA 3ZJYA 1IATA 1U5BA 2QRGA 2P4HX 2YFYA 1XKLA 3GLIE 1OPRA 4D8TA 4FFWA 5A05A 3NBUA 4RSRA 5SY4A 1PT7A 2AI2A 3HDGA 3TZKA 2VDWB 3NBQA 4UVHA 3TLJA 1LDBA 3LYAA 2C9OA 1PNRA 2ICAA 3NRBA 3UGKA 4LTMA 5T64A 2GPNA 2QRLA 3MAAC 5A7HA 3ZZ0A 2C59A 3DEIA 1KIFA 2Y1DA 4HXGA 3KQVA 1YAHA 3GRYA 5JAQA 4Z3OA 4IH9A 3CR8A 1DQZA 1ZRNA 4KDEA 5KOJA 3KL4A 3UT5B 6AT1A 2XXAB 2ZWAA 4HB0A 2D5CA 3KS9A 3QUCA 1RR6A 1E2MA 3KCNA 1QGED 3KJZA 3NTOA 3VPHA 4LUCA 4DC9A 2AZXA 3O4IA 4PC6A 3R7LA 3N8IA 1U98A 1K7CA 1KDOA 4BFUA 3U1BA 3USES 4PY2A 1Z6TA 5EHGA 3YASA 5FUMA 3AETB 1QHGA 1UWLA 3TQOA 4QYTA 2WSSD 3AIKA 1J1IA 4BFWA 1C29B 4ETWA 2PZJA 5AHXA 1W0JD 1PG5A 2IYAA 4LNUA 3VYVA 1N7JA 4PYLA 4BXOA 4JLAA 1T0IA 3IMFA 1I9GA 3MG9A 2XCQA 1RIFA 4LJ5A 1V9CA 2I4RA 2N0SA 2Z3WA 3PYMA 1AHHA 2V98A 3GZJA 5KHAA 2YWJA 3DUWA 1X7WB 1UJ5A 3BHNA 3C3KA 1R8JA 5BN4B 4CF3A 2R84A 3DL0A 1KRXA 3AP2A 4IVNA 3TLXA 1DJLA 5EJ4A 2FN3A 4TKMA 3KQQA 2VHEA 3GZNB 4UTRA 2B6NA 2QRHA 2W9XA 4DEYA 3H2ZA 3TQIA 3HXPA 3FDJA 4RK4A 2P0AA 4NBVA 1N6NA 3N2KB 4XIFA 1CUXA 4ZOBA 4CXMA 3BB1A 3PFCA 4TKUB 3C1OA 3F71A 4R9VA 5EIBD 3AFGA 4GYWA 2QXUA 3HC7A 1BMQA 4TZTA 1S89A 1U7DA 3OZRA 1D6JA 1GTL1 3AEYA 4J76A 2X3UA 4AVYA 5L6MB 3ICWA 2X0EA 5AK4A 4NU6A 3QLUC 3DMDA 1K6EA 2X3YA 3DV0A 5DXFA 2NO1A 1VIAA 2CZCA 1LUAA 4CM8B 3FLAA 4G63A 2V5AA 3D43A 1IPHA 4Y6RA 3TE7A 1F0NA 4Z1OA 1C9NA 3QH4A 4IJUA 3AIOA 4M1YA 1QHHB 4M2LA 4BO2A 5E3HA 2ODTX 4TMWA 2E7ZA 3H1EA 4D8XA 4EFDA 3SQOA 4AY5A 2PLWA 3A6KA 4E21A 5B1EA 2PSHA 3NP9A 1GQOA 2VLIA 4ALLA 2WIGA 3GBSA 1CF2O 3AR6A 3WJ1A 1YRLA 3WAJA 4US2R 3F98A 5EP4A 3HYCA 3T0GA 1MLDA 1SHUX 3OCWA 4MUJA 4URHA 4PN3A 1YIDA 3G0BA 3HVUA 1NLMA 5CGQB 1OD6A 3JR3A 3RVLA 2DUWA 3G0GA 7GPBA 2H9AA 1KI6B 3BK7A 4BIMA 3COSA 3OE7A 4DSOA 2F59A 3IQIX 2WD8A 1DINA 4G0NA 2GO1A 4OU4A 4RENA 3TSCA 5K99A 3P5BA 4W8GA 4RBNA 1PF7E 2I65A 2CEKA 4G89A 4MP6A 1ULZA 1X8KA 4OP1A 2H48A 4FHZA 1K98A 4A26A 4A3SA 3AM3A 3I05A 5CPBA 4B47A 2FEPA 2IY8A 4JA2A 1AQ6A 4ZANA 5CIYA 2GM3A 1Y82A 5EIXA 3OTIA 1W36B 1Q21A 1H4QA 2PANA 1XQVA 4M1SA 3IJRA 1TMKA 1GV1A 3G9ZA 4J0JA 3KPUA 2JJQA 2VDVE 3CVXA 1LQ2A 5I9MA 2I6TA 3L1KA 2XQIA 2QN6A 3ELDA 1W30A 4I99A 4X84A 3U7FB 5KQLA 1P6QA 3O94A 2BZ1A 2R6FA 1QE0A 1T2FA 1VBKA 3PNLA 1NKTA 1X0XA 2AMYA 3D7KA 1P1HA 1VG1A 1WCYA 3KNZA 3PWZA 4ND3A 1JEEA 1X7DA 5EWLA 3GNSA 5LYJA 4LW8A 3OQHA 3UAVA 2FW8A 3WMWA 3WMGA 4DV6B 3U4IA 3LMKA 3I52A 4ZCIA 1OV4A 4ZJUA 2RC5A 3DCIA 1UWKA 3P26A 2J0UB 4CKWB 5DHTA 3WQRA 4BP1A 4W63A 3C6KA 3P0EA 3L02A 4H4EA 5L3QB 4X0EA 5FI0B 4LN1A 2HMWA 1I30A 3WRWA 4XWOA 4DWOA 3IDZA 2CHQA 2D1TA 2K87A 5ESRA 4RPCA 4DNFA 2GM9A 5EKDA 3ESZA 1EWQA 4DMCA 3AJRA 4E1VA 4BNXA 4RACA 4B8YA 2R6DA 2W6IA 3IHKA 1I2BA 4XYMA 3OAAA 1D0IA 4YJGB 3KX2A 2VTKA 4IRUB 4XSGA 3RV4A 4BGUA 2QZJA 4DANA 3FTEA 1VFNA 1PJRA 2WWGA 4FTWA 5K3SA 1SELA 2VYND 1Z88A 3WWCA 1OWMA 1C7FA 3UHAA 4CE6A 1QS0A 1BS9A 4FGJA 2ZIWB 5D5QA 2X3FA 2LGJA 1HEIA 5KAPA 5EZ5A 1H4TA 4CGZA 3HYTA 3FWKA 4X92A 1FB5A 1E5DA 1Z0IA 3INTA 3LP8A 3GHHA 4P22A 4V0KA 4O2AF 4XGIA 4YAWA 3SC2B 3TW0A 3ZQ4A 4CUZA 3LGXA 1I51A 1VCMA 2OV4A 1J2EA 2TECE 3EEFA 4HWPA 2XVMA 4J0EA 3PLNA 4QEKA 4QVKA 4W9RA 4E1BA 3LX4A 2YW2A 4R9RA 4AW9A 2ABWA 3AETA 4FFPA 1E1RA 3R6TA 1E1RD 3RIEA 4A8HA 4YRMA 1Q14A 1U31A 1R0ZA 1ZU5A 4OQZA 4UEWA 4YRRA 4CL0A 1W0KA 2QDXA 3OJLA 4MUNA 2K5UA 4N3NA 2OV1A 5FB3A 5AUQA 1WXWA 2J3EA 4HDMB 4JLNA 4FSXA 2C7RA 3ENKA 1TECE 3THWA 4URFA 3O84A 5EIFA 2B34A 2KLBA 3QEBZ 3MGCA 1ARZA 4MOWA 3T9CA 3JZMA 1QGUB 3DSRA 4MJ7A 3KT8A 4NR0A 5B3JA 2H0RA 2G1PA 3QPBA 3SS7X 3HA2A 4U2DA 3U7RA 1CJUC 1O94A 5FEMA 4DR1B 4IFBA 4KFSA 4S24A 1U2DA 3E9RA 5LXTF 4L08A 2XCOA 1GZVA 2R1TA 2XUGA 3GLRA 4DKJA 1XTJA 3DOOA 3NKLA 3TS1A 1ACLA 3FHOA 1TIBA 1UZAA 5E6UA 4LJ7A 3IAM6 4N40A 4QYIA 2VPPA 4BO5A 1N9ZA 3AERB 4GR4A 4G5YA 1GPLA 4FOLA 3CF4A 4B81A 5FHRA 5EIAA 5HJ2A 5F77A 1U3FA 3PL5A 4J03A 4H77A 4YMSA 5AM4A 4X9XA 4F6LA 4OIFA 2AFIB 5KTKA 1WUYA 1XZJA 2VCEA 4FQ8A 1H5UA 3DGFC 4G8DA 4FYXA 3C3WA 4PSDA 4Z4FA 4LZLA 5DYIA 2Q1TA 2EF1A 2KYRA 1Z5WA 4KLZA 2B6HA 2DQSA 1TZMA 1K6JA 2E2WA 4TS4A 1PK8A 3B6EA 3UA4A 2HT1A 1NNLA 1QDUA 2X6TA 3WK7A 4F5WA 3RD5A 6Q21A 4ZMRA 2ZPTX 3NJ4A 4LOIA 3EIEA 4EBFA 5KI6A 1H05A 5LLDA 4RK5A 3PE3A 3BHJA 2DX7A 2X2OA 1K7EB 1LWNA 3ENVA 1QYXA 2HDWA 3LPAA 4FYKA 4R6XA 3TZHA 5GV8A 2G77B 3S7TA 4K9QA 4C2BA 1AV6A 3S8MA 4M1EA 3UF0A 1NRIA 3WBFA 1NXXA 1KPIA 4KQJA 1ODFA 1I0IA 2XPCA 2CDNA 2RHJA 3Q6IA 5A6VA 1XE3A 2DAPA 1I7NA 5BW6B 2PXAA 1VJ5A 4YPFA 2DBZA 5F2EA 4GVXA 2CFOA 1C0KA 1K88A 2O4CA 4LBZA 4UHDA 2CNKA 5REQA 4AK9A 1PGPA 4UBOA 3RS7A 4NECA 3RW9A 4B3CA 5KPDA 1TVMA 2HR1A 4D0SA 2FQ1A 1R6TA 1RRVA 4NFHA 4BBAA 1EDEA 2FLWA 3B2EA 4RHCA 2QV0A 3RSOA 1ECPA 4EYGA 2O8CA 2Q8QA 5CM9C 4DWJA 4DNQA 2DERA 5IAJA 1XCLA 2I4NA 1KEEA 4EHFA 2WTNA 4AL4A 4B0OA 2NVUA 3QOWA 4RTOA 2FN9A 5JNRA 5M7EA 3FXAA 3QITA 4AJNA 1ZJ5A 2RKBA 4HDCA 4NENB 4B80A 3SWWA 2JAHA 2M9MA 3A31A 3GDHA 3B70A 4KP7A 2ZIFA 2C7GA 1A27A 4QXQA 3PBKA 4A2PA 3DLHA 1KKUA 1M2OB 4ZYWA 4IKOA 1CRPA 4KJXA 2C3YA 1YBAA 2FQYA 4NE2A 3FKJA 1KFBB 4DV0B 5CB6A 3PFWO 4NJMA 1HE3A 2ODAA 1MT0A 3WWOA 1M5UA 2ZRPA 3CM0A 3N8HA 4MVJG 5CGZA 5CHYA 4GPIB 2VZ9A 1NVXQ 2ZAYA 3LUFA 3LKDA 4V0OA 1CP2A 4KO3S 4YWJA 5JD6A 1CUBA 1JKJA 2QMQA 1LPBB 3VVMA 2QW1A 2QJFA 4YXWD 3L4BC 2J4DA 1RQLA 4MWZA 1M2GA 2PY6A 2IH2A 2GTHA 1UOPA 1JLLA 1ZGCA 2IHUA 1G1AA 2QOEA 5F3DA 1G5HA 4R16A 3P32A 5EJ5A 4NJEA 4F4CA 4H7DA 1ZOOA 4KR7A 4KL8S 1DI0A 2D62A 2WV7A 2ETXA 1NYQA 3KKPA 4MYSA 3PQFA 4TRJA 4UUMA 3SQNA 1QF9A 4PSAA 5A3RA 4ZZIA 4YQYA 1PHPA 1WBBA 2JIZA 1N2EA 3UMRA 4QPNA 1E18A 2CF5A 2HBRA 1XTPA 3C6MA 3CRW1 2RAVA 2YYAA 2X4IA 5EMMA 4ZDKA 1R4AA 3I9JA 1M6YA 3ED1A 5AM3A 2D2IA 4LGYA 5HDQA 1HURA 1SQ0A 4OIMA 3FFXA 1XTSA 2V3VA 3STWA 1L7EA 1N77A 1RTTA 1YI0A 2GDZA 1G8YA 4MB0A 5FI5A 4Z2YA 3SXPA 1A9SA 1FRQA 1XJ0A 1ZJ6A 4V2IA 1P39A 4M7WA 3N2GB 4KDCA 5I5GA 3D3WA 4PFJA 1W76A 3JQAB 3UEOA 3VSCA 2C83A 2GBIA 4R01A 4Q12A 2L82A 4IHJF 4NMXB 4ZTBA 4LKOA 1ZQ1A 2B1IA 3FR8A 1P2FA 3MS2A 1Q0QA 3TSYA 5JW6A 1L7AA 1WB4A 1DJOA 2VDLB 2PUGA 3TDKA 1FUYB 2J1LA 5BORA 1ZM3A 1L8XA 1MJHA 4REMA 1V1MA 4Y1GA 4AY4A 4BPRA 4XPZA 2JCBA 4PFKA 2QRMA 1MAAA 2GF0A 3ROEA 3HUFA 5C8YF 3HWWA 1AUVA 1HZZA 2AUTA 2VDUE 1YS4A 3HZHA 4LWOA 4LVCA 4M3NA 2V0GA 2VTVA 1J2TA 2E4WA 1I3MA 2QL5A 2G8NA 3D3QA 4IEFB 1XEXB 3HJAA 3TXXA 1XEWY 2ONJA 3E03A 4QU5A 1K92A 5B1YA 4E2ZA 1PJQA 4ITRC 1T29A 3Q7EA 4WASA 3AQ4A 3OOYA 4NZMA 3E3LA 4B4OA 2C9DA 4B2IA 3GLTA 3I8OA 4NZYA 4M21A 1TVCA 3MJFA 4ABYA 2UUBB 1YHZA 5K0FA 1ZOLA 4EVSA 2BI8A 1NFQA 1F17A 3CUTA 1Z8HA 2BUBA 3AERA 4C88A 1VPVA 4G36A 1ZCAA 2JBAA 2YWEA 2EZUA 1M2EA 2JD1A 4K6HA 3HVHA 4XWTA 5TMDA 1QH9A 5I7FA 3T0FA 3GVCA 4YV0A 1CDEA 3HCOA 3IAAA 4ZO4A 3WAKA 1NBME 2O8FA 3ZKAA 4YECA 1O4VA 3LWDA 1T5DX 4X24A 3T7KA 1V7PC 3BE6A 4BLVA 4D44A 2Z56A 1JWBB 1Y8QB 3FGZA 5LZ7A 1QGOA 3Q3HA 5TRTA 1PT5A 3RYIA 5JSYA 1B8PA 3MJEA 2VDQB 3OPNA 5FTKA 5HCIA 2XHZA 1FTQA 3U13A 2BR4A 1XP5A 4XRGA 4ZOLB 1T2EA 1OX4A 3E2MA 2HQRA 3QWHA 3FRIA 4MB2A 5DRTA 3C7CB 3AKYA 3CNQS 3TW8B 1PG2A 2X40A 4UU8A 5HG0A 4EBBA 1J21A 1J9EA 1R6DA 3PL1A 2Q2NA 4YRCA 1HNXB 1NJ5A 1N6PA 3FB4A 4E3WA 1EP3B 4Y2PA 3IR6A 1OREA 4YAEA 5CDHA 1VPTA 1T1JA 3GN2A 3HCAA 2CXNA 1GY8A 1SVSA 2CLMB 2G7ZA 2YBEA 3KZMA 1FMCA 4G4JA 4XM2A 3WV4A 5KYKA 1BD3A 3LQYA 4F38A 1C3EA 1FC0A 3FLEA 3RUCA 5IDWA 4AYTA 5BSRA 3IPAA 3U17A 3MSXA 2O2SA 4W7HA 4D41A 3WBBA 1LNQA 4DILA 3E70C 3SX0A 4M53A 3NTUA 4X6UA 3LUKA 1MFZA 4D74A 1AS3A 3J80A 3JQCA 3BH0A 2JASA 3IIIA 2WQ6A 4N4AA 3D8SA 5H16A 4J1NA 4IZOA 1M1YE 3RSCA 2EOAA 2W2NA 3R0XA 4DUZB 3A7DA 4V39A 4DXAA 3JAWB 4EUHA 2I71A 3R6LA 4NG4A 3K6RA 1K89A 1YQQA 4CN9A 4TKVA 5IJXA 1IQ0A 1D2EA 3DDCA 3H17A 3H2SA 1W4LA 3JZFA 3KDPA 1NBOA 2FF5A 2O52A 1E0DA 4HJRA 2WICA 4M1OA 2PX3A 3VR6D 1TU4A 3TKLA 2WE8A 2CNWD 4PZUA 4E15A 1FFCA 1LVUA 2ZR9A 3U7QB 2BM8A 1W0KD 2IY9A 4LCJA 4XWYA 3HVJA 1KMHB 1AVTA 5MN4A 2YQ5A 2QX7A 2CHVA 3QPDA 4JUBA 2Q2WA 1CEXA 4KQMA 4CTOA 1ZVQA 3UWMA 2NXJA 1ZX1A 4Q1FA 3SD7A 4DDHA 3SC3A 1E1NA 3FDXA 5TEVA 4PS1A 1E9RA 1N2JA 2R7MA 4G4SP 3ZDBA 2HSEA 5CVVA 1N2CE 1L8AA 4BOYA 5C18A 5F1OA 4DLUA 1TW3A 2CUTA 2CLHB 4HB4A 5A9SA 3D2LA 1VL1A 5LQJA 1W47A 3GAFA 4Z4IA 4XEHA 4R1OA 1K4YA 5K4AA 3D4NA 3TR5A 3TGPA 2ZYVX 2WAAA 1CYDA 1NDUA 5ECGC 2WP0A 3JPWA 4UZSA 4CM4A 3T15A 5C7YA 1FL9A 2Z3VA 4YONB 2QX4A 3MTEA 3QQ5A 4H18A 3RS9A 4OYHA 2WJJA 4D0GA 4BPBA 4NCHA 3C14C 2QTMA 3VTFA 5AW6A 3H4TA 3KJXA 5J2UF 1Z2NX 1E9BA 2PIDA 2QMEA 1N3IA 1YK0A 3CPSA 3CUEF 4LZOA 2XITA 1JFTA 1HLFA 4FLFA 4KK3A 3K35A 1EVYA 1VG8A 2W8BA 3ORQA 1FZTA 1R4NA 2JATA 5DCYA 2B30A 4JQCA 2IOHA 4MO2A 1G7TA 5B6JA 3K0BA 3O0TA 1US8B 2OBBA 3EZ7A 3O1LA 3HDVA 4X7RA 2PT6A 2R6ZA 2O8EB 1Y6QA 3GEDA 2X0JA 5K0TA 3EJWA 2BFCB 4KACA 2XDQB 1U0BB 4IDEA 4QHSA 3FSEA 4OXKA 3GFGA 3H5IA 1Q7RA 1XAHA 3PF9A 1O77A 1J1UA 3QUAA 3ZJ4A 5IULC 1LBIA 1K27A 1JECA 1JXOA 2BYTA 1V5EA 4X41A 2DPMA 3LTEA 2I3GA 4URXR 2OBXA 4PWYA 4OKNA 4UD6A 5IT0A 4RZQA 3SXUB 5K3EA 4OM7A 3EZ2A 4YRFA 4P2BA 4FPXA 2EGGA 2Q3DA 1RLIA 3KXDA 1NVVR 4MZDA 1OX5A 1FSZA 2R751 3DC7A 3EBOA 4FMCF 1UBOS 2A5DA 2XA2A 1GUZA 4A8PA 3ZCUA 4AZ3B 3U7EB 1D03A 2OGZA 2I4IA 3BREA 4UHFA 1W73A 3G2IA 3IC5A 3MN1A 4FFNA 4WUTA 4DCGA 2JBAB 5IN5A 1QZ3A 1USVA 2JH3A 4PZEA 4LE2A 1OYVA 5DNYB 1SKQA 1TU0A 2O5VA 1FFBA 2FN4A 4JGBA 4GKVA 3MS4A 3EEYA 4GM0A 1Q1EA 4YK7A 3UJ9A 4LOJA 3UT5A 3T5PA 3EXG2 3EGVA 1P9LA 4QELA 5ALZA 3IBTA 5KYVA 3FGPA 4CMHA 2P5SA 1XRSB 1BOOA 4UMVA 1JDBC 2CHEA 4IKPA 3QV1A 4BMOB 3THYA 1CUYA 1T8YA 3DCJA 2QLFA 2FUNB 2ZJ5A 1GP2A 3HJBA 2IWRA 3TRJA 3TJMA 1QYWA 4P7BA 1COWA 4D9NA 4B44A 3W5IA 4EG6A 3GAZA 2FPUA 4N8DA 3FZQA 4CPDA 4JXXA 5E1OA 4BVAA 2A57A 4IIXA 4LTNA 1NLFA 4K8OA 4UTOA 1AOXA 4KCGA 2WF9A 5K1ZA 5BV0A 2Q5EA 2O07A 2ECPA 2QS9A 2CE2X 2B35A 2SKDA 1QH8B 4N5HX 3MLAA 5G53C 1SD1A 1UFQA 3K5IA 4JQOA 2P6MA 1HWYA 3VR2A 3COYA 5BRJA 3OUZA 1VL2A 5GZ1A 1SWWA 2CJYA 5HWSA 4R84A 3T7IA 1VSVA 1KOFA 4J94A 1XRQA 2F3QA 2RCNA 2VKTA 3D0RA 4HDNA 3RSZA 4WK4B 1TAQA 1QRRA 4COKA 1Y6FA 4RTQA 3JXEA 1V7ZA 2XRYA 2EJVA 1K86A 3KR0A 1ECBA 3MEQA 4L07A 4QOGA 1JIQA 3DLCA 3KU1A 2HSGA 3EXEA 1O89A 3SM9A 2G6BA 3L1UA 4RV9A 1UANA 4XARA 2VJOA 1UKAA 4FHGA 1JG2A 3M6MD 1JHUA 1L4KA 2X0DA 3QVKA 2FSHA 1E2DA 2WDPA 1EZZA 4HC4A 4CM8A 1LC0A 2GAOA 2ZIEA 4G1MB 3QF4B 5I7SA 2ZBFA 1N34B 4DBZA 2ET6A 1J33A 3EXFA 1II0A 2F3SA 3CVOA 3FUVA 3PFGA 3PUZA 5C8VA 2FE1A 4J1TC 3V1YA 2V6JA 2ZWPA 1JSLA 5KPJA 2HJVA 2B3TA 2F9LA 2VF7A 2WABA 2NU9A 2FEMA 2ZRCA 1JHXA 3AUSA 3HMQA 3KVNA 3KD2A 4FW8A 4OMDA 2B7BA 4RPHA 2RGGA 5CCDA 4RH3A 3ZWCA 3BWEA 2XNHA 1JHRA 4MUHA 5TQVA 1W0CA 2VHQA 3OPQA 4RD0A 3WYDA 1DJPA 2WKRA 1GGVA 1Z2OX 3FOWA 1W0JA 3W5SA 5LPNA 2KHZA 1XLUA 4QX6A 1TJNA 3JATB 2GASA 2EJUA 5KJ1A 4BNDA 3IP8A 1MA0A 3DQZA 5E9AA 1HC7A 3FZYA 4KR9A 1TTTA 3IB3A 3BL8A 1WS6A 3CLUD 4MYRA 4ZAWA 5AWFC 1OAKA 1UUFA 3MHTA 1RWVA 4N5IX 3RVPA 3EK2A 4LHZA 4GICA 1UQRA 3MILA 1PL6A 3BFXA 4XTRA 5J40A 1NOKA 1Y6RA 2ZDGA 2QT0A 4M8IA 4UCQA 2L17A 3VXKA 3E3MA 5IJ0A 5FNZA 3JASB 4JI5B 2XKBA 1EM6A 2O48X 4AF7A 4YRPA 3SE0A 2WINI 5FJJA 1NF2A 2J5XA 4OCZA 4J3FA 1X9GA 1EQAA 5YASA 2HAEA 5EERA 4D9BA 1Y3FE 2VDKB 4IFTA 4B7ZA 1ZW1A 3B6MA 3CT6A 4L9WA 1OJLA 1Y7IA 4TTQA 3JYQA 4LZAA 3UENA 5KTSA 3D0QA 1QF7A 1UWVA 1T1IA 2LW7A 4HH1A 5EWLB 4CR8A 4EEKA 3LA6A 3NC4A 2WTMA 4UAJA 1QG0A 2I6GA 2IL1A 4G1VA 2WHPA 2JZOA 2ZE8A 5ABPA 5B64A 1HTWA 4LSWA 1H6DA 4Z7NB 3A05A 3HY6A 3EVDA 4J0DA 1GT6A 2J6CA 4Y2SA 4DLVA 5L3QA 1I3CA 3EEIA 2QVZX 5K01A 2WSIA 3OM8A 5FPSA 3IOYA 3RHSA 1VB5A 2WTEA 5C8ZA 2PBLA 3LM8A 1WG8A 4DNOA 3HV2A 4GQAA 3T6KA 3ZI4A 4ESOA 1Y5IA 2OO7A 4PNZA 1BWQA 2NO7A 2W2VA 1W46A 3ZNOA 1Z5NA 4WKPA 3UA3A 2YS7A 2VYVD 3RPEA 1SCQA 5AVVA 3R5FA 4ZVLA 3VR5D 1CY6A 3I2FA 4QODA 1ZG3A 1TVKA 3B48A 3GFTA 1H2BA 2QLLA 4QOEA 5IVDA 1LW6E 3WSTA 3EB9A 4AZ3A 3U3OA 2FKAA 2Z04A 1QS0B 5CM2Z 1HFWA 2DBQA 1YVUA 3OT1A 5AXDA 4YWHA 5TVGA 4B45A 1XCJA 5LKAA 3C2QA 3V4PB 1DBVO 1KDTA 2LP4Y 2Z5GA 4YP1A 3UGTA 1DC3A 5GOTA 3DHEA 4HV4A 4IWYA 4G1CA 1OLSA 2HLDD 5A1JA 4XLLA 3DVSX 3CRNA 1L7MA 1IZ7A 1H6CA 1RTKA 1CY2A 1WIWA 2Q28A 2ZBRA 4WERA 2Y1KA 4XQ0A 3VRHA 4DQXA 3FGNA 2FZ4A 4NH4A 4E51A 1JMYA 5A06A 4DLBA 3DBRB 5E7QA 2FSVC 2P0YA 1U04A 1M2HA 1HT2E 4HATA 2PUCA 1Q20A 4NATA 1KL7A 5KDDA 4RYDA 4A9AA 5JMWA 1EDBA 1ZRHA 1EFVB 3V32A 1K66A 2XADA 3NIDB 1ZI9A 1G3RA 4OHPA 4CMAA 5H3CA 2BZSA 1L4HA 3ON5A 4RA9B 3U6KA 2YHAA 1T6YA 1HKHA 2HCTA 4E4TA 4X20A 1I4WA 1VB3A 5HUHA 2Q0HA 3WP0A 4JITA 1Y6ZA 3UBTA 5IF3A 2WM8A 1OHHA 1PX0A 1WUTA 5ISMA 4KB5A 2C3MA 1QH8A 4LYFA 3WGYA 5IANA 1VGQA 4B9AA 3W1VA 4B43A 5JAHA 4WGGA 1JJAA 5HQ3B 3MMPA 4UFNA 4BV9A 1EFRA 1QGUA 2COKA 1G2OA 2E5LB 4K1XA 4UJ3A 3H5VA 2IH5A 4M36A 5AKHA 3SF0A 2VRWA 1O6FA 1RAFA 2IHTA 3I01A 3W5AA 8ABPA 2VHXA 5IAGA 3O2SB 1W85A 2HU7A 5JALA 2FPPA 2M2IA 1ZK1A 3DKVA 1EB8A 3CZCA 4YRDA 3U37A 3MRTA 3G5TA 4Q0MA 5D1NA 3FE2A 3LRPA 1JHZA 1TDJA 4UUAA 5IJAA 3PXAA 1WUIS 6NULA 1XXHE 1U81A 2BF7A 1K7SN 2Q3EA 2V7BA 3BMXA 4LI3X 1FSSA 6REQB 3WRYC 4MDEA 3W4KA 1FYEA 3WNBA 4C6TA 3OZXA 2YHIA 1KWKA 4LBYA 4TZ6A 1W36C 1QB8A 2DPLA 2ZRKA 3AO0B 4WAUA 1VE1A 3TNFA 4LNHA 3QX3A 1NR7A 1EBUA 4QSMA 1J1ZA 3CU5A 4TUYA 1C7IA 2VOJA 3AHGA 3V2GA 5KYXB 1PVDA 1U2ZA 3ANNA 1T5OA 1C1DA 3PDCA 4IUBS 4UTZA 3SR4A 1CVLA 3H0KA 4AIRA 1TPYA 5HF5A 3D3KA 5BOVA 1MHPA 1JQBA 2R2GA 4P4LA 4JXJA 3T7CA 1B15A 1XXHB 3W34A 1E1QD 4R3NA 1LSOA 3BTOA 3MELA 6YASA 1J7KA 2G4LA 1X1DA 1DZ3A 2FJUA 3L8YA 3ZQUA 2II6A 3RKSA 2P8SA 4NMLA 1DWQA 1U8AA 2NTYC 3K1JA 1M1YA 4Y6PA 1G5IA 3D59A 2UUOA 4L16A 4BWVA 2PR2A 2ZYTX 3O3MB 4B3DA 4JJEA 4ZAZA 3C3XA 1JBKA 1G6OA 4M8KA 4ZHQB 1DQPA 1J2UA 1N2IA 3RIMA 4YTEA 3RNOA 4C2AA 3V1MA 1P2VA 1VRCA 3AG6A 5GJBA 2WILA 1U8ZA 3EIXA 2HA3A 1HEYA 1PU2A 4I3FA 4JKYA 2QX9A 5L3RA 3RV3A 4W6QA 1V45E 1NL3A 1Z7BA 4NENA 4BMCA 5AI9A 4HLUC 4M9SA 5ED0A 3S2IA 4F1WA 2O5CA 2O8BB 4JLUA 4DDWA 3O6VA 3RSGA 3TBHA 1YA8A 4IDAA 4PSUA 5DNUA 4RTLA 3H1BA 3G68A 2ZVQX 4KVGA 4LJ6A 4EVQA 4G0VA 4C0KA 1L5YA 1H5QA 2VAMA 4JGGA 2NYUA 4MPTA 1OLOA 2QBYA 4TX1A 4YJ3B 4RADA 3JV7A 1C30B 1PGOA 1IZZA 1QVWA 3X1MA 3UO8B 5CX1A 5HGJA 2PH3A 4CI0B 1AUXA 1BU5A 1ZD9A 3KDAA 4PR0A 2PX4A 2ZWMA 5BYBA 4CM1A 2D2EA 4HZUA 2CMGA 5G1PA 3E5HA 3K6JA 4DWWA 1B2LA 1P0QA 5LB2A 4TWJA 1I5OA 4II2A 4L4UA 4EJ2A 4F12A 2AQHA 2YJNA 3INGA 2ZB2A 4RH0A 4RAQA 1QQBA 4DMKA 2DRIA 3ENWA 2J7KA 4FMCB 4GECA 5KKNB 3DT8A 1JHOA 4KJZA 4LDPA 1L4YA 2E4XA 1QHYA 1EJBA 1GXSA 2B2XA 2LPMA 3A1CA 2H4HA 3EVZA 3MD9A 3HA5A 4FNAA 4M1WA 4KQKA 1MEOA 3GCXA 3K2BA 4IGEA 2Q6KA 4FZVA 4JU9A 4MQEB 2JI9A 4NBLA 1Z6XA 3DWGA 3ZWVA 4RTJA 1H1TA 1TT5B 3ZGYA 3QENA 3WGLA 4D3FA 4JI3B 2W6ID 1NI4A 1QVZA 1PVOA 2FG6C 3DOJA 3RTBA 3U80A 1KA9H 3IBYA 3ZZ1A 3HB5X 2CLDX 1G9XA 4HXFB 2ZEJA 2Z5LA 2LIVA 3WAGA 4U5XA 1G8HA 4DV1B 1MR3F 3AUJB 4Y2JA 2VZ8A 5T8KA 3DTNA 1DBSA 3KB8A 5EIHA 3S44A 1QANA 2HPHA 1H2WA 5IMBA 2CKMA 3V4VB 5BY2A 2BBTA 4FMDB 4R6WA 4C9BA 1SUAA 5IC6A 1GAEO 5KYWB 5BNTA 2QTRA 1U99A 1N6LA 1FDIA 2JGFA 3G82C 2JCGA 3JWIA 3T3DA 3CUYA 2PKXA 4KHPB 1U02A 2OFXA 1TCUA 3G2QA 2G5CA 3LWNA 5A1TA 2FW7A 2MHCA 2FPXA 3HK2A 5DNVA 3UFBA 4E7OA 2IODA 3WB0A 3GJRA 3HLYA 1NW3A 2CFSA 2G06A 3X3HA 1T3HA 3FVWA 1XEXA 3IEUA 2NUTB 3QVSA 2HJGA 1Q22A 3U44B 4PX3A 4C7VA 2FHSA 1ETUA 1RHMA 3A9CA 2RBKA 2ZU6A 4C0BA 1ORDA 2ODEA 1DAIA 3A37A 3F74A 4QWWA 5DNDA 1RYZA 5IVKA 2MINA 2XX3A 2H11A 5B58C 5SYAA 1NRXA 3BRCA 4NYMR 2BM0A 5JNSA 3T1HB 1EGMB 4ZQFA 4KR3A 3E15A 1K6XA 3WLMA 4A23A 4JODA 1EG2A 5JDCC 2A5FA 1A82A 2Y68A 5FTJA 2PS3A 2ZBUA 4L02A 3SC6A 4M98A 3TGLA 3GJ6A 1VL8A 1GZDA 3L9WA 3ZHUA 4LDRA 2P9TA 1H9AA 1RI4A 1N1EA 1EKXA 2Q3CA 3E4DA 2A3NA 2ZT6A 2PV7A 4L57A 4LHVA 1QHEA 2P65A 4N47A 5JADA 4F9FA 4U2CA 4ZALA 1CY0A 3KQUA 2A0XA 2BMEA 3BRQA 3KQPA 2Q3FA 4IS2A 3TSAA 5K4GA 1IJEA 4FIZA 1AA6A 1U2DC 2JCXA 4D9GA 2AN4A 4TUYB 4XM1A 4TKZA 4HNVA 4REQB 2PMBA 1EX7A 1THZA 4ZOLA 5EQDA 1JDPA 2W0MA 3NIBA 3RT9A 3I5UA 3W0LB 2HLNA 2PJRA 1KJNA 3HCEA 3U26A 4YV2A 1G8SA 1THMA 1Y3AA 3T1VA 5KOHB 3BUSA 5EVJA 1RZUA 1XXHA 2WQ7A 4DGQA 4R51A 3DOEA 5F2OA 5F5XA 4MUGA 1UBKS 2R7LA 4A0HA 2BMFA 4G0MA 3RRFA 4QFMA 4HLNA 4LX8A 3BIXA 1IWOA 4LF8B 4YCCA 1YDFA 1E4OA 3CEHA 2CVOA 2WIJA 3CTPA 1KYVA 1OH8A 2ZIXB 4MHSA 2MSCB 4MV8A 1T3GA 1PNOA 3MWLA 4E31A 1QRUA 3NETA 4X1YB 4MARA 2PPLA 1TK2A 3BN3A 3FZNA 1EK2A 1RHKA 3G7UA 4BJ1A 3F9IA 1Z0AA 4K7JA 1YULA 2GT1A 3FYUA 1IAVA 4IL5A 4RXTA 4Z3KA 2X5NA 4XE5A 1L6RA 1SXJC 5C32A 4QDUA 4IH1A 4CG3A 3U5ZB 1WXEA 3U48A 4PZYA 5H9VA 1PUJA 3ROTA 3G6WA 1NVBA 2Y1EA 5HKAA 1QE5A 2Y92A 3CZ4A 4GLLA 2R6CA 2ZJ6A 2JJ8A 4RVNA 5ARDA 2EYQA 3JALB 2WYUA 5EIBC 4CQJA 3CNEA 1JXQA 1RE1A 3L79A 3VDQA 4IIEA 1R37A 3MSCA 2VF4X 2DBRA 4Y2XA 3CZMA 1ZR4A 4KQGA 3G1WA 1KQOA 3GRZA 1NXWA 3HADA 2P2GA 3DFKA 3ITEA 3GFOA 1WMBA 2PX6A 5LU8A 2QZ9A 3JVEA 1KJ9A 1T9HA 3GBPA 4WH0A 4TN5A 3GZ4A 3WYCA 2ZVJA 4WE3A 4DS3A 4KGXA 3QWBA 4R3WA 1U2RA 2H7XA 1Q3KA 1Z08A 1QGYA 1YR6A 5JCJA 1FBTA 2CN1A 2WJPA 1ISJA 4O4JA 5D6OA 5FO1A 4MRPA 1YS6A 3ZWQA 4BFSA 1JEJA 4DIDA 2FMFA 1X19A 1X3SA 3PYXA 1KDPA 2JGKA 3FTCA 2A0YA 1Z0FA 4D0NA 3CNBA 1M8KA 4LWPA 1I24A 1BNCA 4MW0A 2GO7A 3EF0A 1SG9A 3F9RA 4EHJA 3CIOA 1BO6A 3AINA 3TLGB 4F6RB 3L1HA 2TYSB 3EXAA 3V1LA 2Y6VA 5A5EA 2DLCX 1AUQA 3ZWNA 2QZSA 1A9XB 5DOVA 4OHYA 2VH1A 4ZARA 2XA1A 4CETA 1XPRA 1F4LA 4JEIA 4L2IB 2LTAA 1IBCA 1GL7A 1SD5A 1QIHA 1ZD5A 3GNTA 2QI9C 1ZJYA 3B1FA 3H1AA 3HBAA 1V11A 3TSWA 4LGVA 4F0JA 3O7WA 2C98A 5ALWA 3B13B 3V1KA 1HDIA 1PFYA 4IXNA 2OM2A 5EMKA 5AXBA 2BP7A 2ZQ5A 3BA1A 5AHWA 3WK4A 4YCSA 2AJCA 2JKVA 3G0CA 1ABEA 4RC9A 1G291 1L9KA 2C2GA 4IAOA 3UK2A 3PVCA 5JIBA 1QH1A 3SHOA 3EVEA 2QTGA 1QHIA 4HDOB 4V03A 3O2JA 3N7AA 4AO7A 2BW0A 3HFRA 2BFCA 4GOND 3PITA 1YVPA 2ZZMA 4DMMA 3C5EA 4Q1BA 5FTNA 1Z6AA 4M1KA 3RVKA 1KZ7B 2PZ8A 2IEIA 2QQFA 4QPZA 3I9NA 1RPZA 2H1FA 3PXXA 4IOKA 5EMJA 3LD9A 2CLCX 4LHSA 3FIJA 5H3HA 1OV6A 2COUA 2QN9A 1WWKA 4LY9A 4TL8A 3T9FA 4OLJA 4FNGA 3QY9A 1AKQA 3SC4A 3LQ4A 3VPGA 3E0QA 1C3VA 3E9QA 4Q1VA 5D7BA 3P9IA 4ALIA 3DD5A 2DFVA 3IEIA 2PX2A 2BGGA 2OZLB 1FXSA 1N8KA 1RYDA 3KOWA 3RT7A 3WNZA 2IE0A 2XUJA 1IL0A 3EF3A 2FSUA 3BD8A 1JG3A 1KGDA 1UXJA 3DMGA 3G5UA 3O93A 4M83A 2PWBA 3VJLA 4BO6A 3JYLA 5F76A 4ZKEA 5CDUA 5I01A 3RBZA 4H2DA 1CZKA 1IHDA 1VE3A 2K6GA 2WJIA 221PA 3CH6A 1WU7A 3GD5A 2G0NA 4WSOA 4BO9A 4KO8A 3KR2A 4HFJA 3D4OA 4IQFA 1CD5A 1PW5A 1QUEA 1XZHA 3AFMA 3FCEA 1EEXB 1OT3A 3EW9A 1L5LA 3O8NA 2AW3A 5FBLB 3D6NB 4M1ZA 4PQFA 3IV9A 4C2UA 2QJTA 2PRZA 4OLAA 4EGCB 4CKCA 1CY7A 2RI0A 1IMOA 3H1PA 4YC7A 3D3NA 2PTHA 1RKUA 2PKRA 4OB6A 1BXGB 1VSQA 2JGDB 4BC0A 1I80A 1S2DA 1HK7A 1WQ1R 3RYTC 1OBHA 2C2BA 2YXBA 4G97A 4TWRA 3U7HB 2AT1A 1HF3A 1NUUA 3CEPB 2KBFA 1ZMOA 2XUDA 3DMPA 4NH0A 3E0XA 4PSVA 2MYPA 1UBNA 3W6OA 2XE8A 1MAWA 2VPIA 4K9MA 2GFQA 4OK5A 5DT2A 5BN3A 3AKCA 2HKIA 4PAMA 4ZAYA 1NULA 1RWWA 2W2KA 3K0AA 1QNLA 3LPMA 1CETA 4ZIRA 3RVQA 1VHLA 4U2FA 1G66A 3PRYA 4HDNB 5AMXA 3TAHA 3ZBTA 3S2GA 1U9YA 3OBIA 1E0SA 2OY0A 4NESA 3UCFA 1I2DA 1IBLB 2X77A 3ANTA 1RC1A 2JGEA 3RABA 1FYXA 2H8KA 1DL5A 4RAOA 3DEKA 4CIYA 4IUCS 2WWIA 5AW0A 2V8OA 3LKVA 2VHTA 4FSHA 4H35A 2OENG 2EFJA 3C74A 3NQ41 2ZIAA 1IY8A 1HDXA 2REQB 3GAAA 1Z39A 3IIMA 4UARA 1M0WA 3L1JA 3FDFA 5E7MA 5CA1F 4G0QA 3K8QA 5H4GA 4PHGA 1OAAA 3DZBA 2CJWA 1G5RA 4W82A 4A7PA 3A14A 4EITA 3PXEA 1YI1A 4B3HA 3QBTA 1TTHA 1U9CA 2B99A 1IY1A 1DX4A 1E2KA 4AMUA 4YAIA 3IT3A 4L4RA 3FF4A 1HH4A 1M6HA 3HLKA 4RTPA 2VUTA 5LQAA 3TZBA 4TRNA 5AKZA 4IJQA 3S2ZA 2HCRA 2ASVA 3ZC3A 5HTOA 1BH2A 3CB2A 3OKFA 3GN1A 1EJ6A 4F11A 2F8TA 1G6HA 1FS5A 1J20A 2RH5A 5AOVA 2OXTA 1T3LA 3TFWA 5ETJA 3REGA 3RS8A 4UCWA 2IUEA 2OD7A 3QMVA 3W05A 3T94A 4I50F 5K0NA 4DWVA 3FG9A 4L9RA 4KUGA 1T5LA 2VJDA 4HT3B 4BCBA 4PG5A 1QPZA 3F5QA 3KLMX 1DV2A 3FTQA 4MMYB 3RO7A 4B7AA 4QXMA 2IC5A 2A5YB 3VR5A 2RGCA 4Z54A 1A9XA 1FPMA 1EWRA 1AQIA 3FOAA 4RF2A 3T3HA 4E07A 4IDQA 1OZAA 3HFSA 5DTQA 4UTNA 4CQNA 4RVFA 4KLCA 5D3MB 2M6RA 3JQ7B 1JQ5A 2Z6VA 3L8GA 2WB2A 3MCAA 4DG5A 5CLJA 3G5LA 5IWAB 3DMFA 1ZITA 5CJPA 4NU8X 2HJWA 1R8QA 2B98A 1ZUNA 2VPWA 2YXEA 1HT3A 3HH8A 5FXMA 3SR3A 3OFJA 5HUJA 1XPOA 2VJMB 2Z43A 4FZJA 1DKQA 3UYKA 5IUJC 4R71A 3E8MA 4WA8A 5K7SA 2HZ7A 2B36A 2IYUA 3QE9Y 1N5IA 2F1IA 3LT2A 5KU1A 1S96A 3HJRA 2ZSHA 4NARA 4QREA 5ALHA 3LLUA 3URMA 3VZCA 3M1IA 3WGOA 4CM9A 4X6LA 4AIIA 2VF5X 2P4UA 3FAKA 5JAOA 3NFYA 1KYQA 3T3PB 1BX3A 1N6OA 1JSXA 1G16A 2EAUA 4P58A 5EP2A 4DRXB 5CBPA 2XBMA 3O9ZA 3QSYA 5HCNA 4JJ6A 1BE1A 3V9AA 3QU4A 2B8WA 1GSOA 3KYBA 3R5HA 4XB1A 2OZKA 4PPNA 2YWBA 1CQJB 1RAAA 4BKUA 1DAEA 3CRQA 4GYJA 4C4ZA 4KYVA 1TVKB 3JU3A 1OUMA 2P40A 4M9CA 4IQGA 3WRXA 4JOBA 1BQ3A 1Q1NA 2HFKA 2QUZA 4CFYA 2QAGA 4QARA 2YWHA 4PLWA 3GA0A 1UKEA 5I9LA 2B9EA 1N2CB 2BKVA 3EDOA 3FNBA 3K8OE 3PUIA 5A4IS 3WB9A 2I3BA 2BCGY 2P30A 2QP9X 2ZSDA 3H6GA 5FOXA 2AXNA 1QONA 4FXPA 3MGBA 3O8RA 4LYHA 4ZT2A 2A9KA 3UVEA 1Q7GA 1H2ZA 5B57C 3NGXA 4NONA 2ODQA 5G1NA 4K9OA 1RU3A 2BL4A 4OQQA 4V0MA 1L1EA 4BMNA 3CTMA 3INYA 1YBVA 3PVZA 1KAHA 3ROZA 3SQLA 3I72A 1HRDA 1U8XX 5AJTA 3WJAA 1N3YA 3WTBA 1A04A 2X8BA 3AK4A 4FYMA 4LJYA 3DZFA 4LC9A 4K6GA 4M37A 5BYAA 2MYTA 3WADA 3W5CA 4C6SA 3W3AH 4PS0A 4EM6A 1A4IA 5JEDA 1D6SA 4NS1A 1D07A 2P7IA 1U80A 1Q12A 1RXUA 4LNUB 4NDAA 4RD1A 4Q9JA 3ZD9A 1B8UA 2POQX 5JNWA 2JLXA 4BE7B 4EUFA 2GN1A 1SC6A 4LF6B 5IFLA 1PL7A 3H6KA 4PZAA 4DQ0A 3ZIAD 2I4TA 5DYYA 5JSQA 2Q9BA 3OJCA 3VZSA 1KSHA 2P79A 1SXJD 2EKLA 4CM6A 2Q50A 1B26A 1XGKA 2OECA 2V74B 3ESQA 1CR1A 4ZZ1A 2UV8A 3SDBA 2A9VA 1ZIDA 3DW3X 3OJOA 1E6EA 2OAEA 2W2OA 3VC2A 3F6EX 1YZHA 2C5SA 4J0GA 3EGOA 1I6MA 4QTYA 2ZT8A 3D3JA 1LS1A 4J16A 1UPTA 3KAPA 4QJ5A 4BLTA 2H59A 3Q41A 3SYNA 1VHJA 2GETA 5C7OO 1HZJA 3ELBA 4NK4A 2Q5HA 1G2QA 4RCVA 3E05A 2QVXX 3OMWA 5T4BA 3G0HA 1EYZA 2YVLA 1GZ7A 2FYTA 4YJHA 4KNWA 3UFXB 1JQEA 1Y5NA 2GZAA 3GARA 3QE3A 3T5CA 2UXBB 1Y9ZA 4JIGA 1IRXA 1VRWA 2XSZD 4B9EA 1QV6A 3CH7A 3BGOS 1QHHA 3GB9A 4JL6A 4AJ9A 1CRLA 1QR6A 1U65A 3GVPA 1UXOA 2YS6A 3CQ9A 3WZMA 4R8RA 5HTKA 3H4IA 3OA0A 4R2WA 3PEEA 2FZLA 2DHRA 3LO8A 2AXQA 2IZ5A 1C1DB 2XCUA 1LQUA 3C1TA 3LT4A 3QNUA 3SQMA 3T7EA 3ZE0B 3AHCA 3OIFA 3K73O 3UMJA 4OI1A 4MQUA 3LOPA 3S8EA 1XVIA 3CG0A 1YI8A 1VMDA 1M7GA 3DHYA 4M0PA 2BZ0A 2A6PA 1M2FA 2QU7A 3MTQA 4OHRA 4AY2A 4ALKA 4ZQEA 4KREA 2C94A 3WTCA 4NFSA 3CCBA 4MWSA 1E3IA 2O0LA 4MV3A 2EERA 2O7SA 4W5TA 2VL7A 3PWKA 5EGSA 1SKBA 3VC7A 3E9CA 3DMYA 2NZVG 1RACA 3LX6A 3NNDA 1WXGA 1DKRA 1UEJA 3OFNA 2GJ8A 4UAGA 3CW8X 3WLHA 3MUEA 2YASA 5HGXA 2YN4A 4I4TF 1P8JA 3TO5A 4A2WA 1SHTX 4RQTA 4RY9A 2PFKA 2F1JA 4CFSA 4BDSA 1A9TA 2IRWA 3PFKA 3CPEA 1FXWA 2C8JA 1W2HA 2FW9A 2ATXA 1BGXT 1U0JA 1TNDA 2B1JA 2R5FA 1OBFO 3H2BA 4FU0A 4JLKA 4YCAA 2OCGA 4ILKA 3VC1A 4EY6A 3HHPA 4FDMA 2PUAA 3I30X 1AN9A 2I7TA 1FSGA 2VWQA 3I34X 3VNRA 5L4SA 3AM5A 3CINA 3F5FA 5LYJB 1IJKA 1P4HA 3EC7A 4BYGA 1TCVA 1JKIA 1QKKA 3Q0EA 1YACA 1M54A 4PHCA 3DMRA 4IIFA 5KYTA 5E4FA 1CJCA 4L9AA 2HDOA 3BE5A 1JG7A 2VDJA 3I92A 3ZWBA 3IELA 1NKVA 3BIWA 4CQLB 1YZTA 4RTMA 1RZ3A 2OHXA 3QG1A 4DB4A 4GOOD 4ND5A 4CTMA 3MFQA 4MR7A 5I7AA 3VZBA 1IUNA 1EZ1A 3GCZA 5CBPB 4TYMA 3TD6A 1XG5A 1LSSA 1I7SB 1RW4A 4J75A 1ZL2A 2M1ZA 4RZIA 1N32B 4ROSA 1YD7A 4XGRA 3O8BA 2GDJA 4BQFA 1JIXA 1ZN7A 2FUG6 1D4ZA 4Z9FA 1PWYE 2VNKA 4ZPXA 1GXSB 3BCSA 3BJEA 3Q0TA 3HEBA 4K0RA 4QECA 2FWJA 5F21A 1E9AA 3N0TA 4HVTA 3AH8A 3LNTA 5AI8A 1T1RA 1NW9B 1RLOA 3TRHA 4LMPA 4YRSA 4EPRA 3C6YA 1RAIA 3OTQA 3UJ3X 4EUKA 2I7DA 4A8JC 5IJ9B 1F5NA 3EG5A 1KI1A 2R8PA 1L7QA 1IEXA 4DLXA 2EBFX 5F4ZA 3EDCA 2IQ5A 1QBGA 3OPYB 2QTVA 2RAFA 5HIJA 4DARA 3X1WA 3A1NA 1P6XA 1TEXA 4KXMA 1XQ6A 3K5WA 4EB0A 4ZI7A 2QLTA 4JC0A 3STUA 4BVHA 1LTHR 3WK5A 4B3IA 2XOKD 2RBGA 2C9MA 4CNQA 2UZIR 4GO1A 4JENA 4OJQA 1XYGA 5J63A 5CYGA 3G0IA 2DTXA 3KVOA 1GLNA 3CC8A 1IOLA 3HZRA 1F2UB 3UH1A 1KQPA 3EFOB 3I32A 5J1TB 2C5GA 3JSXA 1E3MA 3RB8A 5C4IA 4LKRA 1H0KA 1YZFA 3CO5A 3PD7A 3PUXA 4BHTA 4ISCA 1TD1A 3NONA 4UVGA 3S99A 2GCPA 2FVXA 4UNRA 5DWQA 1BHQ1 3RWMB 5ITZA 1DJNA 2L19A 3NUZA 4MQ5A 2YVUA 5G40A 4FBGA 2W4IA 2PLAA 2MINB 1T8WA 3I4LA 2Y0PA 4MHTA 5BSTA 4NYJR 3SJBA 2WVGA 2Q6IA 2J3DA 1PLKA 4MZXA 4ODIA 1DKLA 2GBFA 4N3GA 4IICA 4Q3EA 3LCUA 4DV5B 2XT9A 3OEYA 1X7YB 3TXYA 4AO6A 5LDHA 1UADA 3PRHA 5CUQA 3TPCA 3GOQA 3UW3A 4A2CA 4V0RA 3W5BA 4BN4A 1YGYA 4JV5B 1OLXA 1DBQA 1WXQA 2VBGA 3KFLA 4ZDIA 2V5UA 4F2HA 2JFWA 3GCGA 2BUAA 3I8SA 521PA 4AUEA 3EZGA 1RMYA 1DS6A 3FDZA 5CB0A 4OBWA 5EHQA 2QX8A 4RLSA 4RF5A 4R81A 1XT6A 2YDYA 1KXZA 4HQ6A 3GRPA 1M6NA 5HFJA 3VPFA 13PKA 3EXIB 3FCOA 3DTYA 1KAQA 2IEBA 5BSHA 4OGLA 3UB4A 4CIXA 1Z56C 4IS3A 4XKJA 4PNHA 4NZPA 4ZN6A 5JZMA 3QELB 4I14A 1G8PA 3A1EA 3SYKA 2EZ9A 1U3DA 4YMLA 1CUGA 2GN6A 3FLMA 1COWD 1P31A 2Q99A 4JN6B 2IS1A 4V38A 2VO1A 1LD3A 3GR6A 3RVOA 1Z0UA 2BLNA 3QE2A 2OK8A 3MWDA 2HM7A 3CLKA 1C0EA 3OKCA 3L7AA 5FNVF 3PC7A 4TWIA 2G63A 3HQ4O 2YRFA 3CRRA 3GGPA 3SCZA 2MSWA 1ZD1A 4DYHA 4V3CA 5BSGA 1VYHA 1FYFA 2C58A 2OGTA 4QU0A 2JGAA 4UAVA 4GOMD 3V80A 1C9EA 2B5VA 4TS3A 4EA9A 3S2UA 2W11A 4HRYA 1XF1A 4RVOA 5SY6A 3WJ7A 2CYCA 1WXHA 3H3FA 3N8KA 1WNTA 5ESWA 5EIEA 4G56A 4XGQA 2ZIGA 4GKJB 1IEQA 5LKRA 3FGOA 4R0NA 5COQA 4JYAB 3NYWA 3ECAA 2VPQA 5IM5A 1BWRA 3CYFA 2YJTD 1IDOA 1DQRA 1S4QA 2GGSA 2ZATA 2NO6A 3SF8B 4QL3A 1L5HB 2R86A 3N6VA 1LLFA 3OEHD 4V1CB 2JFYA 3H0CA 3WC4A 1M2OA 4OY3A 2G04A 4G3XA 2GI4A 4BLOA 1T8RA 2ONZA 3E5RA 3F5DA 3PGXA 3F6BX 1U28A 2EATA 4F3YA 2W2QA 5JYBA 1AE1A 4TS9A 3RRJA 1CUHA 1GTRA 3PICA 4KRFA 1E32A 3LUHA 4UASA 2BGWA 2LZ0A 1H0RA 4PLYA 3ZLJA 2NZWA 4B74A 4AFNA 3IGFA 4FFDA 3CRZA 3PNSA 4U02A 4U2KA 4R2XA 4Z86A 1QGDA 1U7OA 3GRCA 3GVIA 3KB6A 4DJFC 1Z38A 5AHKA 3PGJA 1B1AA 2ESRA 4CL8A 3TD2A 3DBVO 3BH6A 3OD5A 4KV7A 5B4VA 5CAEA 1SVUA 4LZWA 4FS3A 1JPVA 3EASA 3NBFA 2JJMA 2PJDA 3BJMA 4KQWA 4MV5A 4WTOA 3Q88A 4Q37A 3VKWA 4BEVA 3WNVA 3U1TA 1TM7E 4J91A 2O3TA 3TMAA 5INTA 2W2TA 3P9CA 2RGNC 2H1HA 2ZB8A 1O94D 1XKQA 3BKXA 3FOFC 1ZK3A 3I53A 2WAOA 4IIHA 1DIOB 1PR5A 4JLJA 4LJ4A 4AJJA 3KYCB 3V8RA 3HXMA 2GEVA 2O6HA 4KN8A 4RANA 1OTXA 4F1KA 3MIIA 2FR1A 1OYYA 4RJKA 5WRFA 3QLTA 2NV2B 3GT7A 1DIAA 2ZR0A 3IQEA 3PB3A 4LRTB 2WT8A 4D02A 1VMEA 4HWRA 1V11B 1YUMA 5DO9A 3WRYA 1UEXC 3EZYA 3ZHOA 3LT5A 3WA7A 2C4KA 3EPLA 1GQYA 1F6WA 2A35A 1SUSA 4WJZA 4LA4A 4FN5A 4X1KA 3D7MA 1HSOA 1B76A 4IHJA 1KY2A 1FUUA 4AY6A 3PRJA 3IMKA 3LV8A 1XTBA 2XCIA 4LF7B 1CQWA 2IXTA 1PZFA 3QMWA 2F17A 3RARA 1VSTA 2FZWA 3NWBA 3ADKA 4CJXA 2RMKA 1S2LA 2H3EA 2HRQA 2HUPA 2PQMA 1Q19A 4LXIA 2JARA 4BP9A 1KI9A 3C85A 3HRHA 3K9CA 5FWDA 3WGKA 1G9SA 3GJ3A 4ZV9A 3JYNA 2PGDA 1NUSA 2Z30A 3FMIA 1O8BA 1KJZA 4E03A 4RS3A 3AUXA 3VHLB 5ADVA 4X8LA 3A6FA 1ESDA 3DB1A 2Q27A 2C5BA 1ADFA 3CRMA 1R00A 1M1ZA 1PP4A 2IY7A 1EE1A 1E6MA 2N46A 2OZLA 5BVGA 4JDUA 1UIRA 1X0VA 3LVBA 4LVOA 3OE1A 1N7GA 1UPUA 2JBWA 3B85A 4X93A 3VDMA 2HQ1A 2H4FA 2JLUA 5AXAA 3M5PA 3L1IA 3SHQA 1CB7A 1DFGA 2FZKA 2WAXA 3ASZA 3UTDA 4RIEA 3EVFA 4M7RA 4RETA 4ZT7A 4OJYA 4D4JA 1Z7EA 3L7DA 2WD7A 2C95A 1NU8A 5LC1A 2IKSA 3RSQA 2HWWA 3ROGA 1FYDA 3E23A 5EXPA 5HPYB 4LF9B 4L0CA 3GXBA 3STYA 4JH0A 5FOTA 1M1XB 1F1BA 4B40A 1GVHA 4J49A 1YR8A 2VNHA 2AOTB 3K1AA 4FD3A 1QGZA 1USUA 1FNDA 2I62A 3KE8A 4UBNA 3AUAA 3EQZA 3P0IA 2F3TA 4K28A 1A5TA 1P4RA 1TUGA 3EODA 3PNYA 4RIFA 3UYLA 1KO4A 2P9QA 3CURA 5B1HA 1VKNA 3I0NA 5GOZA 5HILA 5ICFA 2ZW9A 3EDQA 4PLPA 3T9EA 4GVPA 1EFPB 4BNHA 4FB4A 1DC5A 4D9CA 5DBEX 3LP5A 5F1KA 3ZEIA 5C5CA 4B6PA 3H2HA 3NVAA 4ZZ0A 4P4SB 5IZ4A 5T8KC 2HO5A 3EQ9A 1N2GA 3L8HA 4QOSA 4YUAA 2AEFA 3GEMA 3IODA 4DCUA 5HZKA 5TPZA 4BCDA 2BZGA 4WINA 2PMDA 4EO9A 2P27A 1RNLA 2OGSA 2UYCA 1H8HA 3SJCA 3RSLA 4DT1B 1OVGA 2WOOA 3RCBA 4HAZA 1SUEA 2BKXA 2O57A 4LY0A 5A2GA 1J49A 4IMJB 3N0RA 4AQYB 2FH5B 1V16A 1E98A 3RSSA 3TFQA 3OU6A 3W6NA 5IMSA 2IX3A 1AGYA 4B3SB 1RXYA 1ORWA 1UMDB 4MUYA 3JW8A 2I3DA 3EXG1 3OFVA 1JNYA 1ZSNA 5FTMA 2GD1O 2ZJ1A 5IP5A 3TR6A 3A6LA 4Q9IA 2RHRA 4M9UA 3QEAZ 2GWRA 1T1EA 3A6HA 3ZVNA 1NVMB 1P6UA 5KZMB 4MUEA 4DCJA 3FWPA 4DMFA 2HPVA 4LMRA 5HZHA 2A3RA 1ODJA