1I4LA

Crystal structure analysis of rac1-gdp in complex with arfaptin (p41)
Total Genus 81
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
81
sequence length
201
structure length
185
Chain Sequence
SRTVDLELELQIELLRETKRKYESVLQLGRALTAHLYSLLQTQHALGDAFADLSQKSPELQEEFGYNAETQKLLCKNGETLLGAVNFFVSSINTLVTKTMEDTLMTVKQYEAARLEYDAYRTDLEELSLGPRDAGDKYEKLRGDVAIKLKFLEENKIKVMHKQLLLFHNAVSAYFAGNQKQLEQT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The structural basis of Arfaptin-mediated cross-talk between Rac and Arf signalling pathways.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein
molecule keywords ARFAPTIN 2
total genus 81
structure length 185
sequence length 201
chains with identical sequence B
ec nomenclature
pdb deposition date 2001-02-22
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1270.60 Mainly Alpha Up-down Bundle Substrate Binding Domain Of Dnak; Chain:A; Domain 2 Arfaptin homology (AH) domain/BAR domain 1i4lA00
3QE6A 2ELBA 4AVMA 1I4DA 2X3XA 4DYLA 1URUA 1I4LA 2Z0NA 3OK8A 4DCNC 1I49A 2FICA 2D1LA 4NQIA 4WPCA 5C5BB 2C08A 2YKTA 4NSWA 3QWEA 3HAJA 4I1QA 2Q12A 2X3VA 2Q13A 3ABHA 3M3WA 1Y2OA 3HAIA 3QNIA 3CAZA 4ATMA 4WPEA 3Q84A 2Z0VA 3HAHA 1X03A 5C5BA 1WDZA 3SYVA 4AKVA 3ACOA 3PLTA 3Q0KA 2RAKA 2Z0OA 3DYTA 4H8SA 3SOGA 4FZSA 2EFKA 2D4CA 3G9GA 1X04A 2RAIA 3I2WA 1I4TA 2X3WA 2EFLA 2RAJA 3LLLA 4BNEA 2V0OA 1ZWWA
chains in the Genus database with same CATH superfamily
2QFFA 3DX3A 2ELBA 1I4DA 4R5GA 5FIGA 3T47A 1E9VA 1I4LA 1URUA 2OW7A 2PMRA 1R33A 2EWFA 1I49A 4F01A 4WPCA 3BVVA 4EZNA 2C08A 4E81A 4IWQA 4AZ6A 4NSWA 4FM3A 3OWGA 2Q12A 3I01A 3C7NA 4AZGA 4AZBA 1SU8A 3CAZA 4WPEA 2KHOA 2OBLA 2YI8A 3BVUA 3EJUA 5C5BA 3SYVA 4G6QA 3O3NB 4EZTA 1SU6A 2Z8YA 2QXLA 2JNKA 2MI7A 3LMFA 3T4AG 3SOGA 4IW0A 3T49A 2GA9D 2QKWA 2YIBA 4KIKB 4M0MA 2RAIA 3DX0A 2YIAA 4JWCA 3EJQA 1U00A 2PY6A 3LLLA 1PS3A 1R34A 3I39X 1GNLA 3L3PA 4R5LA 3RPMA 4BNEA 2X5CA 3O3MB 4D8JA 1W9MA 1SUFA 2YL8A 1GN9A 2GF4A 3CVRA 3D4YA 3EJRA 3OK8A 4FZPA 4HR1B 1TQTA 3A98A 3QNJA 4KIKA 4UDYX 2F7QA 4E3CA 3B53X 3KAWA 4NQIA 5C5BB 3RV0A 3L3OM 3RV1A 3QWEA 3T48A 3BVTA 3QNIA 2Q13A 5KBPA 2YL9A 3FD9A 3BUBA 3DPQA 4FZOA 1GNTA 4ATMA 3OHXM 4EZOA 3Q84A 3DX2A 2ALWA 3D50A 3DPOA 1DKXA 1O7DB 3D4ZA 4JWEA 3ERCC 3PLTA 2Z0OA 3EJSA 3CKDA 2EFKA 3VEBA 1OA0A 2YLAA 3LVTA 4EZVA 2LXYA 4JWDA 4HY9A 2X3WA 3I04A 3B52X 2V0OA 3T46A 3ER9B 1E1DA 3D52A 3QE6A 4JN4A 1HXKA 4NPHA 4R5IA 4AVMA 4EZWA 2Z0NA 4DCNC 3UITA 3CZNA 4B9QA 2FICA 2F7PA 2ND0A 3BVXA 4F00A 1TQUA 2YKTA 3HAJA 2YL6A 2WYIA 4I1QA 4EZQA 1Y2OA 3D51A 3HAIA 4EZYA 3D2EA 4JWIA 1R5EA 1SU7A 2F7OA 3BUDA 4EZSA 3BUIA 2GAFD 1HWWA 1UPXA 4EZRA 4PO2A 1ZYLA 3B51X 4AKVA 1DKYA 3ACOA 1JQKA 3Q0KA 2RAKA 1QX1A 4AZ5A 1LQ7A 2ZXQA 3DYTA 4H8SA 3CZSA 2RT6A 3BUQA 1QWUA 3G9GA 1QWNA 1MJGA 2F1AA 2YL5A 3I2WA 3KDRA 3EJTA 1YWMA 4IWPA 1E2UA 2ND1A 4AZCA 2YI9A 2RAJA 3DDGA 3GI7A 4EZPA 3VKHA 2O0I1 1ZWWA 5E84A 4JLCA 2F1BA 1TQSA 2X3XA 4IM3A 2OBMA 3KAVA 4R5KA 2N3KA 4IM0A 5FLEX 4UDXX 4AZCB 4JNEA 1OAOA 2D1LA 5TKYA 4EZUA 3D2FA 4R5JA 2WYHA 2F7RA 4JL9A 1O7DC 2F18A 2FYVA 2X3VA 3ABHA 3M3WA 4AZHA 3ER8C 1TQWA 4H6HA 2YLLA 4HR1A 4IM2A 3DX4A 1OA1A 4EZZA 4HYBA 2OO2A 2Z0VA 3DX1A 1X03A 3HAHA 1WDZA 4AZIA 3F7WA 4AZ7A 4JNFA 3VEAA 1HTYA 3CV5A 2LM0A 1DKZA 2JNSA 1TQVA 2NCZA 2EX3B 2D4CA 2OZNB 3EJPA 3BUPA 3BVWA 4FZSA 1X04A 4IWOA 2WINM 4DYLA 3BLBA 3ZEDA 3DPPA 3O3OB 1I4TA 2YIVX 2EFLA 4EZXA 4H6IA 2OW6A 3QA8A 3DDFA
chains in the Genus database with same CATH topology
3QE6A 2ELBA 4AVMA 1I4DA 2X3XA 4DYLA 1URUA 1I4LA 2Z0NA 3OK8A 4DCNC 1I49A 2FICA 2D1LA 4NQIA 4WPCA 5C5BB 2C08A 2YKTA 4NSWA 3QWEA 3HAJA 4I1QA 2Q12A 2X3VA 2Q13A 3ABHA 3M3WA 1Y2OA 3HAIA 3QNIA 3CAZA 4ATMA 4WPEA 3Q84A 2Z0VA 3HAHA 1X03A 5C5BA 1WDZA 3SYVA 4AKVA 3ACOA 3PLTA 3Q0KA 2RAKA 2Z0OA 3DYTA 4H8SA 3SOGA 4FZSA 2EFKA 2D4CA 3G9GA 1X04A 2RAIA 3I2WA 1I4TA 2X3WA 2EFLA 2RAJA 3LLLA 4BNEA 2V0OA 1ZWWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3QE6 A;  2ELB A;  4AVM A;  1I4D A;  2X3X A;  4DYL A;  1URU A;  1I4L A;  2Z0N A;  3OK8 A;  4DCN C;  1I49 A;  2FIC A;  2D1L A;  4NQI A;  4WPC A;  5C5B B;  2C08 A;  2YKT A;  4NSW A;  3QWE A;  3HAJ A;  4I1Q A;  2Q12 A;  2X3V A;  2Q13 A;  3ABH A;  3M3W A;  1Y2O A;  3HAI A;  3QNI A;  3CAZ A;  4ATM A;  4WPE A;  3Q84 A;  2Z0V A;  3HAH A;  1X03 A;  5C5B A;  1WDZ A;  3SYV A;  4AKV A;  3ACO A;  3PLT A;  3Q0K A;  2RAK A;  2Z0O A;  3DYT A;  4H8S A;  3SOG A;  4FZS A;  2EFK A;  2D4C A;  3G9G A;  1X04 A;  2RAI A;  3I2W A;  1I4T A;  2X3W A;  2EFL A;  2RAJ A;  3LLL A;  4BNE A;  2V0O A;  1ZWW A; 
#chains in the Genus database with same CATH topology
 2QFF A;  3DX3 A;  2ELB A;  1I4D A;  4R5G A;  5FIG A;  3T47 A;  1E9V A;  1I4L A;  1URU A;  2OW7 A;  2PMR A;  1R33 A;  2EWF A;  1I49 A;  4F01 A;  4WPC A;  3BVV A;  4EZN A;  2C08 A;  4E81 A;  4IWQ A;  4AZ6 A;  4NSW A;  4FM3 A;  3OWG A;  2Q12 A;  3I01 A;  3C7N A;  4AZG A;  4AZB A;  1SU8 A;  3CAZ A;  4WPE A;  2KHO A;  2OBL A;  2YI8 A;  3BVU A;  3EJU A;  5C5B A;  3SYV A;  4G6Q A;  3O3N B;  4EZT A;  1SU6 A;  2Z8Y A;  2QXL A;  2JNK A;  2MI7 A;  3LMF A;  3T4A G;  3SOG A;  4IW0 A;  3T49 A;  2GA9 D;  2QKW A;  2YIB A;  4KIK B;  4M0M A;  2RAI A;  3DX0 A;  2YIA A;  4JWC A;  3EJQ A;  1U00 A;  2PY6 A;  3LLL A;  1PS3 A;  1R34 A;  3I39 X;  1GNL A;  3L3P A;  4R5L A;  3RPM A;  4BNE A;  2X5C A;  3O3M B;  4D8J A;  1W9M A;  1SUF A;  2YL8 A;  1GN9 A;  2GF4 A;  3CVR A;  3D4Y A;  3EJR A;  3OK8 A;  4FZP A;  4HR1 B;  1TQT A;  3A98 A;  3QNJ A;  4KIK A;  4UDY X;  2F7Q A;  4E3C A;  3B53 X;  3KAW A;  4NQI A;  5C5B B;  3RV0 A;  3L3O M;  3RV1 A;  3QWE A;  3T48 A;  3BVT A;  3QNI A;  2Q13 A;  5KBP A;  2YL9 A;  3FD9 A;  3BUB A;  3DPQ A;  4FZO A;  1GNT A;  4ATM A;  3OHX M;  4EZO A;  3Q84 A;  3DX2 A;  2ALW A;  3D50 A;  3DPO A;  1DKX A;  1O7D B;  3D4Z A;  4JWE A;  3ERC C;  3PLT A;  2Z0O A;  3EJS A;  3CKD A;  2EFK A;  3VEB A;  1OA0 A;  2YLA A;  3LVT A;  4EZV A;  2LXY A;  4JWD A;  4HY9 A;  2X3W A;  3I04 A;  3B52 X;  2V0O A;  3T46 A;  3ER9 B;  1E1D A;  3D52 A;  3QE6 A;  4JN4 A;  1HXK A;  4NPH A;  4R5I A;  4AVM A;  4EZW A;  2Z0N A;  4DCN C;  3UIT A;  3CZN A;  4B9Q A;  2FIC A;  2F7P A;  2ND0 A;  3BVX A;  4F00 A;  1TQU A;  2YKT A;  3HAJ A;  2YL6 A;  2WYI A;  4I1Q A;  4EZQ A;  1Y2O A;  3D51 A;  3HAI A;  4EZY A;  3D2E A;  4JWI A;  1R5E A;  1SU7 A;  2F7O A;  3BUD A;  4EZS A;  3BUI A;  2GAF D;  1HWW A;  1UPX A;  4EZR A;  4PO2 A;  1ZYL A;  3B51 X;  4AKV A;  1DKY A;  3ACO A;  1JQK A;  3Q0K A;  2RAK A;  1QX1 A;  4AZ5 A;  1LQ7 A;  2ZXQ A;  3DYT A;  4H8S A;  3CZS A;  2RT6 A;  3BUQ A;  1QWU A;  3G9G A;  1QWN A;  1MJG A;  2F1A A;  2YL5 A;  3I2W A;  3KDR A;  3EJT A;  1YWM A;  4IWP A;  1E2U A;  2ND1 A;  4AZC A;  2YI9 A;  2RAJ A;  3DDG A;  3GI7 A;  4EZP A;  3VKH A;  2O0I 1;  1ZWW A;  5E84 A;  4JLC A;  2F1B A;  1TQS A;  2X3X A;  4IM3 A;  2OBM A;  3KAV A;  4R5K A;  2N3K A;  4IM0 A;  5FLE X;  4UDX X;  4AZC B;  4JNE A;  1OAO A;  2D1L A;  5TKY A;  4EZU A;  3D2F A;  4R5J A;  2WYH A;  2F7R A;  4JL9 A;  1O7D C;  2F18 A;  2FYV A;  2X3V A;  3ABH A;  3M3W A;  4AZH A;  3ER8 C;  1TQW A;  4H6H A;  2YLL A;  4HR1 A;  4IM2 A;  3DX4 A;  1OA1 A;  4EZZ A;  4HYB A;  2OO2 A;  2Z0V A;  3DX1 A;  1X03 A;  3HAH A;  1WDZ A;  4AZI A;  3F7W A;  4AZ7 A;  4JNF A;  3VEA A;  1HTY A;  3CV5 A;  2LM0 A;  1DKZ A;  2JNS A;  1TQV A;  2NCZ A;  2EX3 B;  2D4C A;  2OZN B;  3EJP A;  3BUP A;  3BVW A;  4FZS A;  1X04 A;  4IWO A;  2WIN M;  4DYL A;  3BLB A;  3ZED A;  3DPP A;  3O3O B;  1I4T A;  2YIV X;  2EFL A;  4EZX A;  4H6I A;  2OW6 A;  3QA8 A;  3DDF A; 
#chains in the Genus database with same CATH homology
 3QE6 A;  2ELB A;  4AVM A;  1I4D A;  2X3X A;  4DYL A;  1URU A;  1I4L A;  2Z0N A;  3OK8 A;  4DCN C;  1I49 A;  2FIC A;  2D1L A;  4NQI A;  4WPC A;  5C5B B;  2C08 A;  2YKT A;  4NSW A;  3QWE A;  3HAJ A;  4I1Q A;  2Q12 A;  2X3V A;  2Q13 A;  3ABH A;  3M3W A;  1Y2O A;  3HAI A;  3QNI A;  3CAZ A;  4ATM A;  4WPE A;  3Q84 A;  2Z0V A;  3HAH A;  1X03 A;  5C5B A;  1WDZ A;  3SYV A;  4AKV A;  3ACO A;  3PLT A;  3Q0K A;  2RAK A;  2Z0O A;  3DYT A;  4H8S A;  3SOG A;  4FZS A;  2EFK A;  2D4C A;  3G9G A;  1X04 A;  2RAI A;  3I2W A;  1I4T A;  2X3W A;  2EFL A;  2RAJ A;  3LLL A;  4BNE A;  2V0O A;  1ZWW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...