1I4LA

Crystal structure analysis of rac1-gdp in complex with arfaptin (p41)
Total Genus 81
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
81
sequence length
201
structure length
185
Chain Sequence
SRTVDLELELQIELLRETKRKYESVLQLGRALTAHLYSLLQTQHALGDAFADLSQKSPELQEEFGYNAETQKLLCKNGETLLGAVNFFVSSINTLVTKTMEDTLMTVKQYEAARLEYDAYRTDLEELSLGPRDAGDKYEKLRGDVAIKLKFLEENKIKVMHKQLLLFHNAVSAYFAGNQKQLEQT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ARFAPTIN 2
publication title The structural basis of Arfaptin-mediated cross-talk between Rac and Arf signalling pathways.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein
total genus 81
structure length 185
sequence length 201
chains with identical sequence B
ec nomenclature
pdb deposition date 2001-02-22
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1270.60 Mainly Alpha Up-down Bundle Substrate Binding Domain Of Dnak; Chain:A; Domain 2 Arfaptin homology (AH) domain/BAR domain 1i4lA00
1I4LA 2RAJA 2V0OA 3I2WA 3HAJA 2RAIA 4H8SA 2Q12A 1X03A 2YKTA 3G9GA 1I49A 2C08A 4BNEA 3OK8A 3QE6A 2FICA 1X04A 2Z0VA 2Q13A 3SOGA 4I1QA 2EFLA 2X3VA 2Z0OA 4AKVA 4ATMA 4WPEA 4NQIA 3DYTA 4AVMA 5C5BA 2Z0NA 4WPCA 2X3XA 3PLTA 3HAIA 3LLLA 3HAHA 4NSWA 4DCNC 1Y2OA 3M3WA 3SYVA 2EFKA 2D4CA 5C5BB 2D1LA 3Q0KA 3ACOA 3CAZA 1URUA 4DYLA 2X3WA 1WDZA 3ABHA 3QNIA 1I4TA 1I4DA 2ELBA 3QWEA 4FZSA 1ZWWA 2RAKA 3Q84A
chains in the Genus database with same CATH superfamily
3BUDA 3KAVA 3QA8A 4HR1A 4HYBA 2YI9A 3A98A 2X5CA 3LMFA 1TQTA 2PMRA 4FZOA 2EWFA 4EZNA 3M3WA 2EFKA 2ND0A 3O3MB 3DX3A 2RAKA 3EJUA 1X04A 3D51A 2GAFD 3T46A 1QX1A 3LLLA 1OA1A 2OBMA 3BVWA 3B53X 3O3NB 2ALWA 1URUA 2YL5A 3RV0A 4JWCA 2PY6A 2LM0A 4HY9A 4R5GA 1HXKA 4AZIA 5FIGA 4EZWA 1DKXA 5KBPA 3QE6A 2FICA 2OZNB 2F7OA 4ATMA 1SU7A 4EZVA 2ND1A 3BUPA 3Q0KA 3BLBA 4EZOA 4EZXA 1GNLA 3ABHA 3BUIA 4AZGA 4IM3A 3ER9B 1QWNA 4FM3A 2RAIA 3OHXM 3DX2A 1X03A 3OK8A 3EJRA 3VEBA 3SOGA 2YL8A 3RPMA 3FD9A 2F1AA 3DYTA 1TQSA 2Z0NA 1DKZA 2OW6A 4DCNC 4D8JA 1R34A 1LQ7A 1SUFA 3D52A 5C5BB 2OO2A 2ELBA 3Q84A 3OWGA 1TQWA 1R33A 2JNKA 3G9GA 1E1DA 4AZ5A 2O0I1 2Q13A 2FYVA 2F7PA 4JWIA 4AVMA 3PLTA 3HAHA 4UDXX 3CAZA 4IM0A 2ZXQA 4IWPA 2RAJA 2V0OA 4AZ7A 1YWMA 4EZZA 1SU8A 3BVTA 3C7NA 4AZHA 3CKDA 1TQVA 1MJGA 3D4YA 3DDGA 4FZSA 1Y2OA 4E3CA 3UITA 4UDYX 2NCZA 3KAWA 4F00A 1OA0A 4IWQA 2X3XA 4JL9A 1O7DB 3B52X 2GF4A 3D2FA 1E9VA 4I1QA 5FLEX 2Z0OA 4EZRA 2YL6A 1GNTA 2WYHA 2EX3B 2YI8A 4EZYA 3L3OM 3EJQA 4E81A 1WDZA 3BUQA 3QWEA 4JN4A 2WINM 3QNJA 3F7WA 2KHOA 1TQUA 1PS3A 4PO2A 4R5JA 3DX4A 2N3KA 3SYVA 1HWWA 5TKYA 4EZSA 4EZUA 3EJPA 3D2EA 3VKHA 4IWOA 1I4LA 3HAJA 2GA9D 4NQIA 3HAIA 3I39X 3GI7A 3I01A 2QXLA 1UPXA 2YIVX 1SU6A 3ACOA 4KIKB 2X3WA 3T4AG 4JLCA 3DPQA 4IW0A 4JNEA 3ERCC 1ZYLA 2Z0VA 2EFLA 4EZTA 1O7DC 3CZNA 3BVVA 4NSWA 3CZSA 4KIKA 3RV1A 3T47A 2OBLA 1E2UA 1I4DA 2F7QA 4AZ6A 1JQKA 2F18A 1QWUA 2QFFA 2YIAA 3D4ZA 1U00A 2OW7A 4G6QA 3DPOA 4WPEA 3B51X 3EJSA 3BVUA 1I4TA 3DPPA 3I2WA 3BUBA 3DX0A 4EZQA 2YKTA 3EJTA 4BNEA 3DX1A 3L3PA 4NPHA 3BVXA 3O3OB 4R5IA 4JNFA 4AZBA 2LXYA 4JWEA 4R5LA 2F7RA 2D1LA 3CV5A 4DYLA 3T48A 3LVTA 4H8SA 4M0MA 4H6HA 2X3VA 3D50A 2QKWA 4H6IA 3I04A 2YLAA 4R5KA 2JNSA 2MI7A 1R5EA 1W9MA 2C08A 4FZPA 3KDRA 2Z8YA 2YIBA 4AZCB 2YL9A 3ZEDA 2WYIA 4JWDA 4IM2A 4EZPA 1DKYA 2YLLA 1ZWWA 1HTYA 4F01A 3ER8C 2Q12A 1I49A 4HR1B 1GN9A 3VEAA 4AZCA 1OAOA 5C5BA 4WPCA 2RT6A 3T49A 3DDFA 2D4CA 2F1BA 5E84A 3CVRA 4B9QA 3QNIA 4AKVA
chains in the Genus database with same CATH topology
1I4LA 2RAJA 2V0OA 3I2WA 3HAJA 2RAIA 4H8SA 2Q12A 1X03A 2YKTA 3G9GA 1I49A 2C08A 4BNEA 3OK8A 3QE6A 2FICA 1X04A 2Z0VA 2Q13A 3SOGA 4I1QA 2EFLA 2X3VA 2Z0OA 4AKVA 4ATMA 4WPEA 4NQIA 3DYTA 4AVMA 5C5BA 2Z0NA 4WPCA 2X3XA 3PLTA 3HAIA 3LLLA 3HAHA 4NSWA 4DCNC 1Y2OA 3M3WA 3SYVA 2EFKA 2D4CA 5C5BB 2D1LA 3Q0KA 3ACOA 3CAZA 1URUA 4DYLA 2X3WA 1WDZA 3ABHA 3QNIA 1I4TA 1I4DA 2ELBA 3QWEA 4FZSA 1ZWWA 2RAKA 3Q84A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1I4L A;  2RAJ A;  2V0O A;  3I2W A;  3HAJ A;  2RAI A;  4H8S A;  2Q12 A;  1X03 A;  2YKT A;  3G9G A;  1I49 A;  2C08 A;  4BNE A;  3OK8 A;  3QE6 A;  2FIC A;  1X04 A;  2Z0V A;  2Q13 A;  3SOG A;  4I1Q A;  2EFL A;  2X3V A;  2Z0O A;  4AKV A;  4ATM A;  4WPE A;  4NQI A;  3DYT A;  4AVM A;  5C5B A;  2Z0N A;  4WPC A;  2X3X A;  3PLT A;  3HAI A;  3LLL A;  3HAH A;  4NSW A;  4DCN C;  1Y2O A;  3M3W A;  3SYV A;  2EFK A;  2D4C A;  5C5B B;  2D1L A;  3Q0K A;  3ACO A;  3CAZ A;  1URU A;  4DYL A;  2X3W A;  1WDZ A;  3ABH A;  3QNI A;  1I4T A;  1I4D A;  2ELB A;  3QWE A;  4FZS A;  1ZWW A;  2RAK A;  3Q84 A; 
#chains in the Genus database with same CATH topology
 3BUD A;  3KAV A;  3QA8 A;  4HR1 A;  4HYB A;  2YI9 A;  3A98 A;  2X5C A;  3LMF A;  1TQT A;  2PMR A;  4FZO A;  2EWF A;  4EZN A;  3M3W A;  2EFK A;  2ND0 A;  3O3M B;  3DX3 A;  2RAK A;  3EJU A;  1X04 A;  3D51 A;  2GAF D;  3T46 A;  1QX1 A;  3LLL A;  1OA1 A;  2OBM A;  3BVW A;  3B53 X;  3O3N B;  2ALW A;  1URU A;  2YL5 A;  3RV0 A;  4JWC A;  2PY6 A;  2LM0 A;  4HY9 A;  4R5G A;  1HXK A;  4AZI A;  5FIG A;  4EZW A;  1DKX A;  5KBP A;  3QE6 A;  2FIC A;  2OZN B;  2F7O A;  4ATM A;  1SU7 A;  4EZV A;  2ND1 A;  3BUP A;  3Q0K A;  3BLB A;  4EZO A;  4EZX A;  1GNL A;  3ABH A;  3BUI A;  4AZG A;  4IM3 A;  3ER9 B;  1QWN A;  4FM3 A;  2RAI A;  3OHX M;  3DX2 A;  1X03 A;  3OK8 A;  3EJR A;  3VEB A;  3SOG A;  2YL8 A;  3RPM A;  3FD9 A;  2F1A A;  3DYT A;  1TQS A;  2Z0N A;  1DKZ A;  2OW6 A;  4DCN C;  4D8J A;  1R34 A;  1LQ7 A;  1SUF A;  3D52 A;  5C5B B;  2OO2 A;  2ELB A;  3Q84 A;  3OWG A;  1TQW A;  1R33 A;  2JNK A;  3G9G A;  1E1D A;  4AZ5 A;  2O0I 1;  2Q13 A;  2FYV A;  2F7P A;  4JWI A;  4AVM A;  3PLT A;  3HAH A;  4UDX X;  3CAZ A;  4IM0 A;  2ZXQ A;  4IWP A;  2RAJ A;  2V0O A;  4AZ7 A;  1YWM A;  4EZZ A;  1SU8 A;  3BVT A;  3C7N A;  4AZH A;  3CKD A;  1TQV A;  1MJG A;  3D4Y A;  3DDG A;  4FZS A;  1Y2O A;  4E3C A;  3UIT A;  4UDY X;  2NCZ A;  3KAW A;  4F00 A;  1OA0 A;  4IWQ A;  2X3X A;  4JL9 A;  1O7D B;  3B52 X;  2GF4 A;  3D2F A;  1E9V A;  4I1Q A;  5FLE X;  2Z0O A;  4EZR A;  2YL6 A;  1GNT A;  2WYH A;  2EX3 B;  2YI8 A;  4EZY A;  3L3O M;  3EJQ A;  4E81 A;  1WDZ A;  3BUQ A;  3QWE A;  4JN4 A;  2WIN M;  3QNJ A;  3F7W A;  2KHO A;  1TQU A;  1PS3 A;  4PO2 A;  4R5J A;  3DX4 A;  2N3K A;  3SYV A;  1HWW A;  5TKY A;  4EZS A;  4EZU A;  3EJP A;  3D2E A;  3VKH A;  4IWO A;  1I4L A;  3HAJ A;  2GA9 D;  4NQI A;  3HAI A;  3I39 X;  3GI7 A;  3I01 A;  2QXL A;  1UPX A;  2YIV X;  1SU6 A;  3ACO A;  4KIK B;  2X3W A;  3T4A G;  4JLC A;  3DPQ A;  4IW0 A;  4JNE A;  3ERC C;  1ZYL A;  2Z0V A;  2EFL A;  4EZT A;  1O7D C;  3CZN A;  3BVV A;  4NSW A;  3CZS A;  4KIK A;  3RV1 A;  3T47 A;  2OBL A;  1E2U A;  1I4D A;  2F7Q A;  4AZ6 A;  1JQK A;  2F18 A;  1QWU A;  2QFF A;  2YIA A;  3D4Z A;  1U00 A;  2OW7 A;  4G6Q A;  3DPO A;  4WPE A;  3B51 X;  3EJS A;  3BVU A;  1I4T A;  3DPP A;  3I2W A;  3BUB A;  3DX0 A;  4EZQ A;  2YKT A;  3EJT A;  4BNE A;  3DX1 A;  3L3P A;  4NPH A;  3BVX A;  3O3O B;  4R5I A;  4JNF A;  4AZB A;  2LXY A;  4JWE A;  4R5L A;  2F7R A;  2D1L A;  3CV5 A;  4DYL A;  3T48 A;  3LVT A;  4H8S A;  4M0M A;  4H6H A;  2X3V A;  3D50 A;  2QKW A;  4H6I A;  3I04 A;  2YLA A;  4R5K A;  2JNS A;  2MI7 A;  1R5E A;  1W9M A;  2C08 A;  4FZP A;  3KDR A;  2Z8Y A;  2YIB A;  4AZC B;  2YL9 A;  3ZED A;  2WYI A;  4JWD A;  4IM2 A;  4EZP A;  1DKY A;  2YLL A;  1ZWW A;  1HTY A;  4F01 A;  3ER8 C;  2Q12 A;  1I49 A;  4HR1 B;  1GN9 A;  3VEA A;  4AZC A;  1OAO A;  5C5B A;  4WPC A;  2RT6 A;  3T49 A;  3DDF A;  2D4C A;  2F1B A;  5E84 A;  3CVR A;  4B9Q A;  3QNI A;  4AKV A; 
#chains in the Genus database with same CATH homology
 1I4L A;  2RAJ A;  2V0O A;  3I2W A;  3HAJ A;  2RAI A;  4H8S A;  2Q12 A;  1X03 A;  2YKT A;  3G9G A;  1I49 A;  2C08 A;  4BNE A;  3OK8 A;  3QE6 A;  2FIC A;  1X04 A;  2Z0V A;  2Q13 A;  3SOG A;  4I1Q A;  2EFL A;  2X3V A;  2Z0O A;  4AKV A;  4ATM A;  4WPE A;  4NQI A;  3DYT A;  4AVM A;  5C5B A;  2Z0N A;  4WPC A;  2X3X A;  3PLT A;  3HAI A;  3LLL A;  3HAH A;  4NSW A;  4DCN C;  1Y2O A;  3M3W A;  3SYV A;  2EFK A;  2D4C A;  5C5B B;  2D1L A;  3Q0K A;  3ACO A;  3CAZ A;  1URU A;  4DYL A;  2X3W A;  1WDZ A;  3ABH A;  3QNI A;  1I4T A;  1I4D A;  2ELB A;  3QWE A;  4FZS A;  1ZWW A;  2RAK A;  3Q84 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...