1I4LA

Crystal structure analysis of rac1-gdp in complex with arfaptin (p41)
Total Genus 81
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
81
sequence length
201
structure length
185
Chain Sequence
SRTVDLELELQIELLRETKRKYESVLQLGRALTAHLYSLLQTQHALGDAFADLSQKSPELQEEFGYNAETQKLLCKNGETLLGAVNFFVSSINTLVTKTMEDTLMTVKQYEAARLEYDAYRTDLEELSLGPRDAGDKYEKLRGDVAIKLKFLEENKIKVMHKQLLLFHNAVSAYFAGNQKQLEQT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ARFAPTIN 2
publication title The structural basis of Arfaptin-mediated cross-talk between Rac and Arf signalling pathways.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein
total genus 81
structure length 185
sequence length 201
chains with identical sequence B
ec nomenclature
pdb deposition date 2001-02-22
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1270.60 Mainly Alpha Up-down Bundle Substrate Binding Domain Of Dnak; Chain:A; Domain 2 Arfaptin homology (AH) domain/BAR domain 1i4lA00
3CAZA 3ACOA 4WPEA 1I4TA 2Z0OA 2FICA 2EFKA 1I4DA 3QE6A 3PLTA 1ZWWA 3ABHA 4AKVA 3QWEA 1URUA 4H8SA 1X03A 4AVMA 5C5BA 2D4CA 2Q12A 5C5BB 3Q0KA 3QNIA 2V0OA 2RAIA 3DYTA 3LLLA 1WDZA 2YKTA 4WPCA 3I2WA 3SOGA 1I4LA 4NSWA 2RAJA 4BNEA 4ATMA 4DYLA 2ELBA 3HAJA 3SYVA 4DCNC 2RAKA 2D1LA 3Q84A 2Z0VA 4FZSA 4NQIA 1I49A 3M3WA 2EFLA 3G9GA 2X3WA 2X3XA 3OK8A 2Q13A 1X04A 2Z0NA 3HAHA 2C08A 2X3VA 4I1QA 1Y2OA 3HAIA
chains in the Genus database with same CATH superfamily
2F7QA 1I4TA 2YL9A 3LMFA 2MI7A 2OBMA 4R5LA 1E1DA 1I4LA 3CV5A 3T48A 2FYVA 3VEAA 3QNJA 4KIKA 3DX4A 1X04A 2QXLA 1TQTA 4FZPA 3OHXM 1MJGA 2FICA 4JN4A 4EZZA 2N3KA 4B9QA 2F1BA 3BUQA 5KBPA 4F00A 4H6HA 2YL6A 2WYHA 2Z0NA 5E84A 2F1AA 3B52X 4AZHA 3CZSA 2OO2A 2RT6A 4H8SA 4EZQA 4AZCA 2Q12A 3EJPA 3T47A 3SOGA 2LM0A 4FZOA 2RAJA 4AZIA 4FZSA 3I01A 4EZNA 3BVTA 4JNFA 2WYIA 3KAWA 3HAHA 3O3MB 3CAZA 2F18A 4EZXA 3EJSA 2YKTA 3BVXA 2YIVX 2GA9D 3D2FA 4M0MA 3Q84A 1LQ7A 3B53X 3CKDA 3D4ZA 4EZSA 1TQWA 3DX2A 3DPPA 4IWPA 4H6IA 2X3VA 3L3PA 1SUFA 3CVRA 4I1QA 3GI7A 3PLTA 3BVWA 1R34A 2LXYA 2QKWA 4AVMA 3DYTA 2ND0A 4HYBA 3DX1A 3DX0A 2Z0VA 2JNKA 2GF4A 1UPXA 2YLLA 4AZBA 4IM3A 4JWEA 4AZ5A 2OZNB 1ZYLA 3KDRA 4DYLA 2D1LA 1R5EA 2YIBA 3RV0A 2F7RA 3D2EA 4R5IA 2ALWA 3I04A 3A98A 1ZWWA 1TQSA 4AKVA 5FLEX 1O7DB 4EZVA 1OAOA 1HXKA 4UDXX 1HTYA 4NSWA 3ZEDA 2RAKA 3BUIA 4HR1B 2OW6A 4F01A 1E9VA 2OW7A 3D50A 4EZOA 1U00A 4IM0A 3D51A 3BUBA 3UITA 1SU6A 2PMRA 1I49A 3M3WA 4R5JA 2ND1A 2EFLA 1SU8A 2NCZA 2YL8A 3DPOA 1GN9A 4WPEA 3EJQA 2QFFA 3ER9B 4JLCA 2WINM 4DCNC 1TQUA 3BVVA 4NQIA 4EZWA 2Q13A 4E3CA 3ACOA 3QE6A 1DKZA 1GNLA 3QWEA 2GAFD 1URUA 4AZGA 5C5BB 2YI9A 4FM3A 4G6QA 3T4AG 4UDYX 3SYVA 1DKXA 1SU7A 3DDFA 3OWGA 4HR1A 2X3XA 3OK8A 3O3OB 3RPMA 4JWCA 4EZRA 1R33A 3ERCC 4R5KA 3LVTA 1X03A 1GNTA 1OA0A 3KAVA 1TQVA 2ELBA 2X3WA 1W9MA 1O7DC 4HY9A 2PY6A 4AZ6A 1Y2OA 2KHOA 1YWMA 4D8JA 2D4CA 3Q0KA 3QNIA 3BLBA 3LLLA 3ER8C 3EJTA 2YI8A 2YLAA 2Z8YA 3HAJA 1DKYA 2JNSA 4IM2A 4EZPA 3DDGA 3FD9A 1QX1A 4NPHA 2EFKA 1E2UA 2YIAA 4IW0A 3DPQA 5C5BA 2V0OA 2OBLA 3L3OM 4BNEA 3EJRA 3F7WA 4IWOA 3G9GA 2O0I1 2C08A 3HAIA 4JWDA 5TKYA 3D4YA 2Z0OA 2EX3B 3DX3A 3VEBA 5FIGA 4AZ7A 4EZUA 1JQKA 3I2WA 3BVUA 2ZXQA 4JL9A 3EJUA 1PS3A 4KIKB 2EWFA 1HWWA 2F7OA 3T49A 4JNEA 4EZYA 2RAIA 2YL5A 1WDZA 4EZTA 4JWIA 2X5CA 3RV1A 1QWUA 2F7PA 4PO2A 3I39X 3T46A 4WPCA 1I4DA 3ABHA 3CZNA 4IWQA 4AZCB 4E81A 3QA8A 1QWNA 4R5GA 4ATMA 3VKHA 3D52A 3BUDA 3O3NB 3C7NA 3BUPA 1OA1A 3B51X
chains in the Genus database with same CATH topology
3CAZA 3ACOA 4WPEA 1I4TA 2Z0OA 2FICA 2EFKA 1I4DA 3QE6A 3PLTA 1ZWWA 3ABHA 4AKVA 3QWEA 1URUA 4H8SA 1X03A 4AVMA 5C5BA 2D4CA 2Q12A 5C5BB 3Q0KA 3QNIA 2V0OA 2RAIA 3DYTA 3LLLA 1WDZA 2YKTA 4WPCA 3I2WA 3SOGA 1I4LA 4NSWA 2RAJA 4BNEA 4ATMA 4DYLA 2ELBA 3HAJA 3SYVA 4DCNC 2RAKA 2D1LA 3Q84A 2Z0VA 4FZSA 4NQIA 1I49A 3M3WA 2EFLA 3G9GA 2X3WA 2X3XA 3OK8A 2Q13A 1X04A 2Z0NA 3HAHA 2C08A 2X3VA 4I1QA 1Y2OA 3HAIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CAZ A;  3ACO A;  4WPE A;  1I4T A;  2Z0O A;  2FIC A;  2EFK A;  1I4D A;  3QE6 A;  3PLT A;  1ZWW A;  3ABH A;  4AKV A;  3QWE A;  1URU A;  4H8S A;  1X03 A;  4AVM A;  5C5B A;  2D4C A;  2Q12 A;  5C5B B;  3Q0K A;  3QNI A;  2V0O A;  2RAI A;  3DYT A;  3LLL A;  1WDZ A;  2YKT A;  4WPC A;  3I2W A;  3SOG A;  1I4L A;  4NSW A;  2RAJ A;  4BNE A;  4ATM A;  4DYL A;  2ELB A;  3HAJ A;  3SYV A;  4DCN C;  2RAK A;  2D1L A;  3Q84 A;  2Z0V A;  4FZS A;  4NQI A;  1I49 A;  3M3W A;  2EFL A;  3G9G A;  2X3W A;  2X3X A;  3OK8 A;  2Q13 A;  1X04 A;  2Z0N A;  3HAH A;  2C08 A;  2X3V A;  4I1Q A;  1Y2O A;  3HAI A; 
#chains in the Genus database with same CATH topology
 2F7Q A;  1I4T A;  2YL9 A;  3LMF A;  2MI7 A;  2OBM A;  4R5L A;  1E1D A;  1I4L A;  3CV5 A;  3T48 A;  2FYV A;  3VEA A;  3QNJ A;  4KIK A;  3DX4 A;  1X04 A;  2QXL A;  1TQT A;  4FZP A;  3OHX M;  1MJG A;  2FIC A;  4JN4 A;  4EZZ A;  2N3K A;  4B9Q A;  2F1B A;  3BUQ A;  5KBP A;  4F00 A;  4H6H A;  2YL6 A;  2WYH A;  2Z0N A;  5E84 A;  2F1A A;  3B52 X;  4AZH A;  3CZS A;  2OO2 A;  2RT6 A;  4H8S A;  4EZQ A;  4AZC A;  2Q12 A;  3EJP A;  3T47 A;  3SOG A;  2LM0 A;  4FZO A;  2RAJ A;  4AZI A;  4FZS A;  3I01 A;  4EZN A;  3BVT A;  4JNF A;  2WYI A;  3KAW A;  3HAH A;  3O3M B;  3CAZ A;  2F18 A;  4EZX A;  3EJS A;  2YKT A;  3BVX A;  2YIV X;  2GA9 D;  3D2F A;  4M0M A;  3Q84 A;  1LQ7 A;  3B53 X;  3CKD A;  3D4Z A;  4EZS A;  1TQW A;  3DX2 A;  3DPP A;  4IWP A;  4H6I A;  2X3V A;  3L3P A;  1SUF A;  3CVR A;  4I1Q A;  3GI7 A;  3PLT A;  3BVW A;  1R34 A;  2LXY A;  2QKW A;  4AVM A;  3DYT A;  2ND0 A;  4HYB A;  3DX1 A;  3DX0 A;  2Z0V A;  2JNK A;  2GF4 A;  1UPX A;  2YLL A;  4AZB A;  4IM3 A;  4JWE A;  4AZ5 A;  2OZN B;  1ZYL A;  3KDR A;  4DYL A;  2D1L A;  1R5E A;  2YIB A;  3RV0 A;  2F7R A;  3D2E A;  4R5I A;  2ALW A;  3I04 A;  3A98 A;  1ZWW A;  1TQS A;  4AKV A;  5FLE X;  1O7D B;  4EZV A;  1OAO A;  1HXK A;  4UDX X;  1HTY A;  4NSW A;  3ZED A;  2RAK A;  3BUI A;  4HR1 B;  2OW6 A;  4F01 A;  1E9V A;  2OW7 A;  3D50 A;  4EZO A;  1U00 A;  4IM0 A;  3D51 A;  3BUB A;  3UIT A;  1SU6 A;  2PMR A;  1I49 A;  3M3W A;  4R5J A;  2ND1 A;  2EFL A;  1SU8 A;  2NCZ A;  2YL8 A;  3DPO A;  1GN9 A;  4WPE A;  3EJQ A;  2QFF A;  3ER9 B;  4JLC A;  2WIN M;  4DCN C;  1TQU A;  3BVV A;  4NQI A;  4EZW A;  2Q13 A;  4E3C A;  3ACO A;  3QE6 A;  1DKZ A;  1GNL A;  3QWE A;  2GAF D;  1URU A;  4AZG A;  5C5B B;  2YI9 A;  4FM3 A;  4G6Q A;  3T4A G;  4UDY X;  3SYV A;  1DKX A;  1SU7 A;  3DDF A;  3OWG A;  4HR1 A;  2X3X A;  3OK8 A;  3O3O B;  3RPM A;  4JWC A;  4EZR A;  1R33 A;  3ERC C;  4R5K A;  3LVT A;  1X03 A;  1GNT A;  1OA0 A;  3KAV A;  1TQV A;  2ELB A;  2X3W A;  1W9M A;  1O7D C;  4HY9 A;  2PY6 A;  4AZ6 A;  1Y2O A;  2KHO A;  1YWM A;  4D8J A;  2D4C A;  3Q0K A;  3QNI A;  3BLB A;  3LLL A;  3ER8 C;  3EJT A;  2YI8 A;  2YLA A;  2Z8Y A;  3HAJ A;  1DKY A;  2JNS A;  4IM2 A;  4EZP A;  3DDG A;  3FD9 A;  1QX1 A;  4NPH A;  2EFK A;  1E2U A;  2YIA A;  4IW0 A;  3DPQ A;  5C5B A;  2V0O A;  2OBL A;  3L3O M;  4BNE A;  3EJR A;  3F7W A;  4IWO A;  3G9G A;  2O0I 1;  2C08 A;  3HAI A;  4JWD A;  5TKY A;  3D4Y A;  2Z0O A;  2EX3 B;  3DX3 A;  3VEB A;  5FIG A;  4AZ7 A;  4EZU A;  1JQK A;  3I2W A;  3BVU A;  2ZXQ A;  4JL9 A;  3EJU A;  1PS3 A;  4KIK B;  2EWF A;  1HWW A;  2F7O A;  3T49 A;  4JNE A;  4EZY A;  2RAI A;  2YL5 A;  1WDZ A;  4EZT A;  4JWI A;  2X5C A;  3RV1 A;  1QWU A;  2F7P A;  4PO2 A;  3I39 X;  3T46 A;  4WPC A;  1I4D A;  3ABH A;  3CZN A;  4IWQ A;  4AZC B;  4E81 A;  3QA8 A;  1QWN A;  4R5G A;  4ATM A;  3VKH A;  3D52 A;  3BUD A;  3O3N B;  3C7N A;  3BUP A;  1OA1 A;  3B51 X; 
#chains in the Genus database with same CATH homology
 3CAZ A;  3ACO A;  4WPE A;  1I4T A;  2Z0O A;  2FIC A;  2EFK A;  1I4D A;  3QE6 A;  3PLT A;  1ZWW A;  3ABH A;  4AKV A;  3QWE A;  1URU A;  4H8S A;  1X03 A;  4AVM A;  5C5B A;  2D4C A;  2Q12 A;  5C5B B;  3Q0K A;  3QNI A;  2V0O A;  2RAI A;  3DYT A;  3LLL A;  1WDZ A;  2YKT A;  4WPC A;  3I2W A;  3SOG A;  1I4L A;  4NSW A;  2RAJ A;  4BNE A;  4ATM A;  4DYL A;  2ELB A;  3HAJ A;  3SYV A;  4DCN C;  2RAK A;  2D1L A;  3Q84 A;  2Z0V A;  4FZS A;  4NQI A;  1I49 A;  3M3W A;  2EFL A;  3G9G A;  2X3W A;  2X3X A;  3OK8 A;  2Q13 A;  1X04 A;  2Z0N A;  3HAH A;  2C08 A;  2X3V A;  4I1Q A;  1Y2O A;  3HAI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...