1I4PA

Crystal structure of staphylococcal enterotoxin c2 at 100k crystallized at ph 5.5
Total Genus 63
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
63
sequence length
239
structure length
234
Chain Sequence
ESQPDPTPDELHKSSEFTGTMGNMKYLYDDHYVSATKVMSVDKFLAHDLIYNISDKKLKNYDKVKTELLNEDLAKKYKDEVVDVYGSNYYVNCYFSSKDNGGKTCMYGGITKHEGNHFDNGNLQNVLIRVYENKRNTISFEVQTDKKSVTAQELDIKARNFLINKKNLYEFNSSPYETGYIKFIENNGNTFWYDMMPAPGDKFDQSKYLMMYNDNKTVDSKSVKIEVHLTTKNG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of staphylococcal enterotoxin C2 at various pH levels.
pubmed doi rcsb
molecule tags Toxin
molecule keywords ENTEROTOXIN TYPE C-2
total genus 63
structure length 234
sequence length 239
ec nomenclature
pdb deposition date 2001-02-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01123 Stap_Strp_toxin Staphylococcal/Streptococcal toxin, OB-fold domain
A PF02876 Stap_Strp_tox_C Staphylococcal/Streptococcal toxin, beta-grasp domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.110 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1i4pA01
3.10.20.120 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 1i4pA02
1TS4A 3R2IA 5ELEA 1EU3A 3GP7A 1YN5A 4RFBA 2Z8LA 1PTOD 1EWCA 1PRTB 3BVMA 1LTID 1T5XD 2AQ1B 1AW7A 1FNUA 1LTGD 1EU4A 1V1PB 2O2LD 1CHPD 1SJHD 2QEJC 1LO5D 2J4XA 1FGBD 1TY0A 4DXGA 1EEFD 1L0YB 1I4RA 1I4XA 1SE2A 1TS5A 1PZID 1I4HA 1PZJD 1ET6A 1JCKB 4K6LA 1GOZA 1CHQD 1LTRD 3DWPA 1FD7D 1V1PA 1HQRD 5TSSA 1JR0D 1LT3D 1CQVA 1PZKD 2CHBD 2XN9C 5ELCA 3BZDB 4C56C 3O13A 1YN3A 1D5XC 1STEA 1M4VA 1JQYD 1LT6D 3V05A 1L0XB 1PTOC 1PRTC 1SJED 2WV6D 1CT1D 2IPKD 1I4GA 5D3DA 1SXTA 2ICIA 2NTTA 1PTOH 1TS2A 2QILA 1D5MC 3DWQA 4TSSA 3BVGA 3TSSA 1BCPC 2NTSA 3SEBA 1ESFA 2XRSD 5ELDA 1HXYD 4ZYSA 2G9HD 4RHSA 4L63B 2RDHA 1TS3A 1LTBD 1LLRD 1F77A 1SE3A 1UUPA 3EA6A 2SEBD 1LTTD 1PRTF 4RGTA 1KLGD 5ELBA 1DYQA 1BCPD 4RGNA 5FK9C 1TY2A 1QILA 3W2DA 3R2TA 3OWEB 3URYA 1AN8A 3BYYB 4BWGB 1S5BD 1BCPF 1ENFA 1SE4A 1XTCD 3BYTB 4RHRA 1I4QA 1RF2D 1MD2D 1PRTD 2XNAC 2R61A 1ET9A 1BXTA 1EEID 2AQ2B 1FNVA 1LTSD 1JWMD 5D3IB 1PYWD 4RGOS 4RCOA 1KTKA 1PTOF 1LT4D 1UNSA 1SBBB 1RD9D 1EFID 4O1NA 1DJRD 2RDGA 1XXGA 5ELFA 3EFXD 4UDUC 1KLUD 1SEBD 1CK1A 1G8ZD 1S5FD 1B44D 1JWSD 1JWUD 1D5ZC 1S5DD 1HTLD 1S5CD 4RH6A 4NZLB 3KLSX 2IJ0A 1S5ED 1HA5A 3MFGA 1V1OA 2XRQD 1PTOB 3DWAA 4L6TB 1D6EC 4DXFA 4Z9CB 1RDPD 1B1ZA 4OHJA 3MC0B 4RGMA 2AQ3B 1FNWA 1RCVD 5I4DA 3CHBD 5FKAC 1BCPB 1LTAD 1LT5D 2TSSA 3BVZA 3R8BA 1YN4A 1I4PA
chains in the Genus database with same CATH superfamily
1IGDA 2HD5B 2DENB 1TWFB 3TBIB 1SYEA 2QIEB 1O7ZA 2KEDA 4K7SA 3ZNHB 2M19A 2X38A 4CKBA 1WIAA 4LNNA 5C1ZA 2K1BA 2QA4A 2WDRB 4ITKA 1LTGD 3CPFA 2IY5B 5IP9G 3EUB2 1WD1A 4JBWA 1K0SA 4XWWA 1ONLA 1VQBA 5NUCA 4I7ZC 2MJEA 3UI3A 3QX1A 4YSXB 2WXKA 3FMCA 2ON8A 2C7HA 2EY5A 3AU5A 1PH7A 1I4HA 3BK1A 2NB0A 3CRKC 1V80A 2WP9B 4KY5A 1K8GA 3NWSA 1YQ3B 2EY2A 2B8FA 1UWXA 3LJ3A 2WAQE 1SNDA 2B29A 3I4MG 5C2TB 4KSKC 3K57A 2DAJA 3N52A 2K03A 3D4RA 1T0SC 3JVZX 4HJ9A 2V3NA 3EGRA 3DHHC 2MO1A 3TS2A 4JYAQ 2K39A 4HCNB 2F0UA 1SNMA 3JAMc 3KJOA 3M3YB 2WKCA 4CJ2C 5H1SE 1WY8A 3T3OA 1F52A 4JI0L 2W3RA 2KCNA 5IP4D 3AE7B 1EWHA 3QWNA 2JA5G 2Y5CA 4KY6A 2Z0EB 3SVMA 3SEBA 2ZJPA 1C4QA 2JRIB 3NVVA 2PNRC 1U4RA 3DUZA 1VQDA 1TKWB 3RZOH 2H88B 1FRRA 2RDHA 4I65A 3E9HA 5EPJA 3A33B 2V1CC 3PT2B 3R7RA 2EY6A 1R4NB 2RBMA 5CHWA 2K5QA 2ZJQA 2B63G 1V43A 4II2B 2EPBA 1SNPA 1BF4A 4B3ML 3PO3G 1EY9A 3OJ4B 3W2DA 3Q22A 2UUCQ 5KNCA 2CJNA 2H1EA 2Z6KC 3AE9B 4ZYNA 1TYGB 3GTQH 3TZUA 2EOTA 4P74A 1EOTA 1G91A 4GOCA 4L5QA 1XQQA 4IFDJ 2KQ3A 4QMGA 2LJIA 2DBYA 2CHZA 2J7QB 2MPMA 5I2XA 1WTRA 1JOQA 4KHZA 4OO1G 1L4DB 4Q5VA 1UH6A 2NR2A 4JOIC 1GB1A 2VQEQ 3LNNA 2WX1A 2WS3B 1C78A 3GV6A 4HLEA 2VNUD 2K05A 2WAQG 3N9YC 3VR2A 4Y7NB 4JBKA 4CHKA 5LXIB 4WRDA 5BN5A 5DEHA 1KRSA 1WD0A 2VUMG 3HOVG 4UDUC 3P63A 2KFJA 3M62B 3D6CA 3N6RA 4FHKA 1WGYA 1SLJA 4K3CA 3VUWA 3VUYA 1HTLD 5CTRC 1VQ9A 4FP5D 1FXIA 2Z6KA 2CH4W 4CDCC 1KNEA 1DGSA 3M3YH 3PGEA 3QO2A 2L11A 2MA9B 2WXRA 3IBEA 4IN3A 4R4CA 2AQ3B 4LFCL 1R4MB 1TBEA 2KX3A 4DK6C 2Z9HA 2LMCB 3H15A 4HIOA 2G1EA 3ZRFA 1QZGA 1DD2A 2ZVOA 1KRHA 3BS1A 4JWUC 3T13A 1JRPA 4HR7B 4RAUC 1P1AA 1MGSA 4IJLA 2RPVA 5ELEA 3OWFA 2LASA 2K3UA 4OEMB 4P72A 3VYUA 3AN1A 4AYBG 2CS4A 2HJ8A 3U50C 1WR1A 3ABVB 2C7NB 5GAGC 1V9PA 2GBMA 3PRZA 1KABA 5KRUA 2KWDA 3CW2C 3E6ZX 1XNRL 1EEFD 2FCSA 3HOVH 4XDCA 2F0TA 1EQQA 2BQQA 5G3LD 1IXRA 2MBOA 1Y56A 5JJZA 2UXCQ 3NTHA 3AULA 4JX1C 5FLMG 1B9RA 2XWBB 3AFQA 4LFBQ 1ZXHA 1KD1C 2KHIA 4CQNA 2YYZA 1WCMB 3A8IE 3A8JE 2V3SA 3OTOQ 3PUWA 1CQVA 4FHJA 2LFNA 4A3BH 1T6BX 2A4ZA 3JSVA 4GSWA 1YHAA 4OZBA 3Q3OC 4GN1A 3OAWA 1HZ5A 2Y5PA 3DBHI 5LHY1 3AEVA 1HR0Q 1XEEA 1CA5A 1KAWA 1K83H 5FO7B 3RNEC 2ZTCA 4DV6Q 4ANUA 3JC66 3MTSA 4MIUA 4V190 3TEXA 3RFZB 1F9JA 3SU8X 3E0EA 5C0XG 4TVAB 1WXQA 3CC2A 1T0QC 5L37A 3IXSA 2OCEA 3L16A 1BCPC 2PQEA 3ZJYC 2CCZA 4IUPA 3S1NB 1A6XA 2WXQA 2G9HD 4NP5A 4L63B 5EPKA 3HOXG 3NHHA 4XDXA 1SE3A 3IAM1 3E5SA 1YX6B 1GVPA 1OXTA 4OIKA 3MHZA 3A5ZB 1ZE3D 3V96A 2L4NA 2CHXA 1TY2A 5IYCG 4X3SA 3H6MA 1XD3B 1S4ZA 1SROA 3NUHB 3TUOA 4ZHOA 1S5BD 3UDGA 1R4NI 4WAFA 1E0ZA 4A3JH 1GHJA 4BXXH 4EUTA 2Z4HA 2IW3A 4G3XB 2MWSB 3R66C 5DPSA 2K5PA 1FCCC 2QDBA 2B8GA 3TZDA 1PYBA 3AM9A 2IX1A 1MI2A 2GN5A 2IWHA 2RCNA 1NI2A 1H9MA 5M5YH 3CQZH 3PMFA 3TCAA 4BA1I 4TQ1A 5C3EG 4IM0A 1YNNC 4G11A 1PFNA 2OTLA 5A35A 3F2CA 3P42A 4TMAB 1S5FD 1HCZA 1PUTA 4ZUJA 4BVUC 4IDIA 1GUOA 4XZ4A 1R9TH 1ZGUB 1IUEA 1MPEA 2F0MA 3LXFA 2ZW0A 2ZPYA 5KIXA 4WJWA 1ASZA 4WQMA 3WIMA 4HJKA 4EKUA 4ODGA 4GKJQ 3BY4B 1OGWA 3VTWA 1E8XA 1PTOB 1SSOA 2WXMA 4IWOA 3IAYA 1EZ6A 2V4DA 3GTPB 3OW7A 4XXEA 2MEKA 3PV1A 3VXWA 1FNWA 5G5GA 5C4ZA 2MP1A 5C44B 1G6ZA 5BMHA 2K9XA 4DBGA 1GUSA 4PV1C 3R8BA 4DR6L 1J7AA 1TZ1A 1T5EA 1K0RA 3SK8A 2K6DB 5HGTA 3GOEA 4X6AH 1E2WA 1IW7D 1ZYRD 2Z8LA 1FXTB 4GOPA 4A3IH 4MM3B 5HG2A 2I5LX 1HNZL 1KNAA 2E2HB 2H4OA 3LGJA 3V6CB 2Q2TA 2NN6H 2LHDA 3UINB 2F0LA 1V1PB 3IT4B 3N3KB 4M0WA 3ONAB 3S2AA 5H8YE 2K8HA 2L55A 3W5OA 3HOVB 3HM3A 5JHBA 1FGBD 2M8SA 5D65A 2K7VA 4OELB 4DNRB 1V5TA 1IL8A 4DWFA 2KJHB 1HFNA 3RYTA 3V2TA 1E9MA 4XE0A 1GM5A 1OEYA 1X32A 4UP9A 4LF5L 3VA7A 2LVPA 1ACCA 1GUNA 1HQRD 2R3ZA 3M4PA 3H94A 5LXHA 5IT9E 3IHPC 1XYIA 1JWBD 1HR0L 1SAPA 4LMQD 1TT5B 5JVH3 1U5KA 2I1JA 4OX9Q 1ZDXA 2DZMA 3DMUA 2Q5WD 4DV0L 2JEBI 4J1MA 4Q2JA 4ANVA 2EZVA 4J3OD 1E8YA 1F9QA 2WV6D 2IY0B 1VQEA 1NDDA 4HEDA 2KC2A 4I6LB 1PDQA 2KLCA 2NTTA 3F1ZA 4X66L 4GN3B 1L0WA 3CCEA 4IC7B 2HQEA 3BVGA 4CJ1B 2D5GA 4LF5Q 1IKLA 2DY8A 1Z6HA 3DLLA 3QB3A 2R93H 4XTCS 1XMOQ 3ZNGC 3VRAB 5LMUQ 4GNXC 1STHA 2PQAB 4M02A 2KN4A 1YNJC 3J7AF 4IG7B 4LDTB 4A8XC 5IN7A 1CMXB 1IKMA 1VCBA 4LF4Q 2L0TA 4DR5L 1BOSA 2XTIA 4YWGG 4OL7A 4BY1B 4RGNA 3MJ5A 4N9TA 1I42A 3URYA 2FHTA 4ZRQA 2DGYA 4ABNA 4X64L 3RZFA 2SNSA 4NW2A 1GJXA 3FILA 1TWHB 1WMHA 1E0BA 3I4LA 4APVA 4YTMB 2XNAC 1JJCB 3L0OA 4HSVA 2JA7H 4RM8A 1MBYA 1GUTA 1HZCA 3PO3B 2AQ2B 1LM8B 1UELA 2IDYA 3MFYA 1WTVA 4P6VF 2N1VA 2N1WA 4IUUA 4NQKE 4RCOA 1PH9A 3K0YA 1QZHA 3N1YC 3DXJC 3A55A 1SDFA 5M3MG 3UE0A 2R6GA 1A2TA 1XLQA 1S3OA 4X3UA 2GRIA 4BKSA 2Y5BB 3DBHB 4ZRZA 2KJRA 2QCPX 4BZAA 2XEWA 4F8MA 1MIUA 2DUDA 4HIKA 2LVQA 2R93B 1S5DD 4GKJL 1IYVA 1CQFA 2NBFA 4K0KL 4A3OA 4RMFA 3UE1A 2EYLA 3NBIA 1XNQL 1QZEA 1SIJA 4GDKB 1Y69U 1FEHA 1IBKL 2BE5D 1VS0A 5J2RA 4X66Q 2GLSA 4WJPA 3J81i 1HTQA 1FL0A 2BS4B 4YHHL 2PJHA 3KLRA 1Q10A 2XSCA 5FKAC 3DOWA 3MXUA 4EQNA 4YTPB 4TKNA 1O80A 3CSTA 3D3RA 5E1FA 1FCLA 2PE9A 1E22A 2KBNA 2PKOA 2XBBC 1R9TB 5IP7G 3I8ZA 2NVXH 2KQ7A 1DCZA 1IBLQ 1QUQA 2K6AA 3I4OA 3T53B 2EYHA 2PIAA 1XLNA 3D32A 1ZOYB 2X69A 2QJLA 1W2BA 3VFKA 1D1KA 4B9XA 2ZXPA 4KDIC 2JA8B 3ICEA 2M0AA 4A93G 4I7AA 1RWSA 2ZT9C 4JI7Q 2J4XA 1OEYJ 1EIFA 1I4XA 2K04A 3VHTC 1JT8A 2ASQA 5E6NA 1C79A 4YTNB 3BG3A 1JCKB 1VLBA 2JYTA 3U8ZA 4PT5A 5C3EH 5D6JB 2NMQA 1DM0B 3RNFC 1SYGA 1YNND 2O5JC 4XYCA 1SYFA 3WAPA 2BYTA 3ML8A 2N7JA 2N4FA 4X65L 3S1MB 2KA7A 5GQOA 1GXDC 3Q23A 2DX5B 1DONA 3TIXA 1YJNA 5L83A 4LTUA 4DV5L 2I46A 4JI8L 2N88A 3CP0A 2K8BA 2FXQA 1VQKA 3QJYA 4HMIA 1H95A 5T1IA 4WWNA 4HVBA 1CJEA 3CWIA 2QILA 1YEZA 4KV6A 4Q0FA 1FO4A 3S15H 3RNBC 4JWSC 3AEFB 3K5OA 1ASYA 5E6JA 1ENCA 4XWTA 1JRUA 2E76C 1WRIA 3Q8BA 4ZDVA 2EQSA 4RHSA 4KKIA 4KN4C 2KTRA 3VR5A 4OZCA 2MRPA 4CBVA 2A74C 5E3FA 1F77A 3D4DA 1FJGL 3ENEA 3WAMA 3HOUG 1DYQA 3P7JA 5M3FB 1A63A 2WACA 1BCPD 4DV7Q 2O6VB 1K50A 2WX0A 4U673 3A9JA 3M4OH 1EYDA 1AN8A 2WB1G 2RSNA 4WWPA 4P16A 1J8CA 2BBCA 1RYJA 4ZRKA 4EZLA 4F88A 4ZCKA 1TWGH 2MP2B 3L0WB 4XQJA 1WGRA 2YVCA 3NVWA 3ZW3A 2LKVA 5J1ZA 3C46A 4LUOA 1XWEA 1ET9A 4NJ6A 1BXTA 2B2TC 3F2DA 1DGJA 3SHQA 1KL9A 4XIGS 2FIFA 3VH4B 1PFSA 4C3JG 4CYEA 2YU9B 2W82A 3EHVA 1L1OC 4FF2A 3H91A 3VYSA 1C4AA 2DZIA 2MQHA 3MWYW 2IZVB 4OWTB 1M1KC 1HNWQ 2O2VA 3C8YA 4N58A 2LY7A 3WA0A 3MHSD 4P2CB 4A3MG 1WGKA 2NS5A 2EY1A 1X1MA 3P4RB 1RKNA 5ELFA 4B3RQ 1NMFA 3P1HA 4BS9A 1JWUD 4ZKBB 1YQ4B 2Z1CA 1SMYC 3A7LA 4BA2I 3E9IA 3I72A 1F2RC 2DNEA 3GQBA 1SIFA 1N63A 2ONQA 3IKJA 3AMZA 3PPAA 5FR3A 1OXXK 2KN5A 5LMNW 2WFWA 4C3JB 4DV4L 3AEBB 2NPTA 3GTLH 3HFZB 1KRTA 1E3PA 2EJFC 3IRBA 4YY3Q 4FF4A 5ISRA 4KVGB 2CU3A 3C1EA 1L7YA 4IPHA 3T9LA 4UY8C 3NTIA 5FR6A 1RHPA 3BVZA 3CCMA 2GMIC 2VZKD 3DWGC 2QGQA 3EN2A 2BKFA 4HCEA 1F2RI 2JSVX 3N32A 4AOFA 1E7UA 5M3FG 4KJNA 1K8AC 1JROA 1BBUA 1T5XD 2DZKA 2F0NA 3S17B 2JZPA 3QOLA 5I2YA 4BKGA 4DR1Q 1GUGA 4GLSC 2K5DA 4DV3L 2EKEC 2Y0SG 4F7XA 1DZ1A 2QEJC 2WXIA 4HCPB 2VL6A 2HCCA 1PH4A 2A5UA 4O42A 3Q24A 4DR7Q 2D3GA 2HHHL 1N61A 1JOKA 2FBWB 4ICVA 1VQJA 2VB2X 5I6WA 1XMOL 1QF6A 1TU2B 4MZ9A 1I50H 4DV2Q 4KDLB 2NWGA 1MG8A 2NZOA 1TT2A 1CZPA 4A3DB 4JI0Q 3G71A 1FD7D 1E1OA 1V1PA 2SNMA 1C77A 1K52A 2PMVA 3T4AC 3MC9A 3X3NA 3WANA 1SNQA 5JJKA 2JA7G 4K2KA 3B2GA 4N9F4 5BYRA 4YWLA 4EFOA 3UQAA 3B6YA 4X64Q 4A3KB 4EE2A 3DBLB 1PTOC 3GTOH 2JUOA 4QAYA 2D62A 4JI4L 1IHZA 3CSFA 5DPRA 4MGIE 3P2BA 3HOWB 5IGFA 2V9HA 2YU9H 4IWQA 5M5YB 1HE8A 2ACZB 5BN3A 3J80L 1TS2A 4N9PA 4HIMA 4ZQ3A 4DF7A 2F4VQ 2JY6A 2WNMA 3HHMA 3CCJA 5IKCM 3KH0A 2MCNB 1VQPA 2KFKB 2X6GA 1VQ4A 3VR8B 4WWOA 4DAVA 1TWGB 1VQAA 2E2HH 3L13A 5J22A 2PO4A 4BOZB 2AWTA 3L10B 3PSIA 3OIPA 2RVLA 3M4OB 3HVDA 4BAXA 1HJPA 3HOYB 1UBQA 1V8CA 2QMTA 2KCMA 1JE4A 1KF6B 1CA6A 1MHHE 4C3HG 1J19A 3KUPA 3BDLA 4A75A 1GHKA 1ENFA 1JQ4A 1RL2A 3GO5A 1FFUA 1Y8NB 2DNCA 3MHBA 2ATWA 1L6VA 1V97A 3AXCA 5L95C 2B2UA 1E24A 4X57B 4W9JA 3MP9A 4KZ0A 3Q8DA 4DUZQ 2WDVB 5A2QE 4AJYB 2HHHQ 3GTJH 3K8AA 4P73A 2DYBA 1LTSD 2ZCCA 4HRSA 3U30A 3S14H 4S3SA 1OXSC 2EYPA 2FIDA 4B9WA 1Y1WH 4B3RL 3HRDD 2A6EC 2HDLA 1U4AA 4ZAIA 4HPLB 2NUCA 1KLUD 5BR8Q 4CGYB 1WJ6A 4FJZA 2NVYB 1JE5A 4UP7A 4BBSB 2G45B 2LWPA 3PIPA 1TXYA 4KIKB 4XDDA 2F4IA 3RZDH 2L3ZA 1VZ8A 3E56A 2NBWB 5AZFA 4A3MB 1SE8A 3MFGA 3HKZG 5G3LF 4YY3L 4HEA1 4KGRA 4OVVA 3L9AX 3VTUA 1LGRA 1G6JA 1KDBA 5F2DA 2IO1B 4OONA 1C76A 2KWCA 2R2QA 1Y1VH 3QAQA 1YJIA 2E5LL 5IOIA 1WVLA 5CYUA 1ESRA 4FXGC 2A8VA 2B2UC 3A7AB 3W9CB 2TSSA 2HJ1A 3K81C 3OPOA 2YEPB 3BK2A 1K8RB 3VRBB 5AUKA 5C4HA 4R1JA 5C0XH 3PCOB 3G6JB 3AEAB 4GDKA 1KAAA 1RTNA 1YZ6A 2X6LA 4BY1G 4A3DH 1JORA 1PLFA 3QOJA 2KVZA 1ZKHA 1V86A 3IG3A 4JI2L 2AWOA 1EU4A 4LFCQ 1GUWA 3T51B 2EXZA 3NS8A 1VZ7A 5C0XJ 4C2MB 1RRBA 2M56B 1FPYA 4HCSA 5M5WH 4A3CG 4EZKA 2N55A 2JA6G 1RTOA 5GXGB 2GBNA 2KWUB 2ZEQA 1LUZA 4JCVE 4F8CB 3MA2B 3HRZC 4W9DA 3APDA 2EIFA 4MEMA 1EYAA 5G55A 1ICWA 4QY7A 2E3TA 3JAML 1H9JA 1V1QA 1Q86C 1B9NA 3G6EA 5D94A 3RLFA 3HEJA 1JALA 1PYSB 2IO2B 3GTGH 5ELCA 3J81j 4A3FH 3I4NG 4HTHA 3O13A 2ZJDA 1STEA 4OVZA 3CMAA 4ZOHC 5IP9H 5EE1A 3X23A 2F0QA 3NE5B 5EKIA 3I63C 3FKIG 1KXLA 2KDIA 1LFDA 2ICIA 3ZTCA 2PCFB 3ZYYX 2AX5A 1Y1VG 1H4RA 4DR2Q 2K22A 2PYKA 4ZKCB 3VQIA 4IWPA 3PVLA 4W9EA 3V6EB 5ELDA 1R4PB 1H8CA 4FXDA 3Q8FA 3HOXH 4DV7L 1WTWA 4IUVA 1WE7A 2R93G 2ZM6L 2IHEA 1PH2A 1UUPA 4LFAQ 3AE6B 2M9VA 3K5NA 3OG5A 4LF7Q 4A3EB 4QUFA 1HA6A 1F2YA 2N9PC 4MSQB 1O7YA 4DV6L 3ZNID 5LLIA 5C0XI 1HQMC 4B0MA 5M3MB 4L2YA 3ERSX 4PMWA 1IBMQ 1HUNA 3U7DA 4ZUIA 1N36Q 2KQ4X 2LGIA 2OJRA 4BWGB 2D10A 4R4TA 2ES2A 1SE4A 3Q6SA 3KDFA 1RF2D 2WXHA 2VZKB 2K5WA 4PS3A 1MD2D 1SYDA 2M2LA 3HGBA 2WGSA 2R61A 2A6HD 4RNAA 2N78A 1A70A 4TUUA 1TKEA 2V4IB 3HKSA 4DK1A 3S9WA 5C5MA 3A8KE 4FO2A 3CC4A 4XT1B 4BBSH 4JI6L 5DLQE 4JIOU 1N60A 3TRZA 1SNCA 1SBBB 4K3BA 2GVAA 2IO0B 1V49A 1NENB 3NUCA 2ZXOA 2LXJA 1NSNS 2A5HA 2NVXB 1JMCA 4IUNA 4DPGA 1VQOA 2E2DC 1FVIA 4E3CA 1WCMG 1S5CD 4IOIE 4NZLB 3OTOL 3U2SC 4RMAA 4REZA 1XMQL 3GZNI 2I5MX 3H0GH 3CCLA 3CU7A 3PZ7A 1Z2MA 4BY7B 4DR4Q 3ULPA 4B6WA 2PEAA 2JN4A 4JC0A 4DV2L 3NZ3A 2NZHA 3WAOA 2R92B 3AH7A 2C5LC 2K8CA 3CF6E 2NPTB 4WAAA 2M17A 4DV5Q 1Q1EA 1LM0A 3Q0AA 1GUAB 2X8XX 4HROA 3AB5A 3K59A 3I5JC 2FNJB 3CCRA 4MHEA 2K01A 1F2MA 3W5VB 2ZCBA 1PRTB 1J9OA 3KBGA 4YT0B 3EFUA 1FNUA 3ALBA 4M8AA 1KH0A 2EMSA 3FEWX 1HR0W 4C1NK 4AQYQ 2CR5A 1LO5D 4DDID 2H5XA 1Q0WB 2J53A 1ENAA 1TS5A 1I4RA 3I2ZA 1QLBB 1QOBA 3I73A 1PVOA 3DCGA 3F8TA 3CF5A 2JXMB 1ET6A 1KDAA 2WXLA 4X62L 1Z47A 2F03A 4P75A 1CHQD 3Q3FA 1E10A 3I3CA 4KKSA 1WRDB 1WTPA 5EE0A 1PH3A 1QOFA 1CSQA 4HIDA 3S1RH 3VA5A 4JPBW 3PZ8A 2I1KA 3F2UA 1C4CA 2WYQA 3M9BA 5JEAJ 1PRTC 2IT1A 2GB1A 4M8MA 1V9JA 2PE6B 3R7QA 3SHLA 5CV5A 2ZW1A 1C1YB 2L9HA 5CX3A 3SK5A 1XCQL 4GKKQ 4B08A 2GOWA 1BBXC 1WMHB 1ZXIA 2AYOB 4FJYA 1QCBD 3AYHB 5IT9L 4BKTA 1D5MC 2RF4A 4LF6Q 1JJ2A 4A3KG 1I94Q 1XF5L 3LYYA 3P4QB 4PQXA 3AB9A 1AZPA 2C60A 3PUYA 1U4MA 3OJ3A 2RKSA 4DHJB 2B76B 3MVVA 2KVMA 3S17H 3A0JA 1HPCA 4JPSA 1KFYB 4C7ZA 5C5LA 4K6DA 2DY7A 3VR4A 1NAPA 4U68A 3TP6A 1N34L 1BR9A 3AMUA 1E7PB 4A3KH 3NZSA 4C00A 1YJ9A 3AQQA 4ME3A 1UGJA 4HK2A 4KK7A 3NZUA 1P8LA 2JYOA 4J15A 3OWEB 3GTJB 1V81A 4NAWB 3BYYB 4A20A 1NEKB 1P7EA 4JI3L 1O7IA 1XTCD 2B2YA 2Y0SB 4IUTA 4C3JH 1FMAD 5AUIA 1YD8U 4G4KA 1C3TA 3J9CA 3S2DH 1XT9B 3HOYG 4YCWA 3CCUA 2MJ8A 4DFAA 2Q2IA 1NBWA 2B2WC 3G4SA 5FLMH 3KWVA 4J6HA 4AYBE 3A9KA 1U4LA 3J81E 3VDYA 1DJRD 2RDGA 4G7OC 2VY3A 3SR1A 2CHWA 2JZ3B 3HOUH 4FULA 2KENA 3ULLA 1P9DU 1QNKA 3A1QA 1EFWA 5AJ3Q 2EDGA 4XGAB 1BT0A 4OW0A 1M94A 4FF3A 4NJCA 1EO6A 1Y8PB 4ACFA 1I5FA 4KTAA 4RKBA 5GADC 2ZNVB 4Z9CB 3W1SA 4FF1A 4C80A 1YX5B 1VCIA 4MH8A 2HD3A 4HDQA 4PK1A 1DXMA 4ME5A 4EQPA 4H2AA 4A55A 1I4PA 5CBEE 2KANA 2UYZB 2F1MA 2A68D 3PTFC 3NEMA 3PUZA 2L0CA 1IBXA 3H0GG 1OTRB 1D8LA 3CAMA 1AW7A 5CV9A 1UWMA 2PPBC 3RLNA 2KUMA 3HS0C 2NN6I 4E71A 3KYCD 1SJHD 4GNXB 5JOBA 2QHOA 1WI5A 2A1AA 4WIPA 2MW5A 3CQZB 5FLXE 1T0RC 1BNZA 2MBHA 2K33A 5C4XH 5CV4A 1XX8A 2JA5B 1X56A 2VZAA 5IT9c 2GA4B 1BKBA 2YLMA 4DUYQ 1M8AA 2FCQA 1EY0A 4GOPC 2KDBA 1KHIA 2MH7A 2HUGA 2QDLA 4A3GG 1A2UA 3ZLZA 4C56C 2OJWA 2Q2UA 2OTJA 2CWPA 1JQYD 4BBSG 3OIQA 3S1QH 5CGKA 2KD0A 4GKKL 3KF8A 4W9CA 4C3IH 5KNDA 1QWYA 1SFOH 4QIWE 1I3QB 5LL6X 3HKZB 3NOBA 1SXTA 1FGUA 3KF6A 1WOCA 3IFDA 3TP7A 3HOZH 2VB3X 2EVBA 4TSSA 3UQBA 4USAA 4OWXB 4LJPB 1HNXL 1E7VA 3GTMB 4WJNA 4MJSB 3V3XA 1WTQA 3QJZA 3T16A 5CHVC 3PO2B 5JEAH 5EE3A 2PI2A 4TRDA 1NY4A 1B3QA 1MKHA 4V0BA 3STBD 4LF8L 1MSHA 1EQTA 4ALPA 1UZXB 2EKIA 2F0EA 2E75C 1RODA 1TWCH 1STGA 3VR3A 1N33Q 2FCMA 4NB3A 4DR7L 3P4SB 1IYFA 3R2TA 5M9OA 2C7MB 5KHQA 5IGDA 1PH1A 2OWOA 4QQBX 2KMMA 2LXCA 3J7AV 3UDFA 3V61A 3NQIA 3RZOB 1FIQA 4H44C 3Q3NC 2O4XA 4DA2A 2JSOA 5JVG3 1CFMA 3T1YL 3NXWA 1VMCA 3GD7A 2RMMA 2DNFA 4GNXA 2CH4A 1SR3A 3UI2A 3RR5A 3RN5A 1R4QB 1LYLA 2NZ1D 3OYYA 1RAXA 1RFAA 1H9RA 3A56A 1WYDA 4RKLA 2UUAQ 1VQMA 1UNSA 5IY0A 4A3FG 3I4NH 1EYCA 4JI2Q 1WZ0A 5G2NA 1EFID 2KCCA 2D0PA 1N33L 2FUHB 2FJ2A 3DVGY 3I90A 3EFXD 3I57A 2QC8A 4FVMA 4OIJA 3MAQA 2JRHA 2VQFL 3S14B 1WZ3A 3Q14C 4DHZB 1SN8A 4AYBB 5K5PA 3QHTA 2F0SA 5EJWA 3WOEA 3W1BA 2D3AA 1S5ED 1T0YA 2K50A 3U4EG 4JV5L 1UBIA 2B63H 4DXFA 1PH5A 4F7ZA 1X65A 3Q8AA 1WGGA 3QIAA 1TWHH 4X62Q 2F52A 4DV3Q 3Q3JA 1SRUA 3KLSA 2IGGA 4LK0M 3W1YA 1CTMA 4MH0E 1A3TA 3H3VI 2LVOA 2KXJA 3DVGX 4ULLA 4BY1H 2REXA 3RNGC 4W9FA 3W3AA 4RF0A 1X6OA 3GTGB 3R2IA 4KD4A 1YN5A 4HPPA 3H7PA 3SXHA 1WJNA 5IGCA 3RN9C 2D2QA 4K14A 1UE7A 2LJ5A 2RSUA 4DHJD 1TR5A 1EUVB 1T9HA 1EY8A 4HJ7A 4CO7A 3AEDB 3K7UC 1CHPD 5ELOA 2DJGC 5C4XB 3M85A 4OXPA 3HKZE 1IZ6A 2QF7A 4KGSA 1YJ1A 1VDVA 1L0YB 3ITPA 1PDXA 2QW7A 2O6VD 2F0JA 3PRMB 5JAVA 3KVFB 1B9MA 1X3EA 2TMPA 1L0VB 2M4NA 3WALA 3QG1A 2W54A 4K5VA 2ZVNA 1QG7A 2LD9A 2V1YA 3I7FA 4DR6Q 1PGBA 2I07B 3J81L 3TL5A 1Y1WG 3R93A 4UPAA 4JL9A 4EZJA 3KK7A 1E5WA 1EQVA 1VQ5A 3BINA 4KKTA 2J7ZA 2HDMA 1V6EA 2RSOA 4JLCA 4DGZA 2YTYA 1MI0A 1HNZQ 1PV4A 2K25A 3Q2AC 3H1UA 2AEHA 1UF0A 2LEKA 4NMZA 4DR3Q 4RA8A 5CBAE 3I3TB 1L5PA 4GXBA 4ANXA 4QCLA 1HXYD 2QCZA 5J17A 1U0LA 1EUJA 4F87A 3ZKJC 2BA1A 4F1SA 4TQUS 4K8JA 3C3LA 5CC4A 4XX5A 1CKNB 2PW7A 3QC8B 2YV5A 1GKHA 4ZRJA 4ZRPA 4DV1Q 3ZVVA 4RGTA 1UE1A 5IYBG 1V5OA 4D2KA 5CHFA 1GD7A 1N32Q 5JEAG 5IGEA 1G291 1HHVA 1F2ZA 1QILA 3ZNZB 4LNQA 3U9OA 1Y14B 2IHFA 1BCPF 1K8OA 5DPWA 4BY7H 2K52A 3GTMH 5FLXL 3B1LX 2KMAA 3A4RA 3CCVA 4PMCA 4JI8Q 1MG4A 1UEAB 1F9SA 2F3VA 1Y8RC 5CV7A 3PIP3 1RD9D 4KHVA 3WDNA 4YSYB 2HTHA 4IPCA 1SEBD 1QT9A 2HTME 1G8ZD 3RNAC 4J8QA 1XTDA 5DAUA 4HPMB 3BZKA 4GZYC 3Q8EA 1D5ZC 1E1TA 4YIJA 1KQSA 3PUXA 4PYUA 2IJ0A 4DXAB 2KCTA 1VF7A 1Y8OB 2PW9A 2AHOB 2DWQA 1EYGA 1U4PA 2CQOA 2L1AA 4UAIA 4FNFA 4KHPQ 3QARA 3U7ZA 1B1ZA 4OHJA 5C3JB 3NPPA 3DDCB 3KYHC 1ICFB 5KNBA 1MHXA 1UAPA 4XT3B 3RUIB 2IL8A 3HK0A 1K3BC 3ZRCA 2A69C 1HRJA 2OT2A 1LQBA 3PHXB 3D6WA 4KX6B 2SAKA 3K7AB 4WQOB 3H3VC 2R7ZB 1L1OA 4A3EH 4A3EG 1J8IA 1CZGA 2L32A 3FDTA 2RD0A 1EU3A 3GP7A 1AH9A 2W55A 4FJVB 4KIKA 5LMNL 3S2HB 4X3TA 2RPQA 3VUXA 4B3MQ 3RPFC 2O6VA 5IE8A 4WJ3M 2MP2A 2D5DA 4RM9A 4EVOA 4IURA 4MGYE 1WTOA 1PMRA 1JC7A 3HUIA 2JQRB 1XLOA 4NPSA 1E2VA 2VUMH 2ZZPB 4CJ0B 3FKIB 3I56A 1XO3A 3K58A 3SFEB 2L0FA 2L76A 2CKZB 4W9IA 2J0KA 3UDXA 4JI5L 3KWLA 2NYZD 4A6QA 3DHQA 3N1XC 3DWPA 2N8NA 2UU9L 5I6YA 4DUZL 4JI1Q 5M3FH 4XYOA 1Q81C 3KBXA 2EELA 4BKSD 1OO9B 1W3SA 2L15A 3L54A 1D5XC 2FAZA 5FO8B 1MHWC 5C3EB 1KIXA 1HEZE 1N5WA 1ZXTA 1WFYA 1KJTA 2R92H 1QVCA 4OO1H 1SJED 2MJDA 3CXCA 3AECB 3T1HQ 4A3DG 5E4WC 1H9KA 1QVGA 5E7NA 1GNUA 1HZ9A 3RZWC 4GOPB 2K4KA 3PO3H 3S2DB 3R3MA 4KI0A 3RMHA 3DWQA 4C2MH 4BBRG 4JI5Q 4JI7L 4IQZA 1A62A 2NTSA 3MXNB 3CD6A 3PO2G 5HY6A 3DBSA 3LB8C 1PFDA 2RR9A 2WLBA 1SFOB 2ASBA 1VQGA 4FADA 3C1FA 1CI3M 2F0HA 4B3TQ 2BVCA 1F0ZA 5M5XH 4CDFC 2VW9A 1K8MA 4I6NB 2A73B 1LTTD 4ZK9B 1GPXA 1CM9A 1KLGD 3K7AH 3SDLC 4GGQA 2JWZA 3CPWA 3E3XA 1NCVA 2BF8B 2KVRA 1OQYA 4CDDC 2CW0D 1BUIC 5TR5A 3A4SC 1EY5A 4M01A 3RNUA 1ZUD2 1BDOA 2WXFA 1X54A 2GBKA 2JP1A 2BYEA 1GG3A 3OSOA 5DNFA 1O7LA 2LXKA 1QB5D 3FILB 1Q8KA 2N9LA 5CR3A 3OHXC 5HGQA 1O78A 4BY7G 3GB1A 1QE6A 5D3IB 4RGOS 3IAS1 1B8AA 4US8A 1PTOF 1VQCA 1LT4D 4IO9A 2UXCL 1TKGA 2KKCA 3PSEB 2PTLA 4GB9A 4EQ5A 1FFVA 1CZWA 1F9RA 4TKOB 3EROA 1E8WA 1MJDA 1AWDA 3DQVA 2I5HA 4JQWC 2CJOA 2MBBB 2GI9A 4TQ0A 5EDSA 1JWSD 2KQSA 1LV9A 2KHWB 2D07B 2NCNA 3AEGB 4MACA 3PV0A 3KQ4A 2ZJRA 1ZPSA 2CKHB 1Q5WB 4KKJA 1L2NA 2WAQB 3DWAA 3G48A 2XIWA 1D6EC 1AARA 1WYGA 3NHEB 1RDPD 2MJ3A 3I91A 1XNQQ 4IOCA 2MHVA 1K9MC 4K7WA 1DOKA 3K0XA 2L12A 4EQOA 2BA0A 5I4DA 2KOXA 3K9OB 1B3AA 2KO3A 1E7ZA 3BDCA 3HIZA 3NQTA 1PFMA 4ZRIA 5IA7A 5J39A 4MJSA 3L2PA 4BBRH 2KLGA 1X3QA 4JI3Q 1A3UA 3OMGA 3M95A 1SYBA 1IYJB 1J0GA 4KMUC 3QQ8B 3DWMA 1A3VA 2AQ1B 4JYAL 1SSNA 2PW5A 3GV3A 2WDTB 2I0QA 2PZWA 3PF4A 4K1RB 1Q3LA 1LABA 4DU9A 1RJTA 4NQLB 4LDTD 4DXGA 1UGMA 1WGDA 4A3PA 4A90A 1JJGA 2BDOA 1ZEQX 4L1BA 3DBRB 4LFBL 4FXCA 1WJJA 4GU2A 2KYWA 3TDQA 4K6LA 2UU9Q 1TWAH 1FXAA 2PQAA 1HZ6A 2YTVA 1VJKA 4WORA 1J6QA 5D14A 3CCSA 5TSSA 1N32L 5AFWA 2IO3B 1N8RC 3MJWA 1PZKD 1HZBA 3ND9A 4IM2A 2KX0A 2AWNA 2SDFA 2NVUI 3NG0A 1IYUA 3JW0X 3RUZA 4EEWA 4JI6Q 3H7SA 4LF4L 4DR3L 1VQ6A 1NNXA 3A9JB 3HM6X 3ZIMA 2WXPA 5CORA 3SR6A 1I4GA 1Y1VB 3AU7A 2RDFA 1Q82C 1VQ7A 2JWUA 2L00B 3B2FA 3GDEA 4MNOA 5EQ0A 2HQLA 4RCNA 3VR9B 4AWJA 2J0JA 3J7A5 2B2TA 4KJOA 1VQNA 2EYMA 3P75A 3J80i 4N59A 4GLVB 3LWUA 1VDZA 4IOAA 1TWFH 4FBJB 2DYMA 1Z7TA 4BBRB 1NMGA 5IGBA 4IM3A 1Q7YC 2KZRA 4HAEA 4ANWA 3ZDMC 4PYZA 2OEOA 2E2JB 2BDNA 5D7GA 4B3SQ 3GTPH 4RHRA 2ZNVC 4C7YA 2R2OA 3NTKA 5AJ3L 3NBHA 4IJHA 3S16H 1EWYC 5I9PA 1ML0D 4IPGA 5JJLA 2ENBA 1X3PA 2LSSA 2LHEA 3DEPA 1QJOA 1EL0A 1AE2A 3PREA 2WU2B 3D4WA 3DEOA 3A9KB 2F0FA 5LNK1 2IGDA 1AYFA 1Q8IA 2D3BA 2Z4IA 4I6PA 3AE8B 3H6NA 2ALYB 3DM3A 1XXGA 1U9RA 2NBUA 3OMCA 5C4XG 2JZZA 3TQYA 5KHOA 4QIWB 5BYSA 5HI1A 1S1QB 3AE1B 2HDEA 2WIIB 4JBJA 1RM6C 3U52E 1Z5SB 3H09A 3L3OC 1IL2A 3KUDB 5BMGA 5C44H 1HA5A 1V1OA 2BCOA 1JOOA 3SE0A 1L4ZB 2UU7A 1V2YA 3GTLB 1Z9FA 4G0NB 3M7GA 5C6AA 1ISNA 3ZXRA 4DV4Q 2RDBC 2W3SA 2YEPF 2K1FA 1BCPB 1LTAD 2XK5B 1WFQA 1OQQA 2DHZA 2F0OA 1I94L 2E8GA 4EX5A 4WJOA 3ND8A 5BO4B 1BVSA 4BOSC 4RFBA 3KUZA 2BH8A 1A5RA 2VRRB 4K0KQ 1X3FA 1WJ4A 3JAME 2I2YA 2KK8A 5HHDG 5BMIA 2UXBL 2R7ZG 3NJTA 3K5MA 2R7FA 1TY0A 2KOLA 4KKUA 1TJEA 3HZXA 1C48A 2N7DA 2OQ0A 1QVFA 4US9A 3ZTDA 2EYFA 2Z0DB 1PZID 4YWMA 3KFUA 2DZJA 2F0PA 1B2TA 2MLBA 3W5UB 3ZDTA 3MZ5A 3HOWG 1WH3A 2KC1A 1ZKOA 2B39A 1QOAA 3U4ZA 2IX0A 1WWTA 4H7BA 1YN3A 2INDC 2MSED 3KF8B 1FM0D 3TEWA 1YBYA 1B4OA 1L0XB 4BXXG 2D2CC 5EBCA 4OWWB 4NNJB 4LWCA 4UHVA 2IY1B 2BS2B 1BQQT 1MSGA 3I9V1 1CT1D 1YJJA 1S3SG 4RWSC 3T8MA 4A3IG 2RHSB 4L5SA 2C35B 2N49A 4PZ6A 3VYTA 1PTOH 1BO0A 3H0GB 5IYDG 4HJAA 2CW0C 2AL6A 2LUMA 4XC2A 5C23A 3S15B 2BS3B 3NENA 4A3JG 1VRAB 2FUG1 3JSVB 1E6EB 3Q6BA 5IO9A 1RLFA 4DNIA 4ZYSA 1AE3A 1LTLA 1QKZA 1BBWA 2Q8RE 1K83B 4ID6A 1LTBD 3RT3B 3VVWB 4IFDH 4PS7A 3EA6A 2A19A 1ILQA 2CWAA 4NAMA 1DOIA 1EY7A 3EVQA 4PZ8A 3I4NB 4DR1L 3ZUNA 4A3BB 5JJIA 2YTXA 1SMXA 1PXUA 5J18A 3AU4A 2ZTEA 3AE3B 3TP8A 2NVQH 5BN4A 2A6ED 3NBHB 5A2QL 3KF6B 1I4QA 2AMCB 5ELNA 2VQFQ 1UE5A 1L6UA 2D3CA 4DDGD 1C4PA 2VUMB 3Q69A 1EEID 3FVQA 3VR6A 1QUQB 2LMCA 4DN4M 1FNVA 5I9OA 5HKHA 3HOWH 1EM7A 2JA8H 2AKWB 3O65B 4MN3A 1TQOA 1KTKA 4BBNC 3UF8A 3AE2B 1WXMA 1CSPA 1OQRA 4EGVA 2E2IB 2J0MA 4HN7A 2R7ZH 3GTKB 5BR8L 5C3XA 1KOTA 4IZ8A 3S1NH 5G5HA 1IBML 5IYCH 4ARIA 1PFBA 2SOBA 2NVTH 3I4MB 1N36L 2JE6I 3JAMi 4PZ7A 5CV8A 2UUBL 2L8JA 4AQ7A 5EKKA 1BMLC 3LWEA 2B2WA 3PIO3 4PG3A 1I6VC 2G4SA 4XQNA 1P98A 1RCVD 2K5HA 4DAPA 2M1MA 2E5LQ 1UE6A 1VQLA 2UUCL 2I38A 1HH2P 4DR4L 3PF5A 2A69D 2WB1B 4H0LC 4H02A 3U9SA 3AV8A 4J6IA 1HNXQ 2JX5A 1EWIA 3HOZG 4LNFA 1PTOD 4A3BG 3BVMA 1LTID 1N5XA 2DJFC 3RLOA 4ICUA 4WWMA 4K7UA 1NBFC 2NBVB 4GLAC 1J7BA 1K51A 2KACA 2KDFB 3A54A 5J3BA 5FOBB 2V3PA 3AEEB 1KLVA 1Q46A 4O2DA 2VQEL 4GS3A 2UWQA 1G51A 3FP9A 2VXWA 3LX0A 3T56B 5M5WB 4B3TL 1PGXA 5IGGA 5KYLA 1XMQQ 3RD4A 1ZP0B 2HE7A 2P5ZX 3TN2A 4CKEA 2B63B 2F0VA 4R8IA 2PMZB 3M4YA 4LCDE 3W1SC 3FPUB 4ZLTF 4LJOB 4OO1I 4GDLB 3GTQB 5K36H 3DBRI 4DV0Q 2KEEA 1LTRD 3T1YQ 1PHJA 3B9JA 3PQIA 2F0GA 2Q8TA 2MHJA 3P1MA 4ILWA 1LT3D 4JBMA 1RFKA 2PLPA 4JVZA 3W1GA 1W6JA 1ZDVA 4DK0A 4DQOC 2ID0A 1OTCA 2JA8G 1FD6A 2BKRB 3IVFA 5GMVA 3HP3A 5GAEC 2KT7A 4LAAA 2N9XA 3ZJUA 1WM3A 4ZHPA 1YMHE 1SYCA 2CQAA 1WX8A 3FC4A 5HURA 1ROEA 3B08A 4S0RA 1C9FA 3EC8A 1V8QA 1F1HA 3D31A 4II3B 4AQYL 1TZOA 1N9WA 4FXKC 3OOCA 1NVID 3TSSA 1KC8C 4NAWA 1ESFA 1K3RA 2ZXRA 2QDFA 3H3VH 3QK0A 2BOSA 1STBA 3SK6A 2OOBB 4NPNA 1SF0A 3P4PB 4R4OA 5LMNQ 2NVQB 1SE9A 3GS2A 1TKYA 4KGTA 2JVCA 1GJZA 2Z0SA 5JZEB 2LRWA 5EGTA 1IGCA 4IKGA 1SMYD 5AEKB 1TWCB 2Q2HA 4WURA 2EMTA 2M0XA 2WXGA 2MFIA 1OFFA 1NE3A 1XNRQ 4FN2A 5E6PA 2GVBA 1GAQB 3CCQA 3JYUA 3WOFA 2HT1A 2PPHA 1YHQA 1IBKQ 4P1CC 1GC7A 1LACA 3N1ZC 5EAYA 4WJQA 1YIWA 2Z59B 4JG2A 1D4BA 2PNHA 4W9HA 4NXMQ 1H9SB 1YHBA 3PLUA 2J42A 3UIPB 1NR2A 4G50A 1D2BA 2F0DA 3PRPB 2C9OA 4HJ8A 1STNA 1EIHA 2FCNA 3CC7A 1VMPA 3V62A 3MEFA 3NP8A 2INPE 4TV3A 4IUMB 1MFWA 4MM3A 2JA6H 4RG1A 3NS1A 2INNE 2K5NA 4B0EA 5JPNC 2G3QB 3EIVA 2Z6BA 3Q3MC 1KDCA 3LDZE 2B2YC 1I6HH 2ZPNA 3QIJA 3NRZA 3M7NA 2RA4A 3KLSX 2OHFA 2FINB 5EE9A 4YHHQ 5DM63 1XJVA 1F9PA 4GDLA 1C7YA 1VD2A 4X3KA 4NXML 1AFPA 3TEYA 2XRQD 1OXVA 3QR8A 4QGUA 2N0SB 3QCAA 2JA5H 4WJ4A 2V4LA 5IWAL 4A93H 1B50A 4IFDG 4FLHA 4RGMA 5C4JH 5IYDH 3VH3B 4E74A 3J81c 1AEXA 2WKDA 4BFRA 5KYIA 3GTOB 4K81A 4MGKE 1AZQA 1NTGA 4HDOA 3S2HH 2KFKA 3IL8A 3ER0A 3TREA 2GBJA 2E2IH 2PVOD 1GB4A 4E6IA 1WF9A 1W6KA 4IALA 1XLPA 2B3AA 4P1BC 2IX3A 3HOXB 3VYRA 2WWZA 4P71A 3ETRA 2KWVB 4DV1L 2GBRA 4YCVA 4EOYA 1HZAA 1NJIC 3IFTA 3PO0A 1X9NA 5LMUL 1VZ6A 1P3QU 1WTXA 1HUMA 2K75A 1XCTL 4LNIA 2UXDL 1VQ8A 4C3IB 3GE3C 1YOVB 2RQXA 4A3CH 5H92C 1IPGA 3KW5B 1YQBA 4XQQA 4DR2L 2BWES 2LGSA 3DHGC 2CFMA 1GOZA 3C19A 1A0IA 3CIRB 4N8X1 3RZDB 3MEHA 2D9UA 1H9SA 1L1OB 1HTOA 5JPMC 3EFCA 4K8IA 4DAMA 5M3MH 3KJPA 2WXOA 1ILPA 3HOUB 3F2BA 4GLXA 3M63B 4IPDA 5GROA 2LRUA 5FLXc 4AUQC 4NXNQ 1F2LA 2IPKD 1Q12A 2WXJA 3DHIC 5AZHA 1P0RA 1PH6A 4PMBA 3CKIB 2O5IC 3H8HA 2EYOA 5IP7H 4P7IA 4B9KA 2ICEC 2OF1A 1R4MI 3ML9A 1C0AA 3AI5A 3DBLI 2BTEA 2KHSA 5EBDA 3L4PA 1I3QH 2VS1A 2M00A 2BE5C 4NKLA 4QB4A 3STBC 1TS3A 1K73C 4L5RC 4Y52H 2BB6A 2WDQB 4HWIB 4KLKA 3FKYA 4DUYL 1B7YB 4PNYA 2OXPA 5KEEA 1J5EQ 5CMDA 1PRTF 1GO3E 5ELBA 3T1HL 4WH4A 4JE3B 5BYQA 3G7LA 5COYA 4HJGE 1D7QA 5FK9C 4NJ7A 3TP5A 1WCMH 3KOJA 2AUJD 4CKCA 2WU5B 2H89B 3U4VA 4R8NA 1JICA 1R7SA 4DNTB 1A8VA 2K32A 3PGZA 2JJQA 4CHTB 2LI5A 2KDMA 3X0WA 1VQIA 2BWFA 4PS8A 1TGZB 2K0PA 2KTFA 5IIFA 1YVCA 4AH6A 2MUYA 2QSDA 4HXDA 4POFA 4G7HC 2L5TA 1WI0A 2LGYA 4UP8A 1EIYB 3C2PA 1IBLL 2HIVA 2F0WA 3BWUD 3MC8A 2MNAA 4DAYB 1PYWD 1II3A 3QA8A 1WSPA 2NVYH 4OX9L 1NI3A 2RCFA 4MELA 1VF5C 4MDKE 1KM7A 2JA6B 1S72A 4HKZE 3PHWB 1JW9D 5FJ8H 3ZJVA 2AUKA 1J7CA 3OLMD 2AL3A 3M4QA 4HSPA 5M5XB 1YJWA 4RF1A 2O2VB 4AJWA 3ECIA 4IFDI 2IBIB 1NYRA 4JI1L 2LFIA 3PZDA 1YNJD 1VQFA 2K5VA 4L6TB 1XPOA 3TJPA 3BIID 2BYFA 1EY4A 1E8ZA 3N20C 3UIOB 3ZJTA 1E90A 1Q90A 2JPHA 1FYCA 3DM1A 4X65Q 2E2JH 3TEZA 3VDZA 1LT5D 2WXNA 3APCA 1HFGA 2QKIC 2A68C 2N9EB 3PIOA 2WP8J 1DOYA 1E2ZA 3S1MH 1ZW7A 2KECA 4JOIA 2FE8A 1TS4A 4JW0A 2HCIA 3FPPA 3SDZA 2UUAL 2IGHA 1UEBA 4MSMB 3TEHB 1N6ZA 1HTPA 3S24A 4A76A 1D1IA 4A3IB 1PA6A 4YXDB 3D0FA 1J5EL 1EWCA 3EJIA 4LF9L 1K28A 5CV6A 2BT6A 1CKNA 4Y7NH 3RN2A 4M0WB 2BYVE 3R3OA 3D8GA 1WM2A 1YNTE 1Q1BA 5K36G 1WX9A 3FAHA 4YL8A 3U58A 2JXXA 2F4VL 1VQHA 1YNXA 1IBXB 2F0IA 4A3LG 4FDBA 3RMKC 5LL6S 2KHJA 4A3GH 3EBEA 3NWTA 1WYWB 2LGXA 2CVRA 2PI2E 2F0KA 2OEDA 3MTNB 1STYA 3N30A 4CDEC 1CKMA 3L08A 2KJ6A 1Q1OA 1K53A 3RD2A 5DCNA 3PS6A 4R4IA 2E6XA 2LZ6A 4IW0A 2B2VA 3GTKH 2OQKA 1JR0D 4JI4Q 4LF9Q 3KDFB 5KGUA 3MXPA 1N62A 2CHBD 3WWVA 5JHAA 2PZTA 3L7ZC 2FMCA 3E0JA 1M4VA 1TWAB 2R7DA 1S40A 2XVSA 4MGZE 4BBNF 1IW7C 1ZYRC 1WGHA 4L8JA 1XPRA 3TS0A 2MO0A 2K6QA 1B70B 4DR5Q 5HFYA 2DN8A 4KN7C 1TIID 1G6PA 4ASWC 2JF5A 2JYEA 4A9AA 3CMEA 5JXVA 3WCQA 4B3SL 2XRSD 1BUVT 1SB3C 3HVZA 4C3HB 3EQLC 4O0AA 3BZCA 5IODA 2BW2A 1D3ZA 4DK3C 5D2MB 1XPUA 1WTHA 4LNKA 1FR3A 2EJGC 1AP0A 1UWVA 2MX2A 2UXBQ 3NVZA 2FFKB 1PGAA 3ZO5B 3OW2A 5IAAC 4DAYA 2UUBQ 3KLWA 2C9WB 2G9DA 2MBEA 3PO2H 3IT6B 1FRDA 2DYOA 2BB5A 3DPDA 3BYTB 1I50B 4LF6L 3S16B 3J80c 5IWAQ 2RGFA 4OVUA 2BPSA 4JGHB 1PRTD 4YCUA 3ULJA 2KJXA 3I4MH 5EPLA 5FO9B 3BJUA 4A3GB 4K5WA 3HOZB 3B0AA 3DVNU 4AP4C 3K6OA 1JWMD 1DOLA 4G57A 3KYDD 3HOYH 3SFDB 4ARCA 1DOMA 4C1NI 4WFN3 3A74A 2JEAI 1CUKA 4POGA 1WR6E 2N7EA 4A3FB 1CK1A 4K5XA 2KMCA 2Y3AA 4HMJA 1B44D 1UD7A 3NK9A 4QJFA 1WE6A 2JA9A 2KDEB 4YWKA 1QOGA 4KY7A 4C3HH 3RCZA 1STAA 4RH6A 4OZAA 3A5UA 3VTVA 3K9PB 2EJMA 2UXDQ 3ZGZA 1IP9A 1OXUA 2VH2A 3GE8C 3EECA 4DK5A 3RI7C 3TMEA 1TVXA 3NELA 5IOCA 4KV2A 2J0TD 4LUVA 3MC0B 4JV5Q 2XK5A 4M00A 2JQOA 4DKAC 2JK8A 3P20A 2NVTB 4KD3A 4R9WA 2EYJA 1YITA 1JWAD 1TTNA 1WXSA 1EY6A 2IYDB 5T8IA 2F3IA 3S1RB 4KHPL 1EF1A 4LW1A 1MJCA 2PMZE 4GN4B 3RNCC 4YSZB 2CU1A 3K5LA 5E6OA 2FMMA 1N34Q 2MBQA 4C3IG 1G2SA 2R92G 3Q8CA 4GN5A 4FYDA 2INCC 4KSLC 1X3GA 2O2LD 4N8FA 1C9OA 3NY5A 4L23A 1VR9A 3QWZB 3I55A 3VAWA 5T1GA 5C4JB 1EZ8A 2BH2A 2G5DA 3SGIA 1SE2A 1T3QA 2KNBA 2D0OA 1I35A 2DAFA 2RHQB 2E74C 1PZJD 2WB1E 3NVYA 3AE5B 4MT5A 1EOVA 5C3WA 4LFAL 4A3JB 3GZNB 4LF7L 4MTKA 1YIJA 4DHZE 4NXNL 2MQJA 2L7RA 2EXDA 2KTRB 1PQSA 1I6HB 4W9GA 3J7ZC 2XN9C 3I70A 2D11A 3BZDB 3MXNA 4KZCA 3UGBB 1L2FA 4A3LH 1EIGA 4LF8Q 4C4VB 3T3NA 1LT6D 3V05A 1SNOA 1WJUA 4JK1C 1Y1WB 2L1BA 2A6HC 2LUEA 4S17A 3ZQ4A 1FJGQ 4N6EB 4GIVA 3BU2A 3ZXVA 4HKQA 4B95A 3X3MA 1QNUA 4IUQA 5D3DA 2Q8IB 2QEXA 1X55A 2KAJA 3PUVA 3A1QB 3M3JA 2JU6X 3H7PB 2V0GA 2ZM6Q 3FHWA 2LXAA 3E9SA 1EF5A 4A4IA 3UDIA 1B53A 3FRPB 2K28A 1JB3A 4QF4A 1C8CA 2WHIA 5C44G 3H9DA 2B2VC 2L05A 4LUZA 4AS1A 4GMVA 4W9LA 3CMMB 1DOXA 3AE4B 1LLRD 2J52A 3L17A 4LK1C 2LS01 1JB7A 2SEBD 5JH5C 1I7HA 1P16A 3KUCB 4R3DA 1GC6A 5DPTA 1PH8A 2L83A 3SK4A 3ONSA 5E4XA 4HJ5A 3SD5A 1MVKA 3MXGA 4MTNA 2PVGC 1HNWL 2WINB 2HIXA 1TIFA 4M8NA 2B3GA 4A93B 3TMPB 4LJZC 1QOHA 4QUCA 1MJEA 3ERQA 5FJ8G 1NYQA 4A3MH 2DLBA 3TBLD 3FKIH 4W9KA 2XGTA 4AIMA 3PLVA 5GAHC 3J7YW 2Y0SE 4XYQA 3V60A 2JXTA 3CRLC 1G2TA 1NUCA 2N9KA 3IFWB 4G7ZC 4LNOA 2F3WA 3RULA 2XWJB 1WXVA 2W9NA 4NY0A 2K14A 4M1UB 4O1NA 1RIPA 5EKLA 2ZTDA 4H13C 1CKOA 5IYBH 1YI2A 5DM73 1QQRA 5AZGA 1P7FA 2C5CA 4URKA 2L52A 2WQYB 2PZUA 5MPOA 2G4DB 3AFPA 4OGQC 1NR4A 4K2LA 2JA7B 2VH1A 3NSWA 1M90C 3DVNV 3APFA 4LLGM 3BDOA 4L5TA 2N3SA 4C4VA 1LXDA 4NDXA 3C0RB 2EE1A 1A15A 3J80E 1WXAA 3HG9A 4QL5A 2JT4B 3K80C 2LGDA 2MGSA 1WX7A 4FA6A 2NN6G 3CHBD 3S1QB 1SGHA 1YN4A 2BGFA 4R4QA 1JMLA 1EQRA
chains in the Genus database with same CATH topology
1IGDA 1TWFB 3TBIB 1SYEA 2QIEB 1O7ZA 2KEDA 2M19A 2X38A 4CKBA 2K1BA 4ITKA 2WDRB 1LTGD 3EUB2 1WD1A 4JBWA 4XWWA 1ONLA 5NUCA 2MJEA 4I7ZC 3UI3A 4YSXB 2WXKA 3FMCA 2ON8A 2EY5A 1I4HA 3BK1A 2NB0A 3CRKC 2WP9B 4KY5A 3NWSA 1YQ3B 2EY2A 2B8FA 1UWXA 1SNDA 5C2TB 3K57A 3N52A 2K03A 3D4RA 2V3NA 3EGRA 2F0UA 1SNMA 3M3YB 2WKCA 4CJ2C 3T3OA 2W3RA 2KCNA 3AE7B 1EWHA 3QWNA 2Y5CA 4KY6A 3SVMA 3SEBA 3NVVA 1C4QA 2PNRC 1U4RA 3DUZA 1TKWB 2H88B 1FRRA 2RDHA 4I65A 5EPJA 2EY6A 2RBMA 2K5QA 1V43A 2EPBA 1SNPA 1BF4A 1EY9A 3W2DA 3Q22A 5KNCA 2CJNA 2H1EA 3AE9B 1TYGB 3TZUA 2EOTA 1EOTA 1G91A 4IFDJ 2KQ3A 4QMGA 2LJIA 2DBYA 2MPMA 5I2XA 1WTRA 1JOQA 4KHZA 4OO1G 1L4DB 4Q5VA 1GB1A 3LNNA 2WS3B 1C78A 3GV6A 2VNUD 2K05A 3N9YC 3VR2A 4Y7NB 4WRDA 5BN5A 5DEHA 1WD0A 3P63A 4UDUC 3D6CA 3N6RA 1HTLD 4FP5D 1FXIA 1KNEA 3QO2A 2L11A 2WXRA 4IN3A 2AQ3B 2LMCB 2G1EA 1DD2A 4JWUC 1KRHA 3BS1A 3T13A 1JRPA 4HR7B 4RAUC 1MGSA 2RPVA 5ELEA 3OWFA 2K3UA 3VYUA 3AN1A 3ABVB 1KABA 5KRUA 2KWDA 3E6ZX 1EEFD 4XDCA 2F0TA 5G3LD 1Y56A 5JJZA 3NTHA 4JX1C 1B9RA 2XWBB 1ZXHA 4CQNA 2YYZA 1WCMB 3A8IE 3A8JE 3PUWA 1CQVA 2LFNA 1T6BX 4OZBA 1HZ5A 2Y5PA 5LHY1 1XEEA 1CA5A 5FO7B 3MTSA 4MIUA 4V190 3TEXA 3RFZB 5C0XG 1WXQA 3IXSA 1BCPC 2PQEA 3S1NB 4IUPA 1A6XA 2WXQA 2G9HD 4L63B 5EPKA 4NP5A 3NHHA 4XDXA 1SE3A 3IAM1 3E5SA 4OIKA 1OXTA 3MHZA 1ZE3D 3V96A 2L4NA 1TY2A 4X3SA 3H6MA 1S4ZA 3NUHB 3TUOA 4ZHOA 1S5BD 4WAFA 1E0ZA 1GHJA 2Z4HA 2IW3A 2K5PA 1FCCC 2QDBA 2B8GA 3TZDA 3AM9A 2IX1A 1MI2A 2IWHA 1H9MA 3PMFA 4BA1I 4TQ1A 1YNNC 1PFNA 5A35A 3P42A 4TMAB 1S5FD 1HCZA 1PUTA 4ZUJA 4IDIA 1GUOA 1IUEA 1MPEA 2F0MA 3LXFA 2ZW0A 5KIXA 4WJWA 4WQMA 4ODGA 1PTOB 1SSOA 2WXMA 3IAYA 1EZ6A 2V4DA 3GTPB 3OW7A 4XXEA 2MEKA 1FNWA 5G5GA 5C4ZA 2MP1A 5C44B 1G6ZA 5BMHA 2K9XA 1GUSA 4PV1C 3R8BA 1J7AA 1T5EA 3SK8A 5HGTA 4MM3B 1E2WA 1IW7D 1ZYRD 2Z8LA 5HG2A 2E2HB 1KNAA 2H4OA 2NN6H 2LHDA 2F0LA 1V1PB 3IT4B 4M0WA 3ONAB 5H8YE 2L55A 3HOVB 1FGBD 5D65A 2K7VA 4DNRB 1IL8A 1HFNA 3V2TA 1E9MA 4XE0A 1X32A 3VA7A 1ACCA 1GUNA 1HQRD 2R3ZA 3H94A 5IT9E 1XYIA 1JWBD 1SAPA 4LMQD 5JVH3 1ZDXA 2Q5WD 3DMUA 4Q2JA 2JEBI 4J1MA 2EZVA 4J3OD 1F9QA 2WV6D 4HEDA 1PDQA 2NTTA 2HQEA 3BVGA 4CJ1B 2D5GA 1IKLA 2DY8A 1Z6HA 3QB3A 4XTCS 3VRAB 1STHA 2KN4A 1YNJC 3J7AF 4A8XC 1IKMA 1BOSA 4YWGG 4OL7A 4BY1B 4RGNA 3MJ5A 4N9TA 3URYA 2FHTA 4ZRQA 4ABNA 2SNSA 4NW2A 1GJXA 3FILA 1TWHB 1E0BA 3I4LA 4YTMB 2XNAC 4HSVA 1MBYA 1GUTA 3PO3B 2AQ2B 2IDYA 3MFYA 1WTVA 4P6VF 4IUUA 4RCOA 3K0YA 3DXJC 3A55A 1SDFA 2R6GA 1A2TA 1XLQA 2GRIA 4X3UA 4ZRZA 2QCPX 4F8MA 2R93B 1S5DD 1IYVA 1CQFA 2NBFA 2EYLA 3NBIA 4GDKB 1SIJA 1Y69U 1FEHA 2BE5D 2BS4B 3KLRA 1Q10A 5FKAC 2XSCA 4YTPB 3MXUA 4EQNA 1O80A 3D3RA 5E1FA 1FCLA 2PKOA 1R9TB 3I8ZA 1DCZA 2K6AA 3T53B 2EYHA 2PIAA 1XLNA 1ZOYB 2X69A 2QJLA 1D1KA 4B9XA 2ZXPA 2JA8B 2M0AA 1RWSA 2ZT9C 2J4XA 1I4XA 2K04A 1C79A 4YTNB 3BG3A 1JCKB 1VLBA 2JYTA 4PT5A 2NMQA 1DM0B 1SYGA 1YNND 2O5JC 2BYTA 1SYFA 2N7JA 3S1MB 2KA7A 1GXDC 3Q23A 1DONA 4LTUA 2I46A 2N88A 3QJYA 4HMIA 5T1IA 1CJEA 3CWIA 2QILA 4KV6A 4Q0FA 1FO4A 4JWSC 3AEFB 3K5OA 5E6JA 1ENCA 4XWTA 2E76C 1WRIA 3Q8BA 4RHSA 4KKIA 4KN4C 3VR5A 4OZCA 4CBVA 2A74C 5E3FA 1F77A 3D4DA 1DYQA 3P7JA 5M3FB 2WACA 1BCPD 1K50A 4U673 1EYDA 1AN8A 2RSNA 4P16A 2BBCA 1RYJA 4F88A 4XQJA 3NVWA 2LKVA 5J1ZA 3C46A 1XWEA 1ET9A 1BXTA 2B2TC 1DGJA 4XIGS 4C3JG 2YU9B 2W82A 4FF2A 3H91A 3VYSA 1C4AA 3MWYW 4N58A 3C8YA 2LY7A 4P2CB 1WGKA 2EY1A 3P4RB 1RKNA 5ELFA 3P1HA 4BS9A 1JWUD 4ZKBB 1YQ4B 2Z1CA 1SMYC 3A7LA 4BA2I 3I72A 1F2RC 2DNEA 3GQBA 2ONQA 1N63A 3AMZA 3IKJA 5FR3A 1OXXK 4C3JB 3AEBB 4FF4A 2EJFC 5ISRA 2CU3A 3C1EA 3NTIA 1RHPA 3BVZA 2VZKD 3DWGC 4HCEA 1F2RI 2JSVX 4KJNA 1JROA 2JZPA 1T5XD 2F0NA 3S17B 3QOLA 5I2YA 1GUGA 4GLSC 2K5DA 4F7XA 2WXIA 1DZ1A 2QEJC 2HCCA 4O42A 3Q24A 1N61A 1JOKA 2FBWB 2VB2X 5I6WA 1QF6A 1TU2B 2NWGA 1TT2A 1CZPA 4A3DB 1FD7D 1V1PA 2SNMA 1C77A 1K52A 2PMVA 3T4AC 3X3NA 1SNQA 4K2KA 3B2GA 5BYRA 4A3KB 4EE2A 1PTOC 2D62A 1IHZA 3HOWB 5IGFA 5M5YB 2ACZB 5BN3A 3J80L 1TS2A 4N9PA 5BMIA 4ZQ3A 4DF7A 2WNMA 2X6GA 3VR8B 4DAVA 1TWGB 5J22A 2PO4A 3M4OB 3OIPA 2RVLA 3HVDA 3HOYB 1V8CA 2QMTA 1JE4A 1KF6B 1CA6A 1MHHE 4C3HG 3KUPA 3BDLA 1GHKA 1ENFA 1JQ4A 3GO5A 1FFUA 1Y8NB 2DNCA 3MHBA 1L6VA 1V97A 2B2UA 3MP9A 2WDVB 5A2QE 1LTSD 4HRSA 4S3SA 1OXSC 2EYPA 4B9WA 3HRDD 2A6EC 2HDLA 4ZAIA 2NUCA 1KLUD 4CGYB 2NVYB 4BBSB 4XDDA 2F4IA 1VZ8A 3E56A 4A3MB 5G3LF 3MFGA 4KGRA 4HEA1 3L9AX 1KDBA 5F2DA 1C76A 1YJIA 1WVLA 5CYUA 1ESRA 4FXGC 2B2UC 3A7AB 3W9CB 2TSSA 3OPOA 2YEPB 3BK2A 3VRBB 5AUKA 5C4HA 5C0XH 3G6JB 3AEAB 1KAAA 1RTNA 2X6LA 1JORA 1PLFA 3QOJA 2AWOA 1EU4A 1GUWA 3T51B 2EXZA 1VZ7A 5C0XJ 4C2MB 2M56B 4HCSA 2N55A 1RTOA 5GXGB 3MA2B 3HRZC 1EYAA 1ICWA 2E3TA 3JAML 1H9JA 1B9NA 3RLFA 3HEJA 1JALA 5ELCA 4HTHA 3O13A 1STEA 4OVZA 4ZOHC 5EE1A 2F0QA 3NE5B 5EKIA 2ICIA 2PCFB 3ZYYX 2AX5A 2K22A 2PYKA 4ZKCB 3VQIA 5ELDA 1R4PB 4FXDA 3Q8FA 1WTWA 4IUVA 1UUPA 3AE6B 2M9VA 3K5NA 1HA6A 4A3EB 4QUFA 1F2YA 1O7YA 4B0MA 5C0XI 1HQMC 5M3MB 4L2YA 4PMWA 1HUNA 4ZUIA 2KQ4X 2LGIA 4BWGB 1SE4A 3Q6SA 1RF2D 2WXHA 2VZKB 2K5WA 1MD2D 1SYDA 2M2LA 3HGBA 2R61A 2A6HD 4RNAA 1A70A 1TKEA 2V4IB 4DK1A 3S9WA 5C5MA 3A8KE 4FO2A 4XT1B 1N60A 1SNCA 1SBBB 1NENB 3NUCA 2ZXOA 1NSNS 2A5HA 2NVXB 4IUNA 2E2DC 1S5CD 4IOIE 4NZLB 3U2SC 4REZA 3CU7A 4BY7B 3NZ3A 2R92B 3AH7A 4HROA 1Q1EA 3Q0AA 3AB5A 3K59A 4MHEA 2K01A 1F2MA 3W5VB 1PRTB 1J9OA 3KBGA 4YT0B 1FNUA 4M8AA 1KH0A 3FEWX 4C1NK 1LO5D 2J53A 1ENAA 1TS5A 1I4RA 1QLBB 1QOBA 3I73A 2JXMB 1ET6A 1KDAA 2WXLA 1Z47A 2F03A 1CHQD 1E10A 3I3CA 4KKSA 1WTPA 5EE0A 1QOFA 3VA5A 3PZ8A 3F2UA 1C4CA 5JEAJ 1PRTC 2IT1A 2GB1A 3SHLA 5CV5A 2ZW1A 2L9HA 3SK5A 1XCQL 4B08A 1BBXC 1ZXIA 1QCBD 5IT9L 1D5MC 1XF5L 3LYYA 3P4QB 4PQXA 3AB9A 1AZPA 3PUYA 1U4MA 2RKSA 2B76B 3MVVA 2KVMA 1HPCA 4JPSA 1KFYB 4C7ZA 5C5LA 4K6DA 2DY7A 3VR4A 1NAPA 4U68A 3TP6A 1E7PB 1BR9A 3AMUA 1UGJA 4KK7A 2JYOA 3OWEB 3GTJB 4NAWB 3BYYB 1NEKB 1P7EA 2B2YA 1XTCD 2Y0SB 4IUTA 1FMAD 5AUIA 4G4KA 3J9CA 2MJ8A 4DFAA 3KWVA 2B2WC 4J6HA 1U4LA 3J81E 1DJRD 2RDGA 4G7OC 3SR1A 1QNKA 2EDGA 4FF3A 4NJCA 1Y8PB 4KTAA 4RKBA 4Z9CB 3W1SA 4FF1A 4C80A 1VCIA 4MH8A 1DXMA 4ME5A 4EQPA 4H2AA 4A55A 1I4PA 5CBEE 2F1MA 2A68D 3PUZA 2L0CA 1IBXA 5CV9A 1AW7A 1UWMA 2PPBC 2KUMA 3HS0C 2NN6I 1SJHD 5JOBA 4WIPA 3CQZB 5FLXE 1BNZA 2K33A 5CV4A 1XX8A 2JA5B 2GA4B 1M8AA 1EY0A 2MH7A 2HUGA 1A2UA 4C56C 1JQYD 3OIQA 5CGKA 3KF8A 5KNDA 1QWYA 1I3QB 5LL6X 3HKZB 1SXTA 3TP7A 3IFDA 2VB3X 2EVBA 4TSSA 4USAA 3GTMB 3V3XA 1WTQA 3T16A 3PO2B 5JEAH 5EE3A 4TRDA 4V0BA 1MSHA 1EQTA 2EKIA 2F0EA 2E75C 1RODA 1STGA 3VR3A 3P4SB 3R2TA 5M9OA 5IGDA 2KMMA 3J7AV 3NQIA 3RZOB 1FIQA 4H44C 2O4XA 4DA2A 2JSOA 5JVG3 1CFMA 3NXWA 1VMCA 3GD7A 2RMMA 3UI2A 1R4QB 2NZ1D 1H9RA 3A56A 4RKLA 1UNSA 1EYCA 1EFID 2KCCA 2FJ2A 3I90A 3EFXD 3I57A 4FVMA 4OIJA 3MAQA 3S14B 4AYBB 5K5PA 5EJWA 3WOEA 2F0SA 1S5ED 3U4EG 4DXFA 3Q8AA 3QIAA 3KLSA 2IGGA 4LK0M 1CTMA 1A3TA 4ULLA 3W3AA 4RF0A 3GTGB 3R2IA 4KD4A 1YN5A 3SXHA 5IGCA 4K14A 1TR5A 1EY8A 3AEDB 1CHPD 5C4XB 3M85A 2QF7A 4KGSA 1VDVA 1L0YB 3ITPA 1PDXA 2F0JA 5JAVA 1B9MA 2TMPA 1L0VB 3QG1A 2W54A 4K5VA 1QG7A 1PGBA 2I07B 3J81L 3R93A 3KK7A 1EQVA 4KKTA 2J7ZA 2HDMA 2RSOA 4DGZA 1MI0A 2LEKA 4NMZA 4RA8A 5CBAE 1L5PA 4QCLA 1HXYD 4F87A 2BA1A 4TQUS 4K8JA 3C3LA 5CC4A 2PW7A 4ZRPA 4RGTA 4D2KA 5JEAG 5IGEA 1G291 1HHVA 1F2ZA 1QILA 3U9OA 1BCPF 1K8OA 5FLXL 4PMCA 1UEAB 1F9SA 2F3VA 5CV7A 3PIP3 1RD9D 4KHVA 3WDNA 4YSYB 1SEBD 1QT9A 2HTME 1G8ZD 4J8QA 5DAUA 4GZYC 3Q8EA 1D5ZC 4YIJA 3PUXA 2IJ0A 1VF7A 1Y8OB 2PW9A 2DWQA 1U4PA 2L1AA 4UAIA 4FNFA 5C3JB 3U7ZA 1B1ZA 4OHJA 3NPPA 5KNBA 1MHXA 1UAPA 4XT3B 2IL8A 2A69C 1HRJA 2OT2A 3D6WA 4KX6B 2SAKA 3K7AB 3H3VC 2R7ZB 1J8IA 1CZGA 2L32A 3FDTA 1EU3A 3GP7A 2W55A 3S2HB 4X3TA 3RPFC 2D5DA 4EVOA 4IURA 1WTOA 1PMRA 1JC7A 3HUIA 2JQRB 1XLOA 1E2VA 4CJ0B 3FKIB 1XO3A 3K58A 3SFEB 3KWLA 2NYZD 4A6QA 3DHQA 3DWPA 5I6YA 4XYOA 3KBXA 2EELA 1OO9B 1D5XC 5FO8B 1HEZE 5C3EB 1N5WA 1ZXTA 4OO1H 1SJED 2MJDA 3AECB 5E4WC 1H9KA 3S2DB 4KI0A 3RMHA 3DWQA 4IQZA 3LB8C 2NTSA 1PFDA 2WLBA 1SFOB 3C1FA 1CI3M 2F0HA 1F0ZA 1K8MA 2A73B 1LTTD 4ZK9B 1GPXA 1CM9A 1KLGD 1NCVA 2CW0D 1BUIC 1EY5A 1ZUD2 1BDOA 2WXFA 2JP1A 3OSOA 5DNFA 1O7LA 1QB5D 3FILB 2N9LA 5CR3A 3OHXC 1O78A 3GB1A 1QE6A 5D3IB 4RGOS 3IAS1 4US8A 1PTOF 1LT4D 1TKGA 2PTLA 1FFVA 1CZWA 1F9RA 4TKOB 3EROA 1AWDA 2CJOA 2GI9A 4TQ0A 1JWSD 1LV9A 3AEGB 4MACA 3PV0A 3KQ4A 1ZPSA 4KKJA 2WAQB 3DWAA 1WYGA 2XIWA 1D6EC 1RDPD 2MJ3A 3I91A 2MHVA 1DOKA 2L12A 4EQOA 2BA0A 5I4DA 1B3AA 3BDCA 3NQTA 1PFMA 5J39A 1X3QA 1A3UA 3OMGA 1SYBA 4KMUC 3DWMA 1A3VA 2AQ1B 1SSNA 2PW5A 3GV3A 2PZWA 1Q3LA 1LABA 4DU9A 1RJTA 4DXGA 4A90A 2BDOA 1ZEQX 4L1BA 4FXCA 3TDQA 4K6LA 1FXAA 1HZ6A 1VJKA 4WORA 5D14A 5TSSA 5AFWA 1PZKD 3ND9A 2AWNA 2SDFA 1IYUA 3RUZA 2WXPA 5CORA 3SR6A 1I4GA 1Y1VB 3AU7A 2RDFA 2JWUA 3B2FA 5EQ0A 4RCNA 3VR9B 2B2TA 4KJOA 2EYMA 3P75A 4N59A 3LWUA 1VDZA 2DYMA 1Z7TA 4BBRB 5IGBA 4HAEA 2OEOA 2E2JB 2BDNA 5D7GA 4RHRA 4C7YA 3NTKA 3NBHA 1EWYC 5I9PA 1ML0D 2ENBA 1X3PA 2LHEA 3DEPA 1QJOA 1EL0A 2WU2B 3D4WA 3DEOA 2F0FA 5LNK1 2IGDA 1AYFA 1Q8IA 2Z4IA 3AE8B 1XXGA 1U9RA 3OMCA 4QIWB 5BYSA 5HI1A 3AE1B 2HDEA 2WIIB 1RM6C 3U52E 3H09A 3L3OC 5BMGA 1HA5A 1V1OA 2BCOA 1JOOA 3SE0A 1L4ZB 3GTLB 3M7GA 5C6AA 2W3SA 2YEPF 1BCPB 1LTAD 1OQQA 2F0OA 3ND8A 4RFBA 3JAME 2I2YA 5HHDG 3K5MA 1TY0A 2KOLA 4KKUA 1TJEA 3HZXA 1C48A 4US9A 2EYFA 1PZID 2F0PA 1B2TA 3W5UB 3MZ5A 1ZKOA 2B39A 1QOAA 2IX0A 1WWTA 4H7BA 1YN3A 1FM0D 3TEWA 1B4OA 1L0XB 2D2CC 5EBCA 2BS2B 1BQQT 1MSGA 3I9V1 1CT1D 1YJJA 4RWSC 3VYTA 1PTOH 1BO0A 3H0GB 2LUMA 2CW0C 3S15B 2BS3B 1VRAB 2FUG1 1E6EB 4ZYSA 1QKZA 2Q8RE 1K83B 4ID6A 1LTBD 4IFDH 3EA6A 1ILQA 4NAMA 1DOIA 1EY7A 3EVQA 3I4NB 4A3BB 1PXUA 3AE3B 3TP8A 5BN4A 2A6ED 5A2QL 1I4QA 1L6UA 1C4PA 2VUMB 3Q69A 1EEID 3FVQA 3VR6A 2LMCA 4DN4M 1FNVA 5I9OA 1EM7A 4MN3A 1TQOA 1KTKA 3AE2B 1OQRA 4EGVA 2E2IB 4HN7A 3GTKB 5C3XA 4IZ8A 5G5HA 4ARIA 1PFBA 2SOBA 3I4MB 2JE6I 5CV8A 4AQ7A 5EKKA 1BMLC 3LWEA 2B2WA 3PIO3 1I6VC 4XQNA 1RCVD 4DAPA 2I38A 2A69D 2WB1B 4H0LC 3U9SA 3AV8A 2JX5A 1PTOD 3BVMA 1LTID 1N5XA 4WWMA 1J7BA 1K51A 2KACA 3A54A 5FOBB 2V3PA 3AEEB 2VXWA 3LX0A 3T56B 5M5WB 1PGXA 5IGGA 5KYLA 3RD4A 1ZP0B 3TN2A 4CKEA 2B63B 2F0VA 4R8IA 2PMZB 3M4YA 3FPUB 4ZLTF 4OO1I 4GDLB 3GTQB 5K36H 2KEEA 1LTRD 3B9JA 2F0GA 2Q8TA 3P1MA 4ILWA 1LT3D 1RFKA 2PLPA 1W6JA 1ZDVA 4DK0A 4DQOC 2ID0A 1FD6A 3HP3A 4LAAA 3ZJUA 4ZHPA 1YMHE 1SYCA 2CQAA 3FC4A 5HURA 1ROEA 1C9FA 1V8QA 3D31A 1TZOA 4FXKC 3OOCA 1NVID 3TSSA 1ESFA 2ZXRA 2BOSA 1STBA 3SK6A 1SF0A 3P4PB 2NVQB 3GS2A 1TKYA 4KGTA 5EGTA 1IGCA 4IKGA 1SMYD 1TWCB 4WURA 2WXGA 1OFFA 1GAQB 3WOFA 1LACA 1D4BA 1H9SB 2J42A 1NR2A 1D2BA 2F0DA 2C9OA 1STNA 1EIHA 1VMPA 3NP8A 2INPE 3NS1A 2INNE 4B0EA 5JPNC 1KDCA 2B2YC 3NRZA 3M7NA 2RA4A 3KLSX 2OHFA 2FINB 5EE9A 5DM63 1F9PA 4X3KA 3TEYA 1AFPA 2XRQD 1OXVA 2N0SB 1B50A 4IFDG 4RGMA 1AEXA 2WKDA 5KYIA 3GTOB 1AZQA 3IL8A 2PVOD 1GB4A 4E6IA 1W6KA 4IALA 1XLPA 2IX3A 3HOXB 3VYRA 3ETRA 3IFTA 3PO0A 1VZ6A 1WTXA 1HUMA 1XCTL 4C3IB 5H92C 2RQXA 4XQQA 1GOZA 3CIRB 3RZDB 2D9UA 3MEHA 1H9SA 5JPMC 4K8IA 2WXOA 1ILPA 3HOUB 1F2LA 2IPKD 1Q12A 2WXJA 4PMBA 3CKIB 2O5IC 3H8HA 2EYOA 2ICEC 2OF1A 2BTEA 2KHSA 5EBDA 3L4PA 4NKLA 2M00A 2BE5C 4QB4A 2WDQB 2BB6A 1TS3A 4PNYA 2OXPA 5KEEA 5CMDA 1PRTF 5ELBA 4WH4A 4JE3B 5BYQA 3G7LA 5COYA 4HJGE 5FK9C 3TP5A 2AUJD 4CKCA 2WU5B 2H89B 4R8NA 1JICA 1R7SA 4DNTB 2K32A 4CHTB 2KDMA 2K0PA 5IIFA 2MUYA 2QSDA 4G7HC 2L5TA 3C2PA 3BWUD 2F0WA 1PYWD 1II3A 1WSPA 1NI3A 1VF5C 2JA6B 4HKZE 1JW9D 3ZJVA 2AUKA 1J7CA 5M5XB 4HSPA 4RF1A 4IFDI 1NYRA 2LFIA 1YNJD 4L6TB 3BIID 1EY4A 3ZJTA 1Q90A 1FYCA 3DM1A 3TEZA 1LT5D 2WXNA 1HFGA 2QKIC 2A68C 1DOYA 2WP8J 1E2ZA 2KECA 2FE8A 1TS4A 2IGHA 2HCIA 3FPPA 3SDZA 1HTPA 4A3IB 1D1IA 4YXDB 1EWCA 3EJIA 5CV6A 2BT6A 3R3OA 3D8GA 1YNTE 1Q1BA 5K36G 3FAHA 1IBXB 2F0IA 5LL6S 3NWTA 2CVRA 2OEDA 2F0KA 1STYA 1K53A 2E6XA 2B2VA 1JR0D 1N62A 5KGUA 3MXPA 2CHBD 2PZTA 3L7ZC 2FMCA 3E0JA 1M4VA 1TWAB 2XVSA 1IW7C 1ZYRC 4L8JA 5HFYA 2DN8A 4KN7C 1TIID 2JYEA 4A9AA 5JXVA 3WCQA 2XRSD 1BUVT 1SB3C 3HVZA 4C3HB 3EQLC 5IODA 2BW2A 1FR3A 2EJGC 1AP0A 3NVZA 2FFKB 1PGAA 4DAYA 2G9DA 3IT6B 1FRDA 2DYOA 2BB5A 3BYTB 1I50B 3S16B 1PRTD 2KJXA 5EPLA 5FO9B 4A3GB 4K5WA 3HOZB 3K6OA 1JWMD 1DOLA 4G57A 3SFDB 4ARCA 1DOMA 4C1NI 4WFN3 2JEAI 4A3FB 1CK1A 4K5XA 2Y3AA 4HMJA 1B44D 3NK9A 1QOGA 4KY7A 1STAA 4RH6A 4OZAA 2EJMA 3ZGZA 1OXUA 3TMEA 1TVXA 5IOCA 2J0TD 3MC0B 3P20A 1JWAD 2NVTB 4KD3A 4R9WA 2EYJA 1EY6A 5T8IA 3S1RB 4YSZB 3K5LA 2FMMA 4C3IG 1G2SA 3Q8CA 4FYDA 2O2LD 4L23A 1VR9A 5T1GA 5C4JB 1EZ8A 1SE2A 1T3QA 2E74C 1PZJD 3NVYA 4MT5A 3AE5B 5C3WA 4A3JB 1I6HB 2XN9C 3I70A 3BZDB 3MXNA 3T3NA 1EIGA 1LT6D 3V05A 1SNOA 1Y1WB 4JK1C 2L1BA 2A6HC 3ZQ4A 4N6EB 4HKQA 3X3MA 1QNUA 4IUQA 5D3DA 2Q8IB 2KAJA 4OW0A 2V0GA 3PUVA 2JU6X 3E9SA 1C8CA 1B53A 3FRPB 2K28A 1JB3A 4QF4A 2B2VC