1I4PA

Crystal structure of staphylococcal enterotoxin c2 at 100k crystallized at ph 5.5
Total Genus 63
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
63
sequence length
239
structure length
234
Chain Sequence
ESQPDPTPDELHKSSEFTGTMGNMKYLYDDHYVSATKVMSVDKFLAHDLIYNISDKKLKNYDKVKTELLNEDLAKKYKDEVVDVYGSNYYVNCYFSSKDNGGKTCMYGGITKHEGNHFDNGNLQNVLIRVYENKRNTISFEVQTDKKSVTAQELDIKARNFLINKKNLYEFNSSPYETGYIKFIENNGNTFWYDMMPAPGDKFDQSKYLMMYNDNKTVDSKSVKIEVHLTTKNG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of staphylococcal enterotoxin C2 at various pH levels.
pubmed doi rcsb
molecule tags Toxin
molecule keywords ENTEROTOXIN TYPE C-2
total genus 63
structure length 234
sequence length 239
ec nomenclature
pdb deposition date 2001-02-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01123 Stap_Strp_toxin Staphylococcal/Streptococcal toxin, OB-fold domain
A PF02876 Stap_Strp_tox_C Staphylococcal/Streptococcal toxin, beta-grasp domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.110 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1i4pA01
3.10.20.120 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 1i4pA02
1EEFD 2CHBD 3BYTB 1LT5D 2XRQD 3EFXD 1DYQA 1I4RA 3BVZA 3BZDB 1D5XC 1LTAD 3CHBD 1TS5A 4L63B 1JR0D 2NTTA 2AQ2B 1JCKB 2O2LD 1SBBB 1ENFA 1UUPA 1FNWA 1SE3A 1DJRD 1D6EC 1BXTA 2XNAC 1HXYD 4O1NA 1STEA 5ELDA 1LTRD 4RFBA 1JQYD 4K6LA 1PTOD 2RDHA 1I4HA 3DWAA 1CHPD 3R8BA 1YN4A 3BVGA 1SXTA 1TY0A 1TS4A 1I4XA 1KLUD 1LT6D 4UDUC 1V1PB 2G9HD 4RGTA 1YN3A 5D3DA 1LT3D 1PRTF 1CT1D 2R61A 3MC0B 5ELCA 1AW7A 1G8ZD 1HA5A 3BVMA 4BWGB 4OHJA 1V1PA 1PZID 2AQ1B 1PRTC 1D5ZC 1EEID 4L6TB 1EU4A 1SE4A 1EFID 1BCPC 5D3IB 3EA6A 4NZLB 1I4GA 1ET9A 3W2DA 1CHQD 1PTOB 3DWQA 1CQVA 2XRSD 3R2TA 3URYA 1HTLD 2TSSA 1BCPD 1S5DD 2J4XA 1I4PA 1FNUA 1T5XD 1QILA 1L0XB 1PTOH 1PYWD 1S5CD 2NTSA 1S5ED 1GOZA 1S5FD 5ELFA 4DXFA 1TS2A 1FNVA 3MFGA 4RGNA 1LTBD 1F77A 1ET6A 4RGOS 1SEBD 1BCPF 1KTKA 2QILA 3KLSX 4RCOA 3R2IA 1UNSA 1SJED 3TSSA 4C56C 2IPKD 4TSSA 3BYYB 1PTOC 1RDPD 2IJ0A 3V05A 1S5BD 1XTCD 5ELEA 5ELBA 1I4QA 1BCPB 1FGBD 2Z8LA 1FD7D 5FK9C 1LTID 2XN9C 1TS3A 4DXGA 1RCVD 4RHSA 1M4VA 1PZKD 3GP7A 1EU3A 1ESFA 3OWEB 4RHRA 1TY2A 1AN8A 1B1ZA 2AQ3B 5TSSA 4ZYSA 2QEJC 1PTOF 1MD2D 3O13A 5I4DA 1LT4D 1LTSD 1PZJD 5FKAC 1D5MC 2ICIA 4RH6A 1V1OA 1LTGD 1JWSD 4RGMA 4Z9CB 1XXGA 1RF2D 3SEBA 1PRTD 2WV6D 1LTTD 1LLRD 1KLGD 1LO5D 1JWMD 1RD9D 1CK1A 2RDGA 3DWPA 1PRTB 1SE2A 2SEBD 1L0YB 1B44D 1HQRD 1JWUD 1SJHD 1YN5A 1EWCA
chains in the Genus database with same CATH superfamily
1J8CA 1I3QB 5FO9B 1BMLC 3UDXA 3CMAA 1QVGA 3BVZA 3GTQH 2HD5B 5NUCA 3VR4A 1S40A 4WAAA 2DNFA 1SYCA 4PS3A 2XNAC 1C0AA 1ACCA 3TQYA 4HPMB 4G0NB 1N5XA 3SR6A 3PF5A 4FADA 4DR4L 3KYHC 1UWVA 2GBMA 4US8A 5GROA 3FP9A 3I55A 1DCZA 1VQ6A 1I4HA 2INCC 4D2KA 3UDIA 3QB3A 3G7LA 4C3IG 3LXFA 5HGTA 2K6QA 2FBWB 2KN5A 3VUWA 3FPUB 3VVWB 2ZM6Q 3VR6A 2E2JH 4M8MA 5IKCM 3A33B 2NVXH 2W9NA 1K50A 4JWSC 4L1BA 1T0SC 3NBHA 1WTQA 3PRPB 2PZTA 3I4MH 2JA6G 1V81A 1H9KA 2WXRA 3ZIMA 4L6TB 3PUVA 2HD3A 5LMNQ 1X6OA 1CSPA 3RPFC 1GJZA 3NHHA 1PV4A 2DLBA 1X3QA 2O2VA 2EZVA 1M90C 4K0KL 1NNXA 2B8GA 3URYA 2ZXPA 3MTNB 3A4SC 3H09A 3PV1A 1MHXA 3K57A 4LWCA 5DM73 3S1QB 1PYWD 2UUAL 1BKBA 2JT4B 4W9FA 3PO2B 3QOLA 4FXDA 3EECA 3D4DA 4QF4A 5BR8L 4NMZA 1D4BA 3EUB2 5A2QL 3LGJA 1DOYA 5IYDG 3J7AV 1K8OA 3MAQA 3P75A 1R4MB 2XK5A 3KLSX 5ELOA 2LZ6A 1WYGA 4R1JA 3NS1A 1RHPA 3TN2A 2AWTA 1BOSA 3GE8C 1B4OA 2CJNA 3PLUA 2TMPA 5JEAG 1P9DU 3T53B 1CZGA 3A1QB 4M02A 4W9KA 1ZXIA 3CP0A 4K7UA 3E0JA 4NJCA 4JI8L 1VQDA 2A19A 4IWPA 3RN2A 2JYEA 1F9PA 3PIO3 4LMQD 2MJDA 1Q46A 3ZVVA 4JI2L 4LK0M 5C4XG 3EFCA 3DLLA 2ZJDA 4WIPA 2LSSA 1ZOYB 3PIPA 2CWAA 2MSED 5HG2A 2JA7B 5C4HA 1RIPA 1E1TA 4I6PA 3QAQA 2VQEL 1JRUA 2GBRA 5M5XB 3LJ3A 5I4DA 2CKZB 1B9NA 4R4IA 1UBIA 1IZ6A 3ONAB 1EY4A 1Z47A 1CMXB 2ZEQA 1C3TA 4A3JB 2D07B 5GADC 2UUAQ 1ZE3D 1EO6A 2JA5B 2J52A 1C78A 2A6HC 4GNXB 2WP8J 1K0SA 5BMHA 1K3BC 1MJDA 2MJ3A 3EHVA 2MWSB 4IM3A 5IIFA 1V1QA 2RPQA 3MXNB 4R8NA 1X54A 4OO1H 2R92B 4DWFA 4ANUA 1STHA 4DV1Q 2XIWA 4A3FB 2R7ZB 1MPEA 1BBXC 3B0AA 5D7GA 5HFYA 3EJIA 3W5VB 1F2YA 3MZ5A 2BW2A 5C2TB 3M4QA 3K6OA 1XQQA 3F2DA 1XO3A 3BZDB 2J42A 2L0CA 4X65Q 1TS5A 1XMOL 1SMYD 5EBDA 1XPOA 4JI5L 3R66C 3ML9A 2ICEC 4IO9A 3S2HH 1L4DB 5EE3A 3SHLA 1C8CA 4UHVA 1WY8A 4II3B 3CC4A 4LDTB 1EF1A 2RDHA 3IHPC 3V2TA 3GDEA 2OTJA 2MBHA 5HURA 2CHWA 3H6NA 5M3MH 4BKTA 3HM3A 1GAQB 1SAPA 5M9OA 1WD0A 1YNNC 2ZPYA 4DK6C 4KD4A 1CT1D 1L1OA 4JIOU 1HZ9A 2LI5A 4JV5Q 3QQ8B 4YSZB 4DV0L 4DR3L 4BBNF 4DUYL 2VQEQ 1Q1BA 2VS1A 2WXHA 4AS1A 2FCSA 2KFKA 1TZOA 3S1RH 1K0RA 1NE3A 1ILQA 4EQPA 3H91A 1P16A 2YTVA 4NAWB 4B3SQ 3NVYA 4HJKA 3M63B 5J39A 2BWES 4RM9A 5GXGB 5LXHA 3GTMB 3W1SC 5ELNA 4DPGA 1VQOA 3HOZG 4CKBA 2KVZA 2CHXA 1PTOB 1TU2B 2N3SA 4K5VA 3Q24A 4A3MH 1WJUA 2H88B 4BVUC 4KK7A 2WWZA 1QLBB 1PA6A 3JVZX 3T9LA 4P74A 2NVQB 4F7ZA 2WXLA 3NZUA 3GTGB 4R8IA 4HAEA 1II3A 2NR2A 4RGNA 3ZJUA 3T13A 1I94L 1QOAA 3PUWA 2UXDL 2J0JA 2KNBA 4HCPB 2NS5A 4ULLA 2C7HA 3ZYYX 3S16B 2L52A 1D8LA 4A55A 2KENA 4GN5A 3Q8FA 5LXIB 4TSSA 2XK5B 2HUGA 4HJ8A 1Q1EA 3HHMA 3GS2A 1R4PB 2WXMA 2LUEA 4PYZA 3ALBA 2Z9HA 3ZRCA 1FD7D 2EYJA 2W55A 2A74C 2K28A 2K1BA 1XNQL 2FNJB 4RCNA 4XT1B 4BBSB 3DHGC 2DGYA 2F0KA 2WAQG 1V8QA 3UINB 1TY2A 2RBMA 3E0EA 1NYRA 3N9YC 5TSSA 4TKNA 1B50A 2AX5A 3QJYA 3A8IE 3C3LA 1GUWA 2RHSB 5D14A 1EM7A 2NBWB 2ENBA 3QARA 2FCQA 4CGYB 5JJZA 4LUVA 1W2BA 1WYDA 3V6EB 1LABA 4ZLTF 3DBHB 1JT8A 4IUVA 4DV5L 1PRTD 3TBLD 4YHHQ 1IBKQ 2V4LA 2RSOA 1AFPA 4ITKA 3PIP3 4C3JH 4FP5D 4IM0A 3CPFA 5BMGA 2PW5A 1HFNA 4A20A 1CK1A 1GUOA 1PRTB 4B3SL 2AEHA 1J5EQ 4W9CA 1PH6A 4O2DA 4DR2L 1B9MA 2BB6A 5D94A 5JHBA 3X23A 1MG4A 4LLGM 1YN5A 2DNEA 1G2SA 3WOFA 1VZ8A 2DHZA 4DV3L 1C9OA 2BVCA 2ZJRA 1MI2A 2D0PA 4MZ9A 1FM0D 1J9OA 3CHBD 3PUYA 1I7HA 1UE7A 2FIDA 4MGIE 5EPJA 4C1NK 2Y5PA 4BKGA 2DY8A 2PVOD 2HQEA 1ZKOA 3RZDB 4BY1H 1VDZA 4QB4A 1V9JA 4LNNA 1XLQA 2INNE 1WGGA 3TJPA 5LLIA 3V60A 3JC66 4LW1A 3KQ4A 2HQLA 5IO9A 1E90A 1OXUA 3WAOA 3LWEA 3VDYA 1A70A 1S1QB 2N0SB 5M5YB 3S1RB 4FJZA 4FHKA 1YI2A 2KTRA 1KQSA 3R8BA 5JJKA 3GTJH 1LV9A 2C5LC 1VQEA 1EQTA 2IL8A 4N8FA 2AL3A 4EQ5A 2K6DB 2LXKA 4CHKA 2JUOA 1I4XA 4JI6Q 2L05A 2G9HD 2KCMA 2ASBA 1A5RA 3P20A 4OX9Q 3SDZA 4ZUIA 1WE6A 3OJ4B 2F52A 4YCUA 4DFAA 3VAWA 1ML0D 2JA6H 1EOVA 1VQIA 1DM0B 4H13C 4A3EG 1WXMA 1P1AA 3A0JA 1VCBA 2N7JA 1P0RA 3J7A5 3S17B 2J7ZA 3FHWA 2KN4A 3OJ3A 3MXUA 1B8AA 1Z9FA 1SE4A 2IY1B 3UE0A 4CJ1B 3L10B 4JE3B 3TUOA 4N8X1 5CBEE 1WX8A 5EDSA 4QIWE 3LWUA 3U30A 4WH4A 3F8TA 2EXZA 2BWFA 1S5DD 4JC0A 1FNUA 2NUCA 5JOBA 2I5MX 1NEKB 4DDGD 2B2TC 5FLXc 2Q2TA 4S0RA 1P98A 2PLPA 4KGSA 2BTEA 3E5SA 3PUXA 5M5XH 4Q0FA 4WRDA 1H95A 5DLQE 2WXJA 3KYDD 2KEDA 2GI9A 1T0QC 1SEBD 2GBNA 2H89B 1U4AA 3NRZA 2IW3A 3ULPA 2FIFA 1B2TA 2MNAA 1TWHB 2K5NA 2NZ1D 1EUJA 1TKYA 2INPE 4DF7A 3VHTC 1WCMB 4GKKL 4LJOB 4YL8A 1HUNA 4ZOHC 3VFKA 4QAYA 2F03A 1S5BD 2GVBA 2KA7A 4HMJA 3T8MA 2BYVE 1N60A 4Y52H 4YTMB 2EJMA 1STBA 3IT6B 1LTID 3U4VA 2Y5BB 3WAPA 3B2GA 4N9F4 1RCVD 1ESRA 2OXPA 2DBYA 3PZ7A 3GP7A 4LF9Q 4B3RQ 4OIKA 1DOKA 2VRRB 3QIJA 4KZCA 2KFJA 2JSOA 4JLCA 1YD8U 3Q8EA 1L2FA 2MHVA 3T1YL 1FCLA 4FF4A 1MKHA 5COYA 3O13A 5DPRA 1WI0A 3T56B 2QDBA 2V4DA 5KYLA 2Q2IA 2F0OA 3CCJA 1JALA 3HOWB 3AMZA 4JI7Q 1I6VC 1WSPA 3V96A 2J0MA 1WJNA 5CX3A 4K0KQ 4MTNA 3AFQA 1ZYRD 1LLRD 3TREA 4YWKA 2E2HH 2VH2A 3OHXC 1CTMA 3OTOL 1GC6A 4EZLA 1IL8A 5JJLA 4BAXA 1X1MA 3AU7A 1E1OA 1YJNA 1SE2A 2SEBD 4OL7A 2UXBL 4M0WB 1WGRA 2D5DA 1C4CA 1Q3LA 1I3QH 2V1YA 1FGUA 4IUPA 1K73C 1JROA 1TJEA 2UWQA 3I3TB 4IPCA 1VQPA 1ZUD2 1YJJA 1QF6A 3U7DA 2B63H 1IUEA 1C4AA 1WFYA 1U4RA 2A4ZA 4UPAA 5J18A 4MM3A 4AP4C 2IZVB 2A8VA 3MVVA 1SE3A 1R4NI 5CV9A 3N1YC 2MEKA 2CJOA 2D11A 4ARIA 4LNIA 3UE1A 1K83H 2EJGC 4BA1I 3QC8B 3PO2H 1PTOD 1U9RA 3ZO5B 1ENCA 3DWAA 1NAPA 5J22A 4LCDE 1YN4A 4XYQA 4HEDA 2PCFB 3TEXA 4AYBB 3WIMA 3UGBB 3ZW3A 3J7ZC 1H9MA 1H9JA 1Y1WB 2NVXB 5LL6S 2KK8A 1I6HH 4PG3A 1LT3D 1VQ4A 4B3TQ 5LHY1 1TKWB 1G8ZD 4BWGB 3CCEA 3ULLA 1QZGA 1E7UA 3B9JA 4OVVA 3CSTA 5EQ0A 3M95A 4RMFA 1EYCA 4HROA 5JH5C 1LM0A 2K52A 2O6VD 3KUPA 4M8AA 4RF1A 3ZGZA 4LNKA 1Q0WB 3AE7B 1ZDVA 5IGFA 2QEXA 1CA6A 1QE6A 1FL0A 1BBUA 1YQBA 5FOBB 1CHQD 4BKSA 5DEHA 5EE1A 1ZEQX 2A69C 5DM63 1L5PA 1X3GA 4HIKA 2A1AA 1NI2A 3NVVA 3T1YQ 4C2MH 4IURA 1K8GA 1YIWA 4EQOA 1WJ4A 4R4TA 2MP2A 1MJEA 1WTHA 1TWAB 1FCCC 3PZ8A 4KX6B 2V3PA 4DR3Q 4WAFA 4YIJA 3NBIA 3BIID 4A3KG 2WDTB 1IYJB 3R2IA 5C3XA 2GLSA 3DOWA 4ME3A 3FAHA 5D6JB 2MX2A 2L1BA 3QOJA 2J0TD 1SNOA 2BDOA 1GB1A 4ZAIA 4A93G 2A73B 4K81A 1PLFA 2UUCL 3TEHB 3EBEA 1IBML 2I07B 2PQEA 3E3XA 4DAYB 1H4RA 3RLNA 5CV6A 1FGBD 1E2WA 2PW7A 1WWTA 4MGYE 1T0YA 3OYYA 1Q12A 2OT2A 2F0TA 5C3WA 2PZUA 1GNUA 2MJEA 2IT1A 1LTLA 1GHJA 1UD7A 3ETRA 1EY8A 3A54A 4S3SA 3HOXG 2R7DA 4ZYSA 1I6HB 2NCNA 1IXRA 2RKSA 2NPTB 1XNRL 1VQFA 3KVFB 1XWEA 2WXNA 3T3OA 1S3SG 3U7ZA 1SGHA 2R93H 4IJHA 5I6YA 4K2LA 3GTPH 2KACA 4HIMA 2L8JA 2JA8H 2M19A 2ICIA 3MA2B 1HEZE 3VR9B 3A55A 1LTGD 3KBGA 3QO2A 2D2QA 4KI0A 2O5IC 2PTLA 5G5GA 3W5UB 3D4WA 4XE0A 1XXGA 3X3NA 4XWWA 4JOIA 4CO7A 3S1NB 2EVBA 3UDGA 3RNUA 2VNUD 2HJ1A 3I63C 3Q8CA 4X66Q 1S4ZA 5IT9E 1AWDA 4JI1Q 3J81j 1MI0A 2OEOA 1G91A 2F0HA 4GLSC 2NWGA 1V5TA 2XSCA 1BUVT 4M1UB 3V62A 1F0ZA 3R93A 3NENA 3KK7A 2D10A 3C0RB 5C0XJ 2CHBD 2L3ZA 2LMCA 3QK0A 1ENAA 1ZPSA 4K5XA 4L63B 1Y1WH 4MSMB 5D2MB 3N6RA 3RNBC 2KLCA 3ECIA 3HP3A 1KABA 2O2LD 3N32A 2KDBA 2L76A 4BKSD 3RNGC 5D65A 4UY8C 2YVCA 1HXYD 2NZHA 4PZ6A 3AV8A 1F2RC 1O7YA 4AQ7A 1VF7A 3PT2B 2LGDA 2WB1G 4K6LA 3GTGH 4ME5A 1SIJA 3W1YA 1K28A 2K5QA 4J1MA 1G51A 3IKJA 1YNJC 2AWOA 4JI4L 3S2DH 4IFDI 3H7PA 4R3DA 4FYDA 5E6NA 4BZAA 2BYEA 1WJJA 2KO3A 1OXTA 1P7EA 2F0QA 3IL8A 1SMXA 4PK1A 1AW7A 3HK0A 1QNKA 2EKIA 1GB4A 4OHJA 2EELA 1TZ1A 2KQ4X 3AEFB 1EIGA 2LFIA 2UUCQ 2JA8B 2KWCA 1TR5A 3H8HA 4IFDJ 4OO1I 1QOBA 2GBKA 4AUQC 2N88A 1NMFA 1KDBA 1FIQA 1WR1A 4NQLB 2EYPA 5M3FG 2WACA 4QY7A 1CZPA 3EQLC 2IO3B 1KDAA 1QUQA 4O0AA 5FO7B 1BCPC 4DAYA 1PH1A 2B3GA 2NYZD 1NSNS 2K0PA 5TR5A 5JXVA 3H0GG 3W2DA 3TEYA 1CQVA 1EF5A 3WANA 1FPYA 2K50A 2Z6BA 1I4PA 4OXPA 5M3MB 1PFDA 2JXMB 1Q7YC 4BY7H 2HTHA 2B2WA 3KLWA 1WGYA 3ZJVA 1S5ED 1T9HA 1AE3A 4YSXB 2GMIC 4W9LA 4LNFA 4TKOB 3TP7A 2QJLA 3TCAA 3J7AF 1VZ7A 1N61A 4KKUA 2ZZPB 3CSFA 1M94A 3Q14C 4CBVA 4GSWA 2GB1A 2O2VB 2ZCCA 3I73A 5L37A 4LJPB 1WF9A 2BQQA 5C5LA 2O5JC 5I9OA 4BOZB 1QVCA 4WORA 3GTPB 1WI5A 1IYFA 1NVID 1D1IA 3KOJA 2N9PC 4LFAL 2LHDA 4YSYB 4K2KA 1SNMA 1S72A 1PH7A 4DR6Q 5EE9A 2EIFA 2K7VA 3I8ZA 1BO0A 5FR3A 2LRWA 3FILB 1HZBA 5J2RA 1SR3A 2Z0SA 4J3OD 3RI7C 3NZ3A 2E2IH 3RULA 2JU6X 2KMCA 1O80A 1HA6A 2WS3B 3TZUA 4KGTA 4WQOB 3M62B 3GV3A 4JYAQ 1RAXA 1L0VB 3T3NA 3ML8A 2SDFA 4A3BG 3AH7A 3Q22A 3A9KA 1LGRA 4RH6A 4KHPQ 2HCIA 2C7NB 3BZKA 1CI3M 3L13A 4LNOA 4OIJA 4A3DG 3AM9A 4I7AA 4IQZA 4LFBL 5IYDH 1JOQA 4IKGA 1N62A 2JSVX 4CYEA 2MBBB 1RD9D 1WGKA 3KH0A 1L0YB 2A68C 1HQRD 3KBXA 5IAAC 4G50A 4KY6A 1F52A 2FCMA 4W9DA 1U4PA 4ZCKA 2MH7A 1HH2P 2WU5B 1ILPA 4X62L 5G3LF 2K5PA 4JWUC 3U4ZA 1PQSA 3C1EA 1E10A 3L9AX 3U9OA 3L17A 1KAAA 2C9OA 3QR8A 2EJFC 2PMZB 1PH2A 2PO4A 2LWPA 1H9SB 3PF4A 5CYUA 3P63A 3HUIA 1UGJA 1FVIA 3PSIA 2EYMA 5AFWA 4LJZC 3KWLA 2FMMA 2I2YA 4BBRB 4Q5VA 1FMAD 1PDQA 2FJ2A 4KSKC 5C4JH 3RZWC 2WLBA 1IGDA 3GQBA 3JSVA 3KJOA 1IKMA 2L11A 5DAUA 2OWOA 1PH9A 2WB1E 4H02A 1V43A 4UDUC 1P3QU 3ZTCA 3QHTA 4OO1G 1AZQA 4KGRA 2M00A 3U2SC 2IHEA 2MUYA 4X64Q 3A4RA 4G7OC 3FDTA 1BUIC 3IRBA 1IKLA 1C79A 1SB3C 3RN5A 5HHDG 3HS0C 4ZRIA 2ZVOA 4EUTA 3K9OB 3DBHI 3NUCA 1YIJA 4BOSC 1FJGQ 4DNRB 3L7ZC 3A8JE 2I0QA 4LFAQ 2KAJA 3D32A 2KQSA 2KCNA 1C77A 4IFDG 3RZFA 1S5CD 4CQNA 4IM2A 5E6PA 1TT5B 4KMUC 1GOZA 4C4VA 4DXFA 3J81i 4NAWA 4DHZB 1K3RA 1Y1VH 1LTBD 1CKNB 1KTKA 4A90A 1UNSA 2ACZB 3T4AC 5T1GA 5KRUA 4YHHL 2AMCB 5ISRA 1ZP0B 2MO0A 3V05A 1QVFA 2LJ5A 1YOVB 3NTKA 1W3SA 3L2PA 4FBJB 3PV0A 3NS8A 1XCTL 2LGXA 1W6JA 1WYWB 3V61A 4IUTA 4ZHOA 2VUMG 1VQ7A 2BYFA 5DNFA 2O6VB 1GUSA 5I2XA 3QG1A 1B1ZA 1WGDA 2MRPA 4IWQA 5IP4D 4P72A 4ZKBB 4PT5A 3ZKJC 1MD2D 2KDIA 3P2BA 3I4OA 4POGA 4MTKA 2KTFA 3CW2C 2IO2B 3B2FA 2CFMA 4OGQC 3STBD 1V1OA 4QUCA 4JBKA 4IUQA 2ASQA 2IGHA 3NOBA 1PFNA 5CC4A 2Z4IA 1JOOA 3S2HB 1GKHA 4JI4Q 4LF7Q 4NKLA 5KNBA 2RR9A 3K9PB 4OZBA 1TT2A 5CR3A 5J17A 3LNNA 1RJTA 2JF5A 1EYGA 3ZXRA 2OQ0A 3FRPB 2AKWB 3CF5A 4FHJA 3K7AB 1KD1C 3ZLZA 2R7FA 1V6EA 2LD9A 1LQBA 3DBSA 1XMQL 2F0IA 1X9NA 4HWIB 2WKDA 1M8AA 1D3ZA 2B2VC 2AUKA 3EFXD 4CKEA 1DYQA 1QOHA 3FKIB 2RF4A 4R4CA 2V3SA 1PFBA 5FLMH 1KRSA 3J81L 3AEVA 2AYOB 2L7RA 3APDA 5CTRC 4A8XC 4MJSB 2F3IA 1GUTA 1SSNA 3GTMH 1K83B 1Y14B 4XGAB 1E8ZA 1VQHA 1GVPA 1TWFB 5KIXA 4DR6L 4KDLB 4MH8A 1V97A 2EXDA 3TS0A 1NI3A 4KKIA 2RSUA 2D62A 2H4OA 3AB9A 1J7CA 3AE2B 4DV1L 2F0SA 2V0GA 1LT6D 1WJ6A 3RT3B 2JWZA 1E7PB 4C4VB 4A3MG 3I57A 4YWGG 2EYOA 1EZ6A 2CCZA 3H3VC 1RTNA 2NN6H 1HNWQ 2X6LA 1VQAA 2NN6G 4XTCS 2BS4B 4E71A 2ONQA 5FJ8H 3ERQA 5LMUQ 4I65A 4X3TA 4A3IB 1EEID 4I7ZC 2NBVB 2QMTA 3CMEA 2F4VQ 1N34L 4QCLA 2ZTCA 2BBCA 1HTPA 2G1EA 3HOUH 1TYGB 3DWQA 2E5LL 2XRSD 1C76A 3A5ZB 3EIVA 5JHAA 2RCFA 1T5XD 1E3PA 2EPBA 2VH1A 3AEGB 1PTOH 2JK8A 4K8JA 1A0IA 1S5FD 4BXXH 2KVRA 3L08A 4JPSA 1TIID 1FNVA 3I9V1 4CJ2C 1FXAA 4FXGC 1J8IA 2D3BA 3AEDB 4FJVB 1KAWA 1EQRA 3HRZC 4GS3A 5IGDA 5BO4B 3ERSX 2KT7A 2LGSA 2PE6B 2KMMA 4POFA 3MXNA 4IN3A 4N9PA 1JRPA 2LGIA 4IOIE 2KLGA 4QJFA 4DR5L 3JW0X 1SYGA 1U5KA 4X3KA 2Y3AA 4RAUC 4J6HA 3S2AA 3E9HA 4UP9A 4KHZA 1EWHA 1XPUA 3D6CA 1NR2A 4A93B 3GTOB 1YX6B 1IL2A 4RHRA 2ZTDA 2WFWA 4LAAA 4HIDA 2JRIB 1QG7A 2ATWA 4JBJA 1OTRB 2L00B 1TWHH 4KY7A 3D6WA 2KX3A 4DK5A 1MIUA 1F9RA 2JWUA 2AUJD 3TDQA 2L9HA 1PZJD 5FKAC 1BF4A 1SRUA 4J8QA 1RRBA 2SNMA 1EWIA 4FDBA 2D9UA 1Z6HA 1ZXHA 4JVZA 1HZAA 3SHQA 1UE5A 3PREA 1RF2D 4BBRH 4LTUA 4MEMA 3NUHB 4DR1L 4YCVA 4PS7A 4AWJA 4DQOC 2EDGA 3S2DB 4XZ4A 3OMGA 1UE6A 2PEAA 1PGAA 4C3HH 5BN3A 1XJVA 4MM3B 2I5LX 1G291 2X6GA 3HKSA 1N36L 3PVLA 3G48A 4LFCQ 3ITPA 1TWFH 2IO1B 4DHZE 3Q3MC 2KCTA 2HDEA 1N6ZA 2WXFA 3R3OA 3HOWG 2K39A 2LVOA 3SXHA 2LEKA 1EEFD 3SK4A 1EIHA 1J0GA 2SOBA 3UIPB 3X0WA 1MHWC 3BS1A 2M56B 3WWVA 1WM2A 4EGVA 1K9MC 2JZZA 1WX7A 4OVUA 2UUBQ 4DKAC 1FNWA 1JJ2A 4ARCA 2QF7A 1C4PA 4K1RB 3OW7A 2UUBL 2K25A 1OXSC 3HEJA 2F0FA 2KDMA 2B2YA 2N9KA 1NMGA 1X32A 2ZW1A 2C9WB 5CV4A 3N1ZC 4RNAA 2DZKA 3BVGA 5JPNC 4A93H 3F2CA 3PZDA 1TY0A 1VMCA 2BKFA 2ZCBA 1J6QA 3DWMA 3VH3B 2BH2A 5J1ZA 5IOCA 3K58A 1TTNA 1NR4A 4AQYL 2MJ8A 2CU3A 2C60A 2R2OA 4RWSC 2CS4A 1I35A 1HHVA 3MC0B 3TZDA 1LXDA 2H5XA 2VZKB 4TUUA 2HT1A 1GD7A 4OEMB 2PYKA 4ZRZA 4V0BA 4MDKE 1PRTC 1UGMA 4WJ3M 1RFKA 3GZNB 2FINB 2BPSA 4EQNA 4C3IB 3ZDMC 2FMCA 2YU9B 4TMAB 4WJQA 5LNK1 2N7DA 3VXWA 3EA6A 3P7JA 1A3VA 2JA8G 1SYEA 3ZNZB 4C7YA 5IP7G 4P73A 4LUZA 5KNCA 4G7HC 5JJIA 4H7BA 2Y0SE 1PH8A 3AE4B 3GO5A 4OWXB 3MTSA 1Y1VG 2EY5A 4LF6Q 2WXPA 3FKYA 1Z7TA 3CWIA 3BK1A 1C48A 3OLMD 1OO9B 3MFGA 1DOLA 5G55A 4PYUA 3JSVB 1TGZB 2K32A 5EAYA 2KWUB 2NZOA 4GOPB 4L8JA 5I6WA 1SYFA 5C5MA 4ANXA 3OWFA 4WWOA 2WXGA 2IPKD 1U4MA 5GAEC 1KOTA 1R4QB 4L5QA 2I46A 2CVRA 3FKIG 1IYUA 2MP2B 3S1QH 4MSQB 1EIFA 1CJEA 4GN4B 1UH6A 2ZT9C 1VDVA 1MHHE 2V3NA 2PI2E 4DXGA 4TV3A 5CHFA 1LFDA 2FCNA 2EY2A 4GLAC 3M4OH 2F0LA 4RKBA 4WFN3 1OXVA 1ZDXA 2KYWA 2D2CC 3KF6A 1ZKHA 1J7AA 1EZ8A 1HQMC 4EKUA 2ZXOA 3MHZA 4PNYA 3N52A 1WTPA 1FXIA 2J7QB 3AU4A 1E5WA 2A6HD 4NY0A 4OW0A 3IAM1 3ZJTA 1MSGA 4YY3Q 4X62Q 3U52E 2F3WA 1GJXA 4KSLC 4P71A 4LF9L 5C4JB 3DEOA 4JI2Q 3MXPA 4Z9CB 2F0WA 3ABVB 2WV6D 2IX3A 3CPWA 1WXVA 1B53A 4MGZE 1ROEA 1STGA 2F0VA 4REZA 5IA7A 1HNWL 4HSPA 1RM6C 3SDLC 3KUZA 2RDGA 3M4OB 3WOEA 3VR8B 1R4NB 1VR9A 1XT9B 3NTIA 2EMSA 3TP8A 4LUOA 4A3BH 2XEWA 1VF5C 1QCBD 5M3MG 4BBSG 2RVLA 1SF0A 2B39A 3C2PA 4L2YA 4KHPL 5FLMG 2K8CA 4KZ0A 4A3DH 4B3ML 1KJTA 1UAPA 1L6VA 4X57B 3GB1A 4DR7Q 4LF7L 2EQSA 3MP9A 2NTTA 2AQ2B 2REXA 4FLHA 4KY5A 2ZXRA 2B63B 1FFVA 2YLMA 4FO2A 2VW9A 5IOIA 1DJRD 1D6EC 3F2UA 5EKLA 2Q8TA 5M5YH 3G6EA 1CKOA 2W3SA 4BY7G 2F0UA 3L0WB 1PYSB 3I91A 1YVCA 3ZUNA 3R7QA 1NTGA 1CM9A 1VQMA 5IWAQ 1N9WA 1VQGA 4RKLA 2JZPA 1YNND 2OTLA 4GN1A 1MG8A 4BA2I 3M3YB 1AYFA 3L0OA 1Q10A 2BE5D 4P2CB 4N59A 1GC7A 4GU2A 4DAPA 2JA7H 3K0YA 1GXDC 2F0GA 4JK1C 2L32A 2SNSA 4GDLA 4ZK9B 1K8MA 2FUHB 4GDKA 4EVOA 1PDXA 4N58A 1PZID 1SYDA 2ZTEA 1HNZL 3H15A 3A9JA 5C3EB 3J7YW 1HNXQ 1YHBA 1VQ5A 2D5GA 3PO3H 1ZYRC 1E8YA 2X8XX 4LDTD 2KHJA 5L95C 1JOKA 1PYBA 2KOXA 3ONSA 3I4MG 3FKIH 3K5OA 1U4LA 2JP1A 4CDEC 1SROA 1EFID 2BF8B 3JAMi 4A3IH 2ID0A 1I4GA 4DHJB 3Q8BA 1F2ZA 4CDDC 4MJSA 4XT3B 2R92H 1MJCA 4RF0A 3H6MA 1YJ9A 4ASWC 1Y1WG 2M0AA 2K3UA 2DJGC 1B70B 1OTCA 5AJ3Q 3RMKC 3DBLI 4K7WA 2HIVA 2OF1A 2DAFA 4WWNA 3KF6B 1H8CA 4NPSA 1IW7D 3T1HL 2GN5A 3NP8A 2MHJA 2UU7A 1ET6A 4RGOS 5HGQA 4FF2A 1JB3A 3KLSA 2G45B 4USAA 1P8LA 2N8NA 1KH0A 3DBLB 4V190 2YTYA 5E7NA 4LFBQ 2NBUA 1PTOC 2IJ0A 5BMIA 1I4QA 5C44H 4F1SA 3VR3A 4BY7B 1QOFA 3OOCA 3IVFA 2B76B 3ULJA 3VYRA 3P1MA 5FK9C 1BDOA 2DZJA 4HKQA 5KNDA 2K5WA 4AYBE 2XN9C 2RHQB 1WMHB 2DX5B 2Q8RE 3MHBA 2PVGC 3PLVA 4HRSA 4WJPA 1I50B 1C9FA 1AP0A 1JE4A 4QL5A 2RQXA 2GVAA 2G4DB 3NY5A 1AN8A 3G71A 2ZJPA 4A3FG 3ZJYC 4ID6A 2R7ZG 3ZNID 4B9KA 2ON8A 3H0GH 3R7RA 3M4PA 1QNUA 4F8MA 1FRRA 4R4OA 4ZRPA 2RA4A 4MACA 2WYQA 3AU5A 5G5HA 3MJWA 5BR8Q 1YX5B 4B0EA 4A4IA 2K04A 1RFAA 4ICVA 5AUKA 1BBWA 1WTVA 2WU2B 1YJWA 4U68A 2BS2B 5AZFA 1NDDA 2CKHB 3KUDB 5E6OA 3EVQA 4ZUJA 4JI3Q 1A6XA 2Z6KC 1E22A 3DWPA 1DXMA 3CXCA 4XWTA 2E2DC 2LGYA 4K8IA 1YHQA 2GA4B 5M5WH 2JA7G 1JWUD 1J7BA 2N78A 3SK6A 3Q8DA 1GO3E 2A6EC 1UEBA 3WDNA 5IGBA 2UU9L 2H1EA 2KC2A 4GZYC 1VQ9A 3NWTA 1TBEA 5EKKA 3NJTA 3TS2A 1HFGA 4ABNA 1K8AC 3TRZA 2CW0D 1KC8C 2MW5A 4OX9L 3RUIB 3RNCC 1SBBB 1F9JA 5EPKA 1A15A 2QDLA 2NVYH 4A3EH 5IN7A 5C0XH 2LY7A 4M00A 2UXBQ 5ELDA 3MC8A 3MC9A 4X6AH 2LKVA 3EGRA 4RFBA 5JAVA 1WVLA 3RYTA 3KF8A 4KDIC 4HIOA 4DDID 4FA6A 2JY6A 4NXNQ 2KECA 3D8GA 1TWGH 2EY6A 5IYCG 1SXTA 4EOYA 3CCVA 3PPAA 3BY4B 1VQBA 3M4YA 1A2TA 3F2BA 2D0OA 1YN3A 2BB5A 1I42A 3SU8X 4FXKC 4XXEA 2E75C 3BVMA 3ER0A 1WRDB 2G5DA 4JX1C 2HTME 4BBRG 2KHSA 2Q2HA 4HTHA 1WTXA 3I4MB 1D7QA 2A5HA 4KN7C 5CGKA 4MH0E 1ONLA 3A9JB 1T6BX 3DVGX 4C3IH 1E2VA 3W1GA 2N4FA 1ET9A 1UEAB 4GXBA 4E3CA 3VH4B 4KIKA 1KDCA 5IYBG 3KDFB 2QC8A 2TSSA 1G6JA 4CHTB 1Z5SB 5IYBH 3NELA 3HRDD 2WHIA 4NJ6A 4YTPB 3HG9A 2PQAB 3NSWA 4NNJB 2NVTB 4KV6A 1EUVB 3PRMB 1TS2A 2WAQB 1TWAH 1KF6B 1RL2A 2VB2X 3RNEC 5HKHA 1F77A 1VS0A 5A2QE 3M3JA 4F8CB 1X65A 5GQOA 4RCOA 3PGZA 1CQFA 1NUCA 2MO1A 2XVSA 3BYYB 5AJ3L 4QMGA 1KNAA 2KJHB 2WKCA 2X69A 2EKEC 4HPPA 3AMUA 2G3QB 1YNJD 2PKOA 1BCPB 1XYIA 2WGSA 2Y0SG 2PPBC 1D2BA 5HI1A 1C4QA 3JAML 5JVG3 4PZ7A 2K9XA 1PGXA 5JZEB 4IALA 2N7EA 1ESFA 2G9DA 2J53A 2B2UA 2MBEA 4FVMA 1KLVA 2Z4HA 2F0MA 2E74C 2WP9B 4X3SA 2WNMA 3PO3B 2EY1A 1I94Q 1VRAB 5E3FA 4G11A 4GKJQ 1NENB 2WXKA 4EEWA 2K6AA 1EY9A 3AEEB 3AN1A 1EIYB 2RDBC 2K1FA 3DM1A 3FPPA 4A3KB 3CC2A 1XLOA 2EMTA 2RSNA 4NDXA 3I4NH 1WIAA 3OIPA 3SFEB 3W5OA 2PI2A 1N63A 2JXTA 3P42A 2I5HA 3M9BA 2B2TA 4C1NI 3EROA 4I6LB 1QOGA 3NVZA 1TKGA 1LO5D 5IYCH 1O7LA 3U50C 4GNXA 1Q8KA 4MT5A 5G2NA 3OSOA 4G3XB 4OWWB 2BH8A 1SSOA 3GTKB 2YTXA 3OMCA 5IY0A 4WJOA 3VUXA 3W1SA 2OQKA 5IP9G 3ZTDA 4P1BC 3L16A 3VRBB 4XC2A 4J15A 3T1HQ 5LMNW 1G6ZA 1GHKA 1WTWA 2KOLA 2C7MB 1UE1A 1HZ6A 3DHQA 2DYOA 1NCVA 4JL9A 1FD6A 4A3DB 4QIWB 1ENFA 3I56A 2IGDA 4MN3A 3HM6X 2KDFB 3OPOA 1XF5L 5G3LD 5DPWA 1ISNA 1SMYC 2KUMA 4NXNL 5GAHC 3NQTA 1QKZA 1EQVA 3BDLA 3DHHC 4AOFA 5EJWA 1A3UA 2K5DA 2MBOA 4IG7B 2K8HA 1DGSA 1HUMA 3D3RA 1UWXA 4YCWA 4H2AA 3DXJC 3HKZG 3ENEA 4A3CH 5CV7A 1K51A 2DY7A 3PGEA 2F0JA 4RGTA 4K3BA 3MXGA 2CQAA 1GM5A 4DU9A 3H7SA 1VCIA 5ELCA 4YWLA 2D3GA 5CBAE 3L4PA 3Q23A 2DJFC 2VUMB 3N3KB 2EYLA 3NK9A 4K5WA 1HR0W 1N32Q 1FXTB 3AE8B 3DHIC 4FNFA 1SIFA 3NVWA 4ANWA 2WDRB 3AE1B 5C23A 3NZSA 3VA5A 2OOBB 2QW7A 4LF5L 4A3GH 1Z2MA 2L4NA 1WCMH 3Q6SA 2QIEB 3AE9B 2M9VA 1G6PA 4G4KA 1ASYA 4US9A 2N9EB 1DD2A 4IDIA 5AZGA 1RODA 4IOCA 3M7NA 1LM8B 4A75A 2WB1B 3B6YA 2J4XA 2WIIB 1A8VA 4B3RL 4E6IA 1L0XB 4HJ9A 2KBNA 4ICUA 3ZNGC 3GTLH 3A9KB 2YEPF 5K5PA 1N5WA 4ZKCB 1TQOA 1R7SA 1V8CA 2ZVNA 2L5TA 4RG1A 5KGUA 1KRHA 1FJGL 2BS3B 1L0WA 3HKZE 4C80A 1BCPF 1TXYA 2BOSA 2NVYB 1XEEA 3AE5B 3HVZA 4C56C 4HR7B 4B95A 1FRDA 3RLOA 1CSQA 1WR6E 3PIOA 2FE8A 1PFSA 4TRDA 5CV5A 4ZDVA 1KNEA 3J80E 1F1HA 1Q90A 2OJWA 4HDOA 1C7YA 4C2MB 3CU7A 5HY6A 3JAME 3HOVB 4MELA 2IX0A 3VYTA 2HHHL 4DK0A 3RUZA 4LF8L 1EU3A 4N6EB 1WZ3A 4A3PA 1E9MA 3DBRI 1WXQA 3QJZA 1E2ZA 2HCCA 1LT4D 4DHJD 1IPGA 4R9WA 5GAGC 4JW0A 4YTNB 3BU2A 2DYMA 1JQ4A 5A35A 4CDCC 3ZRFA 3A5UA 2Z0DB 2B2UC 2F3VA 1N32L 1DONA 4YWMA 2QSDA 2JQRB 1TWCH 3AXCA 4KVGB 2UXCL 2ZW0A 2F4VL 5BYQA 2OJRA 3J9CA 2M1MA 4DK1A 4JBWA 1JICA 2KVMA 2HE7A 1NBFC 4OZAA 1EWCA 3QWNA 3DMUA 4O42A 4UP7A 1IYVA 3K0XA 1HCZA 3RNAC 1YHAA 2QCZA 1MGSA 4ILWA 2FUG1 4MNOA 3H3VI 5C0XG 4DV7L 4LF4Q 2WQYB 5IP7H 1JCKB 4P75A 3VA7A 3PRZA 2VB3X 4ACFA 2BKRB 2AL6A 2JQOA 1SFOB 3NTHA 4O1NA 3HOYH 1E6EB 5CHVC 4B0MA 1PGBA 4BFRA 2K8BA 3NEMA 4PQXA 3M3YH 3S17H 4A3JG 3MFYA 2JA5H 3HKZB 2PNHA 3AEBB 2JVCA 1V86A 4NB3A 3GTOH 1OFFA 1QT9A 1CKNA 1Y8NB 3K8AA 3A56A 2E6XA 4P1CC 4Y7NH 1GPXA 1B3AA 4X66L 1WOCA 4XQQA 4GNXC 2Y0SB 4L5RC 1ZW7A 3AFPA 1VJKA 5MPOA 3PUZA 1A2UA 2UXDQ 2AQ1B 1Q8IA 4HCNB 3KW5B 3K7UC 3CCLA 4DUZL 5IGEA 1NBWA 3BK2A 1MBYA 1SYBA 4JQWC 1CZWA 4GB9A 4UP8A 1KIXA 2INDC 4DNIA 2KX0A 2C5CA 4A3GB 2N55A 1EWYC 4FJYA 3TBIB 3KUCB 2O6VA 1VZ6A 2F4IA 4AH6A 1EY5A 4AIMA 3QCAA 4HLEA 2HDMA 4FULA 3KLRA 4EFOA 2Z6KA 1HTLD 3I90A 4NAMA 4HJGE 4OZCA 1BQQT 1QILA 1AZPA 1UELA 1T0RC 1B9RA 3BWUD 4X3UA 3R3MA 4DAMA 3S24A 3I2ZA 4PMCA 5KEEA 2HHHQ 2MA9B 4A3BB 2E8GA 3H9DA 4NP5A 3CAMA 3K5MA 1STNA 2LASA 2N1WA 2QILA 1YJ1A 3DPDA 3S16H 5AUIA 2ALYB 2L0TA 1NYQA 2KJXA 1SJED 4JI0L 4JI0Q 3E56A 2WXIA 1I5FA 1SNPA 4LFCL 3KYCD 3HZXA 4ZRQA 1IHZA 1A62A 1U0LA 3HOVG 1K8RB 2E5LQ 4URKA 1N8RC 2Z1CA 1E0BA 1Y8OB 2Z8LA 3K5LA 2LVQA 3SD5A 3CC7A 5FR6A 3GTKH 2XGTA 2B8FA 3Q69A 3FMCA 4RHSA 1PZKD 4M0WA 4XYOA 1HTOA 1PXUA 3K5NA 5EE0A 2C35B 2OHFA 4W9JA 4KJNA 4HN7A 3C46A 2L0FA 2CR5A 5F2DA 1STYA 2EYFA 2E2JB 1QQRA 4GMVA 3APCA 3N20C 3UIOB 4TQ0A 2JN4A 2WDVB 2VZKD 3LB8C 4DV6Q 2OEDA 3CKIB 4IPDA 5C3EG 2PW9A 3QX1A 1T5EA 4DUZQ 1YITA 1L6UA 2GBJA 1L2NA 2IDYA 2B2WC 2A68D 2KKCA 3OAWA 4JG2A 2RGFA 2DZIA 1KLGD 3UF8A 1KRTA 1F9SA 3GTJB 3E9SA 1V49A 1KXLA 2BT6A 2F1MA 2B2VA 3NE5B 3HOXB 1HR0L 4FXCA 3HOUG 2B29A 4W9HA 3DEPA 3PMFA 4H44C 4A3LG 3E9IA 5DPTA 1IBKL 3H3VH 4C00A 1WRIA 4WURA 1EL0A 2JRHA 1XX8A 1X56A 4HVBA 5K36H 3NQIA 2IYDB 1GUGA 4KHVA 1TKEA 4MHEA 2D3CA 4IWOA 4GDLB 4KKJA 3DVNV 2Q5WD 1FO4A 2YU9H 3VQIA 1HE8A 4II2B 3Q6BA 1RWSA 3NBHB 4KKTA 4DV0Q 3Q3FA 1SNQA 2UU9Q 3CMMB 5JEAH 3DDCB 2R6GA 5DPSA 1MSHA 2DZMA 3J81c 2R3ZA 2N9XA 3U8ZA 2K33A 3IG3A 4HEA1 2KHIA 4Q2JA 2BCOA 2WX0A 1F2LA 4E74A 2B63G 3ZXVA 5BYRA 5CV8A 1PRTF 4JBMA 4B9WA 1V9PA 3RCZA 3I4NG 1HA5A 2W3RA 2K75A 1MFWA 1WM3A 1IBMQ 1YQ3B 4PS8A 5KHOA 2BA0A 4NJ7A 1JB7A 2CWPA 1WCMG 3ZQ4A 2XWBB 2V9HA 2KANA 3IFWB 3PTFC 1TWCB 4TVAB 3AEAB 5FJ8G 2L12A 2KJRA 4BBSH 3CQZB 4NZLB 2K03A 4X65L 3AE3B 3IXSA 4U673 1FFUA 2BGFA 1EYDA 4HCEA 3PSEB 3HOXH 3K7AH 3GOEA 1TWGB 1PFMA 3I7FA 3P4SB 1Q82C 1WTRA 2L1AA 4MGKE 4QUFA 3DBRB 2A69D 1NJIC 4HK2A 2KHWB 2R93G 3GTLB 4BY1G 3CCQA 2NB0A 2P5ZX 5E6JA 2JEBI 4XQJA 2WXQA 1WTOA 1E24A 5M3FB 3VUYA 3B1LX 3HOZH 4L23A 1C1YB 4LF6L 1Y56A 2MFIA 4DUYQ 2R2QA 3H94A 2B3AA 4A3EB 3V3XA 3TMPB 1XTDA 5LL6X 4DK3C 3DQVA 5JPMC 4UAIA 3RLFA 1PH5A 1M4VA 2MLBA 4ZRJA 4DV2Q 3U4EG 3IFDA 4HCSA 2BA1A 3H1UA 3IBEA 1HRJA 2LXCA 3ND8A 1WE7A 4GN3B 3SVMA 5BN5A 5IT9L 4KD3A 5M5WB 2R92G 2IGGA 1LTSD 3KFUA 2M0XA 3I4NB 3TIXA 2HJ8A 3Q3OC 1GUNA 1E7VA 4TQ1A 4L5SA 3RZOB 1SE9A 4A9AA 2KJ6A 1KM7A 4ANVA 1WMHA 2EYHA 4RGMA 4DV4Q 1ICWA 4P16A 5EGTA 4FF1A 1STAA 2JA9A 1H9RA 2OCEA 2ZJQA 4GIVA 3SK8A 1FR3A 1LTTD 3T16A 1EYAA 1QB5D 1NY4A 2RCNA 4DN4M 5C0XI 4DGZA 1TIFA 2G4SA 2LXJA 3DWGC 4IC7B 3S9WA 4RM8A 3PQIA 3NHEB 4XIGS 3N30A 1R9TH 1Y8RC 3BDCA 2EE1A 3HOUB 3ND9A 3VDZA 2D3AA 4AJWA 4A3MB 1E7ZA 2VUMH 1E0ZA 1SJHD 2N1VA 2W54A 2UXCQ 2MGSA 2LS01 1SNDA 2HIXA 3CRKC 2IHFA 3B08A 3LDZE 1VQ8A 4XX5A 1K53A 3AULA 3VTWA 2XRQD 4IZ8A 2Y5CA 5C44G 1I4RA 5C3EH 2AHOB 1LTAD 2PJHA 4CJ0B 2B2YC 5C4XH 1OEYJ 3HFZB 1VLBA 2MBQA 3HGBA 1XCQL 1UUPA 3RFZB 3AECB 4YXDB 1QZHA 1BXTA 1L1OB 1Y8PB 1JJCB 2K4KA 4KJOA 4DAVA 4JI5Q 4F7XA 1EY0A 1N36Q 2M4NA 1QUQB 2ZPNA 1EOTA 1XLPA 4A3FH 4LF4L 2R7ZH 3Q2AC 2RDFA 2I1KA 1CKMA 1DGJA 1JQYD 1X3PA 4EE2A 1HJPA 4R4QA 1CHPD 2KFKB 4I6NB 3WAMA 4DBGA 2KWVB 4LF8Q 2JYOA 2ES2A 1DOXA 1CFMA 2WXOA 2M2LA 4DV4L 3J81E 1V1PB 2ZM6L 4K3CA 2HDLA 2JEAI 3A74A 3H0GB 2F0NA 3TL5A 3F1ZA 3L3OC 4KN4C 4JI8Q 2NVQH 5EKIA 2Q2UA 4P7IA 1CA5A 3CCSA 5IWAL 4DV5Q 3QA8A 3DUZA 1AARA 1HTQA 4HJ7A 1D5ZC 1JORA 4MIUA 2K22A 3DVGY 4WWPA 3HIZA 3VTUA 5AEKB 4F88A 2FXQA 2MCNB 4DV2L 4JI7L 1A63A 2GOWA 3VYUA 2J0KA 1N33L 3Q0AA 2F0PA 1LYLA 5FLXL 2XTIA 3CCMA 1DZ1A 1UWMA 2K01A 3R2TA 1P7FA 3P4QB 1KL9A 5I2YA 4IFDH 2FAZA 4CKCA 3PO0A 1BCPD 3BJUA 4C3JB 3A7AB 4DV3Q 4WJNA 3J80L 4IPHA 1A3TA 2NTSA 1M1KC 4N9TA 1EFWA 5ELFA 4A6QA 3IFTA 4GGQA 3QIAA 1IBXA 1PMRA 1ICFB 3VR5A 3AB5A 3FEWX 1BNZA 1OGWA 1UBQA 1YQ4B 3S15B 4AYBG 1E8WA 3KDFA 2DYBA 3JAMc 1KFYB 3M7GA 4B9XA 1WXSA 3GE3C 2KZRA 3RD4A 1VMPA 1XTCD 2PE9A 2PQAA 5ELEA 2QA4A 2PMZE 4GLVB 4YY3L 3OTOQ 1VQKA 2L83A 2BYTA 5E4WC 1AH9A 1OQYA 1RYJA 2K14A 4M8NA 4OWTB 2CH4W 3RN9C 2DUDA 2V4IB 2F0EA 1X3EA 3LX0A 3ZNHB 3AQQA 4B6WA 3IT4B 4B08A 2AQ3B 3U58A 1VQJA 1Y1VB 2X38A 5T8IA 2QEJC 2N9LA 3NG0A 5KHQA 3HOWH 2K5VA 1GUAB 3RZOH 1L7YA 3C19A 2PMVA 3IAS1 2Z59B 3UDFA 1V5OA 2MP1A 1WZ0A 1KHIA 1L4ZB 3RD2A 3UQAA 4DR7L 3SEBA 4ZYNA 3PCOB 2PPHA 2IO0B 3W1BA 5JVH3 3TMEA 4ZRKA 3VTVA 2KQ3A 1JWMD 4NQKE 3CF6E 2KDEB 4K14A 4XDCA 3S1MB 1IW7C 4DR2Q 4J6IA 5C6AA 2FFKB 1QJOA 1RTOA 4HPLB 4A3OA 2QCPX 4ZHPA 2KXJA 4A3GG 5C1ZA 3FC4A 3OG5A 1D5XC 2FHTA 2VZAA 5C4XB 1JR0D 1WFQA 5H8YE 5DCNA 3EN2A 2NPTA 1T3QA 4JGHB 3QWZB 3MEFA 1HR0Q 2R93B 2KWDA 5H92C 5IT9c 4GKJL 2E2HB 3I70A 1Q81C 1STEA 4JI1L 1VQNA 1RKNA 2L15A 4G57A 3X3MA 1LTRD 1F2RI 1YEZA 2E3TA 3VYSA 2RD0A 1YMHE 1HPCA 4B3MQ 2KC1A 4JV5L 3AE6B 1HZ5A 1TS4A 1G2TA 3SR1A 3S1NH 3ICEA 1Q5WB 3MWYW 1WX9A 5CMDA 4G7ZC 1WD1A 4F87A 3TP6A 1GG3A 2R61A 2Q8IB 1J5EL 4QQBX 3FVQA 1XLNA 3HVDA 1SN8A 1WGHA 2A5UA 3W9CB 1V1PA 3C8YA 3DCGA 1PUTA 1LACA 3CRLC 1FEHA 5T1IA 1XD3B 3GTQB 2KTRB 3I5JC 4LK1C 4NXML 3Q3NC 4TQUS 3TEWA 4YT0B 4EX5A 3DM3A 1PVOA 2K5HA 2E76C 1EU4A 2LMCB 3I4LA 3RR5A 5IE8A 2KEEA 3HOYB 3NWSA 3PO3G 4W9EA 5FLXE 1SFOH 2VL6A 4NW2A 4LNQA 3L54A 4OVZA 3MEHA 1I50H 5FO8B 3W3AA 2A6ED 2LXAA 4C3HB 4WWMA 2DNCA 3PS6A 1WH3A 4KKSA 1SLJA 4HMIA 3Q8AA 2LVPA 3EFUA 1UZXB 1YJIA 1JE5A 5E4XA 4QGUA 1WXAA 4IOAA 1X3FA 2WINB 2IY0B 4JYAL 3SFDB 2CHZA 1Q1OA 4WJWA 4IUNA 3RZDH 4BY1B 3S15H 5C4ZA 3H7PB 4A3CG 4L5TA 4DR1Q 2W82A 3SK5A 1ZXTA 3TSSA 1IBLL 1IBLQ 2NBFA 1UF0A 4EZKA 3TEZA 1RDPD 5I9PA 2VQFL 2JX5A 2L55A 3UI2A 1V2YA 3BG3A 5ELBA 2IWHA 5H1SE 5C44B 1JMLA 3DVNU 4XDDA 2QKIC 3A8KE 5IODA 5AZHA 3IAYA 1AE2A 2IY5B 1TS3A 1BT0A 1R4MI 2N49A 2YEPB 3JYUA 1W6KA 2K05A 4DNTB 4OELB 3VR2A 2JA6B 1IGCA 1JWBD 2O4XA 4ZQ3A 4HKZE 1B3QA 2JE6I 1LUZA 1PTOF 1QWYA 2E2IB 2PNRC 2JPHA 3Q3JA 5L83A 3UI3A 2QGQA 2MPMA 4GOPA 2SAKA 4XYCA 2IBIB 3J80c 5IP9H 4HJ5A 3GZNI 4C7ZA 3D4RA 4A76A 4A3JH 4K6DA 3KF8B 1ASZA 2JA5G 3T51B 2JYTA 3CIRB 1S3OA 1XMOQ 3AYHB 3KJPA 1V80A 1PH3A 2NMQA 3STBC 1F9QA 1BVSA 3P1HA 4K7SA 2VY3A 2DN8A 1SNCA 2WX1A 1AEXA 1R9TB 4LF5Q 2BDNA 2XBBC 4C3HG 4PMBA 2EOTA 3GD7A 4AQYQ 2DENB 4EZJA 5EBCA 2XWJB 1JW9D 3WCQA 3E6ZX 4KLKA 3BDOA 1YZ6A 1EY7A 1OQQA 4DR4Q 4ODGA 2V1CC 1FYCA 4BS9A 4XQNA 3FILA 3BYTB 1LT5D 1J19A 4HDQA 4AJYB 1BR9A 2GRIA 3K81C 1SE8A 1Y69U 3O65B 1XNRQ 3CD6A 4JI6L 2ZNVB 4KIKB 4M01A 2PIAA 1YNXA 3OIQA 1F2MA 1O78A 2QHOA 3P4PB 2KCCA 3GV6A 3EC8A 3UQBA 4NXMQ 4JOIC 2NVUI 4CDFC 4IUMB 2YYZA 4GLXA 4A3KH 2IX1A 2BE5C 3NXWA 3SGIA 4GOCA 2LHEA 1OXXK 1QZEA 1XMQQ 3OW2A 4A3IG 2I1JA 4GDKB 1KLUD 1TVXA 1SDFA 1YBYA 1JJGA 5D3DA 3C1FA 4HJAA 4DA2A 3S14B 2ZNVC 4NPNA 1Q86C 3RMHA 5IGGA 2LUMA 1B7YB 4IUUA 4B3TL 3TP5A 2VQFQ 1D1KA 4KTAA 2I38A 1IP9A 5IGCA 4ALPA 1VQLA 4OONA 5E1FA 3J80i 5BN4A 1DOIA 2JZ3B 4W9IA 5D3IB 2WAQE 2M17A 3BINA 4Y7NB 1VD2A 1H9SA 3V6CB 1X55A 3VRAB 1PHJA 5JEAJ 1N33Q 1XPRA 4BBNC 4GKKQ 4DV6L 3G4SA 3ZDTA 4C3JG 3M85A 3PHWB 3S14H 3CCUA 2NVTH 3P4RB 4X64L 3PO2G 3I3CA 3N1XC 4FF3A 5M3FH 2CU1A 2CH4A 1N34Q 5LMNL 3A1QA 1JWAD 5CORA 4IPGA 3U9SA 5LMUL 1MVKA 1RLFA 1YNTE 4WJ4A 4DXAB 2KQ7A 3AI5A 3WALA 4DR5Q 1XNQQ 2PZWA 1HNZQ 3CQZH 2UYZB 2YV5A 4JI3L 2JJQA 4PMWA 4IJLA 2KD0A 4A3LH 5BYSA 3D0FA 3APFA 4BXXG 3I72A 4P6VF 2MQHA 4RMAA 2JXXA 1O7IA 4W9GA 3OWEB 4PV1C 5K36G 3D31A 1O7ZA 2DWQA 2WDQB 3BZCA 4APVA 5KYIA 2LJIA 1K52A 4H0LC 4DV7Q 5EPLA 2LRUA 4S17A 2MQJA 3RNFC 1HZCA 1OQRA 3NPPA 4GOPC 1ZGUB 2Z0EB 4FN2A 5CHWA 3HOZB 1D5MC 1CUKA 2AWNA 5C3JB 3LYYA 3A7LA 1OEYA 3MHSD 1JWSD 2M8SA 4IW0A 4WQMA 3MJ5A 2F0DA 5J3BA 1IBXB 2NN6I 4RA8A 3CCRA 1PH4A 4XDXA 2VXWA 3KWVA 1HNXL 2RMMA 3K59A 1EY6A 1E8XA 3G6JB 1JMCA 4JCVE 2CQOA 1L1OC 3SE0A 3WA0A 2LFNA 5GMVA 3S1MH 2KMAA 2DAJA 3HOYG 1B44D 3PHXB 4PZ8A 4KV2A 1EQQA 3HOVH 2QDFA 2CW0C 4HSVA 1VQCA 1DOMA 1JC7A 4JPBW 3K80C 2RPVA 4HXDA
chains in the Genus database with same CATH topology
1I3QB 5FO9B 1BMLC 3BVZA 5NUCA 3VR4A 1SYCA 2XNAC 1ACCA 1N5XA 3SR6A 4US8A 4D2KA 1DCZA 1I4HA 3QB3A 3G7LA 4C3IG 3LXFA 5HGTA 2FBWB 3FPUB 3VR6A 4JWSC 1K50A 4L1BA 3NBHA 1WTQA 2PZTA 1H9KA 2WXRA 4L6TB 3PUVA 3RPFC 3NHHA 2DLBA 1X3QA 2EZVA 2B8GA 3URYA 2ZXPA 3H09A 1MHXA 3K57A 5DM73 3S1QB 1PYWD 3PO2B 3QOLA 4FXDA 3D4DA 4QF4A 4NMZA 1D4BA 3EUB2 5A2QL 3J7AV 1K8OA 3MAQA 3P75A 3KLSX 1WYGA 3NS1A 1RHPA 3TN2A 1BOSA 1B4OA 2CJNA 2TMPA 5JEAG 3T53B 1CZGA 1ZXIA 4NJCA 3E0JA 2JYEA 1F9PA 3PIO3 4LMQD 2MJDA 4LK0M 4WIPA 1ZOYB 5HG2A 2JA7B 5C4HA 5M5XB 5I4DA 1B9NA 3ONAB 1EY4A 1Z47A 4A3JB 1ZE3D 2JA5B 2J52A 1C78A 2A6HC 5BMHA 2WP8J 2MJ3A 5IIFA 4R8NA 4OO1H 2R92B 1STHA 2XIWA 4A3FB 2R7ZB 1MPEA 1BBXC 5D7GA 5HFYA 3EJIA 3W5VB 1F2YA 3MZ5A 2BW2A 5C2TB 3K6OA 1XO3A 3BZDB 2J42A 2L0CA 1TS5A 1SMYD 5EBDA 2ICEC 1L4DB 5EE3A 3SHLA 1C8CA 2RDHA 3V2TA 5HURA 1GAQB 1SAPA 5M9OA 1WD0A 1YNNC 4KD4A 1CT1D 4YSZB 1Q1BA 2WXHA 4AS1A 1TZOA 1ILQA 4EQPA 3H91A 4NAWB 3NVYA 5J39A 5GXGB 3GTMB 4CKBA 1PTOB 1TU2B 4K5VA 3Q24A 2H88B 4KK7A 1QLBB 2NVQB 2WXLA 3GTGB 4R8IA 4HAEA 1II3A 3ZJUA 4RGNA 3T13A 1QOAA 3PUWA 4ULLA 2L52A 3ZYYX 3S16B 4A55A 3Q8FA 4TSSA 2HUGA 1Q1EA 3GS2A 1R4PB 2WXMA 1FD7D 2EYJA 2W55A 2A74C 2K28A 2K1BA 4RCNA 4XT1B 4BBSB 2F0KA 1V8QA 1TY2A 2RBMA 1NYRA 3N9YC 5TSSA 1B50A 2AX5A 3QJYA 3A8IE 3C3LA 1GUWA 5D14A 1EM7A 2ENBA 4CGYB 5JJZA 1LABA 4ZLTF 4IUVA 1PRTD 2RSOA 1AFPA 4ITKA 3PIP3 4FP5D 5BMGA 2PW5A 1HFNA 1CK1A 1GUOA 1PRTB 2BB6A 1B9MA 1YN5A 2DNEA 1G2SA 3WOFA 1VZ8A 1MI2A 1FM0D 1J9OA 3CHBD 3PUYA 1I7HA 5EPJA 4C1NK 2Y5PA 2DY8A 2PVOD 2HQEA 1ZKOA 3RZDB 1VDZA 4QB4A 1XLQA 2INNE 3KQ4A 1OXUA 3LWEA 1A70A 2N0SB 5M5YB 3S1RB 3R8BA 1LV9A 1EQTA 2IL8A 1I4XA 2G9HD 3P20A 3SDZA 4ZUIA 4DFAA 1ML0D 4H13C 1DM0B 2N7JA 3S17B 2J7ZA 2KN4A 3MXUA 1SE4A 4CJ1B 4JE3B 3TUOA 5CBEE 3LWUA 4WH4A 2EXZA 1S5DD 1FNUA 2NUCA 5JOBA 1NEKB 2B2TC 2PLPA 2BTEA 4KGSA 3E5SA 3PUXA 4Q0FA 4WRDA 2WXJA 2KEDA 2GI9A 1SEBD 2H89B 3NRZA 2IW3A 1B2TA 1TWHB 2NZ1D 1TKYA 2INPE 4DF7A 1WCMB 4ZOHC 1HUNA 2F03A 1S5BD 2KA7A 4HMJA 1N60A 4YTMB 2EJMA 1STBA 3IT6B 1LTID 3B2GA 1RCVD 1ESRA 2OXPA 2DBYA 3PZ7A 3GP7A 4OIKA 1DOKA 2JSOA 3Q8EA 2MHVA 1FCLA 4FF4A 5COYA 3O13A 3T56B 2QDBA 2V4DA 5KYLA 1JALA 2F0OA 3AMZA 3HOWB 1I6VC 1WSPA 3V96A 1ZYRD 1LLRD 3OHXC 1CTMA 1IL8A 3AU7A 1SE2A 2SEBD 4OL7A 2D5DA 1C4CA 1Q3LA 4IUPA 1JROA 1TJEA 1ZUD2 1YJJA 1QF6A 1IUEA 1C4AA 1U4RA 3MVVA 1SE3A 5CV9A 2MEKA 2CJOA 4ARIA 2EJGC 4BA1I 1PTOD 1U9RA 1ENCA 3DWAA 1NAPA 5J22A 1YN4A 4XYQA 4HEDA 2PCFB 3TEXA 4AYBB 2NVXB 1H9MA 1Y1WB 1H9JA 5LL6S 1LT3D 5LHY1 1TKWB 1G8ZD 4BWGB 3B9JA 5EQ0A 1EYCA 4HROA 3KUPA 4M8AA 4RF1A 3ZGZA 3AE7B 1ZDVA 5IGFA 1CA6A 1QE6A 5FOBB 1CHQD 5DEHA 5EE1A 1ZEQX 2A69C 5DM63 1L5PA 3NVVA 4IURA 4EQOA 1TWAB 1FCCC 3PZ8A 4KX6B 2V3PA 4WAFA 4YIJA 3NBIA 3BIID 3FAHA 3R2IA 5C3XA 2L1BA 3QOJA 2J0TD 1SNOA 2BDOA 1GB1A 4ZAIA 2A73B 1PLFA 2I07B 2PQEA 1WWTA 5CV6A 1FGBD 1E2WA 2PW7A 1Q12A 2OT2A 2F0TA 5C3WA 2PZUA 2MJEA 2IT1A 1GHJA 3ETRA 1EY8A 3A54A 4S3SA 4ZYSA 1I6HB 2RKSA 1XWEA 2WXNA 3T3OA 2KACA 5I6YA 4K2LA 2M19A 2ICIA 3MA2B 1HEZE 3VR9B 3A55A 1LTGD 3KBGA 3QO2A 4KI0A 2O5IC 2PTLA 5G5GA 3W5UB 3D4WA 4XE0A 1XXGA 3X3NA 4XWWA 3S1NB 2EVBA 2VNUD 3Q8CA 1S4ZA 5IT9E 1AWDA 1MI0A 2OEOA 1G91A 2F0HA 4GLSC 2NWGA 2XSCA 1BUVT 4M1UB 1F0ZA 3R93A 3KK7A 5C0XJ 2CHBD 2LMCA 1ENAA 1ZPSA 4K5XA 4L63B 3N6RA 3HP3A 1KABA 2O2LD 5D65A 3AV8A 1HXYD 1F2RC 1O7YA 4AQ7A 1VF7A 4K6LA 4ME5A 1SIJA 2K5QA 4J1MA 3IKJA 1YNJC 2AWOA 4R3DA 4IFDI 4FYDA 1OXTA 1P7EA 2F0QA 3IL8A 1AW7A 1QNKA 2EKIA 1GB4A 4OHJA 2EELA 2KQ4X 3AEFB 1EIGA 2LFIA 2JA8B 1TR5A 3H8HA 4IFDJ 4OO1I 1QOBA 2N88A 1FIQA 1KDBA 2EYPA 2WACA 1CZPA 3EQLC 1KDAA 5FO7B 1BCPC 4DAYA 2NYZD 1NSNS 2K0PA 5JXVA 3TEYA 3W2DA 1CQVA 1I4PA 5M3MB 1PFDA 2JXMB 2B2WA 3ZJVA 1S5ED 4YSXB 4TKOB 3TP7A 2QJLA 3J7AF 1VZ7A 1N61A 4KKUA 4CBVA 2GB1A 3I73A 5C5LA 2O5JC 5I9OA 4WORA 3GTPB 1NVID 1D1IA 2LHDA 4YSYB 4K2KA 1SNMA 5EE9A 2K7VA 3I8ZA 1BO0A 5FR3A 3FILB 4J3OD 3NZ3A 2JU6X 2WS3B 1O80A 1HA6A 4KGTA 3TZUA 3GV3A 1L0VB 3T3NA 2SDFA 3AH7A 3Q22A 4RH6A 2HCIA 1CI3M 4OIJA 3AM9A 4IQZA 1JOQA 4IKGA 1N62A 2JSVX 1RD9D 1WGKA 1L0YB 2A68C 1HQRD 3KBXA 4KY6A 1U4PA 2MH7A 2WU5B 1ILPA 5G3LF 2K5PA 4JWUC 3C1EA 1E10A 3L9AX 3U9OA 1KAAA 2C9OA 2EJFC 2PMZB 2PO4A 3P63A 1H9SB 5CYUA 3HUIA 1UGJA 2EYMA 5AFWA 4LJZC 3KWLA 2FMMA 2I2YA 4BBRB 4Q5VA 1FMAD 1PDQA 2FJ2A 2WLBA 1IGDA 3GQBA 1IKMA 2L11A 5DAUA 4UDUC 1V43A 4OO1G 1AZQA 4KGRA 2M00A 3U2SC 2MUYA 4G7OC 3FDTA 1BUIC 1IKLA 1C79A 1SB3C 5HHDG 3HS0C 3NUCA 4DNRB 3L7ZC 3A8JE 2KAJA 2KCNA 1C77A 4IFDG 1S5CD 4CQNA 4KMUC 1GOZA 4DXFA 1LTBD 1KTKA 4A90A 1UNSA 2ACZB 3T4AC 5T1GA 5KRUA 5ISRA 1ZP0B 3V05A 3NTKA 3PV0A 1XCTL 1W6JA 4IUTA 4ZHOA 5DNFA 1GUSA 5I2XA 3QG1A 1B1ZA 4ZKBB 4PT5A 1MD2D 3B2FA 4OGQC 1V1OA 4QUCA 4IUQA 2IGHA 1PFNA 5CC4A 2Z4IA 1JOOA 3S2HB 4OZBA 4NKLA 5KNBA 1TT2A 5CR3A 3LNNA 1RJTA 3FRPB 3K7AB 2F0IA 2WKDA 1M8AA 2B2VC 2AUKA 3EFXD 4CKEA 1DYQA 1QOHA 3FKIB 1PFBA 3J81L 4A8XC 1GUTA 1SSNA 1K83B 1TWFB 5KIXA 4MH8A 1V97A 1NI3A 4KKIA 2D62A 2H4OA 3AB9A 1J7CA 3AE2B 2F0SA 2V0GA 1LT6D 1E7PB 3I57A 4YWGG 2EYOA 1EZ6A 3H3VC 1RTNA 2NN6H 2X6LA 2NN6G 4XTCS 2BS4B 2ONQA 3ERQA 4I65A 4X3TA 4A3IB 1EEID 4I7ZC 2QMTA 4QCLA 2BBCA 1HTPA 2G1EA 1TYGB 3DWQA 2XRSD 1C76A 1T5XD 2EPBA 3AEGB 1PTOH 4K8JA 1S5FD 4JPSA 1TIID 1FNVA 3I9V1 4CJ2C 1FXAA 4FXGC 1J8IA 3AEDB 3HRZC 5IGDA 2KMMA 3MXNA 4IN3A 4N9PA 1JRPA 2LGIA 4IOIE 1SYGA 4X3KA 2Y3AA 4RAUC 4J6HA 4KHZA 1EWHA 3D6CA 1NR2A 4A93B 3GTOB 4RHRA 4LAAA 1QG7A 4KY7A 3D6WA 1F9RA 2JWUA 2AUJD 3TDQA 2L9HA 1PZJD 5FKAC 1BF4A 4J8QA 2SNMA 2D9UA 1Z6HA 1ZXHA 1RF2D 4LTUA 3NUHB 4DQOC 2EDGA 3S2DB 3OMGA 1PGAA 5BN3A 4MM3B 1G291 2X6GA 3ITPA 2HDEA 2WXFA 3R3OA 3SXHA 2LEKA 1EEFD 3SK4A 1EIHA 2SOBA 3BS1A 2M56B 4EGVA 1FNWA 4ARCA 2QF7A 1C4PA 3OW7A 1OXSC 3HEJA 2F0FA 2KDMA 2B2YA 2N9KA 2ZW1A 1X32A 5CV4A 4RNAA 3BVGA 5JPNC 1TY0A 1VMCA 3DWMA 5J1ZA 5IOCA 3K58A 1NR4A 2CU3A 2MJ8A 4RWSC 1HHVA 3MC0B 3TZDA 2VZKB 2PYKA 4ZRZA 4V0BA 1PRTC 1RFKA 2FINB 4EQNA 4C3IB 2FMCA 2YU9B 5LNK1 3EA6A 3P7JA 1A3VA 1SYEA 4C7YA 5KNCA 4G7HC 4H7BA 3AE4B 3GO5A 3MTSA 2EY5A 2WXPA 1Z7TA 3CWIA 3BK1A 1C48A 1OO9B 3MFGA 1DOLA 2K32A 4L8JA 5I6WA 1SYFA 5C5MA 3OWFA 2WXGA 2IPKD 1U4MA 1R4QB 2I46A 2CVRA 1IYUA 1CJEA 2ZT9C 1VDVA 1MHHE 2V3NA 4DXGA 2EY2A 2F0LA 4RKBA 4WFN3 1OXVA 1ZDXA 2D2CC 1J7AA 1EZ8A 1HQMC 2ZXOA 3MHZA 4PNYA 3N52A 1WTPA 1FXIA 2A6HD 4OW0A 3IAM1 3ZJTA 1MSGA 3U52E 2F3WA 1GJXA 5C4JB 3DEOA 3MXPA 4Z9CB 2F0WA 3ABVB 2WV6D 2IX3A 1B53A 1ROEA 1STGA 2F0VA 4REZA 4HSPA 1RM6C 3VR8B 2RDGA 3M4OB 3WOEA 1VR9A 3NTIA 3TP8A 1VF5C 1QCBD 2RVLA 1SF0A 2B39A 3C2PA 4L2YA 1UAPA 1L6VA 3GB1A 3MP9A 2NTTA 2AQ2B 4KY5A 2ZXRA 2B63B 1FFVA 4FO2A 1DJRD 1D6EC 3F2UA 5EKLA 2Q8TA 2W3SA 2F0UA 3I91A 1CM9A 4RKLA 2JZPA 1YNND 4BA2I 3M3YB 1AYFA 1Q10A 2BE5D 4P2CB 4N59A 4DAPA 3K0YA 1GXDC 2F0GA 4JK1C 2L32A 2SNSA 4ZK9B 1K8MA 4EVOA 1PDXA 4N58A 1PZID 1SYDA 5C3EB 3J7YW 2D5GA 1ZYRC 1JOKA 3K5OA 1U4LA 2JP1A 1EFID 2ID0A 1I4GA 3Q8BA 1F2ZA 4XT3B 4RF0A 3H6MA 2M0AA 2K3UA 2OF1A 1IW7D 3NP8A 1ET6A 4RGOS 4FF2A 4USAA 1JB3A 3KLSA 1KH0A 4V190 1PTOC 2IJ0A 5BMIA 1I4QA 3VR3A 4BY7B 1QOFA 3OOCA 2B76B 3VYRA 3P1MA 5FK9C 1BDOA 4HKQA 5KNDA 2K5WA 2XN9C 2Q8RE 3MHBA 2PVGC 4HRSA 1I50B 1C9FA 1AP0A 1JE4A 2RQXA 1AN8A 4ID6A 2ON8A 1QNUA 4F8MA 1FRRA 4ZRPA 2RA4A 4MACA 5G5HA 4B0EA 2K04A 5AUKA 1WTVA 2WU2B 4U68A 2BS2B 3EVQA 4ZUJA 1A6XA 3DWPA 1DXMA 4XWTA 2E2DC 4K8IA 2GA4B 1J7BA 1JWUD 3SK6A 2A6EC 5IGBA 3WDNA 2H1EA 4GZYC 3NWTA 5EKKA 1HFGA 4ABNA 2CW0D 1SBBB 5EPKA 1A15A 5C0XH 2LY7A 5ELDA 2LKVA 3EGRA 4RFBA 5JAVA 1WVLA 3KF8A 2KECA 3D8GA 2EY6A 1SXTA 3M4YA 1A2TA 1YN3A 2BB5A 4FXKC 4XXEA 2E75C 3BVMA 4JX1C 2HTME 2KHSA 4HTHA 1WTXA 3I4MB 2A5HA 4KN7C 5CGKA 1ONLA 1T6BX 1E2VA 1ET9A 1UEAB 1KDCA 2TSSA 4CHTB 4YTPB 3HRDD 3HG9A 3NSWA 2NVTB 4KV6A 1TS2A 2WAQB 1KF6B 2VB2X 1F77A 5A2QE 4RCOA 1CQFA 1NUCA 2XVSA 3BYYB 4QMGA 1KNAA 2WKCA 2X69A 3AMUA 1YNJD 2PKOA 1BCPB 1XYIA 2PPBC 1D2BA 5HI1A 1C4QA 3JAML 5JVG3 2K9XA 1PGXA 4IALA 1ESFA 2G9DA 2J53A 2B2UA 4FVMA 2Z4HA 2F0MA 2E74C 2WP9B 4X3SA 2WNMA 3PO3B 2EY1A 1VRAB 5E3FA 2WXKA 1NENB 2K6AA 1EY9A 3AEEB 3AN1A 3DM1A 3FPPA 4A3KB 1XLOA 2RSNA 4NDXA 3OIPA 3SFEB 2JXTA 1N63A 3P42A 2B2TA 4C1NI 3EROA 1QOGA 3NVZA 1TKGA 1LO5D 1O7LA 4MT5A 3OSOA 1SSOA 3GTKB 3OMCA 3W1SA 3VRBB 1G6ZA 1GHKA 1WTWA 2KOLA 2DYOA 1HZ6A 3DHQA 1NCVA 4A3DB 4QIWB 1ENFA 2IGDA 4MN3A 3OPOA 1XF5L 5G3LD 1SMYC 2KUMA 3NQTA 1QKZA 1EQVA 3BDLA 5EJWA 1A3UA 2K5DA 1HUMA 3D3RA 1UWXA 4H2AA 3DXJC 5CV7A 1K51A 2DY7A 2F0JA 4RGTA 3MXGA 2CQAA 4DU9A 3L4PA 1VCIA 5ELCA 5CBAE 3Q23A 2VUMB 2EYLA 3NK9A 4K5WA 3AE8B 3NVWA 4FNFA 2WDRB 3AE1B 3VA5A 2L4NA 3Q6SA 2QIEB 3AE9B 2M9VA 4G4KA 4US9A 1DD2A 4IDIA 1RODA 3M7NA 2WB1B 2J4XA 2WIIB 1FD6A 4E6IA 1L0XB 2YEPF 5K5PA 1N5WA 4ZKCB 1TQOA 1R7SA 1V8CA 2L5TA 5KGUA 1KRHA 2BS3B 4C80A 1BCPF 2BOSA 2NVYB 1XEEA 3AE5B 3HVZA 4C56C 4HR7B 1FRDA 2FE8A 5CV5A 4TRDA 1KNEA 3J80E 1Q90A 4C2MB 3CU7A 3JAME 3HOVB 2IX0A 3VYTA 4DK0A 3RUZA 1EU3A 4N6EB 1E9MA 1WXQA 1E2ZA 2HCCA 1LT4D 4R9WA 4YTNB 2DYMA 1JQ4A 5A35A 2B2UC 2F3VA 1DONA 2QSDA 2JQRB 2ZW0A 5BYQA 3J9CA 4DK1A 4JBWA 1JICA 2KVMA 4OZAA 1EWCA 3QWNA 3DMUA 4O42A 1IYVA 1HCZA 1MGSA 4ILWA 2FUG1 5C0XG 2WQYB 1JCKB 3VA7A 2VB3X 1SFOB 3NTHA 4O1NA 1E6EB 4B0MA 1PGBA 4PQXA 3MFYA 3HKZB 3AEBB 1OFFA 1QT9A 1Y8NB 3A56A 2E6XA 1GPXA 1B3AA 4XQQA 2Y0SB 1VJKA 5MPOA 3PUZA 1A2UA 2AQ1B 1Q8IA 5IGEA 3BK2A 1MBYA 1SYBA 1CZWA 2C5CA 4A3GB 2N55A 1EWYC 3TBIB 1VZ6A 2F4IA 1EY5A 2HDMA 3KLRA 1HTLD 3I90A 4NAMA 4HJGE 4OZCA 1BQQT 1QILA 1AZPA 1B9RA 3BWUD 4X3UA 5KEEA 4PMCA 4A3BB 4NP5A 3K5MA 1STNA 2QILA 5AUIA 1NYQA 2KJXA 1SJED 3E56A 2WXIA 1SNPA 3HZXA 4ZRQA 1IHZA 2Z1CA 1E0BA 1Y8OB 2Z8LA 3K5LA 2B8FA 3Q69A 3FMCA 4RHSA 1PZKD 4M0WA 4XYOA 1PXUA 3K5NA 5EE0A 2OHFA 4KJNA 4HN7A 3C46A 5F2DA 1STYA 2EYFA 2E2JB 1QQRA 4TQ0A 2WDVB 2VZKD 3LB8C 2OEDA 3CKIB 2PW9A 1T5EA 1L6UA 2IDYA 2B2WC 2A68D 1KLGD 3GTJB 1F9SA 3E9SA 2BT6A 2F1MA 2B2VA 3NE5B 3HOXB 4FXCA 3DEPA 3PMFA 4H44C 1WRIA 4WURA 1EL0A 1XX8A 5K36H 3NQIA 1GUGA 4KHVA 1TKEA 4MHEA 4KKJA 4GDLB 1FO4A 2Q5WD 3VQIA 1RWSA 4KKTA 1SNQA 5JEAH 2R6GA 1MSHA 2R3ZA 2K33A 4Q2JA 4HEA1 2BCOA 1F2LA 5BYRA 5CV8A 1PRTF 4B9WA 1HA5A 2W3RA 1YQ3B 2BA0A 3ZQ4A 2XWBB 1TWCB 3AEAB 2L12A 4NZLB 3CQZB 2K03A 3AE3B 3IXSA 4U673 1FFUA 1EYDA 4HCEA 1TWGB 1PFMA 3P4SB 2L1AA 1WTRA 4QUFA 2A69D 3GTLB 5E6JA 2NB0A 2JEBI 4XQJA 2WXQA 1WTOA 5M3FB 4L23A 1Y56A 3H94A 4A3EB 3V3XA 5LL6X 5JPMC 4UAIA 3RLFA 1M4VA 3U4EG 3IFDA 4HCSA 2BA1A 1HRJA 3ND8A 3SVMA 5BN5A 5IT9L 4KD3A 5M5WB 2IGGA 1LTSD 3I4NB 1GUNA 4TQ1A 4A9AA 3RZOB 2EYHA 4RGMA 4P16A 1ICWA 5EGTA 4FF1A 1STAA 1H9RA 3SK8A 1FR3A 1LTTD 3T16A 1EYAA 1QB5D 5C0XI 4DN4M 3DWGC 4TMAB 4DGZA 3S9WA 4XIGS 3BDCA 2EE1A 3HOUB 3ND9A 4A3MB 1E0ZA 1SJHD 2W54A 2MGSA 2LS01 1SNDA 3CRKC 1K53A 2XRQD 4IZ8A 2Y5CA 1I4RA 1LTAD 4CJ0B 2B2YC 1VLBA 3HGBA 1XCQL 1UUPA 3RFZB 3AECB 4YXDB 1BXTA 1Y8PB 4DAVA 4KJOA 4F7XA 1EY0A 1EOTA 1XLPA 2RDFA 1DGJA 1JQYD 1X3PA 4EE2A 1CHPD 2JYOA 1CFMA 2WXOA 2M2LA 3J81E 1V1PB 2HDLA 2JEAI 3H0GB 2F0NA 3L3OC 4KN4C 5EKIA 1CA5A 3DUZA 1JORA 1D5ZC 4MIUA 2K22A 4F88A 3VYUA 3Q0AA 2F0PA 5FLXL 1UWMA 1DZ1A 2K01A 3R2TA 1P7FA 3P4QB 4IFDH 5I2YA 4CKCA 3PO0A 1BCPD 4C3JB 3A7AB 3J80L 1A3TA 2NTSA 4A6QA 4N9TA 5ELFA 3IFTA 3QIAA 1IBXA 1PMRA 3VR5A 3AB5A 3FEWX 1BNZA 1YQ4B 3S15B 1KFYB 3M7GA 4B9XA 3RD4A 1VMPA 1XTCD 5ELEA 2BYTA 2L83A 5E4WC 1RYJA 2V4IB 2F0EA 3LX0A 3IT4B 4B08A 2AQ3B 1Y1VB 2X38A 5T8IA 2QEJC 2N9LA 4LLGM 3IAS1 2PMVA 2MP1A 1L4ZB 3SEBA 5JVH3 3TMEA 2KQ3A 1JWMD 4K14A 4XDCA 3S1MB 1IW7C 5C6AA 2FFKB 1QJOA 1RTOA 2QCPX 4ZHPA 3FC4A 1D5XC 2FHTA 5C4XB 1JR0D 5H8YE 1T3QA 2R93B 5H92C 2KWDA 2E2HB 3I70A 1STEA 1RKNA 4G57A 3X3MA 1LTRD 1F2RI 2E3TA 3VYSA 1YMHE 1HPCA 3AE6B 1HZ5A 1TS4A 1G2TA 3SR1A 3MWYW 5CMDA 1WD1A 4G7ZC 4F87A 3TP6A 2R61A 2Q8IB 3HVDA 1XLNA 3FVQA 3W9CB 1V1PA 3C8YA 1PUTA 1LACA 3CRLC 1FEHA 5T1IA 3GTQB 4LK1C 4TQUS 3TEWA 4YT0B 2E76C 1EU4A 2LMCB 3I4LA 3HOYB 1DOXA 2KEEA 3U7ZA 3NWSA 5FLXE 4NW2A 4OVZA 3MEHA 5FO8B 3W3AA 2A6ED 4C3HB 4WWMA 2DNCA 4KKSA 4HMIA 3Q8AA 1YJIA 5E4XA 2WINB 3SFDB 4WJWA 4IUNA 4BY1B 5C4ZA 2W82A 3SK5A 1ZXTA 3TSSA 2NBFA 3TEZA 1RDPD 5I9PA 2JX5A 2L55A 3UI2A 5C44B 3BG3A 5ELBA 2IWHA 1JMLA 4XDDA 2QKIC 3A8KE 5IODA 3IAYA 1TS3A 2YEPB 1W6KA 2K05A 4DNTB 1JWBD 3VR2A 2JA6B 1IGCA 2O4XA 4ZQ3A 4HKZE 1PTOF 1QWYA 2JE6I 2E2IB 2PNRC 3UI3A 2MPMA 2SAKA 4C7ZA 3D4RA 4K6DA 3T51B 2JYTA 3CIRB 2NMQA 1F9QA 3P1HA 2DN8A 1SNCA 1AEXA 1R9TB 2BDNA 4C3HG 4PMBA 2EOTA 3GD7A 5EBCA 2XWJB 1JW9D 3WCQA 3E6ZX 3BDOA 1EY7A 1OQQA 1DOYA 4ODGA 4BS9A 1FYCA 4XQNA 3FILA 3BYTB 1LT5D 1BR9A 2GRIA 1Y69U 2PIAA 3OIQA 1F2MA 1O78A 3P4PB 2KCCA 3GV6A 2YYZA 2IX1A 2BE5C 3NXWA 2LHEA 1OXXK 4GDKB 1KLUD 1TVXA 1SDFA 5D3DA 3C1FA 4DA2A 3S14B 3RMHA 5IGGA 2LUMA 4IUUA 3TP5A 1D1KA 4KTAA 2I38A 5IGCA