1I4PA

Crystal structure of staphylococcal enterotoxin c2 at 100k crystallized at ph 5.5
Total Genus 63
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
63
sequence length
239
structure length
234
Chain Sequence
ESQPDPTPDELHKSSEFTGTMGNMKYLYDDHYVSATKVMSVDKFLAHDLIYNISDKKLKNYDKVKTELLNEDLAKKYKDEVVDVYGSNYYVNCYFSSKDNGGKTCMYGGITKHEGNHFDNGNLQNVLIRVYENKRNTISFEVQTDKKSVTAQELDIKARNFLINKKNLYEFNSSPYETGYIKFIENNGNTFWYDMMPAPGDKFDQSKYLMMYNDNKTVDSKSVKIEVHLTTKNG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ENTEROTOXIN TYPE C-2
publication title Structure of staphylococcal enterotoxin C2 at various pH levels.
pubmed doi rcsb
molecule tags Toxin
total genus 63
structure length 234
sequence length 239
ec nomenclature
pdb deposition date 2001-02-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01123 Stap_Strp_toxin Staphylococcal/Streptococcal toxin, OB-fold domain
A PF02876 Stap_Strp_tox_C Staphylococcal/Streptococcal toxin, beta-grasp domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.110 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1i4pA01
3.10.20.120 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 1i4pA02
1JWMD 3BYYB 3BVZA 1S5CD 1TS5A 1I4QA 4DXGA 4NZLB 1DYQA 1I4HA 5D3IB 1B44D 1XTCD 1TS2A 1SJED 1I4PA 1V1PB 1LT4D 1PTOF 1JQYD 1LTGD 1D6EC 4RHSA 1BXTA 1V1OA 1S5BD 1UUPA 1EEFD 2IJ0A 1CHQD 4RH6A 2AQ2B 3R8BA 1PRTB 3BVMA 1CT1D 1PTOB 1EFID 1D5ZC 3R2TA 1T5XD 1HXYD 3DWAA 1LT3D 1AN8A 3MC0B 1SBBB 5D3DA 4RGOS 1XXGA 1M4VA 5FKAC 4UDUC 1I4RA 1HQRD 1KTKA 1RD9D 3URYA 1PRTF 1D5MC 1TS3A 1SJHD 1I4XA 4Z9CB 2AQ3B 1FD7D 4RCOA 1S5ED 3CHBD 1LTSD 1BCPD 3GP7A 1ESFA 2J4XA 1FGBD 3BYTB 1CHPD 2Z8LA 1PZID 1UNSA 4L63B 1JR0D 1LTID 2TSSA 4L6TB 5ELBA 4RFBA 1L0YB 3OWEB 1LO5D 5ELEA 1EU3A 2IPKD 1LTTD 2RDHA 2NTSA 1SEBD 1B1ZA 1QILA 4OHJA 5I4DA 1S5DD 3BVGA 1JWSD 1JWUD 4O1NA 4TSSA 5FK9C 1SXTA 2AQ1B 1ET9A 2QILA 1HA5A 1STEA 2CHBD 2SEBD 2WV6D 1ET6A 3DWPA 3TSSA 2R61A 1LTBD 1L0XB 1SE3A 5ELFA 4RHRA 1PYWD 1D5XC 1RDPD 2ICIA 2NTTA 1PRTD 3O13A 3EFXD 1AW7A 1EU4A 1G8ZD 1I4GA 1PTOD 1S5FD 1BCPC 1HTLD 2RDGA 1SE2A 5ELCA 1LT6D 2XN9C 3MFGA 1LLRD 3DWQA 2QEJC 4DXFA 5ELDA 1LTAD 1TY2A 2XRQD 3BZDB 3V05A 1F77A 1LTRD 1V1PA 4BWGB 1GOZA 1JCKB 1TY0A 1MD2D 2O2LD 1BCPF 3SEBA 1YN3A 1EEID 1FNUA 4RGMA 3R2IA 1DJRD 1ENFA 1SE4A 1CQVA 1KLGD 1PZKD 1FNWA 2XNAC 1KLUD 1RCVD 2XRSD 1YN4A 1BCPB 3KLSX 5TSSA 1FNVA 1PZJD 2G9HD 4K6LA 3W2DA 1PRTC 4RGTA 1TS4A 1YN5A 1EWCA 1PTOC 1LT5D 4ZYSA 4C56C 3EA6A 4RGNA 1RF2D 1CK1A 1PTOH
chains in the Genus database with same CATH superfamily
1FVIA 5KHQA 4YWLA 3H7PB 1TWHB 1S5CD 3TBLD 4ZHOA 4J1MA 3RNGC 4AJYB 1TVXA 1XTCD 2L3ZA 1CUKA 2R2QA 3L16A 3QWZB 3I3TB 3S1RH 1HTOA 3V62A 3HZXA 4EOYA 2IDYA 3MEHA 3ZRFA 2MPMA 5LMNW 1EWHA 2F0KA 4LFAQ 1T0QC 2BS3B 1CHQD 2C35B 3GTPB 5E6JA 1QOFA 5BMGA 3A74A 1Y1WH 5C4XB 2F03A 3AU4A 5BR8Q 1AWDA 4ZK9B 1RIPA 3PIO3 3C1EA 4KN7C 3R7QA 1YHBA 1AN8A 5IT9L 2CJOA 1PDXA 1FR3A 1SIFA 3WAPA 1JE4A 1NBWA 2BA0A 5FO8B 3DHQA 1EQQA 2GI9A 5KNBA 1QLBB 4ITKA 4LNKA 3CSTA 1MKHA 4LW1A 1TKYA 5C3EH 4FDBA 4Z9CB 4DN4M 4RCOA 3VR3A 5C5LA 1VQGA 1LTSD 1KDBA 1CJEA 4KJNA 5JAVA 3I72A 4GSWA 2VUMB 3AEBB 3BS1A 3NK9A 4NW2A 2D5DA 2A5HA 1UNSA 4CDCC 5C6AA 3PCOB 1S72A 3A8KE 2FAZA 1SNDA 3TCAA 5HKHA 4OVVA 1A3UA 1LACA 2HQLA 2ZM6Q 3ZNID 1E1TA 2I5MX 2PKOA 4MJSB 1Q86C 3J7YW 4MGZE 1UD7A 2CCZA 1AARA 1HCZA 3P75A 2IY0B 3CQZB 3S1QH 1X54A 2UUCL 1I50B 3VYUA 3HG9A 4TSSA 4OIKA 1GG3A 3S24A 4ZRJA 2L32A 5I2YA 2KHIA 3RZWC 2JVCA 1M8AA 2WV6D 3DWPA 2PQEA 1CM9A 1SE3A 3NVWA 4E3CA 3I5JC 2F0LA 1WJ6A 4C3IB 2NTTA 3AMZA 4K0KL 4P2CB 4DR4L 1I94Q 3HOYB 1AW7A 3UI2A 1YBYA 1PTOD 2ZJPA 2PEAA 1A3VA 4K8JA 4KV6A 5E6PA 4AUQC 1D2BA 1NTGA 3RUZA 2WXKA 1FEHA 2CJNA 1STGA 1WRIA 3ZKJC 2RSNA 3KDFB 1RTNA 3PRPB 1K50A 3BZKA 5CBEE 1YJ1A 2LSSA 1FFVA 3TEHB 2EXZA 2O2LD 1HA6A 4LWCA 4LF8L 1ILQA 3G71A 1JMLA 4I7AA 3A9KB 4B9KA 1N5WA 2KVMA 2JA6B 1JORA 4HLEA 1SE4A 5IGCA 1E8WA 3HHMA 4JYAL 5JEAG 1PHJA 4RF1A 3K5OA 2O5IC 4MM3A 1ASZA 2FE8A 3H91A 1WIAA 5I6WA 3U30A 3TUOA 2CKZB 4ASWC 2GN5A 2W3SA 1WXSA 1B7YB 4WFN3 4W9EA 4DXGA 3QR8A 1I4QA 4A3IH 2DUDA 4A3CG 3OIQA 3GS2A 2K5PA 2HTHA 4YWMA 2HJ1A 3OW2A 3PHXB 3VTWA 2FJ2A 2JJQA 1YIJA 4JBKA 1HZ6A 1LT4D 5L37A 1G51A 5FLMG 2K8CA 2RPQA 3JYUA 2QCPX 3Q24A 4DHJB 1KJTA 4BZAA 3E0EA 2QC8A 1Z2MA 2YLMA 4DWFA 2ZEQA 1Z47A 4D2KA 3V2TA 1MFWA 3UDFA 5D7GA 1PTOB 1Q3LA 3H6MA 1YNXA 1VQJA 3J7AV 4JWSC 3MFYA 4JC0A 4EVOA 5FJ8H 4A3DH 1NJIC 5IAAC 1A62A 3U4ZA 1WVLA 1E8YA 4WAFA 2JYEA 5C44B 2VZAA 3FDTA 4YY3L 3IAS1 5IY0A 1NE3A 3X0WA 1YNND 1R9TB 3PSIA 4N9PA 1Y1VG 3NXWA 2K50A 3GO5A 1CKOA 3FKIH 3J81j 2LGSA 3I4MG 1EYGA 1WD0A 3IT6B 2J7ZA 2ZM6L 2FMMA 1FD7D 4FO2A 3PUWA 3J81L 5AEKB 1PFNA 2M00A 4IUVA 2JA8B 1OO9B 4DDGD 1BCPD 2D2QA 1I35A 2INDC 4ILWA 5JPNC 4JWUC 2WXOA 2F3IA 1CHPD 1MSHA 1I6HB 1YJWA 1QVGA 4IWQA 2NBWB 5IYCH 2MHJA 4TUUA 2OCEA 2GBKA 2F0MA 1V43A 5ELEA 3M4OH 4C3HB 2EKIA 4NNJB 4XYOA 2MFIA 1I94L 4EGVA 2NTSA 4ZLTF 4A4IA 2L15A 1Z5SB 4GU2A 5I4DA 4FADA 2D3AA 3QQ8B 1JE5A 3VTUA 2N1WA 3AEAB 4IUNA 2HTME 3AU7A 3DBLB 3UIPB 2ICIA 4M1UB 1PRTD 1KAAA 1EQRA 2M0XA 4X3TA 4YTNB 3F2DA 3STBD 4C1NK 3CPFA 1ZGUB 4M8MA 2FCQA 2A69D 4DV7Q 1IBML 2KHJA 5ELCA 1BMLC 4YCUA 2NB0A 3MFGA 4QY7A 4OVZA 2G4SA 1VQ5A 1P8LA 3KUZA 2JRIB 2XRQD 3UQAA 5KNCA 1C9FA 3WDNA 4JI2Q 4YT0B 4JI4Q 4HJGE 4A3BG 1IXRA 3CCMA 1ICFB 4PZ6A 1JCKB 5LMNL 2LHDA 3WOFA 1TT2A 3E0JA 2KMAA 4K5VA 2IY5B 4WJQA 1E1OA 2MP2A 3NE5B 4RGMA 3AE4B 1VQOA 3Q8AA 5IT9c 4KD4A 1STNA 3P2BA 4BY7H 1KLUD 1GHJA 1LV9A 2SAKA 1X32A 2LGDA 1GB1A 1Y8OB 4X3KA 1BCPB 3OJ4B 4P73A 4H2AA 1WTXA 3GTKH 2RR9A 5J22A 5JOBA 3I9V1 5EKIA 2ZNVB 4ANWA 2B2VC 3HS0C 1E2VA 4ZAIA 4C56C 1WTWA 3TRZA 2DLBA 2XEWA 1CZGA 2K8HA 3ML8A 2NN6G 3BVZA 2DZIA 3UQBA 1EY6A 2A68D 3L10B 3I56A 4ZRZA 3X3MA 3K8AA 1ZDXA 2AWTA 4TQ1A 1O7LA 4OXPA 4OO1H 4ACFA 2LXJA 3ZW3A 3RD2A 1WTHA 2NPTA 4IURA 4GNXC 2IJ0A 2GBJA 2K03A 4UP7A 1PRTB 2L55A 4C1NI 4CGYB 3DVGX 3OOCA 4DV0L 4R9WA 2HIXA 4ODGA 1C4CA 1V49A 1GHKA 3RLNA 3K7AH 1D5ZC 4MT5A 1A0IA 4MNOA 4JOIA 1HZ5A 5M3FH 3E9HA 2F0FA 4MM3B 3M85A 4YWGG 1H9JA 1A2TA 4XQNA 3CD6A 3CU7A 4C4VA 2BB5A 1P9DU 3EVQA 5AZGA 4YWKA 1MG4A 1KH0A 2JXTA 1N33Q 3FAHA 3I63C 1WTOA 1KTKA 2D3BA 2D0PA 3M3YH 1TKEA 1L7YA 5C23A 5NUCA 1IZ6A 2V0GA 5IP4D 2BH2A 2Z6KA 1QNKA 2IO2B 3CHBD 3TBIB 2LVQA 1WGRA 3ZDMC 4A3GB 3A8IE 4P72A 1UWMA 3N6RA 2WDRB 1GO3E 3PUYA 2IWHA 4DAMA 4K8IA 4CKEA 1JR0D 3HVDA 1WJJA 5JEAJ 4B95A 3FEWX 4C7ZA 3PIP3 2GBRA 3I91A 3W1BA 1EUVB 1B9MA 2IPKD 4KTAA 3L54A 4POFA 4JX1C 1R4NB 1YNJD 2K01A 3AE1B 5BO4B 3KQ4A 4IPHA 4B3MQ 5A2QL 4HJ5A 2K6QA 4DV7L 2J52A 1CSPA 2A6EC 1E5WA 3ULLA 3I70A 3HOVH 1HNWL 2NWGA 3KLRA 4HTHA 3PO3H 3B9JA 4H0LC 2SEBD 2UUAQ 4USAA 3S2AA 3HEJA 4LLGM 3RMHA 3Q22A 4JI2L 3S14B 3CRLC 4WWPA 1PYWD 1AYFA 4A9AA 1KAWA 1EM7A 5IGFA 1XMOL 3NTHA 1VMPA 1GXDC 4IDIA 2LJ5A 4HSVA 4P7IA 2JE6I 3CC4A 3D3RA 1A63A 2E76C 1IUEA 4HEDA 3F2UA 1NR4A 2JA7H 3MJWA 1Q0WB 1E0BA 3P1MA 3S1NH 3QCAA 4DXFA 1GB4A 3A8JE 2WAQE 4NAMA 4IFDH 1FO4A 3HOWG 3DXJC 2F3WA 1Q1EA 3HP3A 4KSLC 4H13C 1U4PA 4BWGB 5EPJA 3AECB 2KVRA 1WTRA 1QUQA 3SEBA 2FUHB 1EEID 2I5HA 1Z6HA 3HOZH 1V9JA 4JLCA 3K5NA 2EMTA 2M9VA 5JPMC 3HK0A 4ZHPA 2VS1A 4CJ2C 4JI3Q 3RNUA 1KFYB 3L7ZC 2NN6I 4IPDA 1XQQA 1NMFA 3A54A 2KDEB 3HVZA 4Y52H 3DBSA 3NZUA 4RKLA 1YN5A 3NY5A 1Q7YC 1QE6A 1YQ4B 2RMMA 3J81c 1JJCB 4DR7L 4F87A 3CXCA 3A9JA 1Y1WG 3QAQA 3K5MA 1BF4A 1WM3A 3PT2B 5DPTA 2QHOA 4PMBA 1RF2D 2NVQB 2JN4A 2K1FA 1E2ZA 3HM6X 1JWMD 2MBOA 5L83A 2B2UC 4HJAA 4XXEA 2LXCA 4DR5Q 4IUMB 1K83H 5D3IB 1CA6A 3CKIB 2J53A 4LF6Q 5C3JB 1SJED 1I4PA 4G4KA 5CV5A 1J8IA 4S17A 3W5UB 1LTGD 2KUMA 5M9OA 3WALA 4FJZA 1BUVT 5C3EG 4BBRH 1E9MA 1F2LA 1UEBA 2DNEA 1N33L 3D4DA 4GN1A 4NAWA 2BKFA 1VQAA 4IOCA 4B3RQ 4KY6A 1FCLA 1L4ZB 2KQ3A 3PSEB 2C9OA 4PG3A 2WB1B 4UPAA 1OXSC 1BBWA 4DNIA 1JB3A 2FCSA 4CO7A 3EFUA 1WOCA 1QZGA 4JI1Q 1X3PA 2BA1A 5D3DA 2GBNA 2DZJA 2JY6A 4ZOHC 3TEYA 2KLGA 3SDLC 3DWGC 2Z0EB 3KWVA 4W9GA 1M4VA 4II2B 5FKAC 4HIKA 2IZVB 3AYHB 1KD1C 4FNFA 4LFCQ 1VQKA 2LJIA 1VQBA 4KMUC 2XK5B 4JI6Q 1D5MC 3I7FA 3ND8A 3VRBB 1C79A 1PYSB 5EKLA 1VQ9A 1TWAH 4BY1H 2EDGA 2B2WA 2MQHA 2GLSA 1EZ6A 2KHSA 2WIIB 4B3ML 1TR5A 2NPTB 2VW9A 1HPCA 2KN4A 2UUAL 2M8SA 3QA8A 4A75A 3TZDA 4MELA 4B3SQ 3PF4A 4OW0A 1F9PA 4C3JB 1LTTD 1C3TA 1RTOA 1AP0A 1XPRA 1BNZA 2DNCA 3MJ5A 3UE1A 3V61A 1TYGB 4C4VB 5IODA 3AB9A 4FBJB 2BQQA 1ICWA 2CH4A 1O7ZA 4GOPA 3TSSA 2D3CA 3JAML 1GUGA 2WXHA 3VUYA 2KKCA 4IOIE 3D4WA 3Q3OC 2EXDA 4A3MB 3M9BA 2F4VQ 2ENBA 4DR1L 2A74C 1QF6A 1Y14B 2IX1A 2N9XA 4FA6A 1SE2A 1UZXB 4Q5VA 2D2CC 1EYCA 4MH0E 2RDFA 2PNRC 4RMAA 3CRKC 5C4XH 1HNXQ 2Q8RE 1VQMA 2KZRA 5EDSA 5JH5C 4ULLA 1MHWC 3IKJA 1MD2D 2VQEQ 4R3DA 5GXGB 5H92C 1E7UA 3D6CA 1YN3A 4A3IG 1C8CA 1QVFA 1JRPA 3S15B 4A3PA 3AM9A 2PYKA 4Q0FA 5M3MH 3K81C 4A20A 1UELA 2WDTB 2MO0A 3OWFA 3PZDA 1STAA 2L05A 1XO3A 2K05A 1XMQQ 4W9HA 4DR5L 4C2MH 2QKIC 3HOXH 1FNVA 4DV2Q 3OYYA 4KKIA 4GN4B 1JOQA 1STYA 2IY1B 1VZ8A 4RCNA 4F7ZA 1ZUD2 3VYRA 2VUMH 4GZYC 2WXFA 3KYHC 1K8AC 2B8FA 2B8GA 3ONAB 5FJ8G 5IT9E 4IM3A 5J18A 2UXBL 4A3DG 1TS5A 4B3RL 1WXQA 3PRMB 2Q8TA 3EUB2 4FYDA 4LK0M 5KGUA 2UU7A 5C4HA 1B44D 3HOUB 1H9SB 2UXCQ 1VQNA 2Q2HA 4JI1L 3Q6BA 1N63A 2QIEB 3FKIG 4UHVA 1EQTA 3CPWA 1CMXB 1I3QB 3CQZH 2K75A 1SYDA 5TR5A 1I50H 3AMUA 3QX1A 1V1OA 3X23A 3PREA 3K57A 4G57A 4KHVA 4LFCL 3H15A 3BVMA 3CMMB 4M0WA 2KWVB 4XDXA 4X62Q 1MJDA 5EPKA 4RNAA 3DWAA 1NVID 3CCEA 2BE5D 3T56B 4EQOA 1DOKA 1HFGA 5IYCG 1WSPA 3R93A 4YHHL 2L76A 4I6LB 5GQOA 2KA7A 2Z9HA 1IW7D 3FP9A 1VCBA 2DAFA 3U9OA 1V80A 4XQJA 2L1BA 2KN5A 2KAJA 4PYZA 3QOJA 1TZOA 4DR2Q 1J19A 2LGIA 2JU6X 2F0VA 2UU9Q 2E2JB 3TP7A 2Z1CA 4TQ0A 3DPDA 2X6LA 3QG1A 4K2LA 1XLQA 4LF5Q 2CHXA 4JK1C 1WYWB 4WWNA 2B2YC 2YTXA 2H1EA 3TS0A 1J7AA 3KYCD 1QOBA 1DM0B 1KOTA 3GOEA 1TJEA 1WR6E 4KGTA 1PZID 2EYMA 3A0JA 2MBHA 2INCC 4NAWB 3CF5A 1G6PA 1RAXA 4A3KH 4RFBA 1IBKQ 3HM3A 4NB3A 1WTQA 1H9RA 4HPLB 1X3GA 2Y3AA 1EIFA 4MTKA 4RAUC 2W54A 4ZUIA 2D3GA 4G0NB 1QILA 2F4VL 4JGHB 3ZXRA 4ARCA 1QJOA 1B9RA 2B3GA 1T0RC 5CC4A 1GUAB 1QNUA 2RKSA 3GTLH 1P3QU 3I3CA 4DV6L 3PUZA 4QAYA 3PGZA 1H8CA 4KJOA 4K3CA 4BY7G 2HHHL 3PPAA 1ZE3D 3VR2A 1XNQQ 3HKZG 3M7NA 2EYHA 2BPSA 1YJIA 2OHFA 4MSMB 3DEPA 1SE8A 2REXA 1AFPA 3H3VI 2XN9C 1FIQA 2NBVB 2YEPF 5E6OA 4A3EB 3EN2A 1EL0A 1WR1A 5HURA 5DLQE 3DEOA 5C4JB 2WGSA 3BZDB 3BY4B 1IYFA 3LJ3A 2HDLA 4DV2L 3ZNGC 3S17B 4LUVA 1II3A 3I8ZA 1EY7A 1A3TA 1UGMA 2L0CA 2QEXA 5JVH3 2B29A 3UDIA 3A4RA 3QWNA 5C44H 1STBA 2OJWA 3TEWA 2R7FA 3R2IA 5EBDA 2RPVA 1WI0A 5IP9H 4AWJA 1FFUA 4OO1G 2JA9A 5KRUA 2VL6A 1HZ9A 2WKDA 1ZW7A 3ZJUA 4OWXB 4G7HC 3NELA 1Q81C 4RM9A 3SFDB 3TIXA 2KFKA 2UXCL 4L1BA 2JZ3B 4I6NB 1CQFA 2I07B 3ND9A 5AJ3Q 1CI3M 1PTOC 1HUNA 4FLHA 1CTMA 4R4CA 4X64L 1MI0A 3C1FA 1PH6A 5M3FG 3GTQH 1I6HH 5ISRA 2VH2A 4S0RA 4KGSA 3KH0A 5CX3A 4KZCA 4BKGA 1I4HA 2V4DA 1EYDA 2AL3A 2LRUA 1E24A 2Q2IA 4JI5Q 3PQIA 4N9F4 3NP8A 1UE5A 4BBSB 2J0TD 2WB1E 1O7IA 2MWSB 4PZ7A 1FXIA 2E2HH 2K8BA 5DPRA 3J81E 1S5BD 1KC8C 3DOWA 5JJZA 4JI7Q 1WD1A 1FRRA 3KLSA 3GTMH 3PRZA 2N55A 3IHPC 4DR2L 2EY6A 1SAPA 4DV5L 2UU9L 4NY0A 4AS1A 3OMCA 5CR3A 1VQLA 3JAMc 4LF5L 2JYTA 2BWES 2KEDA 1SBBB 5HY6A 4OWWB 2K04A 2LI5A 3AV8A 3B1LX 3E9IA 3B2GA 1XXGA 2CVRA 3OIPA 4DKAC 1T5EA 3C0RB 4F88A 4HPMB 1VQDA 4BAXA 4UY8C 4MN3A 1PH5A 4HKZE 2F0NA 2I2YA 3URYA 1IBKL 3PO2H 1XF5L 3BIID 4KY5A 2O2VA 2BCOA 3HOVG 3PO3G 1GUSA 3OJ3A 4YL8A 1IBLQ 2Q2UA 1SRUA 1EIHA 5L95C 1FGBD 1C4QA 1R4QB 3BYTB 2PE6B 3ZJTA 4XT3B 1WGYA 4M8NA 3KF8B 4DDID 3HRZC 4LUZA 5CORA 3P4RB 4KIKA 1GD7A 5LL6X 4M0WB 4CJ1B 2NYZD 4HIOA 5LL6S 3ZDTA 4GKJQ 3ICEA 3CAMA 1HQMC 2JA7G 4GXBA 5AZFA 4KKJA 2N7DA 1KIXA 1XNQL 4LF4L 2KCTA 1LM0A 4IFDG 3AE5B 3ENEA 4A90A 1JWSD 3OPOA 1RHPA 3BDLA 4V0BA 1YNNC 3K58A 1SSNA 2CW0D 3HOZG 3FILA 4DK0A 3V96A 1YX6B 1K8OA 4FF3A 2ZW1A 4LFBQ 1TTNA 1NBFC 1S3SG 4KKSA 1X3EA 4B9WA 1BDOA 3M7GA 1BCPC 1Y1VB 2CR5A 3UIOB 3PMFA 3CCRA 2FINB 2ZJDA 3K6OA 3I4MB 3HGBA 4JI0Q 2KANA 2MJDA 2R2OA 4XX5A 1N34Q 1LGRA 1LTAD 4OO1I 2FHTA 4BBNC 1Y56A 3W9CB 2WXQA 5DAUA 1M94A 4J6IA 1YEZA 2KWDA 5AJ3L 2KFJA 2KT7A 3V6EB 2EIFA 1E0ZA 1JALA 4I6PA 3CMEA 2XBBC 3VUWA 1G2SA 3ETRA 2FUG1 2IO0B 5M5XH 4B0EA 4IJHA 4ANXA 1C9OA 4EX5A 1SYGA 4XQQA 2BS4B 2EKEC 2KYWA 3O65B 2JEBI 3GQBA 4BBRG 1YVCA 1HE8A 4EE2A 2G9HD 2XTIA 3N1XC 1PRTC 2PI2A 2K9XA 1TS4A 4JI5L 1SFOB 3ZTCA 2R92B 3MTSA 1WJUA 5M5WB 3MZ5A 3MVVA 3CIRB 1Y8RC 1N5XA 2AHOB 2A1AA 4KI0A 4A3JH 4JI7L 3Q2AC 1AE2A 1VZ6A 2SNSA 4XGAB 3PF5A 1N32Q 1QCBD 3JVZX 5JJKA 4IG7B 1CZWA 3RN9C 2WFWA 1PTOF 2WAQB 3S16B 1RLFA 4NXNQ 4IWOA 3ULJA 4DR3L 2ASQA 1L0WA 4JI8Q 1PH1A 2XGTA 3MA2B 4WQOB 3TP6A 4XWWA 4QQBX 2OJRA 4A3BB 4BY1G 4R8IA 1EF5A 3GV3A 1A2UA 3GTJB 3S14H 4TV3A 2KFKB 2TMPA 1SF0A 2K0PA 1P1AA 4JG2A 4LFAL 3SR1A 2A6HC 4N8X1 2IGHA 2KEEA 4HJ8A 1NSNS 4OVUA 2IO1B 3HUIA 5BR8L 5A2QE 1K73C 4ZRIA 4K3BA 3BZCA 4GLAC 2EYPA 1YJ9A 3D4RA 2UUBQ 4GKJL 1EIGA 2MJ3A 3VR8B 5DEHA 5IO9A 4XTCS 2BYTA 5FR6A 3T1HQ 4CHKA 4FN2A 5C5MA 3Q8DA 2I5LX 3E56A 4KDLB 2PQAA 2N0SB 4IFDI 2D11A 3ZRCA 2KDBA 3RLOA 1QVCA 3RZDB 5DPSA 3J7AF 4DFAA 4CJ0B 1Q10A 3QHTA 1BO0A 1L0YB 3SK8A 1K0RA 4F7XA 1EU3A 3QIAA 4JIOU 4LCDE 1IBXA 5KIXA 1YMHE 3MP9A 1NNXA 2ZZPB 4OX9Q 4BA1I 5IGGA 3S1MH 3BINA 3GE8C 4WWMA 3W1SC 4L5TA 3LB8C 3A33B 5IGBA 4JI0L 2I1JA 4DAYA 3IL8A 3AE8B 3WIMA 1KNAA 4RA8A 2CH4W 1SYFA 4URKA 1Q5WB 5CTRC 4LF7Q 2K1BA 4DV1Q 1TGZB 1WY8A 4JBJA 4UP8A 3KFUA 2MJEA 4J15A 2O2VB 5M3MG 1PH3A 2JZPA 3TDQA 4IUPA 4X66Q 4JBMA 3I4NG 3B0AA 4LNIA 1LUZA 3HOXG 2N3SA 2EZVA 1YITA 2K5QA 2NUCA 3J80L 2PPHA 1PLFA 3FMCA 2QEJC 5GADC 2NVYH 4KIKB 2C7NB 3LWUA 3G6EA 2VUMG 2FIFA 1F77A 3MXNA 3WWVA 3IG3A 1TIID 3OLMD 4X65Q 1TY0A 3W1GA 1VQ8A 2MX2A 1BCPF 1RWSA 3MHSD 3T13A 3NBIA 1FGUA 4WJWA 1WTVA 2RHQB 1E8ZA 1D3ZA 2E75C 5HI1A 2DJFC 3VFKA 3KJPA 4BBNF 2ONQA 3FILB 1TWFH 1N32L 1SGHA 2VNUD 1W6KA 1TT5B 1T3QA 1ISNA 3P20A 3PHWB 4K6LA 5E4WC 2PW5A 2D9UA 4K2KA 4QJFA 2KDIA 3VYSA 4NXNL 4HMIA 2J7QB 4BFRA 2ZVNA 4JI8L 3A1QA 1V5TA 3SHQA 2JP1A 3BYYB 4NZLB 1P7EA 1Y8PB 1ZDVA 4DK1A 1FPYA 2R93H 3OG5A 3G7LA 2EY2A 5I9PA 2JSVX 1IKMA 1TS2A 5JZEB 4OONA 2DYBA 4F1SA 1IPGA 2NVTH 4A93H 1V81A 2MCNB 4IFDJ 4KY7A 1JWAD 2PO4A 3HOWB 4W9FA 2J0JA 3OSOA 1UUPA 1HR0Q 3R8BA 3SK4A 4US9A 4FHJA 2F0SA 2G4DB 3C19A 5EE0A 3N30A 3R2TA 4ABNA 1IL8A 4FXCA 1T5XD 3W1YA 1PH2A 2UUBL 3DM3A 1AH9A 1ZKOA 3DHIC 4CBVA 3AQQA 4YIJA 1DZ1A 1XWEA 3T1HL 1E8XA 2KQSA 2Z0DB 4LJZC 4RGOS 4A3KG 1PH8A 4JOIC 2CFMA 1YZ6A 2DZKA 2LEKA 1UEAB 1FD6A 3CC2A 1K53A 3GE3C 1W3SA 2E6XA 4ICVA 1J9OA 4OELB 1H95A 4TVAB 1FM0D 3FPUB 4LNNA 4HPPA 3GTOH 4JBWA 1V6EA 1WGGA 1N9WA 5BMIA 2E5LQ 1VQCA 1LXDA 2KNBA 1S5ED 4RMFA 4JV5Q 4OL7A 2SDFA 4YCWA 3IFTA 4HEA1 3JAME 1KF6B 4NQKE 3KW5B 2MA9B 3UE0A 2CWPA 2OOBB 1Q46A 4L63B 2L1AA 2MQJA 2WKCA 2E2IH 4DUYQ 2A8VA 2FMCA 4DK3C 2XVSA 1BBUA 4L6TB 3GZNI 1DXMA 5ELBA 1UBIA 4DF7A 3NEMA 2B63B 3SR6A 2Q5WD 3U52E 5C3EB 4IO9A 4XT1B 1B50A 2N88A 1ONLA 1ZYRC 4NP5A 4X66L 3AN1A 4BKTA 4QMGA 3NZSA 1TU2B 5EQ0A 1E7VA 1QOGA 4W9KA 4XDDA 4LMQD 2NZHA 3AE7B 4HCNB 5CHVC 3K5LA 2QILA 1HA5A 1F2ZA 1STEA 4IOAA 2CHZA 2FFKB 3NBHA 1OQQA 1WTPA 2DYOA 1H9KA 3MWYW 1SR3A 2IL8A 2YTYA 5C44G 1ZXIA 2B2VA 4RHRA 1D5XC 1F0ZA 5IP9G 2WDVB 1VQEA 3SGIA 1Q1BA 1PH7A 5HGTA 1OXUA 2WXPA 1F9RA 1SYEA 1Z9FA 3NHEB 2V1YA 1SMYC 3S1QB 2BGFA 2PJHA 2BF8B 1HTQA 5ELDA 4WJOA 3S2HH 1TY2A 4BVUC 3OTOQ 2JX5A 3QK0A 2LWPA 1SN8A 2K5VA 4O0AA 4IPCA 1LYLA 2RVLA 2V1CC 2DWQA 2QCZA 1NCVA 5CV7A 1VLBA 4QIWB 4K14A 1WZ0A 2OEOA 2K5WA 3RD4A 2O6VA 2E2DC 1L5PA 3M4YA 2WU5B 4YCVA 3T8MA 4DAYB 2K6DB 4L8JA 2QSDA 2M19A 2JK8A 5KYLA 4JI4L 3L9AX 3RZOB 4JW0A 3AXCA 1PZJD 1EOVA 3R3MA 3W2DA 4ZKCB 1W2BA 3B08A 3EHVA 2KOXA 3TN2A 5IGEA 2NVXB 2DZMA 1V97A 1IGCA 1T0SC 3HKSA 3TMEA 4DV3Q 1E2WA 4M01A 1RODA 1CK1A 5JHAA 3G6JB 2DY8A 3NS1A 2JA5H 3DM1A 3Q0AA 2QF7A 2F52A 2B3AA 3MXNB 3A7LA 2ZJQA 1VD2A 5C4ZA 2B2TC 2WINB 2F0PA 1D6EC 4AYBB 3LXFA 4ZCKA 2KDMA 3PO2G 1XEEA 2Q8IB 1MBYA 3N52A 4DK6C 4YSXB 1WX8A 1ESRA 4RH6A 3VA5A 2IGGA 1EY5A 4DNTB 3OMGA 2BT6A 5EE1A 2MLBA 4A3IB 1WFQA 4J3OD 2N78A 4A3FB 2L83A 1RYJA 3R3OA 4BOSC 1P7FA 4JV5L 4UAIA 2IW3A 3MC9A 2KD0A 3DMUA 2Z4IA 1VZ7A 1GC7A 3K0YA 1JWBD 3SXHA 2Y5BB 4F8CB 2ID0A 5BYSA 2OXPA 3A1QB 3CCLA 5EPLA 2AKWB 1PH9A 4A3EH 1HQRD 1X55A 4NDXA 2X38A 1XCQL 3VH4B 1TS3A 2UXDQ 3P4SB 1M90C 1FJGQ 3V3XA 2BYEA 3AFQA 3KLWA 1XYIA 1P98A 4KN4C 1V8CA 1GJXA 2C9WB 2MP2B 5HFYA 3H0GH 4A3DB 1NYQA 4A3OA 5D6JB 2K25A 3IXSA 2LY7A 3T1YQ 2DY7A 4REZA 2RSUA 5CMDA 2L9HA 1ACCA 2AUKA 4GOCA 1Q1OA 4EZJA 5IYDH 3FKIB 3OWEB 3EGRA 3D0FA 2C60A 1J6QA 2D5GA 3RYTA 3QO2A 3GTGH 2WP9B 5J39A 1N36Q 1A8VA 4OEMB 2WXIA 2N49A 1VCIA 1J7CA 2GMIC 3K80C 2WXLA 2CHBD 2JT4B 2O6VD 1LTBD 5I6YA 4OZAA 4PMWA 3OTOL 2E3TA 4TQUS 1HFNA 3O13A 4B3TQ 1TXYA 3M4OB 3PVLA 2H88B 1I4GA 4BBSH 1X56A 2CKHB 1SNCA 1XNRQ 3NTKA 2MSED 5DNFA 2IO3B 1TKWB 3M4PA 4IUUA 1A6XA 4GN3B 1BBXC 1E6EB 1LLRD 3CC7A 1NYRA 3APDA 1PQSA 4GS3A 3P63A 5K36H 1YX5B 2M17A 3RT3B 5EJWA 4QB4A 5J2RA 2OEDA 2WX0A 3AFPA 3OW7A 4A3JG 1YJNA 1Q8IA 1VDZA 2R7ZH 2QGQA 4WWOA 3MC8A 4QCLA 2H89B 1RM6C 2K5DA 4L5RC 3T9LA 2IHFA 4DV3L 1TWHH 3SE0A 2BYFA 2F4IA 1CZPA 1KM7A 2E8GA 4PT5A 2XRSD 1H9MA 4WQMA 1I6VC 1HH2P 5CHWA 1G91A 2VB3X 1WF9A 1VF5C 2BW2A 4LAAA 3T16A 4MDKE 1KDAA 3ZGZA 1EIYB 2WLBA 3K9OB 2PIAA 2ZW0A 4MGKE 4EQPA 3R7RA 2Q2TA 3U50C 3U58A 1KRSA 4ZYSA 1G2TA 3TREA 3GTPH 4JI3L 2A6ED 2FBWB 5HGQA 1K3RA 1UBQA 1PXUA 4R4IA 3EFCA 5JVG3 2IT1A 4BY7B 4P1CC 1MVKA 2GVAA 2Z0SA 3Q3FA 2A5UA 4LNOA 3HKZB 4L5QA 1OXVA 3Q8FA 2WXGA 2JPHA 3CCUA 3E9SA 1KL9A 2O6VB 4G3XB 1B53A 3I73A 1C76A 2PW7A 1EEFD 1G6ZA 5HHDG 4CDEC 2Y0SB 2O4XA 2FNJB 4LF6L 3H09A 1SNOA 2IX3A 4RM8A 2UXDL 5BYRA 1Q12A 5J17A 1FJGL 2MBQA 2DNFA 4TKOB 3MC0B 5G3LD 3ABVB 3NG0A 3RNCC 2W55A 5IWAQ 3I55A 4MH8A 1N6ZA 3T1YL 1X3FA 4UDUC 2LXKA 2PZWA 1RD9D 3IFDA 3ZIMA 4EKUA 1CFMA 3PUVA 1I4XA 5BN5A 1N8RC 2JEAI 2KVZA 3K7AB 4DQOC 1QUQB 4DV4Q 1IP9A 4GLVB 3GV6A 5M3FB 1EO6A 2MBEA 2V4LA 2WX1A 1V5OA 2CS4A 1IHZA 1N36L 2VQFQ 1XCTL 2AUJD 3WAMA 2GVBA 3TL5A 1K28A 4ME3A 1WCMB 1RRBA 3K0XA 4FVMA 4JI6L 2EELA 1I42A 2ZVOA 4C3IH 3Q8EA 4PS8A 1XLNA 1JICA 3HOYH 3M3YB 3GB1A 3PO0A 4B3TL 4IN3A 4GB9A 2B39A 5IP7H 2R92H 3A9JB 5EKKA 5FLXL 1S1QB 2R7DA 1DOXA 2KQ7A 2XWJB 1S5DD 1NR2A 4OGQC 1JT8A 1I7HA 4XWTA 5MPOA 1EYAA 4AH6A 3QB3A 3UDGA 3L13A 1F1HA 1HJPA 2N7EA 3GDEA 1P16A 4B3SL 1MG8A 2EY1A 2C5CA 4NMZA 1L0XB 4HROA 4GKKQ 3F1ZA 1UE7A 4K5XA 1YOVB 2Z4HA 1VQHA 3EFXD 4EEWA 1E7ZA 2GB1A 2JA6H 2KX3A 1DOMA 4FP5D 1IYVA 2GBMA 5G5GA 3A56A 4QIWE 2I0QA 3C8YA 3U4EG 3HOVB 3WAOA 3Q14C 3NOBA 3MXPA 1EY9A 1V1PA 2EJFC 4Y7NB 3CCJA 1X9NA 2MO1A 3DCGA 4V190 3QIJA 1S3OA 4MGIE 1C48A 2QW7A 1U4LA 5I2XA 2R93G 4FF4A 3A7AB 1QG7A 3C3LA 1ENFA 1XLPA 4KK7A 3KUCB 3P7JA 4A93G 1HNXL 2EJGC 2JA7B 3L4PA 1NI2A 2CW0C 3S1NB 3RUIB 4HMJA 5GAGC 2K32A 3IT4B 3S9WA 4H02A 2GA4B 2VQEL 4A55A 4WH4A 4E71A 3EJIA 4MJSA 4GLSC 1PMRA 3AEEB 2PCFB 3M62B 2NS5A 4NJ6A 3PZ7A 4LK1C 3RLFA 1UE1A 4HJ9A 3HOZB 1PDQA 2F0UA 4NQLB 1PTOH 1XMQL 5IN7A 3RZDH 4AYBE 1GVPA 4IM2A 3SHLA 2RF4A 4IUTA 1B70B 2KJXA 4X6AH 4ZRKA 3E6ZX 3BJUA 3NRZA 2LXAA 3ZJYC 3CP0A 2VZKD 2KBNA 1E22A 1AZQA 3I57A 4QUCA 1EY0A 3TP8A 1W6JA 4MEMA 1R9TH 5D65A 1JMCA 2HE7A 2PPBC 3H9DA 4GOPB 4CYEA 4R1JA 2MRPA 2CU1A 3U7DA 1MPEA 3DBRI 3NSWA 1Z7TA 1GAQB 3WOEA 5T1GA 2JA8H 2JUOA 4RG1A 4W9CA 4DV4L 1LT3D 2D0OA 5CV6A 1L1OA 2EPBA 2ZCCA 2K7VA 1F2YA 2L7RA 1PVOA 2AEHA 3PIOA 3KBXA 4DA2A 4APVA 1ZEQX 3A9KA 2ZTDA 3A55A 1I4RA 4BBRB 3P42A 1V9PA 3J81i 1U4RA 1T6BX 4X62L 4YTPB 5K5PA 2KTFA 4C3HH 1B3QA 1MHHE 1SJHD 2C7HA 4HWIB 2AQ3B 4PV1C 2OQ0A 2PZUA 3T51B 2RDBC 3KUPA 2VRRB 2WXJA 4OIJA 1Q8KA 1ZKHA 2J4XA 2K5NA 3ULPA 2Z8LA 2UUCQ 2K14A 1D1KA 1ZXHA 3RULA 1KHIA 3BDCA 1WXMA 1TWGB 1WRDB 2F0OA 2RQXA 4WRDA 2WACA 2LUEA 2MBBB 3J80E 1CKMA 2YTVA 1KXLA 4PS3A 4AJWA 3JC66 3KF6A 3RR5A 1XD3B 3CSFA 1TWAB 4DR4Q 4BY1B 4OHJA 2L0TA 2D07B 3J7ZC 4LJOB 1CA5A 3L0OA 3MAQA 4BXXH 1J7BA 1VDVA 3LNNA 1X1MA 1R4MI 2JQOA 2HCIA 4MZ9A 5T1IA 2HDMA 4PS7A 1EQVA 5IOIA 2LD9A 2DENB 4MTNA 2V3PA 2VZKB 4AP4C 2WHIA 2M2LA 4M00A 5E4XA 4WIPA 5CV9A 4FHKA 4AOFA 3VXWA 3IBEA 1QT9A 3ZUNA 1VQ4A 1D4BA 4LF8Q 3M95A 3LX0A 5AUKA 1NEKB 3BK2A 5CYUA 3S2DB 1ROEA 3KWLA 1Q82C 5E7NA 2ICEC 2WDQB 1LTRD 1Y8NB 3SK6A 1F52A 3PV0A 1B4OA 4WORA 5GROA 2M1MA 2QDFA 1JW9D 1GUTA 3Q3JA 4TKNA 3Q8CA 2JA5G 2JQRB 3FC4A 1DJRD 3V6CB 2KCNA 3T3OA 5BMHA 2EYOA 3DHHC 1MHXA 2JRHA 1RCVD 4KZ0A 4OZBA 1GKHA 5C0XH 5H8YE 4W9DA 1WYDA 5ELOA 1WWTA 1C0AA 1MI2A 1WE7A 4CHTB 3FRPB 2N7JA 1VMCA 4RGTA 4LF9Q 4GDKA 2W82A 4HCSA 3GZNB 1F9SA 1LT5D 3VTVA 1JQ4A 2PMZE 1SLJA 5FR3A 3HKZE 1K8MA 2ZNVC 1YD8U 3EA6A 4EZKA 1RL2A 3M3JA 1TZ1A 2RGFA 5M3MB 2WP8J 4WJ3M 2HDEA 4MGYE 3VUXA 4BOZB 5JXVA 1HUMA 4W9IA 1O78A 4DPGA 2B63H 3I4NB 1V1PB 3C2PA 3C46A 3AEGB 4C2MB 2Y0SE 3HOXB 3Q69A 5D94A 3ZO5B 4A3EG 2KCMA 2LVPA 2FXQA 4RHSA 3MHZA 2XIWA 2E74C 3WCQA 2BB6A 4ZRQA 4RF0A 2MUYA 3KK7A 4U673 5FLXc 4QUFA 4IUQA 1YQ3B 4YY3Q 2DJGC 4NPNA 2F0TA 4P74A 1HRJA 3DQVA 3UF8A 3H0GG 1VF7A 5AFWA 1QQRA 1ENCA 3MXGA 3STBC 4ALPA 4A3GH 1WZ3A 2JWZA 2KXJA 2M56B 1SNPA 3B2FA 2A69C 5E6NA 2MHVA 5IYDG 5HG2A 2W3RA 3A4SC 4U68A 4HJ7A 1DCZA 1P0RA 3H8HA 2F0GA 1X6OA 1OQYA 4MHEA 3NVVA 1C78A 4LTUA 4DHJD 1KDCA 4KD3A 1C1YB 3N1ZC 5CHFA 5FOBB 2AWNA 4DBGA 4Q2JA 5GMVA 2F0EA 2A19A 2R3ZA 5LHY1 1S4ZA 1K3BC 1EWYC 2HIVA 2EY5A 2V3NA 4QL5A 4BBSG 2QJLA 2TSSA 1BT0A 3AEVA 3CF6E 2F0IA 3RZOH 3CCVA 2PZTA 3RN5A 1GC6A 1SEBD 1IBLL 4MSQB 2G9DA 1B1ZA 2NVXH 1GM5A 1L1OB 5K36G 1VJKA 4G50A 3NVZA 3BVGA 5AZHA 4HK2A 3D6WA 1SXTA 2AQ1B 1IBMQ 1UAPA 3PGEA 3Q3MC 2I46A 1TWCB 2A68C 1HR0W 4KVGB 1HHVA 4EUTA 2N9KA 1EFWA 1ET6A 2YU9B 5DM73 2PW9A 2NBUA 2R7ZG 2Y5CA 1G291 1PFMA 4F8MA 4A3KB 1UWXA 3L17A 2F0DA 4DR6Q 1RFKA 1FL0A 2JXXA 2L11A 1G8ZD 3FPPA 2WXRA 2ZCBA 4LNQA 2IX0A 5LMNQ 4H7BA 1DGSA 4ME5A 1F9JA 2V3SA 3H1UA 5EAYA 2LZ6A 3F8TA 3Q6SA 3U9SA 3R66C 1F2RC 4PK1A 3GTLB 1V8QA 5CBAE 3VA7A 4LFBL 3H3VH 2AYOB 4A3FH 2DN8A 3L3OC 5JHBA 1V2YA 3A5UA 3DWMA 4LF9L 2FCNA 3KF6B 4K7SA 5C4XG 3AI5A 3HRDD 4YSYB 1X65A 1ENAA 2N9EB 2LFIA 5CV4A 2NVQH 3QC8B 4TMAB 1KNEA 3K59A 4NJCA 1N34L 3ALBA 1PZKD 3DVNU 1UH6A 1DONA 1YHAA 2DYMA 2F0WA 3OAWA 2LKVA 3F2BA 1ZOYB 4XZ4A 3KLSX 3U2SC 2N4FA 3LGJA 4JVZA 4P75A 4ZRPA 5IE8A 1DOIA 1FRDA 4C7YA 5E3FA 2AL6A 4QGUA 3PLVA 3VDZA 2LRWA 3BDOA 3H3VC 1K52A 2AMCB 1EOTA 2L5TA 3VR5A 2ZTCA 3PUXA 5ELNA 1VQFA 2ZTEA 5IOCA 1C4AA 2MH7A 3DBHI 3J7A5 4EQ5A 1ILPA 4GMVA 3QOLA 3FKYA 1DYQA 3ECIA 3NZ3A 2VY3A 4DV0Q 3NS8A 4P1BC 2EYFA 1ML0D 1YNJC 3D31A 4IWPA 1OXTA 2KC2A 5C3XA 1ASYA 4HRSA 3EBEA 4K7UA 2DHZA 2J0MA 1QKZA 2PMVA 4AQYQ 4HCEA 2UWQA 3GTQB 3VQIA 4YSZB 4HN7A 2DBYA 1EFID 2LGXA 2M4NA 2F0HA 2BBCA 4L23A 2C7MB 1HXYD 3W1SA 5GAHC 5M5YB 2UYZB 4GDKB 1A70A 4JE3B 3SFEB 1V86A 4A6QA 3UINB 1FCCC 3P1HA 3AU5A 3N20C 4C3IG 5JJIA 2OF1A 3SVMA 1YI2A 1XPUA 3HOYG 1QOHA 3DLLA 2E2HB 2KWUB 2A73B 3P4QB 4C80A 2CQAA 5IP7G 2ATWA 2R92G 2QDBA 3GTMB 2NBFA 1PRTF 4C3JH 1PA6A 3N32A 4XE0A 3VVWB 2WU2B 1MJCA 2DX5B 2KCCA 4A3LH 1K8RB 1M1KC 2D10A 3RNFC 3IFWB 3GP7A 1B2TA 1ESFA 3K7UC 3ER0A 1ZP0B 1FMAD 2OTJA 2KQ4X 5IYBH 1HZAA 2OTLA 2WAQG 1HNWQ 3PV1A 4N8FA 4W9JA 3DUZA 4EQNA 2JA6G 5BYQA 4N58A 1OTCA 3TS2A 5I9OA 4A3MH 3EC8A 4DR6L 3PO2B 4C00A 2RDHA 3S1RB 2ES2A 3IAM1 2QA4A 3PIPA 1OTRB 1XMOQ 1KLVA 1H4RA 2WQYB 1U0LA 3APFA 4JPBW 1EY4A 4P71A 4GLXA 1OGWA 4ZYNA 4IPGA 2L0FA 3JAMi 4O42A 1WGDA 1OFFA 2VH1A 1ET9A 5LXHA 4KHPQ 2BOSA 3UDXA 1PGAA 2I1KA 3ZNZB 4HXDA 1BR9A 3ZVVA 2R61A 3FVQA 1Y1WB 2N9PC 3AEFB 4GDLA 3JW0X 1WXVA 4AQ7A 1JB7A 4OX9L 2RD0A 4M8AA 3I4LA 4PZ8A 4CKCA 3VH3B 2PVOD 3S15H 4KX6B 3TEZA 1OXXK 5LNK1 4JL9A 2BVCA 2Z6KC 2F0QA 3J9CA 2JXMB 2A6HD 4M02A 1A5RA 5COYA 4LF7L 4DV1L 1O80A 3TZUA 4K1RB 5IGDA 4IM0A 1VQIA 2EYLA 2XK5A 2PLPA 4WJPA 2L12A 1EWIA 1GOZA 2VB2X 4KGRA 3U8ZA 5G55A 2O5JC 4B9XA 3NJTA 2ACZB 1J5EQ 4DR7Q 1PFSA 3BG3A 4ZUJA 5A35A 1B3AA 1FNWA 4POGA 2XNAC 3KBGA 2EMSA 1WGKA 3HOUH 4FULA 3BU2A 3D32A 5KEEA 1MJEA 4B0MA 4X65L 4FXGC 3RNAC 1JC7A 4PMCA 1T9HA 3T53B 1RJTA 2OWOA 1PFDA 4HIMA 3ONSA 1A15A 1I3QH 3N1YC 5DM63 1YIWA 2PQAB 1XLOA 5CGKA 3IAYA 2ZXPA 2PTLA 4K7WA 4AQYL 2JA8G 4RGNA 2KJ6A 2MEKA 2C5LC 3L08A 1WCMH 3SK5A 5T8IA 4MIUA 1QWYA 2BDOA 1IBXB 5M5XB 2V4IB 3AE3B 3U4VA 4OWTB 4GNXA 5EE3A 1JQYD 4R4QA 5KNDA 5H1SE 4C3HG 2LFNA 4S3SA 1CKNA 5FO7B 2JSOA 2NR2A 4XC2A 2KOLA 1OEYJ 2X8XX 3L2PA 3M4QA 2E2JH 4A3JB 4NPSA 2NVUI 3NQIA 1BUIC 2INPE 4DGZA 3RN2A 1IYUA 4H44C 1LQBA 2EVBA 3FHWA 4UP9A 2Z6BA 1FXAA 1C4PA 3AH7A 2K3UA 1XT9B 1D1IA 2L00B 4DUZQ 3M63B 2MJ8A 2AX5A 1HR0L 1JJ2A 1SDFA 1U9RA 1YQBA 1MIUA 1E7PB 3TMPB 3MEFA 1C77A 5BN3A 2ZJRA 3KOJA 2ON8A 5FLXE 2WWZA 1L6VA 2I38A 4HIDA 4CKBA 2HD5B 3WANA 4BXXG 3SDZA 2EYJA 2KX0A 4Y7NH 4DAVA 4HDOA 2FIDA 1IYJB 2RSOA 5EGTA 3SD5A 2K5HA 3F2CA 3Q23A 1WX9A 5AUIA 4EFOA 4KHPL 3PZ8A 3N9YC 3DVNV 1YHQA 3P4PB 1STHA 1LO5D 2E5LL 2WYQA 3EIVA 1AE3A 1PV4A 3ZJVA 1H9SA 1EY8A 1SNMA 2BKRB 1XPOA 4KLKA 4DR1Q 1SE9A 2DGYA 4DUYL 1L4DB 2KENA 3IRBA 2J42A 3E3XA 5C4JH 5C2TB 4CDFC 4ANUA 2YYZA 3J80c 4R4TA 4BKSA 2ZPYA 1HNZQ 1LABA 3S17H 1PFBA 3L0WB 3ZTDA 2F1MA 2X6GA 2H4OA 2PVGC 4J6HA 2SNMA 4DNRB 2K4KA 4NKLA 2RCFA 2XSCA 2KO3A 1FYCA 5IIFA 5C0XG 4FF1A 4N6EB 2ZXOA 4L5SA 3DBRB 4WURA 3S1MB 1J5EL 3V60A 1SROA 1DD2A 1OQRA 2B2WC 2RHSB 5BN4A 1O7YA 3NPPA 3DWQA 3VR9B 2B2TA 2CQOA 1KRHA 1TQOA 1VQPA 4LNFA 2Z59B 4KSKC 4LJPB 1TIFA 2W9NA 2G5DA 1XJVA 3RNEC 2BE5C 2WNMA 1NMGA 4PNYA 1QOAA 5LXIB 1WYGA 4X3UA 4QF4A 1FNUA 1UGJA 4HKQA 1IW7C 1ZPSA 1DOYA 5LMUQ 4ANVA 2HD3A 2B63G 2IGDA 1JOOA 3DVGY 1F9QA 3ZXVA 3TQYA 1CQVA 3A5ZB 3JSVA 1WX7A 3VHTC 4B6WA 1BQQT 3Q3NC 4G11A 1KQSA 2F0JA 2UXBQ 5TSSA 4II3B 2K33A 2NVYB 1N62A 4GDLB 2KLCA 4GOPC 1WFYA 2B2UA 4HCPB 1PH4A 5E1FA 2RCNA 1ZYRD 3BK1A 1WMHA 4CQNA 4NJ7A 4DHZB 1EF1A 4NXMQ 1UF0A 2G1EA 3VYTA 3TEXA 4A3GG 3D8GA 2KMCA 1GUOA 2N8NA 3PS6A 1KRTA 1WXAA 3BWUD 1EZ8A 1TWGH 1R4MB 2CU3A 1TWFB 2BH8A 1VR9A 1B9NA 1U4MA 2G45B 5JEAH 4WAAA 3RPFC 1IKLA 1GUWA 5G5HA 1QZEA 4N9TA 1S40A 4GGQA 4DUZL 1NENB 4FJYA 4DU9A 4HVBA 4YHHQ 1F2MA 3DBLI 2BYVE 4A8XC 2AQ2B 3NBHB 1SMYD 3G4SA 4DXAB 1PUTA 1PGBA 2B76B 4ZQ3A 3AE2B 4WJNA 4XDCA 1NUCA 2R93B 2EQSA 2EE1A 2WXMA 1WH3A 3ML9A 1NAPA 4P6VF 4IALA 2HJ8A 2NVTB 4A93B 4A3CH 3NUCA 4JQWC 2BDNA 2CWAA 2G3QB 2JF5A 5C3WA 3S2DH 1L0VB 1PGXA 4KHZA 4E6IA 2N9LA 2IYDB 4JPSA 4X57B 5FLMH 2PMZB 1NI3A 2EJMA 4BS9A 4W9LA 3H94A 3GTKB 2EOTA 4GNXB 1JROA 4BKSD 2KMMA 1JRUA 1DOLA 1K9MC 2RA4A 2VXWA 1NDDA 2ALYB 2KHWB 3I2ZA 4DK5A 2PI2E 2KTRA 4ZDVA 1CKNB 3CCSA 3EROA 1WJNA 4L2YA 2QDLA 4CDDC 2IHEA 4AYBG 2K28A 1HNZL 2INNE 1SYBA 2LMCA 4DV6Q 1G6JA 3NHHA 5EBCA 4R4OA 3GTOB 2ZPNA 1Y1VH 4ICUA 2K52A 4DAPA 2F3VA 1KABA 3I4MH 1AZPA 2HHHQ 1K0SA 3QJZA 4X3SA 4LDTD 5D2MB 5C0XI 2WXNA 4A3FG 5J3BA 4B08A 1X3QA 3HIZA 2E2IB 3KUDB 1BVSA 1GNUA 4HJKA 3I4NH 2NZOA 2A4ZA 3H7SA 5G2NA 4HSPA 3G48A 3VDYA 3EECA 5CV8A 1TBEA 5G3LF 1OEYA 1D7QA 3U7ZA 1S5FD 1HTLD 1L6UA 3IVFA 4HDQA 3Q8BA 3HFZB 1I5FA 1BKBA 5LMUL 1AEXA 2L8JA 4OZCA 1GUNA 4I7ZC 1J8CA 1LT6D 2JYOA 4G7ZC 3H7PA 3LYYA 1RFAA 4YXDB 1ZXTA 1Q90A 3V05A 4GIVA 1IGDA 1SFOH 1R7SA 2K39A 3DHGC 1HZBA 3I90A 4JCVE 5M5WH 2WB1G 1XNRL 2BS2B 2XWBB 3RMKC 1MSGA 2H5XA 2IBIB 5DCNA 1VQ7A 3KJOA 1Y69U 3AE9B 4NXML 5JJLA 4X64Q 3PTFC 1VRAB 2HCCA 1KLGD 4K81A 4KV2A 5EE9A 5KHOA 3GD7A 3KF8A 1LFDA 1YN4A 1B8AA 3NWTA 3S2HB 4GN5A 3AB5A 2ZXRA 1C7YA 3S16H 2MNAA 4PYUA 2X69A 3TJPA 4TRDA 2KC1A 3RI7C 2K22A 1WJ4A 2HQEA 4A3BH 4AIMA 1GPXA 3LWEA 5GAEC 4R8NA 3EQLC 3PO3B 3GTJH 1JOKA 1K8GA 1R4NI 3NQTA 5D14A 1SMXA 2D62A 1BOSA 4KKTA 3NENA 2R6GA 1UE6A 2KJRA 4XYCA 3AULA 4DV5Q 2GRIA 3CW2C 4LDTB 4K5WA 1QZHA 2V9HA 1SYCA 2BWFA 2YV5A 2N1VA 1BXTA 4HR7B 4C3JG 3KVFB 4A3LG 3T3NA 4IKGA 2K6AA 1V1QA 3MTNB 1TWCH 2MGSA 3OHXC 2ASBA 3JSVB 3DDCB 3E5SA 2GOWA 4YTMB 1E10A 1CT1D 2YU9H 4ARIA 3ZNHB 2L52A 2JA5B 3W5OA 4US8A 3UI3A 4IQZA 1F2RI 5C1ZA 2NN6H 2P5ZX 5IYBG 1T0YA 3VR6A 1U4AA 4KDIC 4J8QA 5C0XJ 3MXUA 4RKBA 1DGJA 3QJYA 1VS0A 1WMHB 1N60A 4A3MG 2KACA 2JZZA 2YVCA 3H6NA 3ZLZA 5IA7A 1L1OC 2B2YA 4KKUA 3B6YA 4HAEA 2KK8A 2NCNA 3W3AA 4O2DA 3NTIA 1YNTE 2J0KA 3VRAB 1E90A 3SU8X 4IZ8A 5IWAL 4RWSC 3RCZA 2BTEA 2LS01 3LDZE 3TP5A 3NUHB 3AE6B 3ITPA 1L2NA 2JWUA 4LF4Q 3CCQA 4WJ4A 4A76A 4FXKC 1LM8B 1N61A 2NZ1D 1LTID 1SB3C 1K51A 2LUMA 3APCA 1XTDA 3KDFA 1SIJA 2KJHB 1K83B 3I4OA 4I65A 3CWIA 2PNHA 4IC7B 3N3KB 2SOBA 1LTLA 3DBHB 2Y0SG 3KYDD 4E74A 1MGSA 4FXDA 1WM2A 2QMTA 1PYBA 2VQFL 4EZLA 2WS3B 1SSOA 4N59A 1JWUD 1R4PB 3H0GB 4O1NA 5FK9C 5LLIA 3RZFA 2KWCA 3X3NA 3W5VB 2L4NA 3ZQ4A 1HZCA 2LHEA 2KECA 2RBMA 1NY4A 1L2FA 5ELFA 2HT1A 2LASA 3CMAA 3MHBA 1RDPD 1HTPA 4BA2I 2MP1A 1EU4A 1JJGA 2OQKA 4XIGS 1WE6A 3J80i 2PE9A 2LGYA 3GTGB 5F2DA 5KYIA 3HOUG 2RDGA 3VAWA 2KTRB 1FXTB 5J1ZA 1J0GA 3AEDB 1RKNA 4FJVB 5IKCM 2ZT9C 2OT2A 4GKKL 4K6DA 1D8LA 4G7OC 1TKGA 1VQ6A 3NVYA 5FO9B 2LMCB 1U5KA 4K0KQ 1WI5A 5M5YH 4ZKBB 2DAJA 2FCMA 3QARA 1WCMG 4XYQA 3ERQA 3ZYYX 1HEZE 2YEPB 2M0AA 4P16A 1XX8A 4IW0A 3ERSX 1YJJA 1E3PA 1CSQA 3T4AC 2NMQA 3RFZB 2LVOA 4MACA 3UGBB 3PLUA 4DHZE 2MW5A 2CHWA 3RNBC 1UWVA 2HUGA 3VR4A 4LUOA 1WGHA 1IL2A 2KDFB 1EWCA 3K9PB 3NWSA 1GJZA 4IJLA 3HOWH 3WA0A 5DPWA 4ID6A 4DR3Q 1EUJA 4PQXA 1QB5D 2R7ZB 2Y5PA 2AWOA 4FF2A 1SNQA 4JYAQ
chains in the Genus database with same CATH topology
1TWHB 1S5CD 4ZHOA 4J1MA 1TVXA 1XTCD 3HZXA 2IDYA 3MEHA 2MPMA 1EWHA 2F0KA 2BS3B 1CHQD 3GTPB 1QOFA 5BMGA 5C4XB 2F03A 1AWDA 4ZK9B 3PIO3 3C1EA 4KN7C 1AN8A 5IT9L 2CJOA 1PDXA 1FR3A 1JE4A 5FO8B 2BA0A 3DHQA 2GI9A 5KNBA 1QLBB 4ITKA 1TKYA 4Z9CB 4DN4M 4RCOA 3VR3A 5C5LA 1LTSD 1KDBA 1CJEA 4KJNA 5JAVA 3I72A 2VUMB 3AEBB 3BS1A 3NK9A 4NW2A 2D5DA 2A5HA 1UNSA 5C6AA 3A8KE 1SNDA 1A3UA 1LACA 2PKOA 3J7YW 1HCZA 3P75A 3CQZB 3AEDB 1I50B 3VYUA 3HG9A 4TSSA 4OIKA 2L32A 5I2YA 1M8AA 2WV6D 3DWPA 2PQEA 1CM9A 1SE3A 3NVWA 2F0LA 4C3IB 2NTTA 3AMZA 4P2CB 3HOYB 1AW7A 3UI2A 1PTOD 1A3VA 4K8JA 4KV6A 1D2BA 3RUZA 2WXKA 1FEHA 2CJNA 1STGA 1WRIA 2RSNA 1RTNA 1K50A 5CBEE 1FFVA 2EXZA 2O2LD 1HA6A 1ILQA 1JMLA 1N5WA 2KVMA 2JA6B 1JORA 1SE4A 5IGCA 5JEAG 4RF1A 3K5OA 2O5IC 2FE8A 3H91A 5I6WA 3TUOA 2W3SA 4WFN3 4DXGA 1I4QA 3OIQA 3GS2A 2K5PA 2FJ2A 1HZ6A 1LT4D 2QCPX 3Q24A 1Z47A 4D2KA 3V2TA 5D7GA 1PTOB 1Q3LA 3H6MA 3J7AV 4JWSC 3MFYA 4EVOA 1WVLA 4WAFA 2JYEA 5C44B 3FDTA 3IAS1 1YNND 1R9TB 4N9PA 3NXWA 3GO5A 3IT6B 1WD0A 2J7ZA 2FMMA 1FD7D 4FO2A 3PUWA 3J81L 1PFNA 2M00A 4IUVA 2JA8B 1OO9B 1BCPD 4ILWA 5JPNC 4JWUC 2WXOA 1CHPD 1MSHA 1I6HB 2F0MA 1V43A 5ELEA 4C3HB 2EKIA 4XYOA 4EGVA 2NTSA 4ZLTF 5I4DA 3AEAB 4IUNA 2HTME 3AU7A 2ICIA 4M1UB 1PRTD 1KAAA 4X3TA 4YTNB 4C1NK 2A69D 5ELCA 1BMLC 2NB0A 3MFGA 4OVZA 1C9FA 2XRQD 5KNCA 3WDNA 4YT0B 4HJGE 1JCKB 2LHDA 3WOFA 1TT2A 3E0JA 4K5VA 3NE5B 4RGMA 3AE4B 3Q8AA 4KD4A 1STNA 1KLUD 1GHJA 1LV9A 2SAKA 1X32A 1GB1A 1Y8OB 4X3KA 1BCPB 4H2AA 1WTXA 5J22A 5JOBA 3I9V1 5EKIA 2B2VC 3HS0C 1E2VA 4ZAIA 4C56C 1WTWA 2DLBA 1CZGA 2NN6G 3BVZA 1EY6A 2A68D 4ZRZA 3X3MA 1ZDXA 4TQ1A 1O7LA 4OO1H 4IURA 2IJ0A 2K03A 1PRTB 2L55A 4C1NI 4CGYB 3OOCA 4R9WA 4MT5A 4ODGA 1C4CA 1GHKA 1D5ZC 4MM3B 1HZ5A 2F0FA 3M85A 4YWGG 1H9JA 1A2TA 4XQNA 3CU7A 3EVQA 2JXTA 1KH0A 3FAHA 1WTOA 1KTKA 1TKEA 5NUCA 2V0GA 1QNKA 3CHBD 3TBIB 4A3GB 3A8IE 1UWMA 3N6RA 2WDRB 3PUYA 2IWHA 4K8IA 4CKEA 1JR0D 3HVDA 5JEAJ 3FEWX 4C7ZA 3PIP3 3I91A 1B9MA 2IPKD 4KTAA 4JX1C 1YNJD 2K01A 3AE1B 3KQ4A 5A2QL 2J52A 2A6EC 3I70A 2NWGA 3KLRA 4HTHA 3B9JA 4H0LC 2SEBD 4USAA 3HEJA 4LLGM 3RMHA 3Q22A 3S14B 3CRLC 1PYWD 1AYFA 4A9AA 1EM7A 5IGFA 3NTHA 1VMPA 1GXDC 4IDIA 4HSVA 2JE6I 3D3RA 1IUEA 2E76C 4HEDA 3F2UA 1NR4A 1E0BA 3P1MA 1GB4A 4DXFA 3A8JE 4NAMA 1FO4A 4IFDH 3DXJC 2F3WA 1Q1EA 3HP3A 4H13C 1U4PA 4BWGB 5EPJA 3AECB 1WTRA 3SEBA 1EEID 1Z6HA 3K5NA 2M9VA 5JPMC 4ZHPA 4CJ2C 1KFYB 3L7ZC 2NN6I 3A54A 3HVZA 4RKLA 1YN5A 1QE6A 1YQ4B 2RMMA 4F87A 3K5MA 1BF4A 4PMBA 1RF2D 2NVQB 1E2ZA 1JWMD 2B2UC 4XXEA 5D3IB 1CA6A 3CKIB 2J53A 5C3JB 1SJED 1I4PA 4G4KA 5CV5A 1J8IA 3W5UB 1LTGD 2KUMA 5M9OA 1BUVT 1E9MA 1F2LA 2DNEA 3D4DA 4KY6A 1FCLA 1L4ZB 2KQ3A 2C9OA 2WB1B 1OXSC 1JB3A 1X3PA 2BA1A 5D3DA 4ZOHC 3TEYA 3DWGC 3KWVA 1M4VA 5FKAC 4FNFA 2LJIA 4KMUC 1D5MC 3ND8A 3VRBB 1C79A 5EKLA 2EDGA 2B2WA 1EZ6A 2KHSA 2WIIB 1TR5A 1HPCA 2KN4A 3TZDA 4OW0A 1F9PA 4C3JB 1LTTD 1RTOA 1AP0A 1BNZA 2DNCA 3MJ5A 1TYGB 5IODA 3AB9A 1ICWA 1O7ZA 3TSSA 3JAML 1GUGA 2WXHA 4IOIE 3D4WA 4A3MB 2ENBA 2A74C 1QF6A 2IX1A 1SE2A 4Q5VA 2D2CC 1EYCA 2RDFA 2PNRC 3CRKC 2Q8RE 4ULLA 4R3DA 3IKJA 1MD2D 5GXGB 5H92C 3D6CA 1YN3A 1C8CA 1JRPA 3S15B 3AM9A 2PYKA 4Q0FA 3OWFA 1STAA 1XO3A 2K05A 2QKIC 1FNVA 4KKIA 1JOQA 1STYA 1VZ8A 4RCNA 1ZUD2 3VYRA 4GZYC 2WXFA 2B8FA 2B8GA 3ONAB 5IT9E 1WXQA 1TS5A 2Q8TA 3EUB2 4FYDA 4LK0M 5KGUA 5C4HA 1B44D 3HOUB 1H9SB 1N63A 2QIEB 1EQTA 1I3QB 1SYDA 3AMUA 1V1OA 3K57A 4G57A 4KHVA 3BVMA 4M0WA 4XDXA 5EPKA 4RNAA 3DWAA 1NVID 2BE5D 3T56B 4EQOA 1DOKA 1HFGA 1WSPA 3R93A 2KA7A 1IW7D 3U9OA 4XQJA 2L1BA 2KAJA 3QOJA 1TZOA 2LGIA 2JU6X 2F0VA 2E2JB 3TP7A 2Z1CA 4TQ0A 2X6LA 3QG1A 4K2LA 1XLQA 4JK1C 2B2YC 1J7AA 2H1EA 1QOBA 1DM0B 1TJEA 4KGTA 1PZID 2EYMA 4NAWB 4RFBA 1WTQA 1H9RA 2Y3AA 4RAUC 2W54A 4ZUIA 1QILA 4ARCA 1QJOA 1B9RA 5CC4A 1QNUA 2RKSA 3I3CA 3PUZA 4KJOA 1ZE3D 3VR2A 3M7NA 2EYHA 2OHFA 1YJIA 3DEPA 1AFPA 1FIQA 2XN9C 2YEPF 4A3EB 1EL0A 5HURA 3DEOA 5C4JB 3BZDB 2HDLA 3S17B 1II3A 1EY7A 3I8ZA 1A3TA 2L0CA 5JVH3 3QWNA 1STBA 3TEWA 3R2IA 5EBDA 2RPVA 1FFUA 4OO1G 5KRUA 2WKDA 3ZJUA 4G7HC 3SFDB 4L1BA 1CQFA 2I07B 3ND9A 1HUNA 1CI3M 1PTOC 1CTMA 1MI0A 3C1FA 5ISRA 4KGSA 1I4HA 2V4DA 1EYDA 3NP8A 4BBSB 2J0TD 1FXIA 3J81E 1S5BD 5JJZA 1FRRA 1WD1A 3KLSA 2N55A 2EY6A 1SAPA 4AS1A 3OMCA 5CR3A 2JYTA 2KEDA 1SBBB 3AV8A 2K04A 3B2GA 1XXGA 2CVRA 3OIPA 1T5EA 4F88A 4MN3A 4HKZE 2F0NA 2I2YA 3URYA 3BIID 1XF5L 4KY5A 2BCOA 1GUSA 1EIHA 1FGBD 1C4QA 1R4QB 3BYTB 3ZJTA 4XT3B 3HRZC 5CORA 3P4RB 5LL6X 4CJ1B 2NYZD 5LL6S 1HQMC 4KKJA 4IFDG 3AE5B 4A90A 1JWSD 3OPOA 1RHPA 3BDLA 4V0BA 1YNNC 3K58A 1SSNA 2CW0D 3FILA 4DK0A 3V96A 1K8OA 4FF3A 2ZW1A 4KKSA 4B9WA 1BDOA 3M7GA 1BCPC 1Y1VB 3PMFA 2FINB 3K6OA 3I4MB 3HGBA 2MJDA 1LTAD 4OO1I 2FHTA 1Y56A 3W9CB 2WXQA 5DAUA 2KWDA 1E0ZA 1JALA 1G2SA 3ETRA 2FUG1 4B0EA 2BS4B 1SYGA 4XQQA 5E6JA 2JEBI 3GQBA 4EE2A 2G9HD 1PRTC 2K9XA 1TS4A 1SFOB 2R92B 3MTSA 5M5WB 3MZ5A 3MVVA 3CIRB 1N5XA 4KI0A 1VZ6A 2SNSA 1QCBD 1CZWA 1PTOF 2WAQB 3S16B 3MA2B 3TP6A 4XWWA 4A3BB 4R8IA 3GV3A 1A2UA 3GTJB 2TMPA 1SF0A 2K0PA 3SR1A 2A6HC 2IGHA 2KEEA 1NSNS 3HUIA 5A2QE 2EYPA 3D4RA 2MJ3A 2BYTA 1EIGA 3VR8B 5DEHA 4XTCS 5C5MA 3E56A 2N0SB 4IFDI 3RZDB 3J7AF 4DFAA 4CJ0B 1Q10A 1BO0A 4F7XA 1L0YB 3SK8A 1EU3A 3QIAA 1IBXA 5KIXA 1YMHE 3MP9A 4BA1I 5IGGA 4WWMA 3LB8C 5IGBA 4DAYA 3IL8A 3AE8B 1KNAA 4RA8A 1SYFA 2K1BA 2MJEA 2JZPA 3TDQA 4IUPA 2EZVA 2K5QA 2NUCA 3J80L 1PLFA 3FMCA 2QEJC 3LWUA 1F77A 3MXNA 1TIID 1TY0A 1BCPF 1RWSA 3T13A 3NBIA 4WJWA 1WTVA 2E75C 5HI1A 2ONQA 3FILB 2VNUD 1W6KA 1T3QA 3P20A 4K6LA 5E4WC 2PW5A 2D9UA 4K2KA 3VYSA 4HMIA 2JP1A 3BYYB 4NZLB 1P7EA 1Y8PB 1ZDVA 4DK1A 3G7LA 5I9PA 2EY2A 2JSVX 1IKMA 1TS2A 4IFDJ 4KY7A 1JWAD 2PO4A 3HOWB 3OSOA 1UUPA 3R8BA 3SK4A 4US9A 2F0SA 5EE0A 3R2TA 4ABNA 1IL8A 4FXCA 1T5XD 1ZKOA 4CBVA 4YIJA 1DZ1A 1XWEA 4LJZC 4RGOS 2LEKA 1UEAB 1FD6A 1K53A 2E6XA 1J9OA 1FM0D 3FPUB 4JBWA 5BMIA 1S5ED 4OL7A 2SDFA 3IFTA 4HEA1 3JAME 1KF6B 4L63B 2L1AA 2WKCA 2FMCA 2XVSA 4L6TB 1DXMA 5ELBA 4DF7A 2B63B 3SR6A 2Q5WD 3U52E 5C3EB 4XT1B 1B50A 2N88A 1ONLA 1ZYRC 4NP5A 3AN1A 4QMGA 1TU2B 5EQ0A 1QOGA 4XDDA 4LMQD 3AE7B 3K5LA 2QILA 1HA5A 1F2ZA 1STEA 2FFKB 3NBHA 1OQQA 1WTPA 2DYOA 1H9KA 3MWYW 2IL8A 1ZXIA 2B2VA 4RHRA 1D5XC 1F0ZA 2WDVB 1Q1BA 5HGTA 1OXUA 2WXPA 1F9RA 1SYEA 1SMYC 3S1QB 5ELDA 1TY2A 2JX5A 2RVLA 2DWQA 1NCVA 5CV7A 1VLBA 4QIWB 4K14A 2OEOA 2K5WA 3RD4A 2E2DC 1L5PA 3M4YA 2WU5B 4L8JA 2QSDA 2M19A 5KYLA 3L9AX 3RZOB 1PZJD 3W2DA 4ZKCB 3TN2A 5IGEA 2NVXB 1V97A 1IGCA 3TMEA 1E2WA 1RODA 1CK1A 3G6JB 2DY8A 3NS1A 3DM1A 3Q0AA 2QF7A 3A7LA 5C4ZA 2B2TC 2WINB 2F0PA 1D6EC 4AYBB 3LXFA 2KDMA 1XEEA 2Q8IB 1MBYA 3N52A 4YSXB 1ESRA 4RH6A 3VA5A 2IGGA 1EY5A 4DNTB 3OMGA 2BT6A 5EE1A 4A3IB 4J3OD 4A3FB 2L83A 1RYJA 3R3OA 1P7FA 4UAIA 2IW3A 3DMUA 2Z4IA 1VZ7A 1JWBD 3K0YA 5BYSA 3SXHA 2ID0A 2OXPA 5EPLA 1HQRD 4NDXA 2X38A 1XCQL 1TS3A 3P4SB 3V3XA 1V8CA 5HFYA 1XYIA 4KN4C 1GJXA 4A3DB 1NYQA 3IXSA 2LY7A 2DY7A 4REZA 5CMDA 2L9HA 1ACCA 2AUKA 3FKIB 3OWEB 3EGRA 2D5GA 3QO2A 2WP9B 5J39A 2WXIA 1VCIA 1J7CA 2WXLA 2CHBD 1LTBD 5I6YA 4OZAA 4PMWA 2E3TA 4TQUS 1HFNA 3O13A 3M4OB 2H88B 1I4GA 1SNCA 3NTKA 5DNFA 1TKWB 1A6XA 4IUUA 1E6EB 1BBXC 1NYRA 1LLRD 3P63A 5K36H 5EJWA 4QB4A 2OEDA 3OW7A 1Q8IA 1VDZA 4QCLA 2H89B 1RM6C 2K5DA 3SE0A 2F4IA 1CZPA 4PT5A 2XRSD 1H9MA 4WQMA 1I6VC 1G91A 2VB3X 1VF5C 2BW2A 4LAAA 3T16A 3ZGZA 1KDAA 2WLBA 2PIAA 2ZW0A 4EQPA 4ZYSA 1G2TA 2A6ED 2FBWB 1PXUA 5JVG3 2IT1A 4BY7B 1MVKA 3HKZB 1OXVA 3Q8FA 2WXGA 3E9SA 1B53A 3I73A 1C76A 2PW7A 1EEFD 1G6ZA 5HHDG 2Y0SB 2O4XA 3H09A 1SNOA 2IX3A 5BYRA 1Q12A 4TKOB 3MC0B 5G3LD 3ABVB 2W55A 4MH8A 4UDUC 2PZWA 1RD9D 3IFDA 1CFMA 3PUVA 1I4XA 5BN5A 2JEAI 3K7AB 4DQOC 5M3FB 3GV6A 1IHZA 1XCTL 2AUJD 1WCMB 4FVMA 2EELA 3Q8EA 1XLNA 1JICA 3M3YB 3GB1A 3PO0A 4IN3A 2B39A 5EKKA 5FLXL 1DOXA 2XWJB 1S5DD 1NR2A 4OGQC 1I7HA 4XWTA 5MPOA 1EYAA 3QB3A 2EY1A 2C5CA 4NMZA 1L0XB 4HROA 4K5XA 2Z4HA 3EFXD 2GB1A 1DOMA 4FP5D 1IYVA 5G5GA 3A56A 3U4EG 3C8YA 3HOVB 3MXPA 1EY9A 1V1PA 2EJFC 4Y7NB 4V190 1C48A 1U4LA 5I2XA 4FF4A 3A7AB 1QG7A 3C3LA 1ENFA 1XLPA 4KK7A 3P7JA 2EJGC 2JA7B 3L4PA 2CW0C 3S1NB 4HMJA 2K32A 3IT4B 3S9WA 2GA4B 4A55A 4WH4A 3EJIA 4GLSC 1PMRA 3AEEB 2PCFB 3PZ7A 4LK1C 3RLFA 3HOZB 1PDQA 2F0UA 1PTOH 3SHLA 4IUTA 2KJXA 3E6ZX 3NRZA 2VZKD 1AZQA 3I57A 4QUCA 1EY0A 3TP8A 1W6JA 5D65A 2PPBC 1MPEA 3NSWA 1Z7TA 1GAQB 3WOEA 5T1GA 1LT3D 5CV6A 2EPBA 2K7VA 1F2YA 3KBXA 4DA2A 1ZEQX 3A55A 1I4RA 4BBRB 3P42A 1U4RA 1T6BX 4YTPB 5K5PA 1MHHE 1SJHD 2AQ3B 4PV1C 3T51B 2PZUA 3KUPA 2WXJA 4OIJA 2J4XA 2Z8LA 1D1KA 1ZXHA 3BDCA 1TWGB 2F0OA 2RQXA 4WRDA 2WACA 3J80E 1TWAB 4BY1B 4OHJA 1CA5A 3MAQA 1J7BA 1VDVA 3LNNA 5T1IA 2HCIA 2HDMA 1EQVA 2V3PA 2VZKB 2M2LA 4WIPA 5E4XA 5CV9A 1QT9A 1D4BA 3LX0A 5AUKA 1NEKB 3BK2A 5CYUA 3S2DB 1ROEA 3KWLA 2ICEC 2WDQB 1LTRD 1Y8NB 3SK6A 3PV0A 1B4OA 4WORA 1JW9D 1GUTA 3Q8CA 2JQRB 3FC4A 1DJRD 2KCNA 3T3OA 5BMHA 2EYOA 1MHXA 1RCVD 4OZBA 5C0XH 5H8YE 1WWTA 1MI2A 4CHTB 3FRPB 2N7JA 1VMCA 4RGTA 2W82A 4HCSA 1F9SA 1LT5D 1JQ4A 5FR3A 1K8MA 3EA6A 5JXVA 5M3MB 2WP8J 2HDEA 1HUMA 1O78A 3I4NB 1V1PB 3C2PA 3C46A 3AEGB 4C2MB 3Q69A 3HOXB 3MHZA 4RHSA 2XIWA 2E74C 3WCQA 2BB6A 4ZRQA 4RF0A 2MUYA 3KK7A 4U673 4QUFA 4IUQA 1YQ3B 2F0TA 1HRJA 1VF7A 5AFWA 1QQRA 1ENCA 3MXGA 2M56B 1SNPA 3B2FA 2A69C 2MHVA 5HG2A 2W3RA 4U68A 3H8HA 1DCZA 2F0GA 4MHEA 3NVVA 1C78A 4LTUA 1KDCA 4KD3A 5FOBB 2AWNA 4Q2JA 2F0EA 2R3ZA 5LHY1 1S4ZA 1EWYC 2EY5A 2V3NA 2QJLA 2TSSA 2F0IA 2PZTA 1SEBD 2G9DA 1B1ZA 5K36G 1VJKA 3NVZA 3BVGA 3D6WA 1SXTA 2AQ1B 1UAPA 2I46A 1TWCB 2A68C 1HHVA 2N9KA 2PW9A 1ET6A 2YU9B 5DM73 2Y5CA 1G291 1PFMA 4F8MA 4A3KB 1UWXA 2F0DA 1RFKA 2WXRA 2L11A 1G8ZD 3FPPA 2IX0A 4H7BA 4ME5A 3Q6SA 3U9SA 1F2RC 3GTLB 1V8QA 5CBAE 3VA7A 2DN8A 3L3OC 3DWMA 3HRDD 4YSYB 1ENAA 2LFIA 5CV4A 4TMAB 1KNEA 3K59A 4NJCA 1PZKD 1DONA 2DYMA 2F0WA 2LKVA 1ZOYB 3KLSX 3U2SC 4ZRPA 1DOIA 1FRDA 4C7YA 5E3FA 3BDOA 3H3VC 1K52A 1TKGA 1EOTA 2L5TA 3VR5A 3PUXA 1C4AA 2BB5A 2MH7A 5IOCA 1ILPA 3QOLA 1DYQA 3NZ3A 2EYFA 1ML0D 1YNJC 3D31A 1OXTA 5C3XA 4HRSA 1QKZA 2PMVA 4HCEA 3GTQB 3VQIA 4YSZB 4HN7A 2DBYA 1EFID 2F0HA 2BBCA 4L23A 1HXYD 3W1SA 5M5YB 4GDKB 1A70A 4JE3B 3SFEB 4A6QA 1FCCC 3P1HA 4C3IG 2OF1A 3SVMA 1QOHA 2E2HB 3P4QB 2A73B 4C80A 2CQAA 2QDBA 3GTMB 2NBFA 1PRTF 4XE0A 2WU2B 2KCCA 3GP7A 1B2TA 1ESFA 1ZP0B 1FMAD 2KQ4X 3DUZA 4EQNA 5BYQA 4N58A 5I9OA 3PO2B 2RDHA 3S1RB 3IAM1 2WQYB 1EY4A 4O42A 1OFFA 1ET9A 2BOSA 1PGAA 1BR9A 2R61A 3FVQA 1Y1WB 3AEFB 4AQ7A 4M8AA 3I4LA 4CKCA 2PVOD 4KX6B 3TEZA 1OXXK 5LNK1 3J9CA 2F0QA 2JXMB 2A6HD 5COYA 1O80A 3TZUA 5IGDA 2EYLA 2PLPA 2L12A 1GOZA 2VB2X 4KGRA 2O5JC 4B9XA 2ACZB 3BG3A 4ZUJA 5A35A 1B3AA 1FNWA 2XNAC 3KBGA 1WGKA 5KEEA 4B0MA 4FXGC 1JC7A 4PMCA 3T53B 1RJTA 1PFDA 1A15A 5DM63 1XLOA 5CGKA 3IAYA 2ZXPA 2PTLA 4RGNA 2MEKA 3SK5A 5T8IA 4MIUA 1QWYA 2BDOA 1IBXB 5M5XB 2V4IB 3AE3B 5EE3A 1JQYD 5KNDA 4C3HG 2LFNA 4S3SA 5FO7B 2JSOA 2KOLA 4A3JB 3NQIA 1BUIC 2INPE 4DGZA 1IYUA 4H44C 2EVBA 3AH7A 1FXAA 1C4PA 2K3UA 1D1IA 2MJ8A 2AX5A 1SDFA 1U9RA 1E7PB 1C77A 5BN3A 2ON8A 5FLXE 1L6VA 2I38A 4CKBA 3SDZA 2EYJA 4DAVA 2RSOA 5EGTA 3Q23A 5AUIA 3PZ8A 3N9YC 3P4PB 1STHA 1LO5D 3ZJVA 1H9SA 1EY8A 1SNMA 1L4DB 2J42A 5C2TB 2YYZA 1LABA 1PFBA 2F1MA 2X6GA 2H4OA 2PVGC 4J6HA 2SNMA 4DNRB 4NKLA 2XSCA 1FYCA 5IIFA 5C0XG 4FF1A 4N6EB 2ZXOA 4WURA 3S1MB 1DD2A 1OQRA 2B2WC 5BN4A 1O7YA 3NPPA 3DWQA 3VR9B 2B2TA 1KRHA 1TQOA 2BE5C 2WNMA 4PNYA 1QOAA 1WYGA 4X3UA 4QF4A 1FNUA 1UGJA 4HKQA 1IW7C 1ZPSA 1DOYA 2IGDA 1JOOA 1F9QA 1CQVA 1BQQT 2F0JA 5TSSA 2K33A 2NVYB 1N62A 4GDLB 2B2UA 3BK1A 5E1FA 1ZYRD 4CQNA 2G1EA 3VYTA 3TEXA 3D8GA 1GUOA 3BWUD 1EZ8A 2CU3A 1TWFB 1VR9A 1B9NA 1U4MA 5JEAH 3RPFC 1IKLA 1GUWA 5G5HA 4N9TA 1NENB 4DU9A 1F2MA 4A8XC 2AQ2B 1SMYD 1PUTA 1PGBA 2B76B 4ZQ3A 3AE2B 4XDCA 1NUCA 2R93B 2EE1A 2WXMA 1NAPA 4P6VF 4IALA 2NVTB 4A93B 3NUCA 2BDNA 5C3WA 1L0VB 1PGXA 4KHZA 4E6IA 2N9LA 4JPSA 2PMZB 1NI3A 2EJMA 4BS9A 3H94A 3GTKB 2EOTA 1JROA 2KMMA 1DOLA 2RA4A 2VXWA 3EROA 4L2YA 2K28A 2INNE 1SYBA 2LMCA 3NHHA 5EBCA 3GTOB 4DAPA 2F3VA 1KABA 1AZPA 4X3SA 5C0XI 2WXNA 4B08A 1X3QA 2E2IB 4HSPA 5CV8A 5G3LF 3U7ZA 1S5FD 1HTLD 1L6UA 3Q8BA 4OZCA 1AEXA 1GUNA 4I7ZC 1LT6D 2JYOA 4G7ZC 3LYYA 4YXDB 1ZXTA 1Q90A 3V05A 1IGDA 1R7SA 3I90A 2BS2B 2XWBB 1MSGA 1Y69U 3AE9B 1VRAB 2HCCA 1KLGD 5EE9A 3GD7A 3KF8A 1YN4A 3NWTA 3S2HB 3AB5A 2ZXRA 2X69A 4TRDA 2K22A 2HQEA 1GPXA 3LWEA 4R8NA 3EQLC 3PO3B 1JOKA 3NQTA 5D14A 2D62A 1BOSA 4KKTA 2R6GA 2GRIA 4K5WA 1SYCA 1BXTA 4HR7B 4C3JG 3T3NA 4IKGA 2K6AA 1E10A 2MGSA 3OHXC 4YTMB 3E5SA 1CT1D 4ARIA 2L52A 2JA5B 4US8A 3UI3A 4IQZA 1F2RI 2NN6H 3VR6A 4J8QA 5C0XJ 3MXUA 4RKBA 1DGJA 3QJYA 1N60A 2KACA 2B2YA 4KKUA 4HAEA 3W3AA 3NTIA 1YNTE 3VRAB 4IZ8A 4RWSC 2BTEA 2LS01 3TP5A 3NUHB 3AE6B 3ITPA 2JWUA 4FXKC 1SB3C 1N61A 2NZ1D 1LTID 2LUMA 1K51A 1SIJA 1K83B 4I65A 3CWIA 2SOBA