1I4PA

Crystal structure of staphylococcal enterotoxin c2 at 100k crystallized at ph 5.5
Total Genus 63
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
63
sequence length
239
structure length
234
Chain Sequence
ESQPDPTPDELHKSSEFTGTMGNMKYLYDDHYVSATKVMSVDKFLAHDLIYNISDKKLKNYDKVKTELLNEDLAKKYKDEVVDVYGSNYYVNCYFSSKDNGGKTCMYGGITKHEGNHFDNGNLQNVLIRVYENKRNTISFEVQTDKKSVTAQELDIKARNFLINKKNLYEFNSSPYETGYIKFIENNGNTFWYDMMPAPGDKFDQSKYLMMYNDNKTVDSKSVKIEVHLTTKNG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of staphylococcal enterotoxin C2 at various pH levels.
pubmed doi rcsb
molecule tags Toxin
molecule keywords ENTEROTOXIN TYPE C-2
total genus 63
structure length 234
sequence length 239
ec nomenclature
pdb deposition date 2001-02-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01123 Stap_Strp_toxin Staphylococcal/Streptococcal toxin, OB-fold domain
A PF02876 Stap_Strp_tox_C Staphylococcal/Streptococcal toxin, beta-grasp domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.110 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1i4pA01
3.10.20.120 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 1i4pA02
1BCPD 3EFXD 2XRQD 1RF2D 1LO5D 1LTID 1HXYD 2XN9C 1SBBB 2CHBD 1LTTD 3CHBD 1BCPC 1L0YB 1S5DD 1ET6A 1GOZA 1I4HA 1KTKA 4RGOS 3MFGA 5D3DA 4Z9CB 3EA6A 1S5FD 2SEBD 1LTBD 2QEJC 1EU3A 1QILA 1SE4A 1BCPB 1V1OA 1SE2A 1CK1A 1HTLD 5FK9C 1TS2A 3OWEB 1PTOH 2AQ2B 1CHPD 1PRTB 1TS5A 1EFID 1JWMD 4RGMA 4O1NA 3TSSA 4L63B 1RDPD 1RCVD 2QILA 4DXFA 2IJ0A 4RFBA 1CT1D 1V1PA 5ELDA 2NTTA 4K6LA 5ELBA 1PYWD 4L6TB 1M4VA 1JCKB 1PTOD 1FNWA 5ELFA 1PTOF 2AQ1B 1DJRD 1V1PB 2XNAC 1TY2A 3BVGA 1SEBD 1BCPF 4ZYSA 1LT3D 1I4RA 3KLSX 1AW7A 2Z8LA 1YN5A 1STEA 1HQRD 1PRTC 1ESFA 1LTGD 3BVMA 5D3IB 1FNVA 3MC0B 4TSSA 1YN4A 1LTAD 2NTSA 1FD7D 1I4GA 5ELEA 2ICIA 2IPKD 1LT4D 1I4XA 1G8ZD 1LT5D 1L0XB 1SXTA 1D6EC 1I4QA 4RGNA 4RHRA 3URYA 1D5MC 4NZLB 1LTSD 5I4DA 1TS4A 2RDGA 1DYQA 3O13A 4RCOA 3BYTB 2R61A 3R8BA 1PZKD 1LLRD 1HA5A 4BWGB 1ET9A 4OHJA 1I4PA 1B1ZA 4RHSA 1S5ED 1UNSA 1RD9D 3BVZA 2J4XA 1PTOC 5ELCA 1SJED 5TSSA 1S5BD 1SE3A 3DWPA 1FGBD 1JQYD 1EEID 1B44D 1UUPA 4RH6A 1EU4A 1F77A 1JWSD 1S5CD 1SJHD 1KLUD 1XTCD 1AN8A 1EEFD 4DXGA 1D5ZC 1D5XC 3V05A 1PTOB 1BXTA 2XRSD 2O2LD 3DWQA 2AQ3B 1PRTD 1LT6D 1JR0D 1PZJD 1KLGD 3R2IA 2WV6D 3BYYB 1PRTF 3R2TA 1EWCA 1ENFA 1JWUD 4RGTA 1MD2D 1YN3A 4UDUC 1CQVA 3DWAA 4C56C 1CHQD 1XXGA 2RDHA 1FNUA 1TY0A 3GP7A 1TS3A 3SEBA 1LTRD 1T5XD 2TSSA 5FKAC 3BZDB 1PZID 3W2DA 2G9HD
chains in the Genus database with same CATH superfamily
4W9IA 3I4NG 4H44C 3AE2B 2OOBB 1E7VA 4DAYA 3JVZX 3W1SC 5F2DA 4C3HH 5I9PA 2FMMA 2VQEQ 1SBBB 4JI5L 3OJ3A 1GUOA 1C77A 5JEAH 3Q23A 1EY8A 1WF9A 1D7QA 2BW2A 1SNPA 3A1QA 3TQYA 3U2SC 1S4ZA 3NQTA 2EKEC 2PNRC 2I2YA 1LACA 3DVNV 4ICVA 4FJZA 4KKUA 1CK1A 1Y69U 3F2BA 3DBHI 3ITPA 1PTOH 1IXRA 1YHQA 1ML0D 4A3EB 3P4QB 2LSSA 3S2HH 3FKYA 1SMYD 2F0SA 3PUYA 2K6AA 4JOIA 3E9IA 1C3TA 3VYSA 4DXFA 3RZDB 3FHWA 5ELDA 1KIXA 2KXJA 5H92C 2MHJA 4DV2Q 2O4XA 3OLMD 2VZAA 1WCMB 1AARA 1V2YA 2ZJQA 3DHIC 4CDFC 3NWSA 1QE6A 4DR5L 4N9PA 2EZVA 4P1CC 4M01A 3J80c 2JA8G 1PTOF 3HFZB 4L5SA 3CCJA 1V5OA 4BZAA 4K0KL 1VQ6A 3V2TA 4DK5A 1PH3A 3HEJA 1V49A 3DWGC 3ZW3A 2A68C 4MTKA 2JA7B 4IDIA 3DEPA 1AW7A 4A3KG 4I6NB 4KKJA 3DEOA 1S3SG 1SIFA 2K28A 4LF7Q 5EE3A 4CQNA 2B3GA 5C5LA 4GNXC 2BQQA 3VTVA 4MM3A 1FXIA 3OHXC 1ZE3D 2EJFC 4IZ8A 2Q2TA 4FYDA 3TRZA 1YN4A 4LUOA 2GRIA 4I7ZC 5ELEA 3P1HA 2N55A 4ICUA 4JBKA 5GAEC 2CQOA 2RHSB 1BDOA 1O7IA 3NVVA 3V61A 2UUAL 4GOPC 4YY3L 3NHEB 3QX1A 4MIUA 4NXMQ 1AYFA 4GXBA 1D6EC 1RWSA 5EBDA 4IWOA 2MNAA 3TEXA 1UWVA 2LS01 3CSTA 4A3MH 4C3JG 1BUIC 2ZVOA 1NNXA 2CJNA 4JPSA 2RCNA 2E2JB 3CU7A 4DHZE 4GDKA 3MHBA 3R8BA 2LMCB 1PZKD 3QK0A 2R6GA 4BWGB 4GIVA 3D4RA 4CJ0B 2KACA 3A5UA 4E71A 1W6JA 4XXEA 3A55A 2EXDA 3NELA 2QIEB 3KF6A 3PVLA 4US8A 4J1MA 3AE8B 1DOXA 4MSQB 3A8JE 3X3MA 4JI3Q 1E8WA 2NCNA 1O7LA 3DWPA 1Q12A 4ANXA 1FGBD 1JQYD 4ZDVA 1B9MA 1UUPA 4W9EA 2CS4A 2O5JC 2V3SA 1JE5A 5KRUA 3APDA 1Q5WB 1JWSD 3I90A 1E3PA 3HOXH 2UWQA 2NYZD 4K7WA 3U52E 2EXZA 5CV8A 3BZCA 1KC8C 3VH4B 4W9KA 4LUVA 2D9UA 4Y7NB 2BS3B 2IX3A 1QOAA 2MJ8A 1O80A 4H02A 4QGUA 1XNRL 4RM9A 1YN3A 4A55A 3ULJA 1K3RA 5C4JB 3H91A 5IE8A 3DWAA 3HIZA 2RA4A 2BDOA 5C44H 4OVVA 4MSMB 3S1QH 1YNJD 4H2AA 3S2HB 4BOZB 2JA6B 2G45B 1XCQL 1IP9A 4KV2A 4WURA 3A74A 4OELB 4B95A 1LO5D 4DR1L 2L52A 4B0EA 4DXGA 4Q2JA 1I4HA 5EE9A 2PNHA 2MLBA 2WXHA 4DAMA 3JAMi 3J81c 3K8AA 1H9JA 1HTOA 1N8RC 1KRTA 5I9OA 2HHHQ 2DLBA 5H1SE 2IY0B 2A6EC 1BVSA 5C44G 1TS2A 2RSNA 2KQ7A 3M3JA 3UGBB 3QWNA 1ROEA 2AWNA 3H6MA 4WAAA 2PQAA 4A3EG 2ONQA 1X6OA 4RGMA 5E6JA 1IGCA 2FAZA 2VNUD 3E0JA 5C23A 4B08A 4ZCKA 2R92G 2BS2B 3DWMA 2EKIA 2IJ0A 4RFBA 4NAWA 4RMFA 3T53B 3CCQA 2F0UA 1Q7YC 1BF4A 1C4CA 3HM3A 3T8MA 2B63B 3H15A 1UE1A 4CJ2C 2YEPB 1SRUA 4DF7A 3S1NH 3RN2A 2MO0A 2KLGA 2KJHB 3M4PA 3OYYA 2F4IA 3V3XA 5IODA 4GN3B 3K5LA 4K5XA 2LJIA 2N9EB 3R3MA 4YCUA 1ASZA 1HFGA 3ZTCA 3AMUA 5IGEA 5DM73 5CV5A 1C48A 5M3MB 4A3DG 1WGKA 2B3AA 1SE8A 2EQSA 1RRBA 4DK6C 3NRZA 4HKQA 2Z0SA 2JU6X 4JI1Q 3STBD 5HY6A 4IG7B 3WOFA 2MRPA 2YYZA 3Q8FA 4PMBA 1QWYA 3IL8A 1R9TH 3QWZB 5C3XA 2KBNA 4RG1A 4ABNA 4B3TQ 3Q22A 2KOXA 3OJ4B 3Q2AC 4WWMA 2LFIA 4ZRKA 2A5HA 4A3GH 2B8FA 4H0LC 1PMRA 1PFMA 1YJJA 1ZP0B 3VA7A 1WZ3A 2PMVA 1MGSA 2LXCA 3EFUA 2PZUA 5M3FH 1R4PB 2FMCA 2E3TA 3URYA 2IHFA 3SVMA 2IYDB 2AYOB 2KVMA 3C3LA 2RMMA 1PH9A 4ANVA 1LQBA 4GDLA 1JJGA 1QOFA 3X0WA 4B9WA 2OXPA 5AEKB 2M00A 2PW7A 2SNSA 3P75A 1B2TA 1IBXB 3PRZA 2WDQB 2IO1B 1FPYA 2F4VL 1IUEA 1KLVA 4DU9A 5HGQA 3HS0C 4IJLA 1MJCA 3OSOA 2NPTB 4ZRZA 1PH2A 3IFTA 5L95C 3FP9A 4PV1C 5D7GA 4JYAQ 1GXDC 1VQNA 2HQEA 2PZWA 1QZGA 3TREA 1N63A 5IO9A 4F1SA 1B9NA 4DAYB 5IOIA 1TWFH 5AFWA 2VS1A 3MA2B 3U8ZA 1KLUD 3NWTA 3GTMB 3MXNA 4N8X1 3IRBA 4FHKA 1FFUA 4DK1A 4YXDB 4KKIA 4KY6A 4JWUC 5JAVA 3PLUA 4PZ6A 4G11A 5HI1A 2NVYH 2ZXPA 1N62A 1R7SA 4MJSA 1SNQA 3IVFA 4K7UA 5IAAC 3W9CB 1STYA 2WAQB 4TVAB 4KY7A 4DDGD 3R7QA 2Z4HA 2HJ8A 2RDHA 3MWYW 3WAMA 2E2IB 4OIJA 3E5SA 4IPCA 1TT2A 3CCEA 5FKAC 1Y14B 1QVGA 1TJEA 1WYWB 1H95A 2Q2UA 4BXXH 3I7FA 5HHDG 3K81C 4X66Q 4JI2L 1C4AA 1DXMA 2CQAA 3D32A 3D6WA 4JBJA 1PQSA 2HHHL 2F0WA 3IXSA 2B39A 1T0SC 1BBWA 2C7NB 3AULA 2WB1G 4DV1L 3AU4A 1TS5A 2RKSA 2R92H 1EFID 2KKCA 4HJAA 2BCOA 3S14B 1XMOQ 3QQ8B 2MGSA 1AFPA 4A3EH 2E6XA 1GNUA 1C9OA 1VDZA 1STHA 5HURA 4ZRIA 2K8BA 5AJ3Q 3H7PA 1DOKA 3M4YA 1NR4A 3VR5A 5E7NA 1XQQA 2RSOA 4R9WA 2E2HB 1S72A 1K8AC 4BBRB 3LDZE 4FF3A 2QW7A 4EX5A 1TZ1A 2OTLA 1DCZA 3OWFA 4JWSC 1VQOA 2JSOA 4BA1I 1YNNC 5G2NA 2F3VA 5J22A 2DZJA 3HP3A 2F0LA 4A3IG 4HN7A 3BVGA 2KAJA 2KDBA 5K36H 4KSKC 1V8QA 4LF8Q 2UUBQ 4WQOB 1EY0A 2FIFA 1GAQB 3HHMA 4DR4Q 1I6VC 2WNMA 5DLQE 1I6HB 1NI2A 1ESFA 4IJHA 1Z9FA 2C35B 3BVMA 4QF4A 3MHZA 3MC0B 5C0XI 2JP1A 4LCDE 2I38A 1HNXL 2KDEB 1JOOA 1STAA 1TVXA 1UE6A 2WXGA 1SYEA 2N9LA 1L0XB 4HJGE 1NAPA 3SK8A 2GBKA 4REZA 1SSOA 1U4PA 2UU9Q 4RM8A 5EDSA 4A3LH 4DHJD 1SMYC 1I35A 1D5MC 4OONA 2F03A 2VUMG 1EL0A 1A2TA 4IUQA 4USAA 5I4DA 2HE7A 2K9XA 3RNCC 2JF5A 2L05A 4MT5A 5FLMG 5M3FB 1OXXK 3IKJA 4OVZA 1JC7A 4JI0L 3PIOA 5KYLA 4OHJA 3P2BA 3NTHA 4OL7A 5A2QE 4A93B 3ZNGC 2WINB 4NXML 1JORA 3S17B 4YY3Q 1T5EA 2AWOA 1W6KA 1YNND 4CJ1B 3NZSA 4BKTA 1RYJA 1JROA 2KUMA 3M9BA 4TKNA 1HNZQ 2H88B 1F77A 4PZ7A 3MEFA 4C3JH 4D2KA 4IO9A 4RKBA 1MJDA 2NMQA 4EFOA 4KLKA 1HZAA 1GJXA 3V05A 2KHIA 2GA4B 1YJWA 1TWGB 5G3LD 2NVTH 1XD3B 4JQWC 4LJOB 3PIP3 2RD0A 3IAYA 1VR9A 3DWQA 4OWWB 4P74A 1SYGA 3AEGB 3CC7A 2NVQH 2C5CA 4HJ5A 3OW2A 4FVMA 4FDBA 3G4SA 3TP5A 2NR2A 4HDOA 4NQKE 4WWOA 3E9HA 1ZXIA 3PPAA 4GDKB 1TWAH 3NPPA 5CV4A 4DR5Q 1KFYB 2PVGC 2WDRB 3Q24A 4URKA 5D14A 3L17A 2F0NA 4OO1G 3I63C 1EQVA 5FLXL 2G9HD 1H9RA 4J6IA 1E22A 4PYZA 2J52A 4BOSC 2ASBA 4UPAA 4DV6L 5DPSA 4GKJL 3Q6BA 3KBXA 2MUYA 2XN9C 4K8IA 5E4WC 1F2RI 3RZWC 1X32A 1BCPC 1OXUA 2X6LA 1ET6A 2HIXA 2L1BA 2ZTEA 3K5OA 3JAME 1KXLA 3A4SC 5LMUL 3SK5A 3EN2A 3T13A 4YCWA 1SE4A 3DBRB 3AEAB 2WX1A 4W9HA 3RLNA 2B76B 4KHVA 2Y5BB 4G7HC 3VQIA 2JUOA 2NN6G 1IBMQ 3SR6A 3PO3B 2AMCB 2EVBA 3Q8EA 3S24A 2YU9H 3CRKC 2INNE 3RULA 4A9AA 1J0GA 1G6ZA 1U4RA 1KNEA 5CORA 1A70A 4JOIC 2EMTA 4TUUA 2NS5A 3MJ5A 3L10B 4JCVE 2JEBI 2G5DA 4ME3A 3NJTA 4AJYB 3RNBC 2JA8H 4ARIA 2GBNA 1N33Q 5KGUA 4NB3A 3B6YA 3PO0A 2BTEA 2PKOA 2AQ1B 1YIJA 1V5TA 2BH8A 2K52A 4GKKQ 1EM7A 2ZPYA 4DUZL 3NQIA 5IGFA 1IBKQ 1B4OA 2ZM6L 5BN5A 4JI7Q 3UDGA 2R93B 1K0SA 3GZNB 3AB5A 2DUDA 4H13C 1B8AA 3PF4A 4XT1B 1UF0A 3B1LX 3Q8AA 3ICEA 3DUZA 2XTIA 4EVOA 5D3IB 3CCMA 4DAVA 2VB3X 1EYDA 2L32A 3ZYYX 3C2PA 2NTSA 2KEEA 3NHHA 4AWJA 2DZMA 2W54A 5CV7A 4Q0FA 4S3SA 2LVQA 2ATWA 1EF1A 4KHPL 1P1AA 2FCSA 1EY7A 4JGHB 5E6PA 4LF9L 2B2YA 2GBJA 1FL0A 5DNFA 2NVYB 1IYVA 2L1AA 2KO3A 1VCIA 4C3HB 1LTSD 4LF6L 2MW5A 3O13A 3U58A 1FYCA 4LF6Q 2LGXA 1NTGA 1EUJA 1WXSA 3BZKA 1U0LA 2RPVA 3JC66 4CDEC 2D10A 1HR0L 3J80E 2CFMA 2K3UA 1T0QC 4YWLA 1M8AA 1UBIA 1VQAA 1UH6A 1X9NA 4QIWE 1XNQQ 3NVWA 3T3NA 3BJUA 4R8IA 2PEAA 3U7DA 3BVZA 4KGSA 3QIAA 3ML8A 1XT9B 1MSHA 1JMCA 2J0TD 2KANA 3MAQA 3DBRI 1RFKA 4EQ5A 1S5CD 5CV6A 3CCUA 1C7YA 2Z59B 4AOFA 1E2WA 1CI3M 2FBWB 2ZTDA 2WP8J 4GN5A 5DAUA 3G71A 4HRSA 1A2UA 3TZUA 4G0NB 1GM5A 5LNK1 3DCGA 3I3CA 2JYOA 4X3SA 4AQYL 4K2LA 2FXQA 2SNMA 1ISNA 1NEKB 1UBQA 3NBHA 3PIO3 1WVLA 1VZ7A 2KDFB 3S9WA 3X23A 3TEYA 3VYTA 5G55A 1ENAA 1FGUA 4PK1A 1RHPA 1CQVA 1H9MA 2MO1A 4HIOA 1J7AA 1EYGA 3E9SA 4JK1C 1PGAA 3PO3G 2JVCA 3AEBB 3JW0X 3TIXA 1K51A 3RZFA 5J1ZA 3U4ZA 2E8GA 2Z0DB 2I5MX 3D4WA 2M0XA 3AI5A 4WAFA 3QCAA 3R93A 1SB3C 2VB2X 4IPDA 3OPOA 1L0YB 1HTPA 4LAAA 4RGOS 1YVCA 1CA5A 1C78A 1S5FD 1WR1A 2HUGA 3ZO5B 3OIPA 2QEJC 3N6RA 1EU3A 1QILA 4C3IH 1EY5A 1GVPA 5IYDH 1GUSA 3DHHC 2GVBA 4WJWA 1C1YB 2WXFA 5BMIA 3KLWA 4M00A 3N52A 1PYSB 1X65A 1ILPA 4LNNA 3BDLA 2CHXA 1ACCA 1GB4A 1E0BA 4KGTA 1BBXC 3FMCA 4K6LA 1AP0A 3AE6B 1T3QA 2MCNB 3ZIMA 2D3GA 2KHWB 5KEEA 3I4MG 1H8CA 3I3TB 3LB8C 2CKZB 2E2DC 2EY2A 1UE7A 2UXBQ 4GLSC 1IW7C 5LXHA 3VRBB 4HCPB 3HKZG 3F2UA 1N5XA 3DM1A 3A33B 4NAWB 5JZEB 5G5GA 4YHHQ 3BWUD 1YHAA 2KQSA 2F3IA 4F7ZA 1BCPF 2BH2A 4C3JB 4DR7Q 3A4RA 4FF2A 1E8YA 1STEA 1HQRD 3E56A 5EE1A 1HPCA 1FR3A 2L12A 2OQKA 1I5FA 1FNVA 2PI2A 4W9FA 5CYUA 4LJPB 2L0TA 1WRIA 3H09A 2M1MA 3HRZC 2VQFL 2QMTA 3M4OH 3CW2C 4LFAL 1PFDA 1EOTA 1JICA 1X3QA 2F0EA 4I7AA 2N49A 3V96A 3CD6A 1LT5D 3AE3B 3GTKB 1FJGL 1HZBA 2AL3A 3GTGB 1TKEA 4EGVA 4KMUC 2KTFA 4GLAC 2B2YC 1QJOA 4DR3Q 3GOEA 1PFSA 3IBEA 4TQ0A 3OTOL 1ZEQX 4JI0Q 2DZIA 4UHVA 5FLXE 2JA7G 3QA8A 3D4DA 3UE1A 1E8ZA 2H89B 3KH0A 5M5XH 5C4XB 2XK5A 1YBYA 3HOWB 4HDQA 1H9SB 5I6WA 3RNFC 1EQQA 1JRPA 3W1SA 2V4LA 2Q8TA 2K03A 3OIQA 1SF0A 1R4MB 1VQ7A 1ZXTA 1WX9A 4MJSB 5KHOA 1I4PA 1IBLL 5CHWA 1KDAA 4BBSH 2F0OA 3AE5B 4XQJA 1UNSA 2JZPA 2A69C 3CQZB 4BFRA 2GLSA 2ZJRA 2KK8A 3KUCB 4BKGA 2N7DA 2KVZA 3Q8DA 2BWES 2XIWA 1E7PB 3PT2B 1QNUA 1VJKA 1KRHA 2KDIA 5HG2A 1E9MA 1KQSA 2B2TA 1KJTA 3MTNB 5JH5C 3E3XA 4K7SA 1CQFA 1ASYA 1JR0D 4CDCC 5C0XG 3PRPB 1SAPA 1T0YA 3VUYA 1TIID 1YEZA 1GHKA 2WDVB 4C4VA 5CV9A 3Q69A 3S16B 3C1FA 3CPWA 2WKCA 4V0BA 3PO2H 1KAWA 1FCLA 1VQHA 4WQMA 1XXGA 3GTQB 5JJLA 3I4NB 2MBQA 4F7XA 2M56B 3DHGC 2PI2E 1PH6A 4NJ7A 5IP4D 4IUVA 5J3BA 1XO3A 3U7ZA 3UIOB 4XC2A 3DDCB 2JA5B 1LTTD 1KD1C 1PGBA 5D3DA 2KQ3A 4DK0A 4GGQA 3S2DB 4L5TA 4B3MQ 2K0PA 2Y5CA 1PVOA 5KIXA 4GKJQ 3KUPA 1LTBD 5IY0A 1YI2A 1OFFA 1G291 4QQBX 3P20A 5BN4A 1PHJA 3PO2G 3HKZE 1EIYB 4DR6L 1B9RA 1WM3A 2WLBA 1JRUA 3MZ5A 3FC4A 5J17A 2W55A 1I94L 2FCMA 2PTLA 4JBWA 4O1NA 4OO1H 1WRDB 2DWQA 4ARCA 3TSSA 4L63B 5C0XJ 1WTQA 4KD3A 2KFKB 4JPBW 1L4ZB 3QB3A 2JYTA 4P73A 3Q8BA 2WAQG 2LUEA 4XDXA 5AUKA 1WR6E 2ZT9C 2VH1A 1WH3A 2H5XA 2GN5A 3M7NA 2VH2A 4GS3A 5EGTA 1QQRA 2F0FA 2L5TA 4HSVA 2OTJA 4KJNA 3UDFA 4DBGA 2ZCBA 4HEDA 3QOLA 4DR2L 4HTHA 3UQBA 3KFUA 1LTGD 1G91A 1EYAA 1Q86C 3GE3C 4PYUA 1PH7A 2NZOA 4HROA 1LGRA 2WU5B 2IGHA 1J8IA 4IUMB 2K5NA 2GVAA 2ICIA 4FP5D 3PGZA 4PNYA 4QMGA 1LT4D 1GG3A 4EZLA 1WGRA 3TL5A 2WXIA 3CCVA 1XNQL 2K1FA 3KK7A 1L2FA 2M9VA 3PZ7A 1MPEA 3VR3A 4RGNA 5IP7G 1E90A 3H7PB 3D0FA 1HUNA 2ON8A 2WP9B 4PT5A 2UU9L 4AH6A 1L0WA 2WB1E 3UDXA 1FEHA 2R7ZB 5EPKA 2F0JA 4JX1C 3J80i 3NS1A 2D0PA 3ZLZA 2IGDA 4C2MH 1MFWA 1TKWB 4GLVB 4YWMA 3QO2A 4XTCS 1L7YA 3U4EG 2BKRB 1YX5B 1F2MA 4ANWA 1MI0A 4KK7A 4ACFA 2DJFC 2AKWB 5EQ0A 3RNEC 2LY7A 5BN3A 1SJED 3L2PA 1S5BD 1SE3A 4M02A 3SHQA 2Y0SB 2WXNA 3HOXG 3U9SA 1EF5A 3QARA 1EO6A 3DVNU 1TZOA 1YITA 1EEFD 1U5KA 1R4QB 3ND8A 2LRWA 1KNAA 4GN4B 3GTGH 4BXXG 2ZM6Q 1PV4A 1XF5L 3DMUA 2A8VA 3HKZB 1LT6D 2N7EA 1F9QA 1PZJD 2FNJB 3HRDD 2AHOB 1S1QB 3KLRA 3PRMB 2MQJA 1XMOL 3PUXA 3K7AH 2D3BA 1PYBA 3L9AX 1OQYA 2VRRB 2VUMH 4NKLA 4DV5L 4A3BG 4RMAA 3IT6B 3Q14C 3GV6A 2XEWA 4FULA 1BCPD 3EFXD 1TKGA 2HIVA 4IC7B 1QZHA 1RF2D 1N60A 2Q2IA 2I1JA 1HXYD 1J19A 4JI2Q 1GUAB 1HEZE 3WANA 1SYFA 2QGQA 3KOJA 2OQ0A 4Z9CB 3MFGA 1PH4A 3L16A 4FN2A 4N58A 1WGGA 2WACA 3VFKA 4JBMA 3KF8A 2Z0EB 2XWJB 4AP4C 3HOUG 1JMLA 1BQQT 1SYDA 5LMUQ 4HPLB 3MEHA 3FKIH 1MHHE 1XMQQ 1Q90A 1OGWA 2WGSA 3DBLB 3QJZA 4QL5A 2QILA 2JXXA 3K59A 2RDFA 3GDEA 3I4OA 4QY7A 2EYLA 4LW1A 4R4QA 5ELBA 4L6TB 3DLLA 3C46A 2N0SB 4HWIB 2XSCA 2A74C 2ZPNA 2K50A 2N78A 1JCKB 3NBIA 1BMLC 1X1MA 3VTUA 1VQIA 1NR2A 2I5LX 3F2CA 5C3WA 1ZYRC 2RR9A 3N1YC 1EZ8A 4K5WA 2D11A 3EFCA 1J7BA 1YJIA 3PZ8A 1A5RA 1XLNA 3AEVA 3S2DH 4W9DA 1LT3D 3NEMA 3PS6A 3KLSX 1B70B 2Z8LA 4O0AA 2C7HA 1K28A 1I7HA 2IX1A 3S2AA 4RAUC 1WFQA 2KJ6A 2RDBC 2ZVNA 3AE9B 4EKUA 5KYIA 1HNZL 2AUJD 1T0RC 1U4LA 1N9WA 4FXGC 2FJ2A 1VQ8A 1TIFA 1WXQA 2J0JA 2RSUA 2WS3B 2IY5B 2YTXA 1E8XA 2FINB 4P6VF 2IGGA 3W5VB 1HZ9A 1S40A 3S16H 3V62A 4M8MA 3NE5B 3HG9A 1F9JA 3CSFA 3N20C 2PQEA 1I4QA 3NVZA 4X3TA 1JB3A 3A9KB 1C0AA 1PH5A 3S1RH 3N30A 4KX6B 2N9KA 1VQ4A 2PCFB 1V9JA 3LGJA 1LLRD 4EEWA 1EQTA 2OEOA 5KHQA 4C4VB 3I4NH 3HUIA 1WI0A 1HE8A 4DV3Q 1P0RA 3RN5A 5E1FA 1YNXA 1Y1WG 3FILB 2LKVA 4ZKCB 1BNZA 2LJ5A 2INPE 5FO8B 1FXTB 2CR5A 1B1ZA 5C3JB 1YQ3B 2D07B 5C3EH 1PTOC 2K5DA 2K1BA 1M90C 1B3QA 4DHZB 1EU4A 5D94A 2A69D 1PGXA 4ANUA 2I5HA 4A3DH 3NXWA 4HSPA 5C5MA 1XLQA 5ELNA 3HOWH 1OXTA 4DR4L 2XRSD 4KV6A 3A56A 1UELA 1WD1A 4K81A 1Z5SB 3M3YH 2FCNA 2Z6BA 1WGHA 2KN4A 2XVSA 4ZAIA 1KLGD 3R2IA 4U68A 2K05A 2KCCA 3BYYB 3I4MB 4YSZB 1XJVA 3DXJC 1F0ZA 1YQBA 1WGYA 4LF5Q 1W2BA 1FFVA 2D5GA 1I94Q 1TY0A 2K04A 1V81A 4DR6Q 5G3LF 3BZDB 1MSGA 1HFNA 4IPGA 3QIJA 1SNMA 3RN9C 2FUG1 5EKIA 5C4XH 4DV4Q 4BBSB 1P98A 1LTID 2K4KA 4G7ZC 3CIRB 4L5QA 1XMQL 5COYA 3KVFB 1P7FA 2KTRB 3TP8A 3VAWA 3F8TA 2NN6I 2SEBD 4BKSD 2HDEA 4RKLA 1DOMA 1E2ZA 2V4DA 3RD2A 1HUMA 4DV4L 3PCOB 4JI4L 1EIFA 1VQPA 3AFPA 5CR3A 2MBBB 4X66L 2PMZB 1SSNA 2BOSA 2KYWA 3H0GG 1EWYC 2KENA 2CH4W 1DOLA 4C3IG 4CKBA 4FJYA 5JPNC 1WTXA 4LF5L 4XX5A 3V60A 4NPNA 4KZCA 4DV5Q 4IFDI 4I6PA 5C4ZA 4AYBE 5NUCA 2Y0SE 2FE8A 1VQFA 1DONA 4R4CA 1L5PA 1RFAA 1C76A 1EWIA 1Q0WB 4HK2A 3J7AV 3I4MH 3R66C 1PFBA 1WTWA 2INDC 3EJIA 4B3RQ 3AB9A 1CKNA 1K83H 4JI8L 4XGAB 3H6NA 2X6GA 1BUVT 1O78A 1YNJC 4A3BB 3MXUA 2QSDA 5E6NA 4ZRQA 3H94A 3NS8A 4ZYSA 4XQQA 2R93G 2PQAB 1SGHA 3UQAA 4JI3L 2L15A 2KD0A 3R3OA 1D2BA 4QJFA 5K36G 3BDCA 1JOQA 1JT8A 4B6WA 3OOCA 3RI7C 1QVCA 2NB0A 2E2HH 2JZ3B 4US9A 4E6IA 1WX8A 2IY1B 3ETRA 3C19A 3GTJB 1FD7D 3PGEA 2QF7A 4QB4A 3GE8C 2B2UA 3X3NA 3J7YW 2B2UC 4DUYL 1DOIA 2KTRA 2XBBC 3BY4B 3P42A 1G8ZD 4MGKE 1VDVA 3RD4A 4HVBA 2PZTA 3OW7A 3I8ZA 3B2FA 1WD0A 2GBRA 3T4AC 2BS4B 2LXAA 2OJWA 2F4VQ 1NYQA 2KZRA 2XGTA 2R93H 3UDIA 1ZW7A 1XWEA 3AFQA 1II3A 3JAML 4IWPA 1DYQA 2KLCA 4ID6A 1GO3E 5IT9E 3SXHA 4GOPB 2PE6B 4NJCA 4IN3A 1YZ6A 1TGZB 2E2IH 5I2XA 3CCLA 2BDNA 1RIPA 1UZXB 1VZ6A 3RUZA 2JA8B 4A93H 3MXPA 2FUHB 2KWDA 1CZGA 1ICFB 2V3PA 3CXCA 1EYCA 1E6EB 2ZZPB 3VUXA 4DR7L 5KNBA 5JOBA 3QR8A 1IHZA 5GQOA 2BB6A 3T56B 4JI1L 1GC6A 2R7ZH 1D5ZC 3DOWA 5CGKA 4MGIE 5LMNQ 3H3VC 5LXIB 4X3UA 1GB1A 4IURA 4W9LA 3I4LA 3IFDA 5E6OA 4HR7B 4F88A 4L5RC 1OTRB 3HOZG 4R4IA 1PRTF 2IDYA 1VQ9A 3TEHB 3TCAA 1D1KA 5IGBA 4LJZC 4OZAA 3ZRFA 2A68D 1EUVB 4B0MA 2L0CA 1Z7TA 3PUVA 1TS3A 1LM0A 1VQMA 2D3CA 2A6HD 4FF4A 3DBLI 4A3MG 3RZOH 2MP2A 1K0RA 3W2DA 3WALA 2LGIA 1FO4A 4QUFA 5IKCM 2RHQB 4N6EB 4L2YA 4HIKA 1QKZA 3CAMA 1MG4A 1V43A 1NE3A 5LL6S 2NVQB 4B3SL 2RVLA 1F52A 4KY5A 3GTPH 3DM3A 1Z47A 1WI5A 2O6VA 2NN6H 1XCTL 2N8NA 4OX9Q 3J7A5 4QIWB 3M62B 4ZYNA 3FRPB 4GOPA 1VQEA 3S15H 2IO2B 2KQ4X 2JA6H 3N32A 5BYRA 1Y1VB 4ZLTF 4P7IA 2VUMB 3FPUB 1KF6B 1D1IA 3AECB 4ILWA 5BR8Q 3E0EA 1RTOA 4G7OC 2BA0A 1HRJA 2PO4A 5C4JH 1SN8A 3Q6SA 2NVXB 4WJNA 1F2LA 2ENBA 3CKIB 1DGSA 4BBRG 2BVCA 2JA5G 2K5QA 1XNRQ 5C0XH 3LXFA 2ZXOA 5ELFA 1K53A 1QOGA 2K5VA 3AU5A 2PMZE 4ZK9B 4N9F4 1HNWQ 2I07B 4MDKE 4JL9A 2KVRA 1J6QA 3ER0A 2SAKA 5CHVC 2LXKA 4YT0B 3VDYA 3PSEB 3G6JB 4A3MB 1UGJA 1Y8NB 5HFYA 1J7CA 4AJWA 4WRDA 4DK3C 3SFDB 4TSSA 4K3CA 2B2TC 3HOYB 3I2ZA 3OMCA 3PMFA 4A3OA 3T51B 3HOZB 2KC1A 1A6XA 3HOYG 2KT7A 2MX2A 4UP9A 4WFN3 5M3FG 2KMMA 1SE9A 2K5PA 4O2DA 4BAXA 1SXTA 5FJ8H 3I91A 1QLBB 2G1EA 1WYDA 2JEAI 4FXDA 2W3RA 4ZKBB 4ZRJA 3W5OA 5H8YE 5KNDA 2O6VD 4KHPQ 3HOVH 1RL2A 1KAAA 2NUCA 3NTKA 2DJGC 3JSVA 1C79A 2W82A 1HTQA 2LASA 2IWHA 3I70A 4DR3L 4HPPA 1ZXHA 2BE5C 1IZ6A 2E76C 4MZ9A 3VR9B 4C00A 4M8AA 2BB5A 4LFAQ 1XX8A 3S17H 1EEID 3TMPB 1CUKA 2NWGA 4NXNQ 4HEA1 1J5EQ 4QUCA 1Y1VG 1UEAB 4K2KA 2KEDA 3ERQA 1K3BC 4JC0A 4ME5A 4A3IB 5JJKA 1BT0A 3KYDD 3FKIG 4LF7L 3DBSA 1WFYA 1V9PA 1BXTA 4WH4A 2D5DA 2EDGA 4NDXA 1G51A 4ZUIA 1AEXA 4JVZA 1SNDA 3GTPB 4K3BA 4RA8A 1PDXA 1R4NB 3ZVVA 2CU1A 3EVQA 4MELA 1EWHA 2LHEA 2DAJA 4G50A 4CKEA 4KDIC 4C56C 5C4HA 2ZNVC 2K22A 4IOIE 5EAYA 3SEBA 1OTCA 3VTWA 3U4VA 2TSSA 2E5LQ 1Y1VH 2JWUA 4WWNA 2ZTCA 3PF5A 2PVOD 4KJOA 2MEKA 4AS1A 5IGDA 3GTOB 1JWAD 1Q1OA 3BIID 3NSWA 4WWPA 2M2LA 1FCCC 1KTKA 2KNBA 2VW9A 5AZGA 1VZ8A 2DAFA 3ZNZB 3ZXVA 1STNA 4A3CH 4EQNA 4II3B 3KYHC 2LGDA 3AE4B 3HM6X 1Q1BA 4HLEA 4KD4A 2MPMA 2E5LL 4C7ZA 2FIDA 1XPUA 2ZJPA 1L0VB 5BMGA 3K5NA 3N9YC 1WTOA 2PPBC 1MJEA 2NTTA 4AUQC 2DY8A 1PYWD 3SK6A 1NENB 5GMVA 3TBLD 2YVCA 2GMIC 1A3TA 5GADC 1WJ6A 4LF4L 3H0GH 5JJIA 2EJGC 2Q2HA 2DNFA 1TY2A 2KFKA 3Q3MC 1WCMH 2CU3A 4AQYQ 2F52A 1E1OA 2ALYB 3TP6A 5HGTA 3Q0AA 1PRTC 1IPGA 1K8RB 4NP5A 2QCZA 3WAPA 2RBMA 3HGBA 4LMQD 4LDTB 1F2ZA 3P4SB 1PA6A 1AE2A 4PMWA 2P5ZX 1I3QB 1B53A 4DFAA 3GTJH 1RTNA 5GAHC 1ESRA 4LFBL 3J81L 1GD7A 5IA7A 1Q46A 1A8VA 4RHRA 2PIAA 4FHJA 1E10A 5JJZA 1EZ6A 5DM63 4OEMB 2QDLA 1HR0Q 4W9JA 1D4BA 5DEHA 2Q8IB 1JOKA 1C4PA 2RCFA 5FO9B 3ZNID 3RLFA 2SOBA 1K50A 2R3ZA 3GTMH 2RF4A 2M19A 3ZDTA 3LNNA 4P75A 1K83B 1CSQA 2A6ED 3C8YA 3K9OB 4KZ0A 1UWXA 2A1AA 3LWEA 2KA7A 2V4IB 3TN2A 4IUNA 3FVQA 3ZGZA 2WFWA 2Y5PA 4DNTB 3M63B 3RNGC 2NBUA 1L2NA 3KYCD 1MI2A 3QG1A 4KKTA 2CWPA 5ISRA 1ZDVA 1V97A 2VZKB 4C3HG 1AE3A 5C6AA 5C3EG 2UUBL 4LF8L 4UY8C 2DNCA 1CMXB 2LD9A 1LM8B 3MFYA 1NJIC 2LVOA 4MGYE 4KN7C 4N9TA 3CMAA 4A3FB 3RNUA 4HJ9A 3ZJTA 2KECA 1JW9D 1B50A 4JI7L 1F9RA 2A6HC 2FFKB 1QZEA 1XPOA 2BYFA 4DUZQ 1Q1EA 3ULLA 2H4OA 4GKKL 2BKFA 2W9NA 3FILA 2EYMA 3U30A 4LF4Q 1WMHB 3AEFB 2DZKA 4J8QA 1OXSC 1J8CA 4XIGS 2K33A 4IWQA 4A3GB 3E6ZX 1PH8A 2K6DB 1E1TA 4X57B 2XK5B 1CZWA 1TWFB 2E75C 3PHWB 1FNUA 1K52A 2QEXA 4MN3A 4AYBG 4GNXB 2MSED 1WXVA 1CZPA 3WOEA 3GZNI 3N3KB 1N36Q 4JV5Q 3S14H 2QJLA 1I50B 2Z6KA 2M0AA 2Z6KC 3A9JB 1X3EA 5C44B 2CKHB 2XRQD 3EIVA 3CCRA 4B3SQ 2DX5B 1NBWA 4FNFA 4BVUC 4LNQA 2NZHA 3DQVA 4A3GG 3K7UC 3WWVA 2N7JA 4YTPB 3K5MA 2LFNA 5IP9H 2NVUI 4HCEA 1V1OA 3N1XC 1AZQA 4GN1A 5IGCA 1D8LA 1RJTA 4J3OD 3T1HL 4A3CG 2LUMA 1IYFA 2AQ2B 3TS0A 3AEDB 1CHPD 4R8NA 1YOVB 3M95A 4X62Q 3R7RA 2KWCA 3VXWA 1RDPD 3B9JA 2HT1A 1V86A 3VUWA 2OF1A 5A35A 3A8KE 2F0IA 1WTRA 5C3EB 3MHSD 3OG5A 4J15A 2HDLA 4XWTA 4A3BH 4CBVA 1X54A 5GAGC 2J53A 4CDDC 3DVGY 4OWTB 2L3ZA 1K8MA 4EE2A 1WCMG 3EECA 4POFA 2HQLA 1ZKHA 4LNOA 1WJUA 2MJEA 3IHPC 2BWFA 2MHVA 3Q8CA 2MBEA 4ZUJA 2LZ6A 3W1GA 1AWDA 4A3FH 4GZYC 2JA9A 1VF7A 3BDOA 1VCBA 4A3KB 4R4OA 3UI2A 5J18A 1CSPA 2QA4A 3EHVA 3J80L 1F9SA 4LNKA 4LLGM 4DXAB 5FLMH 1J5EL 3S1NB 4YIJA 2E74C 2L55A 3GQBA 3KLSA 3PIPA 5BMHA 2KOLA 3M85A 3J7AF 4J6HA 1G6PA 1JJCB 1O7ZA 1OQRA 2DYOA 2GBMA 2YEPF 1QCBD 4RCNA 4MH8A 3RUIB 3WCQA 3ZKJC 2M8SA 1MHWC 5CTRC 2N88A 2MH7A 1VF5C 3FPPA 3T16A 3B0AA 2DY7A 3VR8B 2F0MA 3NP8A 1GUNA 1BR9A 1ENCA 2JX5A 4TKOB 2WXKA 2KN5A 3CF6E 3FAHA 1YJ9A 3HOXB 3KUZA 4DWFA 1GC7A 2A19A 2JSVX 2O2VB 5IOCA 4CGYB 4II2B 4GMVA 1Y8RC 5EPJA 1AH9A 2G4SA 1PDQA 3TP7A 4KIKA 1RD9D 3F2DA 1UE5A 4MNOA 1KM7A 3D3RA 3UIPB 2LGSA 3RZDH 5J39A 1B44D 3S1QB 4XZ4A 4DPGA 2B29A 3PUWA 5IGGA 2X38A 4IALA 4LDTD 2X69A 2PJHA 4HXDA 2N4FA 1STGA 1XTCD 4A3JH 4EZKA 4KGRA 4AIMA 2HDMA 2LI5A 3HOVB 3W1YA 1PTOB 2KCMA 2IW3A 3GD7A 1NI3A 2J42A 3A7LA 2JE6I 1KABA 1YX6B 2AQ3B 1PRTD 1P16A 1STBA 2JN4A 5JVH3 1EIHA 4A90A 2C9OA 1I3QH 4NY0A 2KC2A 4OZBA 2UUCL 2K5WA 4BBNC 1EWCA 1YJNA 1JWUD 1WJNA 1MG8A 2LMCA 2MJDA 3BK1A 5CHFA 5LHY1 2B63H 1U4MA 3WIMA 4E74A 1LV9A 2NBFA 3MXNB 1LTRD 4JE3B 3AV8A 5AJ3L 2F0VA 3ND9A 4RNAA 3PO3H 5CBEE 1QNKA 1L1OB 3K7AB 4IQZA 4IUPA 1VMPA 1JWBD 3WA0A 4X3KA 2WXQA 1GOZA 2K6QA 1GPXA 1IL2A 1R4MI 3EA6A 2XWBB 3AM9A 1WY8A 2CW0D 4OX9L 3QOJA 1BCPB 4YCVA 3PZDA 1UD7A 1HTLD 2L76A 4BBNF 1DD2A 3ABVB 1GUWA 4P71A 1RM6C 3HOYH 1U9RA 1PRTB 3C1EA 2NVXH 3HKSA 3LWUA 1JWMD 1N32Q 3H8HA 4MGZE 2WYQA 2OT2A 4AQ7A 2KWVB 1P8LA 1CKOA 2K8HA 4TV3A 4ZHOA 2CJOA 3K0YA 3BINA 1XYIA 1IW7D 2QDBA 5TR5A 4LNFA 4U673 2K7VA 4QCLA 1HH2P 4KVGB 2PW5A 4GOCA 2JJQA 1FVIA 1TQOA 4C2MB 2L7RA 4YWKA 3GTOH 4C7YA 1WIAA 3TS2A 1Y8OB 3CRLC 4P2CB 5LMNL 4JIOU 1F2YA 1I4RA 1TBEA 4OO1I 1Q81C 4JI6L 3MXGA 2KCNA 2V0GA 1I50H 1TU2B 4EQOA 4TRDA 1ZPSA 1QT9A 3MC9A 4DV3L 5JEAJ 2DGYA 4DHJB 1K8GA 1LTAD 2DN8A 4R4TA 3ZNHB 1LXDA 3BG3A 2WU2B 4MEMA 5AZHA 4JYAL 2DNEA 3PQIA 2HCCA 2HD5B 4XYCA 3EBEA 3RYTA 2IHEA 2YTYA 3QAQA 3ALBA 5I2YA 4XYOA 1VQKA 2Z4IA 1OXVA 3FKIB 1F1HA 4A8XC 3CMMB 3VDZA 5FO7B 2A73B 1YIWA 1VQJA 2UUAQ 4NZLB 4A20A 2K32A 5EE0A 1A15A 2R61A 3ZXRA 3RMKC 3AMZA 1HA5A 1HNXQ 2ZW1A 3JYUA 3S1MH 5CBAE 4BY1H 2YV5A 4IW0A 4XQNA 3H9DA 1M94A 2F0HA 3HOZH 3I57A 3RPFC 2MA9B 5M5WH 4KDLB 3IT4B 5D6JB 5IT9c 1S5ED 3ZJUA 2EYJA 5ELCA 4DUYQ 2IX0A 5TSSA 1WWTA 5AUIA 4B3TL 4WJQA 2R2OA 1TT5B 1V8CA 1ZDXA 5EJWA 2ZW0A 4FJVB 3JAMc 3J81i 3GTLH 2K75A 1L1OA 5CC4A 4HIMA 5DPRA 4PZ8A 3ZTDA 1AN8A 5T1IA 4JI6Q 4WJ3M 1D5XC 4A6QA 3HOUH 2AWTA 5M5YH 4ASWC 5EKLA 4RF1A 1E24A 3SK4A 1QUQA 5LL6X 4DV2L 3P7JA 1T6BX 3LX0A 1NVID 3R2TA 4B3RL 2GOWA 4W9GA 4CYEA 3A7AB 4K5VA 3CC2A 2O2VA 1H9SA 2L0FA 2ZCCA 1SNOA 1E2VA 3GP7A 1WGDA 4GDLB 3RFZB 3PLVA 5J2RA 2BBCA 5M3MG 2WAQE 1EY4A 4DV1Q 2ZNVB 2OEDA 2B2WC 2BGFA 2K5HA 3CPFA 2WQYB 1VQ5A 2UYZB 2CHBD 2V1CC 3CHBD 4P16A 1S5DD 5EPLA 2PW9A 1VQDA 1LUZA 2QKIC 4F8MA 3NUHB 1KOTA 2AL6A 4OIKA 1WTHA 4JI5Q 2JQRB 2I1KA 1PUTA 4MH0E 4JI4Q 3SFEB 3ENEA 4KN4C 3LYYA 5FK9C 1CA6A 3OWEB 2K8CA 1ZGUB 4DV7Q 4DR1Q 2EYHA 1ONLA 3RMHA 1B3AA 2TMPA 1GHJA 5IP7H 1YNTE 3N1ZC 4W9CA 3AYHB 1YD8U 1V1PA 3KDFB 2LVPA 2RGFA 3MJWA 2J7ZA 3IAS1 1HHVA 4N8FA 4IPHA 5IP9G 3SU8X 3CMEA 2ZEQA 2DENB 3G48A 2JY6A 3NVYA 4V190 4IOCA 2DHZA 3ONAB 2F3WA 5FJ8G 2BE5D 3CCSA 4YTNB 1X3FA 3VRAB 1XLOA 2D62A 3OAWA 5C4XG 3M4QA 1SEBD 1P3QU 5T1GA 4YL8A 2CWAA 2K01A 1E7ZA 2BT6A 1ZKOA 1CKMA 1IYJB 4N59A 1SFOB 1HZ5A 1TXYA 2O5IC 3SR1A 3AH7A 1MHXA 3P1MA 4HCNB 5IYCG 2LEKA 4MACA 1I4XA 5BYQA 2KHJA 2BA1A 4XWWA 3PV1A 4UP7A 1WJ4A 4CHKA 5FLXc 4C1NK 4XT3B 4YWGG 2KFJA 5IYBH 4IFDG 3UE0A 2JPHA 3M3YB 4K14A 5IT9L 4BS9A 4IM3A 1EY9A 3T1YL 2M17A 3GS2A 4AYBB 2HCIA 1QG7A 3KJOA 4HJKA 4S17A 4P72A 4BY1G 1KL9A 3BYTB 4P1BC 2JXMB 4A3IH 1X56A 4G3XB 5FR6A 3NG0A 3T1YQ 1P7EA 1WZ0A 3QHTA 3ZJVA 1Q10A 1X3GA 2EOTA 3WDNA 2KDMA 2CVRA 2FHTA 3NBHB 2QHOA 3M4OB 1K8OA 2WXJA 4HIDA 3J7ZC 2Z9HA 1DOYA 1G6JA 1X55A 1A3UA 2KMCA 3P4PB 2J0KA 2ZXRA 4K8JA 4DR2Q 2KX3A 1R9TB 2I46A 3MVVA 4DNIA 1WSPA 3T3OA 4R1JA 1EOVA 2F0QA 2C5LC 2L8JA 2LGYA 3UI3A 1SIJA 1E0ZA 4RH6A 3GTQH 5T8IA 5CX3A 3KW5B 3MP9A 1JB7A 4CO7A 4RWSC 4IM2A 4ZQ3A 4MHEA 2EY5A 3VHTC 4A3DB 3U9OA 1YJ1A 3D31A 4PS7A 4CKCA 2O2LD 3AE1B 3B2GA 3H0GB 4F87A 4YSXB 1RODA 2WDTB 2Z1CA 1QOHA 3KBGA 1MBYA 1C8CA 2JA5H 4BBRH 4BA2I 3NY5A 5FR3A 3SE0A 4GB9A 4K1RB 5E3FA 4Q5VA 3CC4A 3SDLC 1NBFC 5L83A 2ID0A 1NY4A 2OJRA 2J7QB 4BBSG 2R7DA 2WIIB 2J0MA 3L08A 1P9DU 1V1QA 2EPBA 3L54A 4PS8A 3UINB 5HKHA 2N1VA 3PV0A 4JG2A 2WXMA 2L00B 2BPSA 4YSYB 4DV7L 4B3ML 3SD5A 4A3JG 3T1HQ 3TZDA 3ONSA 1N5WA 1L6VA 2X8XX 5IIFA 3D6CA 2QCPX 1VS0A 2CH4A 4NW2A 2MBOA 4A3JB 3S1RB 1L6UA 3DPDA 1LYLA 3EUB2 2INCC 4B9XA 1IBXA 4PG3A 1GJZA 2N9XA 3W5UB 1NUCA 1TWCH 3MTSA 2VQEL 5KNCA 1A3VA 4EQPA 1NMFA 1SYBA 4DA2A 2UUCQ 4NMZA 2IO0B 3VH3B 2EMSA 4I65A 1MVKA 2EYFA 2F0TA 4I6LB 2HTME 4IM0A 4A76A 2M4NA 1WTPA 1TYGB 2F0DA 1QF6A 4POGA 5D65A 2C60A 3H7SA 3SHLA 4L1BA 1Y1WB 4Y7NH 4EOYA 1DJRD 4EZJA 3VYRA 1Z2MA 5DPTA 3NZUA 1WJJA 2CCZA 1UAPA 1Q82C 1WE6A 5JHBA 3H1UA 1LTLA 4LK0M 3L0OA 5G5HA 1SYCA 3W3AA 1J9OA 1RLFA 2DYMA 1KHIA 1EFWA 1IBLQ 1HZCA 4S0RA 3F1ZA 4WORA 2D3AA 1WOCA 2O6VB 1CJEA 4HPMB 2EY6A 1JJ2A 2AX5A 1I4GA 4FF1A 3QC8B 1MIUA 1C9FA 1EY6A 2QC8A 5C1ZA 2SDFA 1V80A 2V1YA 2PYKA 1ICWA 1XPRA 2JYEA 5LMNW 5IYBG 1UGMA 1FM0D 4O42A 1NYRA 3OTOQ 1TWHH 2FCQA 5EBCA 4M8NA 1WX7A 3K80C 3SGIA 1FJGQ 1W3SA 4HCSA 2A5UA 1TS4A 4KTAA 1WTVA 1VRAB 4DAPA 1U4AA 2IO3B 5MPOA 4DNRB 2VQFQ 3P63A 2L83A 3Q3JA 3C0RB 4TQUS 3TJPA 4DDID 1HQMC 1FMAD 3APCA 4C80A 1XTDA 3TDQA 2ICEC 4RHSA 3I73A 1DZ1A 2F1MA 1G2SA 3MC8A 2B8GA 2J4XA 3NOBA 2MJ3A 1Q8KA 2AUKA 5EKKA 3J81E 3L0WB 2JRHA 1YHBA 2WX0A 2REXA 2LXJA 4C1NI 3K9PB 4ALPA 4K0KQ 2UXCL 3K0XA 4YHHL 2YU9B 1SJHD 1WM2A 5M3MH 4C3IB 2ES2A 4QAYA 2BYTA 1IYUA 2V9HA 3GTKH 4JW0A 2N3SA 2MBHA 3RR5A 4M0WA 4OW0A 3HOUB 1BOSA 1OEYA 1ILQA 2JZZA 2WXOA 2EE1A 2Q8RE 4X64Q 1XLPA 1QUQB 2DYBA 4RF0A 1FIQA 3WAOA 3L7ZC 5M5WB 3JSVB 4L8JA 2N9PC 4WJOA 5D2MB 1DGJA 4UDUC 4LFCQ 2JWZA 3IAM1 4X62L 1CHQD 4BY1B 1H9KA 5IYDG 1VD2A 1KDBA 3TEZA 1JE4A 3BS1A 1PZID 2WWZA 2JT4B 4NQLB 3V6CB 1I42A 1H4RA 1TTNA 1OQQA 1LFDA 2VXWA 5I6YA 3A8IE 2HJ1A 4LNIA 2R2QA 2OCEA 1N32L 1SDFA 2KCTA 1WXMA 3I55A 3APFA 4BY7H 1F9PA 1BO0A 3S1MB 1FRDA 2RPQA 4NNJB 4M1UB 1YQ4B 4PQXA 3CF5A 1BKBA 3TEWA 1SE2A 3HVDA 4MM3B 1CTMA 4JV5L 3I9V1 3Q3OC 1PH1A 1VQLA 2LWPA 4OWXB 1UEBA 1A63A 4FADA 2IZVB 1R4NI 1E5WA 2EYOA 1QOBA 4LFCL 5FOBB 3RNAC 3RZOB 4A3FG 3A9KA 2KWUB 5ELOA 3ML9A 2ZJDA 1CT1D 1TWAB 4IOAA 4X64L 2WB1B 2GI9A 4YTMB 3A5ZB 3VR2A 2EY1A 1TWCB 3W1BA 1FXAA 1WYGA 4FXCA 1CM9A 1E7UA 2BYEA 1RKNA 1SROA 2EYPA 4ZOHC 3O65B 3L4PA 1PTOD 3HVZA 4A4IA 3VVWB 4MTNA 1IKLA 2MQHA 2G3QB 2UXCQ 1HR0W 4E3CA 3Q3NC 1QB5D 5M9OA 1YN5A 1NSNS 3DHQA 1Y1WH 3BK2A 3EC8A 4NPSA 1A62A 4DN4M 3AEEB 1OEYJ 1RAXA 5LLIA 3G6EA 3A54A 3I72A 2UXDQ 2ACZB 3A1QB 1N34Q 2KJRA 2BF8B 4NAMA 2IPKD 3K57A 5A2QL 2LRUA 3ZDMC 4K6DA 3PREA 1SFOH 3V6EB 3H3VH 1O7YA 4OVUA 2D2CC 5E4XA 2NBVB 2YLMA 3A9JA 4OZCA 4BKSA 3RLOA 3GO5A 4DV0L 3GB1A 4XDDA 3RCZA 4F8CB 2G4DB 4A3KH 2K25A 4OXPA 1HZ6A 2KJXA 2RDGA 2PE9A 1Z6HA 5JEAG 1KRSA 2DBYA 2QDFA 3J9CA 2CHWA 2D0OA 2Y3AA 5IN7A 1C4QA 2OWOA 1ET9A 3H3VI 1WMHA 3P4RB 4A93G 3HZXA 1SMXA 3VR4A 3CQZH 1ZYRD 2JQOA 2W3SA 2UU7A 2F0KA 2L4NA 3CWIA 4WJPA 4B9KA 2CW0C 4IFDH 3TUOA 3NUCA 4XYQA 1YMHE 4LWCA 3ULPA 2HD3A 2WKDA 1IBKL 1D3ZA 2EELA 1B7YB 1PXUA 3K6OA 1GUGA 3I56A 2R7ZG 3ZQ4A 3VYUA 2EIFA 2JA7H 1AZPA 4FA6A 4PMCA 4G4KA 2MP2B 2B2VA 2B2VC 3KWLA 4L23A 1X3PA 2G9DA 4FBJB 4IUUA 4LK1C 1FD6A 1S3OA 3IG3A 4IUTA 2NPTA 2NBWB 4CHTB 2C9WB 3B08A 1HNWL 2VL6A 1M1KC 2KMAA 5JPMC 4IKGA 4G57A 2MWSB 2HTHA 4WIPA 4KSLC 1N6ZA 1ENFA 2EJMA 4RGTA 2UXBL 1KH0A 3EGRA 4GSWA 3EQLC 5K5PA 3ECIA 3NTIA 1OO9B 1IBML 4DKAC 3UF8A 1JQ4A 4XE0A 1T5XD 1A0IA 4X65Q 3S15B 4UP8A 4KI0A 2K14A 5IWAL 2B2WA 2K39A 2Q5WD 2WHIA 1XEEA 4ZRPA 1EIGA 1PFNA 4HAEA 2F0GA 5L37A 4FO2A 1Q3LA 1KDCA 1EQRA 2LHDA 3L13A 4NJ6A 3PSIA 2IBIB 3NZ3A 5IYCH 4KIKB 3VR6A 2A4ZA 3KF6B 3BU2A 3U50C 4DV6Q 5IWAQ 2CHZA 4FXKC 2WXPA 3IFWB 4X65L 1K9MC 2B63G 2IT1A 4HJ7A 3KJPA 4GU2A 1VMCA 2KX0A 3M7GA 1IKMA 3NK9A 3LJ3A 1HA6A 5BO4B 2C7MB 2N1WA 2L11A 2AEHA 1RCVD 2Y0SG 3K58A 1N36L 3G7LA 1VLBA 4FLHA 1CKNB 2MFIA 3FDTA 3AN1A 1T9HA 3PO2B 4ODGA 1L4DB 5DPWA 4GLXA 1WXAA 1NCVA 1SR3A 1QVFA 1HCZA 3ZRCA 3KQ4A 1M4VA 1UWMA 3TBIB 3TMEA 5BYSA 1Q8IA 1FNWA 2E2JH 1G2TA 1Y8PB 2NZ1D 3KDFA 1V1PB 2XNAC 1F2RC 2PPHA 1FRRA 5GXGB 4NXNL 4WJ4A 2IL8A 4BY7B 4OGQC 2BYVE 1TKYA 3AE7B 1MKHA 3RT3B 3EROA 2VZKD 1IL8A 1ZOYB 3ZUNA 5JVG3 4BY7G 1K73C 2ASQA 3Q3FA 2PLPA 4R3DA 4HMIA 2D2QA 2MP1A 3ZJYC 3KF8B 4ULLA 3VA5A 3OMGA 2F0PA 4APVA 4H7BA 3DBHB 1BBUA 4DQOC 4JLCA 1LABA 1Y56A 1I6HH 2OHFA 4LTUA 1VQCA 3FEWX 1GKHA 4KKSA 4A3LG 3QJYA 4UAIA 3I5JC 1TWGH 2KHSA 3GV3A 2NVTB 3PHXB 5AZFA 3D8GA 4Y52H 2RQXA 3L3OC 3PUZA 4DV0Q 3J81j 2VY3A 5M5XB 3KWVA 4EUTA 1N61A 4HMJA 1PLFA 4RCOA 4XDCA 2H1EA 1GUTA 1NMGA 1DM0B 2WXRA 1JALA 3AQQA 2JK8A 1N34L 1TR5A 4ZHPA 3STBC 2UXDL 1SNCA 2GB1A 4LF9Q 5DCNA 3DVGX 4HKZE 4LFBQ 4M0WB 1VQBA 3AXCA 3AU7A 2L9HA 5GROA 2WXLA 2R92B 5M5YB 4A75A 3PTFC 1HJPA 1L1OC 3HOWG 1IGDA 2V3NA 2YTVA 3KUDB 1V6EA 4LUZA 2JXTA 5CMDA 4GNXA 2I0QA 4ITKA 2JRIB 1SLJA 3A0JA 3SDZA 1ZUD2 4X6AH 1TWHB 3HK0A 1WE7A 4IFDJ 2WV6D 4JI8Q 1VQGA 4KHZA 4A3PA 5BR8L 4TQ1A 1NDDA 4DGZA 1MD2D 2R7FA 4HJ8A 3CP0A 1N33L 5JXVA 3ERSX 4TMAB 3T9LA 3HOVG 3GTLB 4PS3A 2JA6G 3NENA 1CFMA 5C2TB 5JHAA
chains in the Genus database with same CATH topology
4H44C 3AE2B 4DAYA 5F2DA 5I9PA 2FMMA 1SBBB 1GUOA 1C77A 5JEAH 3Q23A 1EY8A 2BW2A 1SNPA 3U2SC 1S4ZA 3NQTA 2PNRC 2I2YA 1LACA 4KKUA 1CK1A 1Y69U 3ITPA 1PTOH 1ML0D 4A3EB 3P4QB 1SMYD 2F0SA 3PUYA 2K6AA 3VYSA 4DXFA 3RZDB 5H92C 5ELDA 2O4XA 1WCMB 3NWSA 1QE6A 4N9PA 2EZVA 1PTOF 3V2TA 3HEJA 3DWGC 2A68C 2JA7B 4IDIA 3DEPA 1AW7A 4KKJA 3DEOA 5EE3A 2K28A 4CQNA 5C5LA 1FXIA 3OHXC 1ZE3D 2EJFC 4IZ8A 4FYDA 1YN4A 2GRIA 4I7ZC 5ELEA 3P1HA 2N55A 1BDOA 3NVVA 4MIUA 1AYFA 1D6EC 1RWSA 5EBDA 3TEXA 2LS01 4C3JG 1BUIC 2CJNA 4JPSA 2E2JB 3CU7A 3MHBA 3R8BA 2LMCB 1PZKD 2R6GA 4BWGB 3D4RA 4CJ0B 2KACA 1W6JA 4XXEA 3A55A 2QIEB 4US8A 4J1MA 3AE8B 1DOXA 3A8JE 3X3MA 1O7LA 3DWPA 1Q12A 1FGBD 1JQYD 1B9MA 1UUPA 2O5JC 5KRUA 1JWSD 3I90A 2NYZD 3U52E 2EXZA 5CV8A 2D9UA 4Y7NB 2BS3B 2IX3A 1QOAA 2MJ8A 1O80A 1YN3A 4A55A 5C4JB 3H91A 3DWAA 2RA4A 2BDOA 1YNJD 4H2AA 3S2HB 2JA6B 1XCQL 4WURA 1LO5D 2L52A 4B0EA 4DXGA 4Q2JA 1I4HA 5EE9A 2WXHA 1H9JA 5I9OA 2DLBA 2A6EC 1TS2A 2RSNA 3QWNA 1ROEA 2AWNA 3H6MA 5E6JA 2ONQA 4RGMA 1IGCA 2VNUD 3E0JA 4B08A 2BS2B 3DWMA 2EKIA 2IJ0A 4RFBA 3T53B 1BF4A 2F0UA 1C4CA 2B63B 4CJ2C 2YEPB 4DF7A 2F4IA 3V3XA 5IODA 3K5LA 2LJIA 4K5XA 1HFGA 3AMUA 5IGEA 5DM73 5CV5A 1C48A 5M3MB 1WGKA 3NRZA 4HKQA 2JU6X 3WOFA 2YYZA 3Q8FA 4PMBA 1QWYA 3IL8A 5C3XA 4ABNA 3Q22A 4WWMA 2LFIA 2A5HA 2B8FA 4H0LC 1PMRA 1PFMA 1YJJA 1ZP0B 3VA7A 2PMVA 1MGSA 2PZUA 1R4PB 2FMCA 2E3TA 3URYA 2RMMA 3SVMA 2KVMA 3C3LA 1QOFA 4B9WA 2OXPA 2M00A 2PW7A 2SNSA 3P75A 1B2TA 1IBXB 2WDQB 1IUEA 4DU9A 3HS0C 3OSOA 4ZRZA 3IFTA 4PV1C 5D7GA 1GXDC 2HQEA 2PZWA 1N63A 1B9NA 5AFWA 3MA2B 1KLUD 3NWTA 3GTMB 3MXNA 4YXDB 1FFUA 4DK1A 4KKIA 4KY6A 4JWUC 5JAVA 5HI1A 2ZXPA 1N62A 1R7SA 1SNQA 3W9CB 1STYA 2WAQB 4KY7A 2Z4HA 2RDHA 3MWYW 2E2IB 4OIJA 3E5SA 1TT2A 5FKAC 1TJEA 5HHDG 1C4AA 1DXMA 2CQAA 3D6WA 2F0WA 3IXSA 2B39A 1TS5A 2RKSA 1EFID 2BCOA 3S14B 2MGSA 1AFPA 2E6XA 1VDZA 1STHA 5HURA 1DOKA 3M4YA 1NR4A 3VR5A 2RSOA 4R9WA 2E2HB 4BBRB 4FF3A 1DCZA 3OWFA 4JWSC 2JSOA 4BA1I 1YNNC 2F3VA 5J22A 3HP3A 2F0LA 4HN7A 3BVGA 2KAJA 5K36H 1V8QA 1EY0A 1GAQB 1I6VC 2WNMA 1I6HB 1ESFA 3BVMA 4QF4A 3MHZA 3MC0B 5C0XI 2JP1A 2I38A 1JOOA 1STAA 1TVXA 2WXGA 1SYEA 2N9LA 1L0XB 4HJGE 1NAPA 3SK8A 4REZA 1SSOA 1U4PA 1SMYC 1D5MC 2F03A 1EL0A 4USAA 1A2TA 4IUQA 5I4DA 2K9XA 4MT5A 5M3FB 1OXXK 3IKJA 4OVZA 1JC7A 5KYLA 4OHJA 3NTHA 4OL7A 5A2QE 4A93B 2WINB 1JORA 3S17B 1T5EA 2AWOA 1W6KA 1YNND 4CJ1B 1RYJA 1JROA 2KUMA 2H88B 1F77A 4D2KA 4RKBA 2NMQA 1GJXA 3V05A 2GA4B 1TWGB 5G3LD 3PIP3 3IAYA 1VR9A 3DWQA 1SYGA 3AEGB 2C5CA 4FVMA 3TP5A 1ZXIA 4GDKB 3NPPA 5CV4A 1KFYB 2PVGC 2WDRB 3Q24A 5D14A 2F0NA 4OO1G 5FLXL 1EQVA 2G9HD 1H9RA 2J52A 2MUYA 2XN9C 3KBXA 5E4WC 4K8IA 1F2RI 1X32A 1BCPC 1OXUA 2X6LA 1ET6A 2L1BA 3JAME 3K5OA 3SK5A 3T13A 1SE4A 3AEAB 2B76B 4KHVA 3VQIA 4G7HC 2NN6G 3SR6A 3PO3B 3Q8EA 2EVBA 4A9AA 3CRKC 2INNE 1G6ZA 1U4RA 1KNEA 5CORA 1A70A 3MJ5A 2JEBI 4ARIA 5KGUA 3PO0A 2BTEA 2PKOA 2AQ1B 1EM7A 3NQIA 5IGFA 1B4OA 5BN5A 2R93B 3AB5A 4H13C 4XT1B 3Q8AA 3DUZA 4EVOA 5D3IB 4DAVA 2VB3X 1EYDA 2L32A 3ZYYX 3C2PA 2NTSA 2KEEA 3NHHA 2W54A 5CV7A 4Q0FA 4S3SA 1EY7A 2B2YA 5DNFA 2NVYB 1IYVA 2L1AA 1VCIA 4C3HB 1LTSD 3O13A 1FYCA 2RPVA 3J80E 2K3UA 1M8AA 3T3NA 3NVWA 4R8IA 3BVZA 4KGSA 3QIAA 1MSHA 2J0TD 3MAQA 1RFKA 1S5CD 5CV6A 1E2WA 1CI3M 2FBWB 2WP8J 5DAUA 4HRSA 1A2UA 3TZUA 5LNK1 3I3CA 2JYOA 4X3SA 4K2LA 2SNMA 1NEKB 3NBHA 3PIO3 1WVLA 1VZ7A 3S9WA 3TEYA 3VYTA 1ENAA 1RHPA 1CQVA 1H9MA 1J7AA 3E9SA 4JK1C 1PGAA 3AEBB 1K51A 5J1ZA 4WAFA 3D4WA 3R93A 1SB3C 2VB2X 3OPOA 1L0YB 1HTPA 4LAAA 4RGOS 1CA5A 1C78A 1S5FD 2HUGA 3OIPA 2QEJC 3N6RA 1EU3A 1QILA 1EY5A 1GUSA 4WJWA 2WXFA 5BMIA 3N52A 1ILPA 3BDLA 1ACCA 1GB4A 1E0BA 4KGTA 1BBXC 3FMCA 4K6LA 1AP0A 3AE6B 1T3QA 5KEEA 3LB8C 2E2DC 2EY2A 4GLSC 1IW7C 3VRBB 3F2UA 1N5XA 3DM1A 4NAWB 5G5GA 3BWUD 1BCPF 4C3JB 4FF2A 1STEA 1HQRD 3E56A 5EE1A 1HPCA 1FR3A 2L12A 1FNVA 5CYUA 1WRIA 3H09A 3HRZC 2QMTA 1PFDA 1EOTA 1JICA 1X3QA 2F0EA 3V96A 1LT5D 3AE3B 3GTKB 3GTGB 1TKEA 4EGVA 4KMUC 2B2YC 1QJOA 4TQ0A 1ZEQX 5FLXE 3D4DA 2H89B 5C4XB 3HOWB 1H9SB 5I6WA 1JRPA 3W1SA 2Q8TA 2K03A 3OIQA 1SF0A 1ZXTA 1I4PA 1KDAA 2F0OA 3AE5B 4XQJA 1UNSA 2JZPA 2A69C 3CQZB 2XIWA 1E7PB 1QNUA 1VJKA 1KRHA 5HG2A 1E9MA 2B2TA 1CQFA 1JR0D 5C0XG 1SAPA 1TIID 1GHKA 2WDVB 5CV9A 3Q69A 3S16B 3C1FA 2WKCA 4V0BA 1FCLA 4WQMA 1XXGA 3GTQB 3I4NB 4F7XA 2M56B 4IUVA 1XO3A 3U7ZA 2JA5B 1LTTD 1PGBA 5D3DA 2KQ3A 4DK0A 4LLGM 3S2DB 2Y5CA 2K0PA 5KIXA 3KUPA 1LTBD 1OFFA 1G291 3P20A 5BN4A 1B9RA 2WLBA 3FC4A 3MZ5A 2W55A 2PTLA 4JBWA 4O1NA 4OO1H 2DWQA 4ARCA 3TSSA 4L63B 5C0XJ 1WTQA 4KD3A 1L4ZB 3QB3A 2JYTA 3Q8BA 4XDXA 5AUKA 2ZT9C 3M7NA 5EGTA 1QQRA 2F0FA 2L5TA 4HSVA 4KJNA 4HEDA 3QOLA 4HTHA 1LTGD 1G91A 1EYAA 4HROA 2WU5B 2IGHA 1J8IA 2ICIA 4FP5D 4PNYA 4QMGA 1LT4D 2WXIA 3KK7A 2M9VA 3PZ7A 1MPEA 3VR3A 4RGNA 1HUNA 2ON8A 2WP9B 4PT5A 1FEHA 2R7ZB 5EPKA 2F0JA 4JX1C 3NS1A 2IGDA 1TKWB 3QO2A 4XTCS 3U4EG 1F2MA 1MI0A 4KK7A 5EQ0A 2LY7A 5BN3A 1SJED 1S5BD 1SE3A 2Y0SB 2WXNA 3U9SA 1TZOA 1EEFD 1R4QB 3ND8A 1KNAA 1XF5L 3DMUA 3HKZB 1LT6D 1F9QA 1PZJD 3HRDD 3KLRA 3PUXA 3L9AX 4NKLA 3IT6B 3GV6A 1BCPD 3EFXD 1TKGA 1RF2D 1N60A 1HXYD 1HEZE 1SYFA 4Z9CB 3MFGA 4N58A 2WACA 3KF8A 2XWJB 1JMLA 1BQQT 1SYDA 3MEHA 1MHHE 1Q90A 2QILA 3K59A 2RDFA 5ELBA 3C46A 2EYLA 2N0SB 4L6TB 2XSCA 2A74C 1JCKB 3NBIA 1BMLC 1NR2A 5C3WA 1ZYRC 1EZ8A 4K5WA 1J7BA 1YJIA 3PZ8A 1XLNA 1LT3D 3KLSX 2Z8LA 1I7HA 2IX1A 4RAUC 3AE9B 5KYIA 2AUJD 1U4LA 1WXQA 4FXGC 2FJ2A 2WS3B 2FINB 4P6VF 2IGGA 3W5VB 3NE5B 3HG9A 2PQEA 1I4QA 3NVZA 4X3TA 1JB3A 2N9KA 2PCFB 1LLRD 1EQTA 2OEOA 3HUIA 5E1FA 3FILB 2LKVA 4ZKCB 1BNZA 2INPE 5FO8B 1B1ZA 5C3JB 1YQ3B 1PTOC 2K5DA 2K1BA 1EU4A 2A69D 1PGXA 3NXWA 4HSPA 5C5MA 1XLQA 1OXTA 2XRSD 4KV6A 3A56A 1WD1A 2KN4A 4KX6B 2XVSA 4ZAIA 1KLGD 3R2IA 4U68A 2K05A 2KCCA 3BYYB 3I4MB 4YSZB 1F0ZA 3DXJC 1FFVA 2D5GA 1TY0A 2K04A 5G3LF 3BZDB 1MSGA 1HFNA 1SNMA 2FUG1 5EKIA 4BBSB 4G7ZC 1LTID 3CIRB 5COYA 1P7FA 3TP8A 2NN6I 2SEBD 2HDEA 4RKLA 1DOMA 1E2ZA 2V4DA 1HUMA 5CR3A 2PMZB 1SSNA 2BOSA 1EWYC 1DOLA 4C3IG 4CKBA 5JPNC 1WTXA 4IFDI 5C4ZA 5NUCA 2FE8A 1DONA 1L5PA 1C76A 3J7AV 1PFBA 1WTWA 3EJIA 3AB9A 2X6GA 1BUVT 1O78A 1YNJC 4A3BB 3MXUA 2QSDA 4ZRQA 3H94A 4ZYSA 4XQQA 3R3OA 1D2BA 5K36G 3BDCA 1JOQA 3OOCA 2NB0A 4US9A 4E6IA 3ETRA 3GTJB 1FD7D 2QF7A 4QB4A 2B2UA 3X3NA 3J7YW 2B2UC 1DOIA 3P42A 1G8ZD 1VDVA 3RD4A 2PZTA 3OW7A 3I8ZA 3B2FA 1WD0A 3T4AC 2BS4B 1NYQA 1XWEA 3JAML 1II3A 1DYQA 4ID6A 5IT9E 3SXHA 4NJCA 4IN3A 5I2XA 2BDNA 1VZ6A 3RUZA 2JA8B 3MXPA 2KWDA 1CZGA 2V3PA 1EYCA 1E6EB 5KNBA 5JOBA 1IHZA 2BB6A 3T56B 1D5ZC 5CGKA 3H3VC 1GB1A 4X3UA 4IURA 3I4LA 3IFDA 4HR7B 4F88A 1PRTF 2IDYA 1D1KA 5IGBA 4LJZC 4OZAA 2A68D 4B0MA 2L0CA 1Z7TA 3PUVA 1TS3A 2A6HD 4FF4A 3W2DA 2LGIA 1FO4A 4QUFA 4N6EB 4L2YA 1QKZA 1V43A 5LL6S 2NVQB 2RVLA 4KY5A 1Z47A 2NN6H 1XCTL 4QIWB 3FRPB 2KQ4X 5BYRA 1Y1VB 4ZLTF 2VUMB 3FPUB 1KF6B 1D1IA 3AECB 4ILWA 4G7OC 1RTOA 1HRJA 2BA0A 2PO4A 3Q6SA 2NVXB 1F2LA 2ENBA 3CKIB 2K5QA 5C0XH 3LXFA 2ZXOA 5ELFA 1K53A 1QOGA 4ZK9B 2I07B 2SAKA 4YT0B 3G6JB 4A3MB 1UGJA 1Y8NB 5HFYA 1J7CA 4WRDA 3SFDB 4TSSA 2B2TC 3HOYB 3OMCA 3PMFA 3T51B 3HOZB 1A6XA 2KMMA 4WFN3 2K5PA 1SXTA 3I91A 1QLBB 2G1EA 2JEAI 4FXDA 2W3RA 4ZKBB 5H8YE 5KNDA 1KAAA 2NUCA 3NTKA 1C79A 2W82A 2IWHA 3I70A 1ZXHA 2BE5C 2E76C 3VR9B 4M8AA 2BB5A 1XX8A 1EEID 2NWGA 4HEA1 4QUCA 1UEAB 4K2KA 2KEDA 3ERQA 4ME5A 4A3IB 1BXTA 4WH4A 2D5DA 2EDGA 4NDXA 4ZUIA 1AEXA 1SNDA 3GTPB 4RA8A 1PDXA 3EVQA 1EWHA 2LHEA 4CKEA 4C56C 5C4HA 4IOIE 2K22A 3SEBA 2TSSA 2JWUA 2PVOD 4KJOA 2MEKA 4AS1A 5IGDA 3GTOB 1JWAD 3BIID 3NSWA 2M2LA 1FCCC 1KTKA 1VZ8A 1STNA 4EQNA 3AE4B 1Q1BA 4KD4A 2MPMA 4C7ZA 1L0VB 5BMGA 3K5NA 3N9YC 1WTOA 2PPBC 2NTTA 2DY8A 1PYWD 3SK6A 1NENB 1A3TA 2EJGC 1TY2A 2CU3A 5HGTA 3Q0AA 3TP6A 1PRTC 4NP5A 2RBMA 3HGBA 4LMQD 1F2ZA 3P4SB 4PMWA 1I3QB 1B53A 4DFAA 1RTNA 1ESRA 3J81L 4RHRA 2PIAA 1E10A 5JJZA 1EZ6A 5DM63 1D4BA 5DEHA 2Q8IB 1JOKA 1C4PA 5FO9B 3RLFA 2SOBA 1K50A 2R3ZA 2M19A 3LNNA 1K83B 2A6ED 3C8YA 1UWXA 3LWEA 2KA7A 2V4IB 3TN2A 4IUNA 3FVQA 3ZGZA 2Y5PA 4DNTB 1MI2A 3QG1A 4KKTA 5ISRA 1ZDVA 2VZKB 1V97A 4C3HG 5C6AA 2DNCA 3MFYA 4KN7C 4N9TA 4A3FB 3ZJTA 2KECA 1JW9D 1B50A 1F9RA 2A6HC 2FFKB 1Q1EA 2H4OA 3FILA 2EYMA 3AEFB 4J8QA 1OXSC 4XIGS 2K33A 4A3GB 3E6ZX 1CZWA 1TWFB 2E75C 1FNUA 1K52A 4MN3A 1CZPA 3WOEA 2QJLA 1I50B 2M0AA 5C44B 2XRQD 4FNFA 2N7JA 4YTPB 3K5MA 2LFNA 4HCEA 1V1OA 1AZQA 5IGCA 1RJTA 4J3OD 2LUMA 2AQ2B 3AEDB 1CHPD 4R8NA 1RDPD 3B9JA 2OF1A 5A35A 3A8KE 1WTRA 2F0IA 5C3EB 2HDLA 4XWTA 4CBVA 2J53A 1K8MA 4EE2A 2MJEA 3Q8CA 2MHVA 4ZUJA 1AWDA 4GZYC 1VF7A 3BDOA 4A3KB 3UI2A 3J80L 1F9SA 3S1NB 4YIJA 2E74C 2L55A 3GQBA 3KLSA 5BMHA 2KOLA 3M85A 3J7AF 4J6HA 4MH8A 1O7ZA 1OQRA 2DYOA 2YEPF 3WCQA 1QCBD 4RCNA 2N88A 2MH7A 1VF5C 3FPPA 3T16A 2DY7A 3VR8B 2F0MA 3NP8A 1GUNA 1BR9A 1ENCA 2JX5A 4TKOB 2WXKA 3FAHA 3HOXB 2JSVX 5IOCA 4CGYB 5EPJA 1PDQA 3TP7A 1RD9D 3D3RA 5J39A 1B44D 3S1QB 5IGGA 3PUWA 2X38A 4IALA 2X69A 1STGA 1XTCD 4KGRA 2HDMA 3HOVB 1PTOB 2IW3A 3GD7A 1NI3A 2J42A 3A7LA 2JE6I 1KABA 2AQ3B 1PRTD 5JVH3 1STBA 1EIHA 4A90A 2C9OA 4OZBA 2K5WA 1EWCA 3BK1A 1JWUD 2LMCA 2MJDA 5LHY1 1U4MA 1LV9A 2NBFA 1LTRD 4JE3B 3AV8A 2F0VA 3ND9A 4RNAA 5CBEE 1QNKA 3K7AB 4IQZA 4IUPA 1VMPA 1JWBD 4X3KA 2WXQA 1GOZA 1GPXA 3EA6A 2XWBB 3AM9A 2CW0D 3QOJA 1BCPB 1HTLD 1DD2A 3ABVB 1GUWA 1RM6C 1U9RA 1PRTB 3C1EA 3LWUA 1JWMD 3H8HA 2OT2A 4AQ7A 4ZHOA 2CJOA 3K0YA 1XYIA 1IW7D 2QDBA 4U673 2K7VA 4QCLA 2PW5A 1TQOA 4C2MB 4C7YA 1Y8OB 3CRLC 4P2CB 1F2YA 1I4RA 4OO1I 3MXGA 2KCNA 2V0GA 1TU2B 4EQOA 4TRDA 1ZPSA 1QT9A 5JEAJ 1LTAD 2DN8A 3BG3A 2WU2B 2DNEA 2HCCA 5I2YA 4XYOA 2Z4IA 1OXVA 3FKIB 4A8XC 5FO7B 2A73B 4NZLB 2K32A 5EE0A 1A15A 2R61A 3AMZA 1HA5A 2ZW1A 5CBAE 4XQNA 3I57A 2F0HA 3RPFC 3IT4B 1S5ED 3ZJUA 2EYJA 5ELCA 5AUIA 2IX0A 5TSSA 1WWTA 1V8CA 1ZDXA 5EJWA 2ZW0A 5CC4A 1AN8A 5T1IA 1D5XC 4A6QA 5EKLA 4RF1A 3SK4A 5LL6X 1T6BX 3P7JA 3LX0A 1NVID 3R2TA 3A7AB 4K5VA 1H9SA 1SNOA 1E2VA 3GP7A 4GDLB 3RFZB 2BBCA 1EY4A 2OEDA 2B2WC 2WQYB 2CHBD 3CHBD 4P16A 1S5DD 5EPLA 2PW9A 3NUHB 2QKIC 4F8MA 4OIKA 2JQRB 1PUTA 3SFEB 4KN4C 3LYYA 5FK9C 1CA6A 3OWEB 2EYHA 1ONLA 3RMHA 1B3AA 2TMPA 1GHJA 1YNTE 1V1PA 2J7ZA 3IAS1 1HHVA 3NVYA 4V190 3ONAB 2F3WA 2BE5D 3VRAB 4YTNB 1XLOA 2D62A 1SEBD 5T1GA 2K01A 2BT6A 1ZKOA 4N59A 1SFOB 1HZ5A 2O5IC 3SR1A 3AH7A 1MHXA 3P1MA 2LEKA 5BYQA 4MACA 1I4XA 2BA1A 4XWWA 4C1NK 4XT3B 4YWGG 4IFDG 3M3YB 4K14A 5IT9L 4BS9A 1EY9A 3GS2A 4AYBB 2HCIA 1QG7A 3BYTB 2JXMB 1P7EA 3ZJVA 1Q10A 2EOTA 3WDNA 2KDMA 2CVRA 2FHTA 2WXJA 3M4OB 1K8OA 1DOYA 1A3UA 3P4PB 2ZXRA 4K8JA 1R9TB 2I46A 3MVVA 1WSPA 3T3OA 2F0QA 1E0ZA 3UI3A 1SIJA 4RH6A 5T8IA 3MP9A 4RWSC 4ZQ3A 4MHEA 2EY5A 4A3DB 3U9OA 3D31A 4YSXB 4CKCA 2O2LD 3AE1B 3B2GA 3H0GB 4F87A 1RODA 2Z1CA 1QOHA 3KBGA 1MBYA 1C8CA 4BA2I 5FR3A 3SE0A 5E3FA 4Q5VA 2ID0A 2WIIB 2EPBA 3PV0A 2WXMA 4YSYB 3TZDA 1N5WA 1L6VA 5IIFA 3D6CA 2QCPX 4NW2A 4A3JB 3S1RB 1L6UA 3EUB2 4B9XA 1IBXA 3W5UB 1NUCA 3MTSA 5KNCA 1A3VA 4EQPA 1SYBA 4DA2A 4NMZA 4I65A 1MVKA 2EYFA 2F0TA 2HTME 1QF6A 1WTPA 1TYGB 2F0DA 5D65A 3SHLA 4L1BA 1Y1WB 1DJRD 3VYRA 1UAPA 4LK0M 5G5HA 1SYCA 3W3AA 1J9OA 2DYMA 4WORA 1CJEA 2EY6A 2AX5A 1I4GA 4FF1A 1C9FA 1EY6A 2SDFA 2PYKA 1ICWA 2JYEA 1FM0D 4O42A 1NYRA 5EBCA 4HCSA 1TS4A 4KTAA 1WTVA 1VRAB 4DAPA 5MPOA 4DNRB 3P63A 2L83A 4TQUS 1HQMC 1FMAD 4C80A 3TDQA 2ICEC 4RHSA 3I73A 1DZ1A 2F1MA 1G2SA 2B8GA 2J4XA 2MJ3A 2AUKA 5EKKA 3J81E 4C1NI 2YU9B 1SJHD 4C3IB 2BYTA 1IYUA 4M0WA 4OW0A 3HOUB 1BOSA 1ILQA 2WXOA 2EE1A 2Q8RE 1XLPA 4RF0A 1FIQA 3L7ZC 5M5WB 4L8JA 1DGJA 4UDUC 3IAM1 1CHQD 4BY1B 1H9KA 1KDBA 3TEZA 1JE4A 3BS1A 1PZID 1OQQA 2VXWA 5I6YA 3A8IE 1SDFA 1FRDA 1F9PA 1BO0A 3S1MB 4M1UB 1YQ4B 4PQXA 3TEWA 1SE2A 3HVDA 4MM3B 1CTMA 3I9V1 2EYOA 1QOBA 5FOBB 3RZOB 1CT1D 1TWAB 2WB1B 2GI9A 4YTMB 3VR2A 2EY1A 1TWCB 1FXAA 1WYGA 4FXCA 1CM9A 1RKNA 2EYPA 4ZOHC 3L4PA 1PTOD 3HVZA 1IKLA 1QB5D 5M9OA 1YN5A 1NSNS 3DHQA 3BK2A 4DN4M 3AEEB 3A54A 3I72A 2ACZB 4NAMA 2IPKD 3K57A 5A2QL 4K6DA 1O7YA 2D2CC 5E4XA 4OZCA 3GO5A 3GB1A 4XDDA 1HZ6A 2KJXA 2RDGA 1Z6HA 5JEAG 3J9CA 2DBYA 2Y3AA 1C4QA 1ET9A 3P4RB 3HZXA 3VR4A 1ZYRD 2W3SA 2F0KA 2L4NA 3CWIA 2CW0C 4IFDH 3TUOA 3NUCA 4XYQA 1YMHE 2WKDA 2EELA 1PXUA 3K6OA 1GUGA 3ZQ4A 3VYUA 1AZPA 4PMCA 4G4KA 2B2VA 2B2VC 3KWLA 4L23A 1X3PA 2G9DA 4IUUA 4LK1C 1FD6A 4IUTA 4CHTB 4IKGA 5JPMC 4G57A 4WIPA 1ENFA 2EJMA 4RGTA 1KH0A 3EGRA 3EQLC 5K5PA 3NTIA 1OO9B 1JQ4A 4XE0A 1T5XD 3S15B 4KI0A 2Q5WD 2B2WA 1XEEA 4ZRPA 1EIGA 1PFNA 4HAEA 2F0GA 1Q3LA 1KDCA 4FO2A 2LHDA 3NZ3A 3VR6A 4FXKC 2WXPA 2IT1A 1VMCA 3M7GA 1IKMA 3NK9A 1HA6A 2L11A 1RCVD 3K58A 3G7LA 1VLBA 3FDTA 3AN1A 3PO2B 4ODGA 1L4DB 1NCVA 1HCZA 3KQ4A 1M4VA 1UWMA 3TBIB 3TMEA 5BYSA 1Q8IA 1FNWA 1G2TA 1Y8PB 2NZ1D 1V1PB 2XNAC 1F2RC 1FRRA 5GXGB 4BY7B 2IL8A 4OGQC 1TKYA 3AE7B 3EROA 2VZKD 1IL8A 1ZOYB 5JVG3 2PLPA