1I4PA

Crystal structure of staphylococcal enterotoxin c2 at 100k crystallized at ph 5.5
Total Genus 63
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
63
sequence length
239
structure length
234
Chain Sequence
ESQPDPTPDELHKSSEFTGTMGNMKYLYDDHYVSATKVMSVDKFLAHDLIYNISDKKLKNYDKVKTELLNEDLAKKYKDEVVDVYGSNYYVNCYFSSKDNGGKTCMYGGITKHEGNHFDNGNLQNVLIRVYENKRNTISFEVQTDKKSVTAQELDIKARNFLINKKNLYEFNSSPYETGYIKFIENNGNTFWYDMMPAPGDKFDQSKYLMMYNDNKTVDSKSVKIEVHLTTKNG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ENTEROTOXIN TYPE C-2
publication title Structure of staphylococcal enterotoxin C2 at various pH levels.
pubmed doi rcsb
molecule tags Toxin
total genus 63
structure length 234
sequence length 239
ec nomenclature
pdb deposition date 2001-02-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01123 Stap_Strp_toxin Staphylococcal/Streptococcal toxin, OB-fold domain
A PF02876 Stap_Strp_tox_C Staphylococcal/Streptococcal toxin, beta-grasp domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.110 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1i4pA01
3.10.20.120 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 1i4pA02
4C56C 1SE2A 1PRTC 2XNAC 3BYTB 1MD2D 5ELCA 1D5XC 3KLSX 1LTRD 1CHQD 1KLGD 1PYWD 1T5XD 1LT6D 2AQ3B 1SE3A 1CT1D 1V1PB 4DXFA 1D5ZC 1JR0D 1EFID 1TS2A 4RGNA 1FNVA 2XN9C 3BVMA 1AN8A 3MC0B 2SEBD 3EFXD 5D3IB 4Z9CB 1UUPA 5D3DA 4RHSA 1LT3D 1QILA 1YN4A 2QEJC 1KTKA 3MFGA 1M4VA 2XRQD 3CHBD 2RDHA 1BCPC 1PRTD 1D6EC 1JQYD 1DYQA 1RDPD 1S5DD 1TS4A 1JWUD 4OHJA 2Z8LA 1PZKD 5ELEA 1I4GA 4RFBA 1CK1A 1SE4A 5FKAC 1LT4D 1PRTB 1LTGD 4RGOS 1F77A 4NZLB 2CHBD 3DWAA 1LTTD 1ET6A 2TSSA 3DWPA 1HQRD 3V05A 1I4RA 1PZJD 3TSSA 1L0XB 1I4PA 1RF2D 1LLRD 1CQVA 1S5CD 1TS3A 2J4XA 1I4QA 5TSSA 1PTOC 1TS5A 3BYYB 1DJRD 1BCPD 1TY2A 1EU4A 3W2DA 4ZYSA 1PRTF 1EWCA 2R61A 1LTSD 1LT5D 1G8ZD 1ESFA 1JWSD 1PTOB 1EEFD 1S5FD 1YN5A 4RHRA 2IJ0A 1SEBD 1BCPB 1ENFA 1SBBB 1TY0A 1V1PA 2O2LD 3BZDB 2ICIA 1RCVD 1STEA 1UNSA 3OWEB 3URYA 1YN3A 4UDUC 1LTID 1XTCD 1JCKB 5ELBA 1PZID 4RH6A 2IPKD 4RGTA 1EU3A 2AQ2B 1B1ZA 4RCOA 1PTOD 5I4DA 3R2IA 5ELDA 1BCPF 1HA5A 2WV6D 1SJED 1KLUD 3EA6A 1LTAD 1D5MC 1HXYD 1V1OA 1CHPD 1FGBD 1AW7A 1L0YB 4L63B 1FD7D 4O1NA 3GP7A 4BWGB 1B44D 1FNUA 1JWMD 3DWQA 2NTSA 2NTTA 5FK9C 2G9HD 1I4HA 4L6TB 3R2TA 1EEID 2QILA 3BVZA 1SJHD 3R8BA 2AQ1B 1PTOH 1ET9A 1RD9D 3O13A 1PTOF 2XRSD 1FNWA 1S5ED 1SXTA 1XXGA 1I4XA 5ELFA 1S5BD 1GOZA 3BVGA 2RDGA 4K6LA 4RGMA 1HTLD 4TSSA 4DXGA 1LO5D 3SEBA 1LTBD 1BXTA
chains in the Genus database with same CATH superfamily
3VTVA 1WGKA 1F9PA 4OX9Q 1K0RA 3MC9A 5HURA 3P4RB 1FR3A 3D3RA 3UDGA 1GUWA 3B9JA 3GZNB 1BBWA 2D10A 4NQLB 1HJPA 3D4WA 2NWGA 1TTNA 2LVOA 3OJ3A 3V2TA 5A2QL 1T5XD 2AQ3B 4HJ5A 1J5EL 4LUOA 4XT1B 3J81L 2EXZA 5COYA 1SNPA 3CCJA 2B39A 3AEVA 2C7NB 2L7RA 4GDLB 1ZGUB 3BS1A 4N58A 2NB0A 4KKJA 3D6CA 4OVUA 4BAXA 1KRHA 2GBNA 1AYFA 3EFXD 1I7HA 2L00B 1IBXB 4RNAA 5GXGB 4ICVA 4JI2Q 1YN4A 2QEJC 4IWQA 1OXVA 5BN3A 4NJCA 1L6VA 4USAA 3VTUA 4LTUA 4K7UA 1JOQA 4G50A 2KVMA 3RN5A 4HKQA 3EHVA 1RDPD 1EIGA 1H9KA 3KUPA 1E6EB 2JVCA 4HPMB 5EPKA 3RT3B 4RFBA 2WNMA 1CSPA 4A3DB 3RN2A 1V81A 1LT4D 2FCSA 4JGHB 1PRTB 1LTGD 2ZXRA 4DR5Q 4JX1C 3I5JC 3H6MA 2DY7A 3J81c 3L08A 3VFKA 2B8FA 2JA7B 4O2DA 1WMHB 1Y8RC 4H13C 4M8MA 2NVYB 2PO4A 4P6VF 2YU9H 1VQFA 4LFCQ 4IO9A 2KOXA 4P71A 5IP7G 3N1XC 3D0FA 3NG0A 4IOIE 3TEYA 4DV7Q 4AOFA 2JA6H 4ANVA 1G2TA 2L8JA 3HHMA 2B2TC 1PRTF 1STAA 3K5OA 4FO2A 3PUVA 2JA7H 5FLMH 2NVYH 2K1BA 4GKKQ 2CFMA 1SEBD 1E7UA 1BCPB 4YCVA 2JA5G 2O2LD 2RPVA 4LNQA 3VA7A 3Q6BA 2K52A 4OWXB 5EGTA 5JJKA 1F9QA 1YJJA 4FHKA 3NPPA 2ZJQA 4RGTA 1HZCA 1YJWA 5LMUQ 4ZKBB 3N20C 5C44G 2BW2A 4MSMB 1BCPF 5M5YB 2KK8A 2R6GA 4R4IA 2WV6D 4G7HC 4A3IB 1XF5L 1UELA 2FCNA 4DUZL 3STBC 3SK5A 5D2MB 4DK6C 3PIOA 4MNOA 1VRAB 4KSLC 2ZZPB 1A3VA 3TUOA 1ZYRD 2F0KA 1BVSA 1QJOA 2F3VA 4MH8A 2MGSA 5C5MA 1TXYA 4A3IH 1NDDA 2OTLA 3MWYW 1V2YA 3KH0A 1XX8A 1KF6B 1CKNB 5CHFA 3AEBB 4RMFA 4ITKA 1GC7A 3UIOB 3KJOA 3OG5A 4WQMA 2HUGA 2A73B 2PQAB 4P2CB 2L1AA 5C3WA 2KJRA 2B2TA 1R7SA 4LF9L 2JYEA 1VQBA 2J7ZA 2RDGA 4LF6L 4YCWA 1WGRA 2DJGC 3DEOA 4JYAQ 3K58A 1M1KC 1YQBA 2ON8A 1UWMA 2IY5B 2CHZA 2HD5B 5CR3A 1VF5C 1PH3A 5G3LF 5EDSA 2KDMA 2IHFA 2FMCA 2X69A 4JBJA 3BK1A 3IAS1 1X32A 4NP5A 3ZTCA 1D5XC 2K39A 1E0ZA 1GUSA 2BYTA 1K73C 3TRZA 3T4AC 5M3MG 4YSYB 1KD1C 1LT6D 1N6ZA 3H09A 4LF7Q 5IT9L 1CZGA 2F0UA 3GE3C 2JT4B 2P5ZX 3MHSD 4EGVA 1ASZA 2E75C 5FJ8G 1YHQA 3PVLA 4POFA 3CRLC 1RODA 4FF2A 1FD6A 4C3JH 2H1EA 2E8GA 1CA5A 2XBBC 3B08A 4M8NA 1M4VA 2K8BA 2EOTA 3H3VC 5CV5A 4A93B 3I56A 3J7AV 3NELA 5IKCM 3SHQA 4HEDA 2MH7A 2H4OA 4OHJA 1R4QB 2I07B 1I4GA 2NPTA 4A3KG 1P16A 2WXKA 3H7PB 1HNWQ 1WTXA 4RAUC 4HCPB 4HR7B 3RLOA 2Y5CA 2VZAA 2OWOA 3TS2A 1EIHA 3J9CA 4A93H 2KDEB 2OEDA 1YVCA 4ID6A 2J0TD 4A3JB 1UE5A 1Q82C 1IW7D 1PFBA 2KCCA 4DR6L 1STBA 4P1CC 1I4RA 2AX5A 3PLUA 4LUZA 2K01A 2YTXA 1LLRD 2VQFL 3RNUA 3JSVA 3I4MG 2WU2B 5DPSA 3AE6B 5IY0A 3LX0A 3KK7A 1DD2A 3T3NA 2WKDA 2CCZA 3TEHB 4N9F4 4A3JH 4CJ2C 2Q8IB 1OEYA 1SYBA 4P75A 1BF4A 1JMLA 1K83B 4BY7H 2LS01 2L83A 1ENFA 2ZVNA 4ZUIA 1PVOA 4I65A 3KQ4A 5ELNA 4DAPA 1UNSA 2LI5A 1XLNA 4KZ0A 3HOWB 1O7ZA 3LXFA 4HEA1 4DAMA 2DBYA 1E7PB 4CDEC 4N9PA 2K8CA 3ZYYX 1EU3A 1K8OA 3AE7B 4G7ZC 4BBSB 1K83H 1DM0B 4RCOA 1YMHE 4LW1A 2Y5PA 4QIWB 1Q0WB 1EQQA 4FF3A 3KVFB 2CJOA 5GMVA 3HOWH 4PYZA 4KHZA 4WORA 3RULA 1VQHA 3BDCA 3S2HB 1AW7A 2I46A 3HFZB 4BBSH 1IYUA 1K3RA 1L4DB 4JI6Q 2GN5A 1D2BA 4K1RB 1NMFA 1TWFB 4A55A 3U58A 5E6PA 2XVSA 1ONLA 1SNQA 3S2HH 3KUZA 1BT0A 4BBRB 2IO0B 1ML0D 2XRSD 4K2KA 1HR0L 1WM2A 4LNKA 3HM6X 2UXDQ 3QK0A 3G6EA 1H9RA 4K3CA 4OL7A 3L0OA 5FLXc 3ENEA 1N34Q 1EFWA 2J0MA 1TWFH 4DN4M 5E7NA 5DM73 3M85A 4EQPA 1JMCA 3QARA 4AJYB 3P4PB 3MTSA 2WU5B 4HWIB 4K5VA 1JB3A 5JEAJ 3J81j 5CC4A 4K0KL 1HR0W 1C9OA 4BBRH 1WGYA 4A6QA 2PZWA 2F0SA 3CQZB 2WINB 1YIWA 2AUKA 1FRDA 4PS7A 4CHKA 2CR5A 1RL2A 4YWKA 2O6VA 1MGSA 4JI5L 4PYUA 4A3FG 2N55A 3OWFA 2EDGA 1E2VA 4DQOC 3A1QA 1PYWD 3PGZA 1CQFA 3NJTA 2OOBB 3OJ4B 1SE3A 1OGWA 4XE0A 4CKBA 2X8XX 2K75A 3EFUA 3SFEB 1C4PA 1SIJA 1C76A 4KZCA 3MHBA 2VH2A 2MJ8A 3IVFA 1VQ7A 4WWOA 3L7ZC 4OIJA 5IYBG 5J17A 1SYFA 4YTPB 2OXPA 2N0SB 2XRQD 4DK1A 2BKFA 2KQ4X 2L55A 3RYTA 4IURA 4K2LA 2MBBB 2KWDA 2PPHA 4DR2Q 4W9GA 5JVH3 1WYWB 1JE4A 1A62A 2GBKA 4CKEA 4DR7Q 4XC2A 3SK8A 4AS1A 2N49A 3HEJA 4JI8L 2EYFA 4B95A 1PH7A 4K81A 2LXKA 4QUFA 1JWBD 1LTTD 1TBEA 2IY0B 3PSEB 1Z7TA 3I90A 3KWVA 3T56B 3UQBA 4OWTB 1WGGA 1HRJA 1HQRD 2K4KA 2L52A 1A63A 5JZEB 2D3GA 1Q10A 1EUVB 3I72A 1LTSD 1VQ8A 1JWSD 1PTOB 3NQIA 3ZJUA 2CJNA 1PYSB 2J0JA 1RTNA 1N61A 1XNRL 2ZXOA 3QG1A 2MJ3A 1D1IA 1A2UA 2WYQA 2LASA 5CBEE 3I91A 4X65Q 1X54A 3CD6A 4QQBX 1MHHE 5LNK1 5C0XI 5JJZA 5GAGC 1GB1A 1WD1A 4TQUS 4A3BG 4I6PA 4DR4Q 3NY5A 3ZLZA 4WIPA 3BK2A 3PO2G 2V3SA 4LDTD 2HE7A 4LFAL 2MEKA 4W9LA 5BYSA 3Q14C 1QZGA 3AECB 1TWCB 2B29A 3VQIA 3TEZA 1P98A 3QOLA 3K7AB 1B2TA 4LK1C 4S0RA 3JAML 4P7IA 4OXPA 4A90A 4AYBE 2EMTA 1S1QB 4EFOA 1KDCA 2BGFA 4F8CB 1HZ9A 2PNHA 3P75A 3MTNB 1TT5B 4RM8A 2N7EA 5JHBA 1I6VC 4F8MA 3D31A 5DLQE 1FD7D 2KTRB 4HJKA 4YWMA 4O1NA 5BYRA 3IL8A 2B3AA 1MI0A 5FOBB 4ARIA 1FNUA 5C3EG 4DNRB 1CSQA 3MHZA 4TUUA 2VUMB 2KMMA 3UI3A 5G55A 4BS9A 2Z6KC 4A3EG 2N9PC 4XGAB 3VA5A 1IXRA 1QWYA 4HCEA 2PJHA 3O13A 1N8RC 3UDXA 1MHXA 2PMVA 4V190 4WJ3M 1WX9A 3VTWA 4AYBG 4DV3L 3F1ZA 1K8RB 3DBRB 2INCC 1OQQA 2K5DA 1WR6E 2I5MX 4QB4A 3RMHA 2VUMH 3RFZB 4RGMA 3JAMc 1HTLD 4QGUA 4K6DA 1CUKA 3E9IA 3PIP3 3GTGB 4JV5L 3DM3A 1LO5D 4IOCA 3SEBA 1NNXA 3I57A 2FXQA 2FUG1 4KD3A 5H92C 2PNRC 1XLPA 3RR5A 2IO1B 1CFMA 1Y1VG 1MG4A 3AI5A 4OZAA 3F2CA 1PRTC 2OQ0A 2WS3B 3DHIC 1JOOA 1V80A 1JB7A 2JZPA 2G45B 1KAWA 2MUYA 3TP5A 5CTRC 3SU8X 3A0JA 2HTME 5KIXA 4JI7L 2QCZA 4BBNF 2E2HB 2EQSA 3NOBA 4DK5A 2RQXA 2UUCQ 1F2YA 3NWSA 3AU5A 4XIGS 4FNFA 1E3PA 4HN7A 3K5NA 2JZZA 2GBRA 3U50C 4X3TA 1ZDVA 2SAKA 1SE8A 2UXCQ 1STHA 3CKIB 1VQ9A 2E2HH 2N4FA 2ZW1A 4OVZA 2JE6I 3IXSA 1BCPC 1FM0D 3I7FA 2A8VA 3HOXG 1TS4A 2LHDA 4OZBA 2E5LQ 3PS6A 2QJLA 3N52A 4EQ5A 4A3GG 2GBJA 3HG9A 2QKIC 2KHWB 3ECIA 3MC8A 4GDLA 5FKAC 3I70A 1SNDA 2Z6KA 1PQSA 4TKOB 1JWAD 1IBXA 2L4NA 4A9AA 3H9DA 4BOZB 2TSSA 1NAPA 3ULLA 4X64Q 4JI5Q 3NRZA 3WAMA 3A54A 4M01A 4LF5L 1OQRA 5I6WA 2KWUB 3CCMA 3IFWB 3TBLD 4B3RQ 4ANUA 4A76A 1ZXIA 2VQEL 1ENCA 1S5CD 3S2DB 1DZ1A 3AEGB 2K5WA 3PSIA 3DHGC 4TV3A 3HOZB 2EVBA 2EYMA 2R92B 1E2WA 2RPQA 1QCBD 2RCFA 4JI1L 1VCIA 2A6HC 2FE8A 4A3MG 1JORA 2F0NA 3VR4A 1WWTA 5TR5A 5GAHC 2EY2A 2PQEA 5C4HA 2WXHA 1WMHA 1AE3A 3S2DH 3W5VB 4D2KA 4OGQC 1IHZA 4B3MQ 1O78A 1EWIA 3HOVG 3CC2A 3HOZH 2G1EA 4ANWA 5KYIA 2JEBI 1FYCA 1BKBA 2UU9L 3EUB2 1EY4A 2BBCA 4A8XC 2R93G 1N36Q 2IHEA 3WAPA 1E22A 3C8YA 3QIJA 4IUMB 2QDFA 1RLFA 1WTHA 3VYSA 3E6ZX 2LJ5A 3DVGX 3R2IA 5ELDA 1KM7A 4JIOU 2M00A 1BDOA 2C60A 5HFYA 3SK4A 1IBLL 1QOGA 1ZPSA 1G6ZA 3EA6A 4DAVA 3BDLA 1HXYD 2F0QA 4HDOA 4OO1G 2OTJA 2RD0A 1L0YB 5T8IA 1KAAA 3X3MA 3KLRA 4US8A 1DONA 2JK8A 2UXBQ 1XMQL 5IIFA 2LFIA 5G5HA 2KC2A 1WTVA 4OIKA 2J42A 1IKLA 1GXDC 3TMPB 4RCNA 4TQ0A 3VH4B 1BR9A 4X3KA 2PW7A 1K50A 2KTFA 4XX5A 4HKZE 4BY1B 3N6RA 3AE1B 4HRSA 5D7GA 3IAM1 4V0BA 3NEMA 2NZHA 2WAQB 2K14A 1KABA 1SXTA 4KY7A 1L4ZB 2L32A 2M19A 3I4NG 2KDIA 2M4NA 3Q3NC 4WH4A 3ZJTA 4EOYA 4ALPA 3B6YA 2Q2HA 4FADA 3PF5A 1NBWA 4K6LA 4JVZA 3HGBA 2O5JC 1D7QA 1VLBA 4HPLB 4GLVB 4OX9L 2KT7A 4ANXA 4BY1H 1E8WA 3SGIA 1Q90A 1U9RA 2RVLA 1XLQA 3IFDA 4RG1A 4DDID 2JQOA 3CCVA 3OYYA 1R4NB 1B3AA 1CKNA 1EYAA 4DA2A 3FMCA 5D65A 2XNAC 3EBEA 3WDNA 4HLEA 2BS3B 1SMYC 5JJLA 3HOUB 4LWCA 2SNSA 2KMAA 1Y1WG 1SNOA 2JSOA 2L0FA 3QJZA 5IA7A 2D3AA 2PQAA 2F0GA 3DMUA 1TWAB 5E4WC 1SIFA 3TP7A 4BA1I 4XDDA 3DLLA 3MA2B 1KJTA 3R7QA 4C7ZA 4A3CH 5CV7A 3MXUA 3ZNHB 4TVAB 2C7HA 5FR3A 5IGFA 1I6HB 3RCZA 2QF7A 1DOXA 4N8X1 4JI3Q 3HOUH 5D3IB 2ZW0A 1UUPA 2B2UC 3A4SC 4DV3Q 2E2DC 3KJPA 4ARCA 3E9HA 4DV4Q 2E6XA 2OT2A 2QEXA 4YTNB 4DHJD 2F4VQ 2DJFC 4MN3A 1I6HH 4C1NK 4MDKE 4JBKA 4JI0L 1PMRA 3DWMA 4KGSA 5ELEA 4DR5L 1C77A 4HCNB 4GOPC 1WZ3A 3TREA 2FUHB 1LM8B 3VUXA 2JJQA 4DU9A 1UAPA 2UYZB 2NVUI 2ZNVC 4KI0A 4LFCL 1AZPA 2M1MA 4L8JA 1I94Q 1GUTA 1J19A 4NAWB 1FEHA 5IP9G 2DN8A 3OIPA 3TEWA 2D0PA 4DV7L 2KDFB 1EYGA 3ML8A 4OVVA 4YT0B 1I4PA 3M4PA 3TMEA 2ZM6Q 1QKZA 3FDTA 2V4LA 4PMBA 2QCPX 1EU4A 1WCMB 3H7PA 4GKKL 1EWCA 4JC0A 1GO3E 1SLJA 1EQTA 1VQGA 3MEHA 2JA9A 4CQNA 3I4OA 3LDZE 2AWOA 4A20A 5JVG3 1JJ2A 4BOSC 1V1PA 3WWVA 5M9OA 2HJ8A 3G7LA 1V8QA 2SDFA 1WCMH 1LTID 3NTIA 1GUAB 3CAMA 1Q1OA 2WXQA 5LMUL 3TL5A 4HVBA 5IN7A 2FFKB 5JOBA 1ZW7A 1X3GA 3CMEA 2N7DA 2N3SA 4IG7B 1E1TA 2Z6BA 1PTOD 2F0JA 3OTOQ 3DQVA 4K14A 4X57B 4XZ4A 5IAAC 4F7ZA 1G291 3A7AB 3EROA 1TU2B 2PEAA 4LF5Q 2CH4A 1UF0A 3CW2C 3KBXA 4X6AH 2I1JA 1I3QB 2MQJA 2WXIA 2VQEQ 3JW0X 2NVXB 1I50B 4GOPA 4FJZA 1NR2A 4WJPA 3J7YW 2RMMA 1JRUA 1J7CA 4C3IG 3ZNGC 3A8JE 2PCFB 1IP9A 1ESRA 1STYA 1G2SA 2DGYA 1EZ8A 4C3HG 3DPDA 3BVZA 4WJWA 4A3EB 3QHTA 1VQJA 1VF7A 2WXJA 4DGZA 3L9AX 1N62A 3P1MA 4B0MA 2NVXH 2V4DA 4PT5A 1S5ED 2REXA 3GTKB 1WIAA 4JYAL 5C5LA 5M5WB 2MJEA 2EELA 3RNAC 4XWWA 3HM3A 2BWFA 3NVWA 3Q0AA 1RAXA 2VRRB 2K5PA 1PH1A 5C0XH 1KL9A 1JCKB 3NK9A 1WTOA 4DV6Q 4OEMB 2OJRA 4DHZB 3RI7C 3GTKH 1EY0A 2KBNA 1SDFA 5A35A 1NJIC 3DCGA 4ME3A 2A69C 2HTHA 1KQSA 1ACCA 1WR1A 2MCNB 3PPAA 4HK2A 1PH5A 1VQAA 4GLSC 1KLGD 1DOIA 2NS5A 1PLFA 1LACA 4KKIA 1LXDA 4JL9A 5IYCH 3U30A 2BDNA 3PUWA 1F0ZA 4WRDA 3BVMA 3ONAB 3IBEA 3R66C 4WQOB 4HIDA 1SN8A 3PLVA 3I8ZA 4Z9CB 4AH6A 3CMAA 1T0YA 2H88B 1MSGA 4J3OD 2JYOA 4AQ7A 1Q7YC 1X6OA 3KLWA 3A5ZB 4WFN3 5CHWA 3VUYA 3LJ3A 3UE0A 4BKSD 1FJGQ 4GKJQ 2BCOA 1EYDA 4PZ6A 2WFWA 2WXNA 5G2NA 1H4RA 4NXNL 2FAZA 4LF8Q 2K1FA 4ZCKA 3J7A5 1PGBA 4GSWA 4WAFA 4HIOA 1HH2P 3FAHA 3GDEA 2KECA 2V3PA 1SRUA 1X3FA 4TKNA 2G5DA 4DNIA 2A19A 1X55A 4KGRA 3CF5A 2LWPA 2KUMA 2A6ED 1V9JA 4BZAA 4F88A 4IUQA 4GS3A 5CV6A 3WAOA 2MBOA 3G48A 2FIFA 2LGYA 1L0XB 2MFIA 4IJHA 4NKLA 5EBCA 2L05A 3DDCB 2RHQB 2BQQA 2LUEA 2V4IB 3VRBB 4Y7NB 4QAYA 4L23A 3M4OB 3V60A 1LYLA 1YN5A 2IO2B 2JEAI 2K0PA 3T13A 1R4MB 4W9HA 5I9PA 1X1MA 5EKLA 2V3NA 3I3TB 4BXXH 4H2AA 4Q2JA 3URYA 4H0LC 1Y8OB 2QDBA 5EQ0A 1YN3A 3TP8A 4JI0Q 2HQLA 1L1OB 4Y7NH 3J80E 2NZOA 3M4OH 4HMIA 2I1KA 3PGEA 4MEMA 2JA8B 2DAFA 1LGRA 1UEBA 3AFQA 2L0TA 3NZSA 4QF4A 4ZRKA 1B1ZA 4CDFC 1WXAA 1HA5A 1WVLA 4A3DH 3RNBC 4FLHA 5L83A 5DPTA 1KLUD 4TQ1A 1TR5A 3PO3G 4LDTB 4DR3Q 1LTAD 3ERQA 4APVA 3KYHC 4JI6L 3T16A 4MHEA 2JA8H 3CPFA 1Q3LA 5C3XA 4RF1A 1E9MA 3NS8A 4FHJA 1OXTA 1WGDA 1JC7A 1JWMD 1WXSA 2NTSA 2NZ1D 2K6QA 4MJSB 2G9HD 1I4HA 1QVFA 3A8KE 2QILA 1VQIA 3S2AA 2UXDL 4XDCA 2JYTA 2R7ZG 4P1BC 1RD9D 1N34L 3DBRI 1KC8C 3L13A 1KNAA 3I4NB 5E4XA 4FYDA 2DYBA 3L10B 1U5KA 1SSNA 1ZXHA 3T9LA 1P0RA 2KTRA 2LD9A 4U68A 1YIJA 4B3TQ 3RN9C 3M7NA 3AMUA 1K53A 2E74C 2EMSA 2K25A 2LXAA 1I42A 4WURA 4B9XA 2ZXPA 3PUZA 3R93A 3PF4A 1QQRA 1XPUA 3BYTB 1NMGA 1QF6A 5ISRA 1RFKA 2O4XA 3GE8C 2K3UA 1MD2D 3ZDMC 1WJ6A 5M5YH 2VS1A 1UD7A 4AP4C 1S72A 2ZJPA 2LY7A 4II3B 3TZDA 1PDQA 1HTQA 3D4DA 1PH8A 1JR0D 4M00A 5BMHA 3RZDB 3MC0B 3S1MB 2BT6A 5CX3A 3GO5A 3NQTA 2D62A 3A8IE 2UUAL 1F2MA 1VMCA 4DR2L 4GDKB 3IT4B 1WD0A 3EFCA 2XIWA 4DR7L 4US9A 2MHVA 1D6EC 1JQYD 3FKIG 4TMAB 1F52A 3HK0A 1HQMC 4KIKB 3MEFA 3Q8EA 3VDZA 3HOYG 1ZP0B 4JWSC 2AWNA 3S1MH 2KN4A 5KHQA 5CBAE 4HTHA 3ZRCA 3VR9B 1RYJA 2GBMA 2DX5B 2QIEB 2INPE 2F0VA 5J1ZA 2PW5A 4BVUC 1UEAB 2LGSA 3DBSA 1A3UA 2Z0DB 1ZE3D 1V97A 1B8AA 4AQYQ 1PUTA 2PIAA 3MP9A 1E0BA 5AJ3Q 1EL0A 2MA9B 2WXPA 1VQLA 4M0WA 4E3CA 1E2ZA 4B3SQ 2NN6G 1WJJA 4ABNA 1VDZA 2L3ZA 4JLCA 1TY2A 3ABVB 4YWGG 4W9IA 3H0GB 2QSDA 4HDQA 1NI2A 4CHTB 4X65L 4GNXB 2IGDA 3P7JA 4H7BA 2IJ0A 1XCTL 1YJIA 1IL8A 4DR4L 2PMZE 2ASBA 3AULA 3HKZB 3U7DA 3AQQA 3ZO5B 2Y0SB 3H0GH 2RSNA 4NXNQ 1PGAA 4JOIC 4IM3A 3FPPA 3TBIB 4MGIE 2O2VB 3RNGC 5CV4A 1T0SC 2C9WB 4GIVA 2E3TA 4RKBA 1MBYA 3BWUD 2Z1CA 4OWWB 2GI9A 1JOKA 3A74A 1TZOA 4ZAIA 1L7YA 3K0YA 5T1IA 1CKOA 3J7AF 3RUZA 3BIID 4R9WA 2WWZA 3PZ8A 3ZGZA 3C19A 1PH6A 4ILWA 1H9JA 1JW9D 4KX6B 3U7ZA 1WY8A 3PQIA 2M2LA 4C3IB 2Q5WD 4G7OC 4IJLA 1FPYA 1NI3A 2NTTA 2C7MB 3BY4B 4X3SA 3EJIA 1X9NA 5BN4A 1UH6A 2MW5A 5JHAA 2JP1A 4DUYQ 4K5WA 1G6PA 4CYEA 4QJFA 3GTLB 4MGZE 5IYDG 4ZRPA 5J2RA 3IHPC 1YNXA 5FO9B 2Q8TA 3VR3A 5BN5A 3PO0A 4GU2A 4K5XA 2F0WA 5FLXL 1PV4A 3A9KB 4ACFA 4YSZB 4FULA 5IOCA 3ND8A 2N8NA 3P4QB 4XT3B 1GJXA 3ZNID 1QVCA 1V86A 3GTLH 1R4NI 1SE9A 2Y5BB 4IWOA 3TIXA 2KX3A 2ACZB 2Q2IA 4UY8C 4HJAA 1JE5A 4CGYB 2M0AA 3U4EG 2UUCL 1JRPA 5M3FB 2DWQA 4JOIA 1T0RC 1FVIA 1NUCA 3GTJB 2AL3A 2K5VA 3RZWC 1U0LA 4H44C 5C4XB 2C9OA 2B63B 3A55A 1V8CA 1TIFA 2MX2A 2KCTA 2UXCL 3PMFA 3APFA 5J39A 4YHHQ 3CRKC 2GVAA 4DF7A 1GAQB 1UWXA 1AN8A 5M3FH 1K8GA 1IGDA 2SEBD 1WJNA 3H1UA 1SGHA 2VW9A 3ZVVA 4JI4L 3PHXB 3RLNA 2KA7A 4EQOA 4OELB 2E5LL 2E2IB 1XNQQ 5C4XH 2B63H 3ER0A 2A1AA 3UQAA 5IGDA 5GQOA 2NVQB 1JWUD 4YTMB 4N8FA 1U4LA 4HSPA 3J7ZC 1T6BX 3LNNA 4A75A 4O0AA 1HFNA 2JWUA 2MRPA 5C4JB 4X64L 3U8ZA 2B76B 5E6OA 4DV0Q 3M95A 4RM9A 3NP8A 5LL6S 1FCCC 3ZXRA 4DHJB 4B3RL 2CW0D 1KLVA 3WALA 3Q22A 1TKEA 2OF1A 1A5RA 4NXMQ 3CQZH 2NVQH 4ODGA 1C3TA 3HP3A 1XD3B 5C4JH 3Q6SA 2D5GA 4URKA 3BYYB 5JEAH 4A3LG 5C4ZA 1H8CA 2N1VA 4KVGB 3B2GA 1ZUD2 4YWLA 3OMGA 4B3ML 1D4BA 2B2WC 2MBEA 2UUAQ 1E8YA 3H8HA 4NAWA 1T3QA 3TJPA 3J81i 2WXGA 1SBBB 2N78A 5FO7B 3CCRA 4GN3B 1N36L 2WLBA 1Z6HA 2YVCA 5JAVA 1JJCB 5DPRA 3QC8B 3ZXVA 2KDBA 3OHXC 2B2VA 3UDFA 1VJKA 1EF5A 2MNAA 2JUOA 1KDBA 2LRUA 3T1HQ 4AWJA 2PPBC 4IPGA 3ZJYC 4X62Q 2DY8A 3QAQA 3PO3B 2LMCA 1X3EA 3CCLA 2F3IA 2KEDA 2KOLA 3RZOB 1NY4A 2L12A 3I73A 2RDBC 4ZQ3A 4IW0A 2UXBL 4W9EA 3RNCC 4Y52H 2Q8RE 3CCEA 5LXIB 2Z0EB 2HHHQ 4KHPQ 1GHJA 1DOMA 1XPOA 1GM5A 5IP7H 3ZKJC 1B44D 1BO0A 1E10A 1AFPA 2JA5B 1AARA 2D5DA 1SSOA 5IO9A 3KDFB 3RZOH 2HD3A 3VYUA 2BTEA 4S3SA 4KY6A 2L0CA 2KACA 3AEFB 1RJTA 4PMCA 1YJ1A 3VYTA 3RNFC 1B9MA 1PTOH 2F0MA 1JT8A 3GOEA 4JPBW 3B2FA 4F7XA 1PTOF 1C9FA 2LXCA 2BA0A 5C44B 4YL8A 2JA5H 1MJEA 3GB1A 4DV2Q 1E1OA 4XQJA 1MVKA 3P42A 2EYHA 4FXGC 1TT2A 2WDTB 4EKUA 3OLMD 2B2WA 4LMQD 1XMOL 3PV0A 3A56A 5EE3A 1PYBA 2M0XA 2BWES 1GUOA 4XDXA 5C44H 4MT5A 2K6DB 2PI2A 1TWCH 1E90A 2ZJRA 1HUNA 2WGSA 2N9EB 3K7AH 3KYDD 4LUVA 1JALA 4MIUA 5C6AA 2WDRB 4PZ7A 4JI3L 3PRMB 4DXFA 3I9V1 3AE3B 1WF9A 1R9TB 4UP9A 4GMVA 1TS2A 2SNMA 4XQNA 1FNVA 1BOSA 3M3YB 3K57A 4DV4L 1IUEA 3V3XA 1EY9A 1SYCA 5KNCA 2BVCA 2LGIA 2PYKA 2F4VL 1S3SG 2DLBA 4F87A 1HPCA 3P1HA 2RDHA 2HQEA 4W9CA 4DPGA 4IM2A 4XYQA 2EYJA 3HOYB 1UGJA 4IPCA 3A5UA 3M3YH 1L1OC 1I94L 1IYFA 3J80L 4GLXA 2IL8A 3C46A 3NENA 4EUTA 3R3OA 3TS0A 5M3MB 2DZJA 3MXPA 4LLGM 2D2CC 1F77A 2WDQB 4IZ8A 3OMCA 3GTGH 2F0HA 5K5PA 5C0XG 2ZM6L 1W2BA 4ZRJA 3DWPA 2RHSB 2ZCBA 2WB1E 3NVVA 2YYZA 1AZQA 5LL6X 3SR6A 2PVOD 3CSFA 4XWTA 3G6JB 1TS5A 5M3MH 1VQEA 4FXDA 1N32L 3KUCB 3FRPB 3NVZA 2BE5D 3QA8A 2INNE 1G8ZD 1ESFA 1F9RA 1KH0A 1R4MI 2N9XA 1W6JA 1S5FD 2CWPA 5FJ8H 1J7AA 4JI4Q 1ZOYB 2RDFA 1YX6B 2YV5A 3VXWA 4A3KB 3VR8B 3I3CA 4CKCA 2F0LA 3J80c 1IKMA 1VZ7A 1KXLA 2I5LX 1N9WA 4DFAA 1SF0A 4IFDG 1YNTE 3AEEB 1PFSA 4AUQC 2WB1G 1X3QA 4HMJA 1SROA 3OTOL 2VY3A 4G4KA 3GS2A 3F2BA 5D14A 1EIYB 1YEZA 2KLGA 3VVWB 4A3KH 2ZTCA 1CJEA 3DVNV 3I4MB 4OO1I 3CCQA 3EECA 3V62A 4KHVA 2K22A 1Q1BA 1JICA 1V1OA 4CJ1B 1VZ6A 2L76A 3ALBA 3W1SC 1L1OA 3A9JB 3GP7A 2H5XA 4MH0E 4G3XB 2V9HA 4POGA 1RWSA 3E56A 2XWBB 3PUXA 3I4MH 3T3OA 1G91A 3BG3A 3NTKA 2R92H 1HZ5A 3FHWA 1YHBA 4IOAA 5NUCA 1II3A 1BQQT 2V1CC 2XTIA 4IPDA 2BS4B 2EJMA 2K03A 4DK0A 1CMXB 4K7SA 1XXGA 2AHOB 4I7AA 3P2BA 5IGGA 2WDVB 3T51B 5ELFA 4LJZC 1PH9A 2R3ZA 1GOZA 4H02A 1GPXA 1D8LA 4MJSA 2CQAA 1CTMA 4DV6L 3RUIB 1EIFA 2QMTA 1OEYJ 1TKWB 1SMYD 5KGUA 3V61A 5F2DA 2BS2B 2NBFA 3SXHA 2EYLA 1F9SA 2A68C 1QVGA 2KHJA 2NVTB 5AZGA 4I7ZC 5C1ZA 2FJ2A 1NVID 3SD5A 4GN5A 2X6GA 4C4VB 2HT1A 3EGRA 1CHQD 1HNXQ 2JA6G 4CJ0B 3S16B 4P16A 3AV8A 4GXBA 2DHZA 4FA6A 2WXLA 3S1RB 5I6YA 2VNUD 3O65B 2JA7G 1HTOA 3C1EA 1HUMA 3UE1A 1EY6A 5FLMG 2NVTH 1RFAA 3FILB 3UINB 4LFBQ 5IT9E 5EBDA 3OIQA 1TKYA 3D32A 2KQSA 2PW9A 2W3SA 3UIPB 3CMMB 1FJGL 4GKJL 2MJDA 1LT3D 4GNXC 3EIVA 2LGDA 3S16H 3MFGA 2VL6A 4IUTA 2E76C 3W1SA 4U673 3CHBD 4LF8L 3MXNB 3S1RH 3PCOB 1DYQA 4EX5A 3S1QB 1KOTA 2F0OA 2WACA 4WJ4A 3BDOA 2AYOB 3AEAB 3ETRA 2F52A 5AUIA 2NUCA 5E1FA 3QOJA 4YIJA 1NE3A 4A3FB 2JWZA 1XMOQ 2EY5A 3U9OA 2MO1A 1F1HA 1XT9B 1E8XA 2FNJB 2UUBQ 3K80C 2G4SA 3Q24A 4BKTA 1A70A 4GDKA 4KDIC 2I2YA 4UPAA 2JSVX 4O42A 2KWCA 2JXMB 1STNA 1J9OA 3EVQA 5IGBA 3H94A 5HI1A 1PZJD 4A3PA 4PK1A 1TYGB 1YNND 2W54A 3W3AA 2LSSA 4A3FH 3PIPA 4KIKA 3NE5B 3K81C 5TSSA 4ZHPA 2CQOA 4A3IG 4NW2A 5BR8Q 2RGFA 2WX0A 1TWAH 2KQ3A 3AMZA 5GROA 4ZOHC 1EM7A 1U4RA 2V0GA 1EF1A 5L95C 1NBFC 1ILQA 1WE6A 4EEWA 1ROEA 2E2JB 3V6CB 3X0WA 3S9WA 1N33Q 4JBWA 4J6IA 4II2B 1TVXA 3MFYA 3UF8A 2A4ZA 4R3DA 1B9NA 2B3GA 2BOSA 2R7DA 4JG2A 5IYBH 3H7SA 3LYYA 3OWEB 1YJNA 1TWGB 1S40A 2ZTDA 1DXMA 1P9DU 3ONSA 4KDLB 4KKUA 1B3QA 5C2TB 1Q86C 4KV2A 3T1YQ 2E2JH 2DZKA 3N3KB 2AKWB 3TEXA 3VH3B 1SFOB 3A1QB 4DR3L 1AEXA 4GNXA 3IT6B 3B0AA 3K9OB 4J1MA 2X6LA 1TWGH 3M63B 4F1SA 2WP8J 2CHWA 4JK1C 3BJUA 2QHOA 3PZ7A 1M8AA 4BWGB 5IGEA 4ASWC 1N32Q 3MJWA 3U4ZA 4N6EB 3D4RA 2RSUA 2O2VA 4WJNA 2ZT9C 1Q8KA 1BBXC 4KMUC 2WKCA 2HDMA 4NNJB 3V96A 4DWFA 4R8NA 1HZAA 4C3JG 2FCMA 1ZKHA 3DBHB 1VDVA 4A3BB 4KV6A 1AE2A 3PO2B 2A5UA 4B3TL 1EY5A 4B08A 3VR6A 1CZPA 3Q2AC 1HTPA 2ZPYA 4UP8A 1IBMQ 4KSKC 1YNJD 3M4YA 4DXGA 2AUJD 4A3BH 4FN2A 1EWHA 4AIMA 3PO2H 4A93G 1DOYA 1BXTA 1QOHA 1P7FA 1XQQA 3WOFA 2ENBA 1M94A 5C3EB 2NCNA 2K8HA 3UGBB 1J7BA 4NMZA 3A9KA 1X65A 2I5HA 3JAMi 1I3QH 4JE3B 1D5ZC 4A3JG 1SYGA 2MHJA 3LGJA 4AYBB 1I50H 3QJYA 3L0WB 5C3EH 4FF4A 4BY7G 4GZYC 1MJDA 2Y3AA 4YY3Q 4C00A 2WX1A 3L3OC 5J22A 1WOCA 4A3EH 1EQVA 3U2SC 2BA1A 1EO6A 4ZHOA 2VB2X 5H8YE 4C1NI 1Y1VB 1BUIC 1AH9A 3UDIA 4K8JA 3ZDTA 3CC7A 1XYIA 2L15A 5E3FA 1XO3A 3DBLB 1NYQA 2HIVA 1IL2A 4FJYA 5M5WH 4DV5Q 1YJ9A 1VQNA 4ULLA 3HOWG 2N9LA 4NZLB 4DNTB 2RR9A 4AQYL 1GUGA 5FR6A 5AJ3L 4YXDB 2OQKA 1DGJA 2YLMA 1Y1VH 1V5TA 4B3SL 1T0QC 3CC4A 3W5UB 3ZIMA 2IO3B 4PS8A 4BBSG 2DZIA 4DR1Q 2XEWA 2FIDA 3WA0A 4L5RC 2H89B 1CQVA 2J52A 2EYPA 2J4XA 2XSCA 1VQMA 1PTOC 1OQYA 5AEKB 4IFDJ 4C7YA 2K5QA 3KF8B 4ZYSA 1VQDA 1Q1EA 4LJPB 1E5WA 2EJFC 2EY1A 5HHDG 3W9CB 4CDCC 2HDLA 3SR1A 1OTCA 3HOXB 1WE7A 1C4QA 4C2MB 1K0SA 2M56B 4A3GB 2R2QA 4WAAA 1WI5A 3BZDB 2XK5B 3FKYA 1PXUA 5CYUA 4HIMA 3KBGA 3W1BA 3JYUA 1YZ6A 2VZKD 4EVOA 1LM0A 4BBRG 3AE9B 4JPSA 3A7LA 3HOXH 4W9JA 4X66Q 1B70B 3M7GA 1IZ6A 4A3GH 5DPWA 4FDBA 3C1FA 2BF8B 2IBIB 1MIUA 2D0OA 1DCZA 1G6JA 4S17A 2M8SA 5JJIA 3AN1A 3ZJVA 3MXGA 5AUKA 1SYDA 1UZXB 1SNCA 1CHPD 4A3MB 2WXRA 4REZA 4LF4Q 2RF4A 3IRBA 1PH2A 1K52A 1DGSA 3DWQA 4DUYL 1KFYB 2F0DA 4LNOA 5FK9C 2MP2B 4EZKA 3HOVB 5IGCA 3QQ8B 2IT1A 2ONQA 5JEAG 4HJ9A 3D8GA 1Y69U 4RF0A 3AU4A 1WXMA 2NR2A 4A3MH 2R93B 5EE9A 5LLIA 2W55A 2QA4A 2PE6B 3QWNA 5KRUA 1QUQB 4ZUJA 4BFRA 5EPJA 2XGTA 1RM6C 4BBNC 2F03A 1GJZA 1H95A 1S5BD 3STBD 3HOVH 3BVGA 1XPRA 2QW7A 3M9BA 4IN3A 1LFDA 2DAJA 1VD2A 1F2RI 4LK0M 2BYFA 2R93H 4KD4A 2EKIA 3KDFA 3MJ5A 1LTBD 1A3TA 2LVQA 2C5CA 2YU9B 2V1YA 2KX0A 1ZDXA 1BMLC 1B53A 2MWSB 3OOCA 4ZKCB 1GHKA 2JA6B 1MPEA 2B8GA 2Z4HA 3PT2B 5EE0A 3DVGY 4YHHL 3K9PB 3AU7A 4OO1H 2J7QB 4L1BA 4PMWA 3ZQ4A 2K7VA 1ZEQX 2YEPB 1GNUA 3IG3A 2A6EC 2BYEA 4WJQA 1UWVA 1XNQL 3GD7A 3ZW3A 1R4PB 1UE1A 2BB5A 4OZCA 1J0GA 1QILA 1K8MA 1KTKA 1NTGA 1WYDA 2KQ7A 3IAYA 4ZYNA 2OCEA 1C8CA 3U9SA 3LWUA 5LHY1 1HE8A 2JZ3B 2ZEQA 2YTVA 2CHXA 4HSVA 4DV0L 2KO3A 5C3JB 1P8LA 3I4NH 2G3QB 3HS0C 2MSED 2YEPF 2KMCA 4KTAA 1Y1WB 3QB3A 1QZHA 1SE4A 3TP6A 3NTHA 2KVZA 5DM63 2R7FA 3S24A 1YITA 4NXML 3AB9A 3NHHA 4BKGA 1K3BC 2PLPA 1ET6A 2W9NA 3AE2B 2MQHA 3GQBA 3MVVA 3KF6B 4QCLA 2F4IA 5IWAQ 2NN6I 3FEWX 1CI3M 4Q5VA 1UE6A 1WI0A 3BINA 2IYDB 4DAYB 1Y1WH 2KZRA 3NXWA 1HEZE 1WYGA 1WJUA 3P4SB 1U4AA 4N59A 4DKAC 3S15B 4L5QA 4HJ7A 1DJRD 3BZKA 4X3UA 4B9WA 2FINB 3S14B 4HPPA 2A74C 1HCZA 1NCVA 1VQ5A 2OHFA 4WWPA 3QX1A 4KKTA 3S17B 1PFDA 4BKSA 1NSNS 4UHVA 1IBKQ 4RHRA 2N88A 2D3CA 3NUCA 3RZDH 5GADC 1HNZQ 3D6WA 1L0WA 1NEKB 3S15H 3F8TA 1LABA 2VUMG 3VR5A 3S14H 3T1HL 2BKRB 2HCIA 3U52E 3K5MA 1IGCA 4X62L 3S17H 4RH6A 3Q3MC 3PREA 2QDLA 2OEOA 4PG3A 1YI2A 3I4LA 1A6XA 1TGZB 4I6LB 1FGUA 5FO8B 1NR4A 3F2UA 3L2PA 3W1GA 3AE5B 4E74A 2HHHL 3TDQA 5JXVA 4KHPL 1CZWA 2F1MA 1HA6A 3NZUA 2F0FA 4QY7A 5IP9H 3CCUA 1K51A 2N9KA 1FGBD 4W9DA 4NJ6A 1A0IA 1A8VA 2D9UA 1XTDA 2JF5A 1QZEA 2GMIC 1VQOA 2KJXA 2JRHA 5CMDA 2O6VD 4C3JB 1WTQA 1L6UA 1PDXA 1ZYRC 3Q3OC 5IOIA 2MBHA 3X23A 2XWJB 4PQXA 2Q2TA 2RA4A 4DDGD 3M3JA 3G4SA 2AWTA 4DV1Q 4K7WA 5D94A 1P1AA 1ET9A 4DV2L 1F9JA 2KN5A 3L16A 1P3QU 4W9KA 1FO4A 1VQPA 1XLOA 1Q5WB 1O7IA 4FVMA 1FRRA 4B0EA 4R1JA 2HJ1A 3A9JA 1QG7A 3CIRB 4TSSA 4HIKA 3DM1A 5JPMC 3RPFC 5G5GA 2KD0A 3DHHC 1P7EA 1SE2A 2LXJA 3KW5B 1SB3C 2DENB 3KLSX 1LTRD 1VMPA 3DUZA 1S3OA 3KLSA 3RLFA 4CBVA 4J8QA 4C3HB 3PRPB 1IYJB 3SFDB 3FPUB 5IT9c 1V1PB 4LCDE 3KFUA 2DNEA 2KCNA 5KNDA 2K50A 1V6EA 1HFGA 2EYOA 1YQ4B 4BY7B 2JX5A 4XXEA 1J5EQ 1C0AA 1JQ4A 4C3IH 2BYVE 3IFTA 5KEEA 3GV3A 3L4PA 2ZTEA 4C3HH 1QOAA 1Q8IA 4RHSA 3HOZG 1KNEA 2FMMA 1Y56A 2WIIB 2R92G 2DYMA 3NBHB 3CWIA 4C4VA 4QUCA 1HHVA 3H3VI 1G51A 1S5DD 5I2YA 2GOWA 2Z8LA 1B9RA 2KFKB 3FILA 5I9OA 3VDYA 1N5XA 4NPSA 1K8AC 2IGHA 1VQ6A 5K36H 4GOPB 3N32A 3H15A 4WJOA 5HKHA 2KC1A 3GTOB 2ZNVB 4TRDA 2B2VC 4RKLA 3N9YC 3MXNA 3TSSA 1IW7C 2HCCA 3FP9A 2L11A 2Z9HA 1OFFA 2DNCA 5C23A 2OJWA 2WAQE 1M90C 4KJOA 2JQRB 3M4QA 1F2ZA 3GTJH 1LT5D 3GTOH 1MFWA 1EUJA 3Q8BA 2PVGC 1MHWC 2UU7A 4C80A 4L2YA 1KIXA 2IDYA 4ICUA 3EQLC 2CU3A 1CKMA 2CU1A 1PFMA 3L17A 1STEA 1V5OA 4LNFA 3NZ3A 3V6EB 1O80A 1XTCD 4BY1G 2KAJA 4R4OA 2E2IH 4LNNA 4ZK9B 2BB6A 4GLAC 2WAQG 2CS4A 5DCNA 2ASQA 4XQQA 1FXIA 1XWEA 2DNFA 4MM3B 1F2LA 4MELA 1SJED 2BDOA 2KXJA 2LZ6A 3I63C 2FBWB 5MPOA 3CU7A 5KHOA 3HZXA 1VZ8A 1D5MC 3L54A 3A33B 1H9SB 2DUDA 4A3CG 4FJVB 2C35B 4DUZQ 2WP9B 2K32A 4LNIA 1HZ6A 3DBHI 2KEEA 3HOUG 1C79A 5J3BA 4GN1A 3KWLA 1I5FA 1L2FA 1L2NA 3AM9A 1KRTA 1U4PA 2AQ1B 2KJ6A 4JBMA 1JJGA 1BBUA 4YCUA 5AFWA 2ZVOA 2BH2A 4R4CA 2JU6X 4NB3A 2CH4W 4NQKE 4GOCA 1I4XA 2ALYB 1YHAA 3K59A 4KN4C 2JN4A 2CWAA 3NBIA 2X38A 5IODA 4HCSA 4HJ8A 1UBIA 1RHPA 2B2YC 4IQZA 4PZ8A 4LF9Q 5HG2A 1QB5D 3UI2A 4MGYE 1H9MA 4LF6Q 1OXUA 1HNXL 4XYCA 3PZDA 2RCNA 3JVZX 5ELCA 4NY0A 1IPGA 3G71A 2KENA 3E0JA 4IWPA 3PO3H 3AYHB 1L0VB 2EJGC 1MKHA 1WFQA 2GB1A 3HUIA 4MSQB 2R7ZB 2D11A 4LFBL 1C48A 1UGMA 3HVDA 3MAQA 1TQOA 3K0XA 2EY6A 1LUZA 4MACA 2D3BA 3C2PA 2CW0C 4K3BA 1E24A 1EFID 4RGNA 1ICWA 1QNKA 4N9TA 4NPNA 1QLBB 3NUHB 3APDA 3P20A 3CXCA 2G9DA 5D3DA 1WRDB 1J6QA 2EIFA 5CGKA 2R7ZH 1Z9FA 1WCMG 3QCAA 2K04A 1WXVA 1Z2MA 2MPMA 1SMXA 4P72A 1WH3A 4WWNA 5LXHA 2L1BA 1PRTD 2NYZD 3CSTA 3M62B 4ZDVA 3DBLI 4EE2A 4NDXA 5CHVC 2UUBL 1FIQA 4IDIA 4FP5D 3QIAA 1FFUA 2DYOA 3QWZB 4DK3C 2PZUA 1VQKA 4JWUC 2HIXA 1C4CA 1ICFB 1W6KA 2KLCA 3T8MA 4KK7A 3DEPA 1N60A 1SAPA 2KKCA 4FF1A 1U4MA 3HVZA 5BR8L 4FXCA 5A2QE 1TIID 1JROA 5I2XA 4KN7C 2QC8A 5EAYA 3J81E 2KFJA 1KRSA 2VB3X 5JPNC 1WTWA 4DR6Q 2PI2E 3TCAA 3ZUNA 4L5TA 3AFPA 5IE8A 3PUYA 3ULPA 1BCPD 4G57A 4HAEA 2B2YA 3T53B 4K8IA 3W2DA 1N33L 2LJIA 2MLBA 3WIMA 3E0EA 2VQFQ 3IKJA 2J0KA 5EPLA 1GC6A 3FKIB 1S4ZA 3HRZC 3ITPA 3LWEA 3ZRFA 2K28A 3NSWA 1R9TH 2AMCB 4BA2I 3N1YC 4IFDI 2TMPA 1ISNA 1TY0A 5J18A 1PFNA 3ND9A 1WTPA 3T1YL 5D6JB 4DHZE 2MBQA 4HJGE 2IX3A 1AP0A 3FKIH 2JPHA 1GG3A 3HIZA 3KF8A 2LRWA 1PA6A 4DBGA 4YSXB 2KHSA 4R4TA 3HOYH 5I4DA 1OXXK 4QL5A 3TN2A 3NHEB 4B6WA 4HROA 3GV6A 2J53A 2LVPA 3VHTC 4OONA 5DEHA 2A6HD 3TQYA 2CKHB 2VZKB 1FCLA 4CDDC 1DOKA 4QMGA 3AH7A 2XK5A 4IUPA 2K9XA 3NWTA 3EN2A 4XYOA 1ILPA 5IYCG 2ICEC 5KNBA 3GZNI 3VAWA 1NYRA 1WRIA 4GB9A 5H1SE 2KJHB 5G3LD 1ENAA 2NN6H 4RA8A 1EEID 2MP1A 4M02A 1GKHA 1SJHD 3BZCA 3K8AA 3R8BA 1GB4A 5GAEC 1ZXTA 3U4VA 1IBML 3I2ZA 1Z5SB 1TJEA 1O7YA 3AE8B 5T1GA 2JRIB 2PZTA 5DAUA 5HGQA 1HR0Q 2NBVB 2WQYB 3DXJC 3MZ5A 3RNEC 1Y14B 1D3ZA 1B4OA 5AZHA 5CV8A 2MP2A 2K6AA 2A68D 4PS3A 2PMZB 4L5SA 4M0WB 1SYEA 2BPSA 1VQCA 2DZMA 4A3OA 1T9HA 4K0KQ 5KYLA 1QUQA 3VR2A 1OTRB 4MZ9A 2ATWA 1WJ4A 1YBYA 1V9PA 3NS1A 3RD2A 5LMNL 1QOFA 4GGQA 4WWMA 2A5HA 2I38A 1YX5B 2PTLA 2PE9A 4YY3L 4RWSC 2NPTB 4KJNA 3OAWA 1W3SA 2JXTA 1Y8NB 4NJ7A 5LMNW 4HXDA 1Q46A 3FVQA 2IY1B 2RSOA 4BXXG 1N5WA 2M9VA 4P74A 4P73A 4UAIA 1Y8PB 3I55A 3C0RB 3N30A 1Z47A 3OW7A 2N7JA 5IYDH 2Z4IA 1YOVB 3PTFC 1EWYC 2BE5C 4DV5L 3JSVB 1MSHA 3DHQA 2C5LC 2JY6A 3RZFA 1GVPA 1PZKD 3CP0A 2IX1A 4EZJA 2KHIA 5M5XB 3RMKC 3CCSA 1CK1A 4A4IA 1ZKOA 3H91A 2EXDA 3E5SA 4R8IA 4A3DG 1EY8A 1O7LA 3HKSA 4DR1L 1QT9A 2EZVA 4IALA 1V43A 2JA8G 2EPBA 2VXWA 2KWVB 4JI8Q 2KANA 2LKVA 2NBUA 2O5IC 1E7VA 3V05A 1NENB 2EKEC 4ZRZA 5M5XH 1PGXA 1FL0A 3Q8FA 5BMIA 4J15A 4LAAA 4KGTA 4IUVA 1J8CA 1Q81C 1EEFD 1V1QA 1LQBA 1YD8U 3DOWA 1EZ6A 2K05A 2ID0A 3OW2A 4GN4B 1UBQA 3KF6A 2F0IA 1C4AA 2R2OA 1LTLA 1FXTB 2ICIA 1EOVA 3OSOA 2QGQA 1RIPA 4IUUA 1XNRQ 1QOBA 3SDZA 4UDUC 4X66L 4DAYA 3Q3JA 4FBJB 1VS0A 3ZNZB 1EYCA 3H6NA 2IGGA 2LFNA 1PZID 1IYVA 3S1NB 3E9SA 5DNFA 1K9MC 3S1QH 1E7ZA 2AQ2B 2RKSA 4MTNA 4EZLA 3F2DA 3N1ZC 3H3VH 3JC66 1KHIA 4KKSA 2YTYA 2K5HA 1B50A 4G11A 1EQRA 2Z0SA 3FC4A 2RBMA 2ZPNA 4LFAQ 3GTQB 4LF4L 2W82A 1J8IA 1LV9A 1UE7A 3SHLA 4EQNA 3S1NH 1VQ4A 1QNUA 3W1YA 4L63B 3ULJA 1C1YB 4ZRQA 1MI2A 4NAMA 1EOTA 4M8AA 5EJWA 1A2TA 4ZLTF 4B9KA 4IPHA 3GTQH 4A3LH 4KLKA 2FCQA 2WXMA 3SDLC 1TWHB 3X3NA 4RMAA 1C78A 2IWHA 2Q2UA 4M1UB 4XTCS 3WOEA 1SR3A 3Q23A 4JI2L 1A15A 3GTMB 1D1KA 1FNWA 2O6VB 3DWGC 5JH5C 1EY7A 3APCA 1WGHA 3ERSX 4MTKA 2LHEA 1OXSC 2WXFA 2W3RA 4OW0A 3BU2A 1MG8A 1STGA 2FHTA 2GVBA 4UP7A 2ES2A 1XEEA 1T5EA 1TWHH 5FLXE 3P63A 2KNBA 4Q0FA 3GTMH 2F0EA 4C56C 3WANA 2EE1A 3R3MA 3K6OA 4JV5Q 2KCMA 2IW3A 3ZTDA 4IUNA 4IC7B 1SFOH 3TZUA 3KYCD 2IZVB 2GA4B 1WFYA 4DXAB 2GLSA 5ELOA 4I6NB 1MJCA 1CT1D 3HKZE 3OPOA 2F0TA 4JI7Q 2AL6A 2Y0SE 1PH4A 2NMQA 1BNZA 2XN9C 3RD4A 1GD7A 2L5TA 2KVRA 1YNNC 5BYQA 2VH1A 2N1WA 5AZFA 2WHIA 5EKIA 1WXQA 1C7YA 2F3WA 3H0GG 4J6HA 3C3LA 2A69D 2LMCB 3WCQA 2K5NA 2L9HA 1FMAD 1HZBA 5HGTA 3VUWA 3HKZG 3SVMA 2CVRA 3ML9A 5IWAL 4RGOS 4KY5A 4CO7A 2Y0SG 4PV1C 1Q12A 2CHBD 3DWAA 3VYRA 2GRIA 2LEKA 5BMGA 3LB8C 3KOJA 4IKGA 3NBHA 3Q3FA 3Q69A 3SE0A 4LJOB 2B2UA 5LMNQ 1SNMA 3ICEA 1RKNA 1VCBA 4FXKC 1RF2D 5IP4D 1QE6A 1TZ1A 1TS3A 1BUVT 1I4QA 5E6NA 1WTRA 1FFVA 2JXXA 3AE4B 1IBKL 3R7RA 4JCVE 2KFKA 2R61A 2PKOA 3Q8AA 2CKZB 1WX8A 1X56A 1PHJA 1HNZL 3VRAB 2D07B 1X3PA 4QIWE 4E71A 1XJVA 1L5PA 3B1LX 3QR8A 5C0XJ 2NBWB 4JI1Q 3PIO3 1I35A 1K28A 1B7YB 2F0PA 3CF6E 2HDEA 1RCVD 2INDC 3W5OA 1CA6A 5HY6A 2G4DB 5ELBA 2ZJDA 4ZRIA 4E6IA 1WM3A 2IPKD 4PNYA 4W9FA 4R4QA 3GTPB 4JQWC 5EE1A 2SOBA 1CM9A 5CV9A 2UU9Q 1WSPA 2UWQA 1KDAA 3Q8DA 1AWDA 2M17A 1ASYA 2MO0A 4MGKE 2Z59B 5K36G 2ZCCA 3DVNU 3J80i 3NVYA 3Q8CA 1RRBA 1YNJC 3CPWA 2WXOA 3AB5A 3HRDD 4G0NB 4ME5A 3K7UC 2BH8A 3GTPH 1IBLQ 1XCQL 3PV1A 5BO4B 3EC8A 3KUDB 1RTOA 1OO9B 4DV1L 4LF7L 1N63A 3E3XA 5M3FG 2LGXA 4AJWA 1V49A 4L6TB 3R2TA 1E8ZA 1FXAA 4MM3A 1XMQQ 3K5LA 2WB1B 1WZ0A 1VR9A 2IX0A 2K33A 3SK6A 5C4XG 1WX7A 2B63G 1TKGA 5CORA 2D2QA 3A4RA 1GUNA 5EKKA 1YQ3B 3QO2A 1H9SA 4IM0A 4C2MH 5E6JA 2LUMA 3AEDB 3PHWB 4IFDH 2AEHA 1F2RC 2I0QA 3PRZA 1HNWL 4JW0A 3JAME 2KYWA 1DOLA 3AXCA 5L37A
chains in the Genus database with same CATH topology
1WGKA 1F9PA 5HURA 3P4RB 1FR3A 3D3RA 1GUWA 3B9JA 3D4WA 2NWGA 3V2TA 5A2QL 1T5XD 2AQ3B 4XT1B 3J81L 2EXZA 5COYA 1SNPA 2B39A 4GDLB 3BS1A 4N58A 2NB0A 4KKJA 3D6CA 1KRHA 1AYFA 3EFXD 1I7HA 1IBXB 4RNAA 5GXGB 4USAA 1YN4A 2QEJC 1OXVA 5BN3A 4NJCA 1L6VA 4LTUA 1JOQA 2KVMA 4HKQA 1RDPD 1EIGA 1H9KA 3KUPA 1E6EB 5EPKA 4RFBA 2WNMA 4A3DB 1LT4D 1PRTB 1LTGD 2ZXRA 4JX1C 3H6MA 2DY7A 2B8FA 2JA7B 4P6VF 4H13C 2NVYB 2PO4A 4IOIE 3TEYA 1G2TA 2B2TC 1PRTF 1STAA 3K5OA 4FO2A 3PUVA 2K1BA 1SEBD 1BCPB 2RPVA 2O2LD 3VA7A 5EGTA 1YJJA 1F9QA 3NPPA 4RGTA 4ZKBB 2BW2A 1BCPF 5M5YB 2R6GA 2WV6D 4G7HC 4A3IB 1XF5L 3SK5A 1VRAB 1A3VA 3TUOA 1ZYRD 2F0KA 1QJOA 2F3VA 4MH8A 2MGSA 5C5MA 3MWYW 1XX8A 1KF6B 3AEBB 4ITKA 4WQMA 2HUGA 2A73B 4P2CB 2L1AA 5C3WA 2B2TA 1R7SA 2JYEA 2J7ZA 2RDGA 3DEOA 3K58A 2ON8A 1UWMA 5CR3A 1VF5C 5G3LF 2KDMA 2X69A 2FMCA 3BK1A 3IAS1 1X32A 4NP5A 1D5XC 1E0ZA 1GUSA 2BYTA 3T4AC 4YSYB 1LT6D 3H09A 5IT9L 1CZGA 2F0UA 4EGVA 2E75C 3CRLC 1RODA 4FF2A 1FD6A 2H1EA 1CA5A 1M4VA 2EOTA 3H3VC 5CV5A 4A93B 3J7AV 4HEDA 2MH7A 2H4OA 4OHJA 1R4QB 2I07B 1I4GA 2WXKA 1WTXA 4RAUC 4HR7B 2Y5CA 1EIHA 3J9CA 2OEDA 4ID6A 2J0TD 4A3JB 1IW7D 1PFBA 2KCCA 1STBA 1I4RA 2AX5A 2K01A 1LLRD 2WU2B 3AE6B 3LX0A 3KK7A 1DD2A 3T3NA 2WKDA 4CJ2C 2Q8IB 1SYBA 1BF4A 1JMLA 1K83B 2LS01 2L83A 1ENFA 4ZUIA 4I65A 3KQ4A 4DAPA 1UNSA 1XLNA 3HOWB 1O7ZA 3LXFA 4HEA1 2DBYA 1E7PB 4N9PA 3ZYYX 1EU3A 1K8OA 3AE7B 4G7ZC 4BBSB 1DM0B 4RCOA 1YMHE 2Y5PA 4QIWB 4FF3A 2CJOA 4KHZA 4WORA 3S2HB 3BDCA 1AW7A 2I46A 1IYUA 1L4DB 1D2BA 1TWFB 4A55A 2XVSA 1ONLA 1SNQA 4BBRB 1ML0D 2XRSD 4K2KA 1H9RA 4OL7A 4DN4M 5DM73 3M85A 4EQPA 3P4PB 3MTSA 2WU5B 4K5VA 1JB3A 5JEAJ 5CC4A 4A6QA 2PZWA 2F0SA 3CQZB 2WINB 2AUKA 1FRDA 1MGSA 2N55A 3OWFA 2EDGA 1E2VA 4DQOC 1PYWD 1CQFA 1SE3A 4XE0A 4CKBA 3SFEB 1C4PA 1SIJA 1C76A 3MHBA 2MJ8A 3L7ZC 4OIJA 1SYFA 4YTPB 2OXPA 2N0SB 2XRQD 4DK1A 2KQ4X 2L55A 4IURA 4K2LA 2KWDA 5JVH3 1JE4A 4CKEA 3SK8A 4AS1A 3HEJA 2EYFA 4QUFA 1JWBD 1LTTD 1Z7TA 3I90A 3KWVA 3T56B 1HRJA 1HQRD 2L52A 1Q10A 3I72A 1LTSD 1JWSD 1PTOB 3NQIA 3ZJUA 2CJNA 1RTNA 1N61A 2ZXOA 3QG1A 2MJ3A 1D1IA 1A2UA 5CBEE 3I91A 1MHHE 5LNK1 5C0XI 5JJZA 1GB1A 1WD1A 4TQUS 4WIPA 3BK2A 5BYSA 2MEKA 3AECB 1TWCB 3VQIA 3TEZA 3QOLA 3K7AB 1B2TA 4LK1C 4A90A 3JAML 1KDCA 3P75A 1I6VC 4F8MA 3D31A 5BYRA 1FD7D 4O1NA 3IL8A 1MI0A 5FOBB 4ARIA 1FNUA 4DNRB 3MHZA 2VUMB 2KMMA 3UI3A 4BS9A 3VA5A 1QWYA 4HCEA 3O13A 1MHXA 2PMVA 4V190 1OQQA 2K5DA 4QB4A 3RMHA 3RFZB 4RGMA 1HTLD 4K6DA 3PIP3 3I57A 3GTGB 1LO5D 3SEBA 2FUG1 4KD3A 5H92C 2PNRC 1XLPA 1CFMA 4OZAA 1PRTC 2WS3B 1JOOA 2JZPA 2MUYA 3TP5A 2HTME 5KIXA 2E2HB 2RQXA 1F2YA 3NWSA 4XIGS 4FNFA 4HN7A 3K5NA 4X3TA 1ZDVA 2SAKA 1STHA 3CKIB 2ZW1A 4OVZA 2JE6I 3IXSA 1BCPC 1FM0D 2LHDA 1TS4A 4OZBA 2QJLA 3N52A 3HG9A 2QKIC 5FKAC 3I70A 1SNDA 4TKOB 1JWAD 1IBXA 2L4NA 4A9AA 2TSSA 1NAPA 3NRZA 3A54A 1OQRA 5I6WA 1ZXIA 1ENCA 1S5CD 3S2DB 1DZ1A 3AEGB 2K5WA 3HOZB 2EVBA 2EYMA 2R92B 1E2WA 1QCBD 1VCIA 2A6HC 2FE8A 1JORA 2F0NA 3VR4A 1WWTA 2EY2A 2PQEA 5C4HA 2WXHA 3W5VB 4D2KA 4OGQC 1IHZA 1O78A 2G1EA 5KYIA 2JEBI 1FYCA 3EUB2 1EY4A 2BBCA 4A8XC 3C8YA 3VYSA 3E6ZX 3R2IA 5ELDA 2M00A 1BDOA 5HFYA 3SK4A 1QOGA 1ZPSA 1G6ZA 3EA6A 4DAVA 3BDLA 1HXYD 2F0QA 4OO1G 1L0YB 5T8IA 1KAAA 3X3MA 3KLRA 4US8A 1DONA 5IIFA 2LFIA 5G5HA 1WTVA 4OIKA 2J42A 1IKLA 1GXDC 4RCNA 4TQ0A 1BR9A 4X3KA 2PW7A 1K50A 4HKZE 4BY1B 3N6RA 3AE1B 4HRSA 5D7GA 3IAM1 4V0BA 2WAQB 1KABA 1SXTA 4KY7A 1L4ZB 2L32A 2M19A 4WH4A 3ZJTA 4K6LA 2O5JC 3HGBA 1VLBA 1Q90A 1U9RA 2RVLA 1XLQA 3IFDA 1B3AA 4DA2A 1EYAA 3FMCA 5D65A 2XNAC 3WDNA 2BS3B 1SMYC 3HOUB 2SNSA 1SNOA 2JSOA 2F0GA 3DMUA 1TWAB 5E4WC 3TP7A 4BA1I 4XDDA 3MA2B 4C7ZA 5CV7A 3MXUA 5FR3A 5IGFA 1I6HB 1DOXA 2QF7A 5D3IB 2ZW0A 1UUPA 2B2UC 2E2DC 4ARCA 2E6XA 2OT2A 4YTNB 4MN3A 4C1NK 4KGSA 1PMRA 3DWMA 5ELEA 1C77A 4DU9A 1UAPA 4KI0A 1AZPA 4L8JA 1GUTA 4NAWB 1FEHA 3TEWA 2DN8A 3OIPA 4YT0B 1I4PA 3TMEA 1QKZA 3FDTA 4PMBA 2QCPX 1EU4A 1WCMB 1EWCA 1EQTA 3MEHA 4CQNA 2AWOA 5JVG3 1V1PA 5M9OA 3G7LA 1V8QA 2SDFA 1LTID 3NTIA 2WXQA 2FFKB 5JOBA 1PTOD 2F0JA 4K14A 1G291 3A7AB 3EROA 1TU2B 3KBXA 2WXIA 1I3QB 2NVXB 1I50B 1NR2A 3J7YW 2RMMA 1J7CA 4C3IG 3A8JE 2PCFB 1ESRA 1STYA 1G2SA 1EZ8A 4C3HG 3BVZA 4WJWA 4A3EB 1VF7A 2WXJA 4DGZA 3L9AX 1N62A 3P1MA 4B0MA 2V4DA 4PT5A 1S5ED 3GTKB 5C5LA 5M5WB 2MJEA 2EELA 4XWWA 3NVWA 3Q0AA 2K5PA 5C0XH 1JCKB 3NK9A 1WTOA 1EY0A 5A35A 1SDFA 2A69C 1ACCA 4GLSC 1KLGD 1DOIA 1PLFA 1LACA 4KKIA 2BDNA 3PUWA 1F0ZA 4WRDA 3BVMA 3ONAB 3I8ZA 4Z9CB 2H88B 4J3OD 4AQ7A 1MSGA 2JYOA 4WFN3 2BCOA 1EYDA 2WXNA 1PGBA 4WAFA 3FAHA 2KECA 2V3PA 4KGRA 2KUMA 2A6ED 4F88A 4IUQA 5CV6A 1L0XB 4NKLA 5EBCA 2V4IB 3VRBB 4Y7NB 4L23A 3M4OB 1YN5A 2K0PA 2JEAI 3T13A 5I9PA 5EKLA 2V3NA 4H2AA 4Q2JA 3URYA 4H0LC 1Y8OB 2QDBA 5EQ0A 1YN3A 3TP8A 3J80E 4HMIA 2JA8B 4QF4A 1B1ZA 1HA5A 1WVLA 1KLUD 4TQ1A 1TR5A 1LTAD 3ERQA 3T16A 4MHEA 1Q3LA 5C3XA 4RF1A 1E9MA 1OXTA 1JC7A 1JWMD 2NTSA 2NZ1D 2G9HD 1I4HA 3A8KE 2QILA 4XDCA 2JYTA 1RD9D 1KNAA 3I4NB 5E4XA 4FYDA 1SSNA 1ZXHA 4U68A 3M7NA 3AMUA 1K53A 2E74C 4WURA 4B9XA 2ZXPA 3PUZA 3R93A 1QQRA 1QF6A 3BYTB 5ISRA 1RFKA 2O4XA 2K3UA 1MD2D 2LY7A 3TZDA 1PDQA 3D4DA 1JR0D 5BMHA 3RZDB 3MC0B 3S1MB 2BT6A 3GO5A 3NQTA 2D62A 3A8IE 1F2MA 1VMCA 4GDKB 3IT4B 1WD0A 4US9A 2XIWA 2MHVA 1D6EC 1JQYD 4TMAB 1HQMC 3Q8EA 1ZP0B 4JWSC 2AWNA 2KN4A 5CBAE 4HTHA 3VR9B 1RYJA 2QIEB 2INPE 2F0VA 5J1ZA 2PW5A 1UEAB 1A3UA 1ZE3D 1V97A 1PUTA 2PIAA 3MP9A 1E0BA 1EL0A 2WXPA 4M0WA 1E2ZA 2NN6G 4ABNA 1VDZA 1TY2A 3ABVB 4YWGG 3H0GB 2QSDA 4CHTB 2IGDA 3P7JA 4H7BA 2IJ0A 1XCTL 1YJIA 1IL8A 3HKZB 2Y0SB 2RSNA 1PGAA 3FPPA 3TBIB 5CV4A 2E3TA 4RKBA 1MBYA 3BWUD 2Z1CA 2GI9A 1JOKA 1TZOA 4ZAIA 3K0YA 5T1IA 3J7AF 3RUZA 3BIID 4R9WA 3PZ8A 3ZGZA 4ILWA 1H9JA 1JW9D 4KX6B 3U7ZA 2M2LA 4C3IB 2Q5WD 4G7OC 1NI3A 2NTTA 4X3SA 3EJIA 5BN4A 2JP1A 4K5WA 3GTLB 4ZRPA 5FO9B 2Q8TA 3VR3A 5BN5A 3PO0A 4K5XA 2F0WA 5FLXL 4YSZB 5IOCA 3ND8A 3P4QB 4XT3B 1GJXA 2ACZB 4CGYB 2M0AA 3U4EG 1JRPA 5M3FB 2DWQA 1NUCA 3GTJB 4H44C 5C4XB 2C9OA 2B63B 3A55A 1V8CA 3PMFA 5J39A 3CRKC 4DF7A 1GAQB 1UWXA 1AN8A 1IGDA 2SEBD 2KA7A 4EQOA 2E2IB 5IGDA 2NVQB 1JWUD 4YTMB 1U4LA 4HSPA 1T6BX 3LNNA 2JWUA 1HFNA 5C4JB 2B76B 3NP8A 5LL6S 1FCCC 2CW0D 3Q22A 1TKEA 2OF1A 4ODGA 3HP3A 3Q6SA 2D5GA 3BYYB 5JEAH 5C4ZA 3B2GA 1ZUD2 3OMGA 1D4BA 2B2WC 3H8HA 1T3QA 2WXGA 1SBBB 5FO7B 2WLBA 1Z6HA 5JAVA 3OHXC 2B2VA 1VJKA 1KDBA 2PPBC 2DY8A 3PO3B 2LMCA 2KOLA 2KEDA 3RZOB 2L12A 3I73A 4ZQ3A 2Q8RE 1GHJA 1DOMA 1B44D 1BO0A 1E10A 1AFPA 2JA5B 2D5DA 1SSOA 2BTEA 3VYUA 4S3SA 4KY6A 2L0CA 2KACA 3AEFB 1RJTA 4PMCA 3VYTA 1B9MA 1PTOH 2F0MA 1C9FA 3B2FA 4F7XA 1PTOF 2BA0A 5C44B 3GB1A 4XQJA 1MVKA 3P42A 2EYHA 4FXGC 1TT2A 2B2WA 4LMQD 3PV0A 3A56A 5EE3A 4MT5A 1GUOA 4XDXA 1HUNA 1JALA 4MIUA 5C6AA 2WDRB 4DXFA 3I9V1 3AE3B 1R9TB 1TS2A 2SNMA 4XQNA 1FNVA 1BOSA 3M3YB 3K57A 3V3XA 1IUEA 1EY9A 1SYCA 5KNCA 2LGIA 2PYKA 2DLBA 4F87A 1HPCA 3P1HA 2RDHA 2HQEA 4XYQA 2EYJA 3HOYB 1UGJA 3J80L 2IL8A 3C46A 3R3OA 5M3MB 3MXPA 4LLGM 2D2CC 1F77A 2WDQB 4IZ8A 3OMCA 2F0HA 5K5PA 5C0XG 3DWPA 3NVVA 2YYZA 1AZQA 5LL6X 3SR6A 2PVOD 4XWTA 3G6JB 1TS5A 4FXDA 3NVZA 3FRPB 2BE5D 2INNE 1G8ZD 1ESFA 1F9RA 1KH0A 1W6JA 1S5FD 1J7AA 1ZOYB 2RDFA 4A3KB 3VR8B 3I3CA 4CKCA 2F0LA 1IKMA 1VZ7A 4DFAA 1SF0A 4IFDG 1YNTE 3AEEB 1X3QA 4HMJA 4G4KA 3GS2A 5D14A 1CJEA 3I4MB 4OO1I 4KHVA 2K22A 1Q1BA 1JICA 1V1OA 4CJ1B 1VZ6A 3GP7A 1RWSA 3E56A 2XWBB 3PUXA 3T3OA 1G91A 3BG3A 3NTKA 1HZ5A 5NUCA 1II3A 1BQQT 2BS4B 2EJMA 2K03A 4DK0A 1XXGA 5IGGA 2WDVB 3T51B 5ELFA 4LJZC 2R3ZA 1GOZA 1GPXA 2CQAA 1CTMA 2QMTA 1TKWB 1SMYD 5KGUA 5F2DA 2BS2B 2NBFA 3SXHA 2EYLA 1F9SA 2A68C 2NVTB 4I7ZC 2FJ2A 1NVID 2X6GA 3EGRA 1CHQD 4CJ0B 3S16B 4P16A 3AV8A 2WXLA 3S1RB 5I6YA 2VNUD 3C1EA 1HUMA 3FILB 1EY6A 5IT9E 5EBDA 3OIQA 1TKYA 2PW9A 2W3SA 2MJDA 1LT3D 3MFGA 4IUTA 3W1SA 2E76C 4U673 3CHBD 1DYQA 3S1QB 2F0OA 2WACA 3BDOA 3AEAB 3ETRA 5AUIA 2NUCA 5E1FA 3QOJA 4YIJA 4A3FB 2EY5A 3U9OA 3Q24A 1A70A 2I2YA 2JSVX 4O42A 2JXMB 1STNA 1J9OA 3EVQA 5IGBA 3H94A 5HI1A 1PZJD 1TYGB 1YNND 2W54A 3W3AA 3NE5B 4ZHPA 5TSSA 4NW2A 3AMZA 2KQ3A 4ZOHC 1EM7A 1U4RA 2V0GA 1ILQA 1ROEA 2E2JB 3S9WA 4JBWA 1TVXA 3MFYA 4R3DA 1B9NA 2BOSA 3LYYA 3OWEB 1TWGB 1DXMA 4KKUA 5C2TB 3TEXA 1SFOB 1AEXA 3IT6B 4J1MA 2X6LA 2WP8J 4JK1C 3PZ7A 1M8AA 4BWGB 5IGEA 4N6EB 3D4RA 2ZT9C 1BBXC 4KMUC 2WKCA 2HDMA 3V96A 4R8NA 4C3JG 1VDVA 4A3BB 4KV6A 3PO2B 1EY5A 4B08A 3VR6A 1CZPA 1HTPA 1YNJD 3M4YA 4DXGA 2AUJD 1EWHA 1DOYA 1BXTA 1QOHA 1P7FA 3WOFA 2ENBA 5C3EB 1J7BA 4NMZA 4JE3B 1D5ZC 1SYGA 4AYBB 3QJYA 4FF4A 4GZYC 2Y3AA 3L3OC 5J22A 1EQVA 3U2SC 2BA1A 4ZHOA 2VB2X 5H8YE 4C1NI 1Y1VB 1BUIC 4K8JA 1XYIA 5E3FA 1XO3A 1NYQA 4ULLA 2N9LA 4NZLB 4DNTB 1GUGA 4YXDB 1DGJA 3W5UB 2H89B 1CQVA 2J52A 2EYPA 2J4XA 2XSCA 1PTOC 4IFDJ 4C7YA 2K5QA 4ZYSA 1Q1EA 2EJFC 2EY1A 5HHDG 3W9CB 2HDLA 3SR1A 3HOXB 1C4QA 4C2MB 2M56B 4A3GB 3BZDB 1PXUA 5CYUA 3KBGA 2VZKD 4EVOA 4JPSA 3AE9B 3A7LA 3M7GA 3C1FA 1DCZA 3AN1A 3ZJVA 3MXGA 5AUKA 1SYDA 1SNCA 1CHPD 4A3MB 2WXRA 4REZA 1K52A 3DWQA 1KFYB 2F0DA 5FK9C 3HOVB 5IGCA 2IT1A 2ONQA 5JEAG 3D8GA 1Y69U 4RF0A 2R93B 5EE9A 2W55A 3QWNA 5KRUA 4ZUJA 5EPJA 1RM6C 2F03A 1S5BD 3BVGA 4IN3A 1F2RI 4LK0M 4KD4A 2EKIA 3MJ5A 1LTBD 1A3TA 2C5CA 2YU9B 1ZDXA 1BMLC 1B53A 3OOCA 4ZKCB 1GHKA 2JA6B 1MPEA 2B8GA 2Z4HA 5EE0A 3AU7A 4OO1H 4L1BA 4PMWA 3ZQ4A 2K7VA 1ZEQX 2YEPB 2A6EC 3GD7A 1R4PB 2BB5A 4OZCA 1QILA 1K8MA 1KTKA 3IAYA 1C8CA 3U9SA 3LWUA 5LHY1 4HSVA 5C3JB 3HS0C 2YEPF 4KTAA 1Y1WB 3QB3A 1SE4A 3TP6A 3NTHA 5DM63 3AB9A 3NHHA 2PLPA 1ET6A 3AE2B 3GQBA 3MVVA 4QCLA 2F4IA 2NN6I 3FEWX 1CI3M 4Q5VA 3NXWA 1HEZE 1WYGA 3P4SB 4N59A 3S15B 1DJRD 4X3UA 4B9WA 3S14B 2FINB 2A74C 1HCZA 1NCVA 2OHFA 4KKTA 3S17B 1PFDA 1NSNS 4RHRA 2N88A 3NUCA 3D6WA 1NEKB 1LABA 3VR5A 2HCIA 3U52E 3K5MA 1IGCA 4RH6A 2OEOA 1A6XA 3I4LA 5FO8B 1NR4A 3F2UA 3AE5B 3TDQA 5JXVA 1CZWA 2F1MA 1HA6A 2F0FA 1K51A 2N9KA 1FGBD 2D9UA 2KJXA 5CMDA 4C3JB 1WTQA 1L6UA 1PDXA 1ZYRC 2XWJB 4PQXA 2RA4A 1ET9A 1FO4A 1XLOA 4FVMA 1FRRA 4B0EA 1QG7A 3CIRB 4TSSA 3DM1A 5JPMC 3RPFC 5G5GA 1P7EA 1SE2A 1SB3C 3KLSX 1LTRD 1VMPA 3DUZA 3KLSA 3RLFA 4C3HB 4CBVA 4J8QA 3SFDB 3FPUB 1V1PB 2DNEA 2KCNA 5KNDA 1HFGA 2EYOA 1YQ4B 4BY7B 2JX5A 4XXEA 1JQ4A 3IFTA 5KEEA 3GV3A 3L4PA 1QOAA 1Q8IA 4RHSA 4JWUC 1KNEA 2FMMA 1Y56A 2WIIB 2DYMA 3CWIA 4QUCA 1HHVA 1S5DD 5I2YA 2Z8LA 1B9RA 3FILA 5I9OA 1N5XA 2IGHA 5K36H 3GTOB 4TRDA 2B2VC 4RKLA 3N9YC 3MXNA 3TSSA 1IW7C 2HCCA 2L11A 1OFFA 2DNCA 4KJOA 2JQRB 1F2ZA 1LT5D 3Q8BA 2PVGC 4C80A 4L2YA 2IDYA 3EQLC 2CU3A 1PFMA 1STEA 3NZ3A 1O80A 1XTCD 2KAJA 4ZK9B 2BB6A 4XQQA 1FXIA 1XWEA 4MM3B 1F2LA 1SJED 2BDOA 2FBWB 5MPOA 3CU7A 3HZXA 1VZ8A 1D5MC 1H9SB 2WP9B 2K32A 1HZ6A 2KEEA 1C79A 3KWLA 3AM9A 1U4PA 2AQ1B 5AFWA 2JU6X 1I4XA 3K59A 4KN4C 3NBIA 2X38A 5IODA 4HCSA 1RHPA 2B2YC 4IQZA 5HG2A 1QB5D 3UI2A 1H9MA 1OXUA 5ELCA 3E0JA 1L0VB 2EJGC 2GB1A 3HUIA 2R7ZB 1C48A 3HVDA 3MAQA 1TQOA 2EY6A 4MACA 3C2PA 2CW0C 1EFID 4RGNA 1ICWA 1QNKA 4N9TA 1QLBB 3NUHB 3P20A 2G9DA 5D3DA 5CGKA 2K04A 2MPMA 2L1BA 1PRTD 2NYZD 4EE2A 4NDXA 1FIQA 4IDIA 4FP5D 3QIAA 1FFUA 2DYOA 2PZUA 1C4CA 1W6KA 4KK7A 3DEPA 1N60A 1SAPA 4FF1A 1U4MA 3HVZA 4FXCA 5A2QE 1TIID 1JROA 5I2XA 4KN7C 3J81E 2VB3X 5JPNC 1WTWA 3PUYA 1BCPD 4G57A 4HAEA 2B2YA 3T53B 4K8IA 3W2DA 2LJIA 3IKJA 5EPLA 3FKIB 1S4ZA 3HRZC 3ITPA 3LWEA 2K28A 3NSWA 4BA2I 4IFDI 2TMPA 1TY0A 1PFNA 3ND9A 1WTPA 4HJGE 2IX3A 1AP0A 4YSXB 3KF8A 2KHSA 5I4DA 1OXXK 3TN2A 4HROA 3GV6A 2J53A 5DEHA 2A6HD 2VZKB 1FCLA 1DOKA 4QMGA 3AH7A 4IUPA 2K9XA 3NWTA 4XYOA 1ILPA 2ICEC 5KNBA 1NYRA 1WRIA 5G3LD 1ENAA 2NN6H 4RA8A 1EEID 2MP1A 1SJHD 1GB4A 3R8BA 1ZXTA 1TJEA 1O7YA 3AE8B 5T1GA 2PZTA 5DAUA 2WQYB 3DXJC 3MZ5A 1B4OA 5CV8A 2K6AA 2A68D 2PMZB 1SYEA 5KYLA 3VR2A 3NS1A 1QOFA 4WWMA 2A5HA 2I38A 2PTLA 4RWSC 4KJNA 2JXTA 1Y8NB 3FVQA 2RSOA 1N5WA 2M9VA 4UAIA 1Y8PB 1Z47A 3OW7A 2N7JA 2Z4IA 1EWYC 2BE5C 1MSHA 3DHQA 1PZKD 2IX1A 5M5XB 1CK1A 1ZKOA 3H91A 3E5SA 4R8IA 1EY8A 1O7LA 1QT9A 2EZVA 4IALA 1V43A 2EPBA 2VXWA 2LKVA 2O5IC 3V05A 1NENB 4ZRZA 1PGXA 3Q8FA 5BMIA 4LAAA 4KGTA 4IUVA 1EEFD 1EZ6A 2K05A 2ID0A 2F0IA 1C4AA 2ICIA 3OSOA 4IUUA 1QOBA 3SDZA 4UDUC 4DAYA 1EYCA 2IGGA 2LFNA 1PZID 1IYVA 3S1NB 3E9SA 5DNFA 2AQ2B 2RKSA 4KKSA 1B50A 3FC4A 2RBMA 2W82A 3GTQB 1J8IA 1LV9A 3SHLA 4EQNA 1QNUA 4L63B 4ZRQA 1MI2A 4NAMA 1EOTA 4M8AA 5EJWA 1A2TA 4ZLTF 2WXMA 1TWHB 3X3NA 1C78A 2IWHA 4M1UB 4XTCS 3WOEA 3Q23A 3GTMB 1A15A 3DWGC 1D1KA 1FNWA 1EY7A 2LHEA 1OXSC 2WXFA 2W3RA 4OW0A 1STGA 2FHTA 1XEEA 1T5EA 5FLXE 3P63A 4Q0FA 2F0EA 4C56C 2EE1A 3K6OA 2IW3A 4IUNA 3TZUA 2GA4B 1CT1D 3OPOA 2F0TA 2NMQA 1BNZA 2XN9C 3RD4A 2L5TA 1YNNC 5BYQA 5EKIA 1WXQA 2F3WA 4J6HA 3C3LA 2A69D 2LMCB 3WCQA 2L9HA 1FMAD 5HGTA 3SVMA 2CVRA 4RGOS 4KY5A 4PV1C 1Q12A 2CHBD 3DWAA 3VYRA 2GRIA 2LEKA 5BMGA 3LB8C 4IKGA 3NBHA 3Q69A 3SE0A 2B2UA 1SNMA 1RKNA 4FXKC 1RF2D 1QE6A