1I4PA

Crystal structure of staphylococcal enterotoxin c2 at 100k crystallized at ph 5.5
Total Genus 63
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
63
sequence length
239
structure length
234
Chain Sequence
b'ESQPDPTPDELHKSSEFTGTMGNMKYLYDDHYVSATKVMSVDKFLAHDLIYNISDKKLKNYDKVKTELLNEDLAKKYKDEVVDVYGSNYYVNCYFSSKDNGGKTCMYGGITKHEGNHFDNGNLQNVLIRVYENKRNTISFEVQTDKKSVTAQELDIKARNFLINKKNLYEFNSSPYETGYIKFIENNGNTFWYDMMPAPGDKFDQSKYLMMYNDNKTVDSKSVKIEVHLTTKNG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ENTEROTOXIN TYPE C-2
publication title Structure of staphylococcal enterotoxin C2 at various pH levels.
pubmed doi rcsb
molecule tags Toxin
total genus 63
structure length 234
sequence length 239
ec nomenclature
pdb deposition date 2001-02-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01123 Stap_Strp_toxin Staphylococcal/Streptococcal toxin, OB-fold domain
A PF02876 Stap_Strp_tox_C Staphylococcal/Streptococcal toxin, beta-grasp domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.110 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1i4pA01
3.10.20.120 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 1i4pA02
2WV6D 1D6EC 2AQ2B 1D5XC 1HXYD 1PTOF 1LTBD 1S5ED 3R2TA 1S5BD 4C56C 1ESFA 1BCPF 1SE2A 1PZID 4ZYSA 4RCOA 1B1ZA 4O1NA 5FK9C 1JWMD 1I4GA 1V1PB 4RH6A 1PRTF 1CHQD 2O2LD 3KLSX 1PTOD 1FD7D 1G8ZD 1LTGD 1EFID 1LT6D 1UNSA 1BCPD 1CHPD 1FNUA 2ICIA 1SE3A 3V05A 1LTTD 1CT1D 3BZDB 1JQYD 1EEFD 2CHBD 1ET9A 1LTRD 4BWGB 1FNVA 1PRTD 4RGNA 1YN5A 1M4VA 1RD9D 1JWUD 1LTAD 3BVGA 3DWAA 3SEBA 1HQRD 3BVZA 1PZKD 1HTLD 4RHRA 1LLRD 1MD2D 1XTCD 1TS3A 1PTOB 1PYWD 2SEBD 1PTOC 3BYTB 1TS4A 1PZJD 1ET6A 2XN9C 1RCVD 3OWEB 1TY2A 1L0XB 3URYA 1S5FD 1ENFA 1EU4A 1S5CD 2NTSA 2RDGA 4RFBA 2AQ1B 1DJRD 4RGTA 5D3DA 1GOZA 1KLGD 1RF2D 5ELCA 1CQVA 1LO5D 1TY0A 2IJ0A 4RGOS 1LTID 3CHBD 1YN4A 1LT3D 3R2IA 3TSSA 1LTSD 1BXTA 1LT4D 1SJED 5ELBA 2R61A 4DXGA 1I4QA 3O13A 1V1OA 4Z9CB 1D5MC 1I4RA 1AW7A 1EWCA 4L6TB 1PTOH 1SXTA 1KLUD 3EFXD 5I4DA 2Z8LA 1AN8A 1SBBB 3BYYB 5ELDA 1F77A 1XXGA 1KTKA 1FNWA 2RDHA 3EA6A 3R8BA 4NZLB 2IPKD 1STEA 3W2DA 1BCPB 2XNAC 1RDPD 1BCPC 1LT5D 1SEBD 5D3IB 1SE4A 4RHSA 5ELFA 2TSSA 5TSSA 1T5XD 2XRQD 3DWPA 1I4XA 5ELEA 4K6LA 1JWSD 1UUPA 4L63B 1PRTB 1PRTC 3DWQA 2AQ3B 1EEID 1D5ZC 1B44D 1SJHD 3GP7A 3MC0B 4DXFA 1JR0D 3BVMA 1S5DD 2QILA 1DYQA 1HA5A 1V1PA 1QILA 2QEJC 1EU3A 1TS5A 2J4XA 5FKAC 1JCKB 2G9HD 1I4PA 1I4HA 1YN3A 4OHJA 1L0YB 2NTTA 1FGBD 1TS2A 2XRSD 4TSSA 4RGMA 4UDUC 1CK1A 3MFGA
chains in the Genus database with same CATH superfamily
3ZW3A 2N9LA 3FPPA 2WU5B 2F03A 3I55A 3RNUA 1HCZA 4JCVE 3S14B 1E2ZA 1NR4A 1T3QA 2ON8A 4KSKC 1QF6A 3PLVA 3R2TA 2Q2IA 1D1IA 2WACA 3LWEA 2MH7A 4JLCA 3ZTCA 4L5SA 4ZYSA 4YSZB 4K2LA 4KKTA 1H9JA 1WTQA 3Q3FA 1F2LA 3M4PA 4IUQA 4HIMA 1SLJA 4YY3Q 3V2TA 2OTLA 1ZUD2 2K03A 5JEAG 1CHQD 4B3SQ 2R92G 3BU2A 1C0AA 4B3RQ 5EKKA 1O80A 1FYCA 4HDOA 1VCIA 4OO1G 3Q8FA 3J81i 2BB5A 1VQGA 1VQ5A 4S0RA 1NE3A 2K39A 2M19A 5GROA 5T1IA 2WXFA 4PMWA 2KN4A 4QAYA 2R93B 5IODA 2F3WA 1E22A 2D2QA 2ICIA 3AECB 5L37A 5C4JB 2DENB 4NAWB 4ACFA 4IFDJ 3QX1A 2JA8B 1X9NA 1F9PA 2VUMB 2PE9A 1QG7A 3HOYG 2JU6X 3AH7A 4GDKB 4MGKE 5D7GA 4KHPQ 2F0OA 3IRBA 1FNVA 1HUNA 1Z2MA 2MBQA 4FNFA 3KWVA 2K0PA 1LTAD 1EYCA 4XWWA 3ITPA 2B63G 1F2RI 1XEEA 1EOVA 4TUUA 4KIKB 1C3TA 1PTOC 1FVIA 2E2JB 4XWTA 4IPCA 2ZW1A 4R4QA 1HR0W 3URYA 1NAPA 1S5FD 4LNIA 1HJPA 2ACZB 3BY4B 2KTFA 5J18A 4DWFA 1SMYC 2VNUD 1KLGD 3WAMA 2BT6A 2ZTEA 3Q8BA 1QOGA 1FL0A 4KI0A 2O6VA 5IP7G 3ULPA 2MW5A 3HKZE 3G4SA 3AE8B 1WJ4A 3D6CA 4TKNA 1TBEA 1NUCA 1EF1A 5IIFA 3A33B 2B2YC 1HFGA 1PMRA 4DV2Q 1V81A 1KABA 1A62A 2M9VA 4Z9CB 4HMIA 2L15A 1J5EQ 4GKJL 1I4RA 1Y14B 2B2UA 3J81c 4IWQA 4H02A 1GNUA 1RIPA 4BAXA 1ILPA 3Q3OC 4DR5L 5HGTA 4C4VB 3NBHA 3NTHA 5GXGB 1E1OA 2JQOA 1AN8A 2DBYA 2WWZA 2A8VA 3ULLA 3GTMB 3MC9A 3KW5B 2UXBQ 2D0OA 1XXGA 1DOLA 4DDGD 1JRPA 1WE7A 3PHWB 2KHSA 3SDZA 3WOEA 1A63A 4NZLB 4DDID 4GZYC 3ND9A 2AL3A 4ARIA 5JEAJ 5FLMH 4CDFC 2DJFC 1ZKHA 2KNBA 4IM2A 2WB1G 2EYPA 4JI2L 5LNK1 2OQ0A 3JAML 4M8MA 5L95C 1CTMA 3NQTA 4X62Q 4KN7C 2Y0SG 2L52A 2N7EA 3M3JA 3BJUA 1GUGA 2RVLA 1ZYRC 2Q8RE 5C23A 3JVZX 1KRSA 2B2VA 1U4RA 3I3CA 1B44D 3OIQA 2L00B 1WFYA 4MT5A 3VR6A 1VF7A 4DV4L 3R7RA 2BH2A 3DXJC 4DR1Q 4MJSB 3UDIA 4C1NI 3AEFB 4IFDI 2MP2A 3EJIA 1MJEA 4LF4L 1PGBA 4R4OA 4B08A 2F0QA 3MHBA 4HJAA 2ZCBA 3F2BA 4KKIA 4CJ2C 3NJTA 5IT9c 1SNOA 4DV1L 1XCTL 3M62B 2L9HA 1EQVA 2MSED 2E2IH 2G45B 2MHVA 2N9XA 2ZVOA 1A5RA 3KQ4A 2K4KA 5C1ZA 4IOIE 2FCMA 4LF6L 2JK8A 2VH2A 2W3SA 3ZXRA 4GLVB 4B3ML 1IZ6A 2UYZB 1ESFA 1BCPF 1SE2A 1HNZQ 4QCLA 3U50C 2JYOA 5EBDA 2EYMA 2N49A 2BWFA 1UE1A 2ALYB 2L11A 4LNQA 5CHWA 4Y7NH 3GTLB 4A3KG 2L55A 1NENB 1N63A 2WXMA 2KCMA 1J7AA 1UH6A 3KUDB 3C1EA 2A5UA 1YNND 4GOCA 2JA7B 5G5HA 3NSWA 2I2YA 3KUPA 1TT5B 3P4SB 3ONSA 3UDGA 5M5YB 2SDFA 2GVBA 1QJOA 3Q69A 2EYJA 4YTPB 3W5UB 2XSCA 1CT1D 5HURA 3IFTA 4A3IH 2HHHQ 1GB4A 4HR7B 1VQDA 3DPDA 3AV8A 1M4VA 2JXMB 3DWAA 4LF7Q 2KAJA 2D62A 4OO1I 3HOZB 2HCCA 3TL5A 3NE5B 1Y1WG 1JOKA 2BDOA 4TRDA 3DWGC 2BA1A 1PFSA 3M7GA 1K3BC 2PW5A 4A3DG 1QB5D 1ZEQX 1JALA 2L1AA 2KMAA 4HSVA 4FVMA 4DK0A 4FF2A 4IUNA 2XK5B 4A3BB 3GOEA 4IWOA 3A9KB 1EL0A 2K6AA 1YITA 3E5SA 4DR6L 4U673 3VUWA 1ESRA 1XNRL 4DXAB 2KZRA 4DPGA 2DNEA 2WU2B 3E6ZX 4XXEA 4JBMA 2L7RA 5BYSA 1EWIA 1ENCA 4AJWA 1E24A 2N9EB 3HOUH 1XMQL 5CX3A 3VQIA 3E0EA 5FO9B 4AH6A 2JYTA 4QJFA 3PHXB 2MJEA 1ROEA 5CORA 3Q0AA 3MXUA 4URKA 4EOYA 3H1UA 5JVG3 1V8QA 4MH0E 3SXHA 1PV4A 5C3EB 4ABNA 4YY3L 5M3FB 4CDCC 4B9XA 3GB1A 3DM3A 4B3RL 1EY7A 5KHOA 2F0WA 3PMFA 3PUWA 3T3OA 1O7LA 3EBEA 3TCAA 1PGAA 2A19A 4FHKA 1LM8B 3PO2G 5ELEA 3RLOA 3G48A 1MI0A 2CKZB 3S16H 2C7HA 2NZOA 4J6IA 3DVNU 1A2TA 3JAMc 2ZJRA 1FJGQ 4W9EA 2PQEA 2K8HA 4ULLA 1JW9D 4IOCA 5JHBA 4LDTB 4A75A 1B50A 2PVGC 3NWSA 2BWES 1WMHB 1WRIA 2LMCA 3CAMA 3KF6A 1JCKB 2RBMA 3IAYA 1C77A 1R9TH 3QB3A 4DAYB 3QG1A 2CHZA 4OHJA 4F7XA 2KA7A 1PHJA 4TSSA 2Z4IA 4NP5A 4RGMA 1IGCA 2VXWA 1HZBA 2EE1A 3FPUB 2QF7A 4ZAIA 1H95A 4P6VF 5C4HA 5GADC 3AMZA 2F1MA 2ZZPB 1RFAA 4KN4C 3TMPB 2K5HA 1VRAB 1CUKA 3S24A 3OPOA 1KRTA 4C2MH 1OXXK 2OT2A 3T1YQ 1HR0Q 2BOSA 3U8ZA 1PZID 4BBSB 1J5EL 1UBIA 3Q3JA 3I90A 5M3MG 1Q3LA 4F7ZA 2BBCA 1WJJA 5C44H 1A3TA 4C3JH 2WAQG 4HK2A 4JQWC 2YU9B 1TWAH 5DM63 2UXBL 4TQUS 2INNE 3WAOA 1TWCH 4QIWB 2MJ3A 2F0HA 2EYHA 3OWFA 3U9OA 3W5OA 1TWHH 1NI3A 2FNJB 2Y5CA 5EAYA 3OAWA 5ELOA 4A90A 1UEAB 3U58A 1WF9A 3BZDB 1XNQL 1QQRA 1TU2B 3A55A 2RR9A 1GHJA 1CJEA 4EQ5A 2E2HH 3CC4A 5I6YA 3D8GA 3T4AC 1Q81C 1UGMA 2VQFQ 4MSMB 2EMTA 3W3AA 4OIKA 1WGGA 1RTNA 5IYDH 3NENA 1ZDVA 3DBLI 4TQ1A 1V97A 3I63C 2H89B 4MEMA 3OWEB 1PYSB 2DNCA 1K8OA 2MJDA 5C3JB 1EQRA 3MXPA 4NY0A 2A1AA 4PYUA 4C80A 3RZDH 2Q2TA 1AE2A 3S17B 2EY5A 1WGYA 4OZCA 4K7SA 4OW0A 3VA5A 2HJ1A 2HDMA 3U7ZA 2DYOA 3TSSA 4MHEA 2DY7A 1C7YA 1WXMA 2R92B 3AFPA 5C3XA 4ZYNA 3MFYA 2NBVB 3GQBA 2J42A 1P1AA 2B2WA 1SR3A 5MPOA 3SFDB 4P1CC 4BBRG 4MJSA 4IQZA 2Z8LA 3GTKH 3EN2A 4JI3Q 4NXML 1ZW7A 2KJRA 2BB6A 4YHHL 2J0MA 3FEWX 2MRPA 4DNIA 5M5XH 3RN9C 1SSOA 3LGJA 1EQQA 4LFCQ 3EA6A 4A3GG 2LZ6A 4LDTD 4HVBA 1OQQA 4M02A 4X3KA 5CBAE 2KEDA 4M1UB 4HJ9A 4DHZE 2OTJA 4HROA 1VCBA 3EIVA 2EY6A 1NYQA 1DGSA 3OSOA 3DWPA 3I4MG 3A7AB 1Q1BA 2DUDA 1PDQA 5CV4A 2B76B 4OGQC 5COYA 2QJLA 4W9IA 4TQ0A 3TBIB 4JV5L 2HT1A 3ULJA 1Q10A 5CV8A 1CKMA 1H9KA 1KL9A 3LXFA 1D5ZC 2HHHL 4N58A 2DYBA 4KD4A 2OJRA 3HFZB 2BF8B 1HA5A 2JF5A 3UE0A 4LF7L 4DNTB 2C35B 1TVXA 3I70A 3L08A 1YN3A 4II3B 3M63B 1AZQA 1H9RA 1QVGA 3AEBB 3WIMA 3H15A 2XTIA 4R4TA 4CBVA 3HOWG 1D1KA 5C0XG 3I5JC 4EGVA 3M3YH 1YQBA 2OXPA 2K1FA 1I50H 4X64Q 4PYZA 3MA2B 4A3JG 1Y8RC 4UP7A 3CP0A 1CM9A 4P16A 4DV5Q 3NUCA 3OLMD 2RSNA 2YV5A 3EUB2 3A0JA 3H7PA 1ZOYB 1H9SB 4K14A 2M0AA 3VUYA 2N9KA 1EY5A 2I38A 2Y5PA 2WB1B 1IGDA 2EYOA 1UF0A 2JSVX 3K7UC 2PLPA 5C4XH 2L83A 2VB2X 4GNXB 1VQMA 3JSVB 2Q5WD 2K75A 2LXAA 3ZRCA 1WWTA 2R93G 1JOQA 1N5XA 2AWNA 1G6PA 1ZP0B 3AU7A 2ID0A 4HXDA 4LJOB 2XK5A 1F9QA 4KGSA 4I6PA 4YCVA 4BXXG 1K28A 3QWNA 4TKOB 1KAAA 2VUMG 3H7SA 2K5DA 4XDCA 1JOOA 5BYQA 1YHBA 2D07B 5LL6X 1P8LA 1IKMA 1J8IA 4E74A 4L5TA 1UNSA 1BCPD 4IWPA 3V05A 1SFOB 3CF6E 3HM3A 1EEFD 1FJGL 3I57A 1G2SA 5IYCH 3S2DB 4R8NA 1P9DU 1MBYA 2JE6I 3CCQA 1D4BA 2MHJA 4GKKQ 4DR2Q 4HIDA 4FF3A 3VH3B 4IUVA 3K9PB 1VQ9A 1NYRA 2N1VA 1JICA 2UXDQ 1K3RA 3CKIB 5AUIA 2WXIA 4W9DA 4WQMA 2V3SA 3AEVA 5LMNL 1UAPA 1S72A 1K8MA 1WGRA 1U5KA 4RFBA 4LAAA 3PGEA 2Y0SE 2IGDA 4MGIE 3ERQA 3K5NA 1B8AA 1KDCA 5J22A 5C0XJ 4IDIA 1MIUA 2WP8J 3KYHC 2K6QA 3QR8A 4DHJD 5K36G 3AI5A 1DCZA 1GJXA 4JI4Q 4DQOC 1GB1A 1I4QA 2BE5C 4W9CA 1WMHA 3H91A 4IPDA 3X3MA 3T1YL 1HR0L 5KNBA 2LFNA 2N4FA 1U4AA 2IO2B 1PTOH 1XTDA 2H88B 3NZ3A 5TR5A 1L1OC 1MJDA 1JJ2A 2PMZE 3DHHC 1BT0A 4BY7B 1MPEA 4ICVA 2F0LA 5ELDA 4CJ1B 1F77A 4KMUC 5JAVA 2ZVNA 3R66C 1TIID 4FN2A 3IBEA 3ZKJC 1FNWA 1YHAA 3EVQA 3M4OH 3W2DA 5KHQA 2J7ZA 3S1NB 3BG3A 2EZVA 1XLQA 2Y5BB 3DVNV 4X3UA 2HIXA 3I91A 1WSPA 1T5XD 3ENEA 1WJUA 2K22A 1Y1WB 2ZPYA 1KDAA 3CXCA 3K9OB 2NZHA 1PRTB 1PH6A 4A3DB 5M5WB 4JI6Q 1X3GA 3GTOB 3P42A 4CJ0B 1F2ZA 3N30A 2MQHA 4JX1C 1WCMG 2GOWA 1Z5SB 1JWBD 3DCGA 3HS0C 3GP7A 3MC0B 1O7IA 2INDC 3U2SC 3CC7A 1UWXA 1I5FA 1S5DD 4IG7B 1XWEA 2RQXA 4ZKCB 2IY5B 2NUCA 4TMAB 2KD0A 1ZE3D 4ZCKA 2CKHB 1KNAA 5BMHA 2A69D 4WAAA 4V190 5JZEB 4IW0A 1LQBA 3J80i 3STBD 5A35A 4A93B 4A3FH 1V9PA 3HRZC 1R7SA 3CCEA 2HDLA 2RHSB 1OXSC 5ELNA 4C3HH 3QARA 4B9WA 3Q8AA 3U9SA 2M56B 1X3EA 3UINB 1HUMA 1OTCA 4A3EG 2WP9B 4WJNA 3K7AB 5C0XI 4FDBA 1AZPA 1XYIA 1YNTE 3S15B 2V1CC 5EPLA 4JI3L 2AWOA 3NBHB 2JYEA 4U68A 2WKDA 1XPOA 5DPSA 1XX8A 5IT9E 2JA5H 3ZLZA 2IY1B 4LFCL 1YNJD 2IDYA 1PLFA 3S1QB 2QDFA 2FCNA 1V5TA 3RLNA 3VR2A 3HHMA 5J17A 4LJPB 3AM9A 3VR3A 1WM3A 4GXBA 2L05A 2N3SA 1E8XA 3TZDA 3U4VA 3KDFA 4MN3A 1VQ7A 2YTYA 1RKNA 1I6HH 4G50A 3DBRB 2SNSA 1C9OA 1AYFA 3PCOB 1HTLD 1LLRD 3KBGA 1CKOA 1XTCD 2G4DB 3K5LA 3WCQA 1NR2A 2K14A 2B8FA 2UU7A 1QVCA 3TP8A 5G2NA 3S1RB 4LF8Q 1FXAA 1ASYA 3HM6X 2CW0D 1X3QA 2OEDA 4LW1A 2K01A 1MGSA 2KCTA 2KLGA 3EFUA 1TY0A 3OJ4B 4OX9Q 4P2CB 3J7AF 2IO3B 2WAQB 3QJYA 2VZKD 1LV9A 3L9AX 1IBKQ 2RA4A 3RNCC 1LTSD 4DV7Q 3VR4A 1BXTA 4HEDA 1IW7D 5E6OA 4DV5L 5C3EG 4LFBL 5T8IA 5EPJA 3PPAA 5C6AA 3DHQA 1GUOA 2LGXA 1CKNA 3R3MA 3HGBA 2QCZA 4ZDVA 4EEWA 4PZ7A 1QOHA 1MG8A 4FYDA 1BUVT 5BO4B 4QB4A 2XWJB 2LJIA 5IGDA 2LSSA 4BA1I 1HA6A 3H6NA 4NAMA 4TV3A 4GMVA 1VD2A 3DBHB 5D3IB 1ONLA 2YTVA 4RHSA 2F3IA 3GE3C 2GA4B 2PI2A 1SYBA 1F2YA 2ZXOA 4J15A 1U0LA 3I7FA 1JWSD 4JBWA 5KNCA 2HUGA 4RM8A 1L0VB 1FD6A 4JI8L 2D0PA 1V49A 2IWHA 3J81L 5JVH3 2PJHA 3H8HA 3IXSA 2UWQA 3A5UA 3I56A 2CU3A 4GNXA 2W3RA 1SN8A 1ZXTA 2YEPF 3JSVA 2Q2HA 3TIXA 1EU3A 4K5WA 4DUZQ 2VH1A 2M00A 4UP8A 2QEXA 2UXDL 1NVID 1WE6A 4A3MH 2DHZA 3T9LA 1KHIA 1IXRA 3IKJA 1WTXA 5AUKA 4FJZA 3X23A 4BBRB 1RLFA 5FR6A 2C5LC 4PS3A 3ML8A 3TUOA 2G9DA 4WJWA 4IKGA 1BDOA 1MSHA 3G6JB 3VYTA 4KJOA 3JAME 2A6HC 4BBSG 1X1MA 2A68C 4DKAC 1K0RA 4IFDG 3F2UA 4A4IA 4KGTA 1E0ZA 4A3GB 2KKCA 3EQLC 1GUSA 1L2FA 1Q8IA 3SK8A 3T8MA 4JC0A 4BKSD 1VQLA 3AE2B 5EGTA 4JOIA 1S5BD 5NUCA 1Y1VH 3ONAB 4C3IB 1VQJA 5T1GA 1K83H 2Z1CA 4JI4L 4LF9L 4G7OC 2VL6A 5K5PA 2Z59B 2CHWA 3D0FA 3GTLH 1PGXA 4A3CH 4W9GA 2KHJA 2Z4HA 4HCEA 5BR8Q 5FLMG 2RMMA 2X38A 5CV6A 2NVYH 4RH6A 4IURA 3CSTA 3FRPB 4FHJA 1RAXA 3ZUNA 5G3LD 4KK7A 4AP4C 3T1HQ 3VRAB 3PO3B 2K04A 4B0MA 3OW2A 2Y3AA 1SYDA 2NPTA 4L2YA 1CHPD 3V62A 3M4QA 1SE3A 3CW2C 2IO1B 2Z9HA 4IPHA 2AUKA 4KDIC 2M4NA 2LFIA 2K32A 3GTGB 3I4NH 4MIUA 1M90C 4JI6L 1LTRD 5IGGA 3HOWB 3APDA 4WAFA 5M9OA 1JRUA 1P98A 4IUPA 2L0CA 1HQRD 4A3JB 2IL8A 2KOLA 4C1NK 4LCDE 4RNAA 4DK5A 3VDZA 3AN1A 3BYTB 1TS4A 1VJKA 3QCAA 2V4IB 2LMCB 1QZHA 2G1EA 3KF6B 2LUMA 3D4DA 1M8AA 2NTSA 1ML0D 2WXPA 1KH0A 5L83A 4ZRKA 3RD2A 1A8VA 2IJ0A 2ZJPA 2KDFB 1OXTA 2F0SA 5J2RA 3MEHA 4JBKA 2NBFA 2RHQB 1UELA 4KX6B 1Q7YC 1EY6A 5EKIA 1XLPA 1TZOA 1ZPSA 2LRWA 1A70A 3C46A 2BKRB 3T56B 1BUIC 1AW7A 4LFAQ 1SYCA 1SXTA 1BNZA 2LVPA 1PH7A 2ZCCA 4MDKE 3DM1A 2K5NA 4BY1B 2MBEA 1HFNA 2DZKA 2JVCA 2N0SB 3BYYB 5I6WA 2KMCA 4YT0B 3PT2B 3DEPA 1VZ6A 1YJIA 3MHZA 4RKBA 4W9KA 2F0IA 1Q1OA 4XE0A 1RL2A 4YTNB 2R7ZH 1WYGA 4NJ7A 1HZAA 4EQOA 3P75A 4AYBB 4X3SA 4X3TA 4A3IG 3L4PA 2KQ4X 1R4MI 3W1BA 2L5TA 2LGYA 4HIKA 1YJJA 3RZWC 3DWQA 3BS1A 1XLNA 2LJ5A 3PRZA 3HOXB 3M9BA 1SJHD 4K0KQ 1OXUA 2X6GA 1BOSA 3BVMA 3FKIB 3N32A 2WNMA 4LK0M 1TS5A 3HZXA 1KNEA 3CPWA 5JHAA 3ZJVA 2G9HD 2RSOA 2JZZA 2ZM6Q 4B3TQ 3ECIA 1FCCC 4KHZA 2MBOA 5HI1A 4LF8L 4BKSA 2NN6G 1IBLL 2D10A 2K3UA 1EO6A 4HMJA 1G291 3RZOB 2EYFA 3B1LX 4AOFA 2EVBA 3H0GH 3HOUG 2AQ2B 4A3LH 4EZLA 2B39A 4XT1B 1WTHA 1VQ6A 1TJEA 1SMYD 4LMQD 3OYYA 2XIWA 2WDTB 4C56C 2B2TA 3KF8B 3A4SC 4ICUA 1FCLA 3AE6B 1LABA 2W55A 3I3TB 1QKZA 3TP5A 3ZNZB 2HE7A 4WJ4A 3WALA 2X69A 2V1YA 1SE8A 3TEXA 3NTIA 2AHOB 4ZRZA 2AL6A 2F0NA 4WRDA 1WCMB 1STYA 2ZNVB 4O0AA 4A8XC 5FJ8H 1W6JA 3QHTA 3P4PB 1HNWQ 2C7MB 3ND8A 1WX7A 4E71A 1CSQA 4K5VA 1L5PA 1ASZA 3AU5A 3AB9A 2I1JA 2JA6H 4JI7Q 1XT9B 2CHBD 2IX1A 5EE0A 4FF4A 4P1BC 1DOMA 3PZ7A 3BVGA 1ZYRD 1IHZA 1WH3A 4J6HA 2EIFA 1YX5B 4JE3B 3BVZA 1IBMQ 2F0FA 1W6KA 3HRDD 4GN5A 1YNNC 2SEBD 3ZO5B 4IUMB 1WIAA 1KQSA 3V3XA 1FGUA 3SHQA 1BR9A 3D4RA 1S4ZA 1TY2A 1SSNA 2F0KA 4F87A 1GUTA 2K5VA 5LMUQ 2B3AA 3KWLA 4F8MA 2AQ1B 5I9OA 4DV6Q 5JEAH 4A3EB 2R92H 1WXAA 4MTNA 3F1ZA 4HEA1 3TZUA 2UUCQ 4H44C 3PZ8A 3QQ8B 4AUQC 4J8QA 1LT3D 1QE6A 1XPRA 4BY7G 1STAA 3GS2A 1LT4D 3V6CB 2NVXH 1KXLA 4AQ7A 4KJNA 2KJ6A 4RAUC 3F2DA 3A54A 5J3BA 1D5MC 1N33L 1T0RC 4W9FA 1IYFA 4L6TB 3ABVB 3H7PB 4K7WA 4FXDA 3FKYA 4OWWB 2KHWB 2NB0A 3HOYH 3E3XA 4PMBA 4JI5Q 3NHHA 3CCRA 1F2MA 3E9IA 1EY9A 1ZKOA 2FUG1 2WFWA 5BR8L 2KJHB 3J7AV 2B63H 1STEA 3MXNA 4DR7Q 2BS2B 1VQFA 3WWVA 1LT5D 5C4ZA 3HUIA 2KHIA 3RD4A 3T1HL 2CJNA 4DR3Q 2YYZA 4ZUJA 1IPGA 1MG4A 3GZNB 3TDQA 4FXKC 2N8NA 5C2TB 4X6AH 5E6PA 1DOYA 3RMHA 5IP7H 1B9NA 4WFN3 3J7A5 1LACA 4M00A 4G7HC 2L12A 4DXFA 1JR0D 2KQSA 2MCNB 1VQ8A 3CIRB 2VZAA 4IJHA 1DYQA 1NTGA 2Q8TA 1QILA 1Y56A 3PRMB 4PT5A 4MGYE 5JJIA 4A93G 2GVAA 2NWGA 4IJLA 2C7NB 2MO0A 1FGBD 1TS2A 2UUBQ 5IWAQ 2GI9A 4B3SL 1J19A 1R4MB 1WR6E 3P4QB 1CK1A 4L5RC 4C7YA 2B2YA 2V9HA 2BYEA 2NYZD 4HLEA 3SVMA 3RLFA 2R6GA 3I73A 3N20C 4YSYB 3AB5A 3EROA 1D8LA 4KVGB 4B6WA 1PA6A 1OGWA 3T53B 3ETRA 4KSLC 1HTPA 4HCPB 2ZTDA 4PV1C 1Q82C 3CMAA 1B9MA 4DR4Q 5LLIA 2QMTA 4JI1Q 2NBUA 3C0RB 2EY2A 2NN6I 4LFAL 1PUTA 4KHPL 4OZAA 1WXVA 1PH4A 3WA0A 1SE9A 2PTLA 2L0FA 1P7FA 2CH4A 3NG0A 4A76A 1V1PB 1GUNA 1QWYA 5EDSA 1I7HA 4CQNA 2EQSA 3A1QA 1OFFA 1K8AC 3VR8B 1UE7A 1HZ5A 4ZRIA 4DA2A 2OWOA 1XLOA 2AEHA 2D9UA 3C3LA 1ZXHA 4DBGA 2H4OA 5CBEE 2HTME 3UI2A 1KDBA 1FFVA 5DEHA 4GIVA 1L6VA 2B29A 3D31A 4ILWA 1IL2A 2MWSB 1B70B 3LWUA 2VQEQ 4Y52H 5FO7B 1V2YA 1E7PB 1U4PA 3VAWA 4IOAA 2JZPA 1QUQA 4DV2L 1QOBA 4RGNA 1YJ9A 2DX5B 4MH8A 2A6EC 1AFPA 1NJIC 2FFKB 1MD2D 1SIJA 1TS3A 3VTVA 4F8CB 4K2KA 1A6XA 2XN9C 1FPYA 2ICEC 1VQBA 2O5JC 1E7UA 1LFDA 4B3TL 4I7ZC 5CC4A 3GV3A 4MACA 3TN2A 1DJRD 4EE2A 4FXCA 4NQLB 4A3KH 1LO5D 1MJCA 1TYGB 3TMEA 2F0PA 1PH5A 2KLCA 1GUWA 2KC1A 4DAMA 2PCFB 1EIFA 1NY4A 2G4SA 4X62L 4A55A 2R61A 2JZ3B 3EGRA 3NTKA 3UDFA 4P71A 1GC7A 1F2RC 1CZGA 1GPXA 1GAQB 1A3VA 4M01A 5AJ3Q 1SDFA 2E8GA 2AWTA 4DR1L 2JXXA 2RDHA 2EXDA 3A74A 4K8JA 3KLSA 3VFKA 1BCPB 1S1QB 4GLSC 2XWBB 1JT8A 1JORA 4GDLA 3QA8A 1J9OA 1S40A 5M5WH 3TRZA 3D4WA 2J0KA 2V3NA 1I6VC 3EC8A 3U30A 1CMXB 3A9JA 4XTCS 3K58A 1RWSA 2FIFA 4XYOA 2GBNA 4ANWA 2E2IB 3KF8A 3LB8C 1B3AA 1MHWC 2MO1A 4QIWE 3NVVA 4BOZB 3E9SA 2VW9A 2WXKA 5FOBB 4MM3A 5GAEC 3KDFB 3APFA 2PZTA 1E8YA 4B9KA 1HNZL 2P5ZX 3NVYA 3L0WB 1WGHA 4V0BA 4MZ9A 1E9MA 2M1MA 2HTHA 5IGBA 4WIPA 1F0ZA 1I4PA 4O42A 4E6IA 2G5DA 1C4PA 1L6UA 2WYQA 2XRSD 4IC7B 5BYRA 4Y7NB 3W1GA 5LMUL 3KOJA 4C3IG 2DN8A 2CR5A 1WYDA 3OTOQ 4DV6L 3DVGY 3FC4A 1TR5A 1EYDA 4N9PA 1DONA 1YQ4B 2WLBA 3UE1A 5HFYA 3VDYA 3W1SA 1UE6A 1JMLA 5DPRA 4YWGG 5IE8A 4A6QA 2OF1A 4GOPB 1F9SA 5KGUA 3AE9B 3EHVA 3AE3B 3PO2H 4JW0A 3K7AH 2RDFA 1UBQA 1TWGH 5KRUA 1XPUA 1OEYA 4RCOA 4A3IB 2WXGA 1N34Q 3DOWA 1LGRA 3PO3G 2NVTH 3VR9B 4QL5A 3Q2AC 2O2VA 1VQNA 1CKNB 1I4GA 1HRJA 1V80A 2F0MA 2I5MX 4N6EB 2G3QB 2JT4B 1WTOA 1P7EA 3RNBC 5CYUA 2LGDA 4JI0Q 1QCBD 3AYHB 4DU9A 4ASWC 1DOIA 1A3UA 3M4YA 4KY7A 5H1SE 4BBNF 2OQKA 3SDLC 1EFID 1W3SA 1G6ZA 4DR3L 1E5WA 3ZJUA 1STNA 2LXJA 2CWAA 2K7VA 5I2YA 1OO9B 2KQ7A 2FJ2A 2JPHA 5G3LF 1K0SA 3AEGB 1IYUA 2ZT9C 3L3OC 3HOVG 3DDCB 4BWGB 3A4RA 3NZSA 2J53A 4OWTB 3GTQB 4HN7A 4KHVA 2DWQA 3HOUB 1SGHA 3VRBB 4EZJA 1EQTA 4IN3A 3KYDD 5FLXL 2JEBI 3RR5A 1WFQA 1OXVA 2PQAB 3K0XA 4WJQA 3DBRI 1ET6A 1TWFH 2E2DC 2DLBA 1RCVD 5M3MH 4K5XA 5E3FA 4A3FG 3GTJB 1ENFA 2RDGA 1I3QH 5IP9H 1F1HA 2ZTCA 5IWAL 2F4VQ 5JPNC 1GG3A 4LJZC 3MVVA 2MBBB 4ZRJA 4YXDB 5IGFA 3U52E 3HK0A 4RA8A 2WHIA 3VUXA 3CHBD 1F9JA 4G57A 2UXCQ 2M0XA 5CHFA 2RSUA 4BY1G 4LUVA 2KWUB 1BO0A 1WTVA 2KK8A 4XYQA 1YBYA 4HKQA 3KVFB 4OL7A 1B53A 3J80L 3U4ZA 1PH1A 4JI1L 3K81C 4AYBG 2PI2E 3I4LA 4Q5VA 1PVOA 3KFUA 1RM6C 2WXOA 5EJWA 3Q14C 1CI3M 1YX6B 4DHJB 3HEJA 3T3NA 3R8BA 2J0TD 5EBCA 4GU2A 3M95A 2RDBC 3L13A 2WB1E 4WQOB 2A4ZA 1FRDA 1SE4A 3HOXG 1HNXQ 5EE9A 1C4QA 3UIPB 2IT1A 2R2OA 4L23A 2WXHA 3FKIG 1T0YA 4FADA 3OIPA 4K6LA 4CDDC 3DBHI 4LF5Q 2NPTB 2XEWA 4G3XB 4PZ8A 2NVQH 4C2MB 1Z47A 3QK0A 4W9LA 1EIGA 2DAFA 1M94A 2QILA 3RI7C 1V1PA 5E6NA 2LXKA 5BN3A 3VR5A 2K5WA 2C5CA 2JWUA 2CH4W 3D3RA 4XQNA 3ZNHB 2R3ZA 1H9MA 1I4HA 2SNMA 1T9HA 5C44B 4BA2I 2J7QB 1N6ZA 3L16A 4C3JB 2NTTA 2JEAI 4XC2A 2VZKB 2FMCA 4KKUA 2QDBA 4A3GH 1TWCB 5A2QL 1Z9FA 1ICWA 2MFIA 4X66Q 1KM7A 1TWHB 2C9OA 1Q86C 3TEWA 3UQAA 1KC8C 3GTPH 1SNPA 1PTOF 4UHVA 2I0QA 2V3PA 3J81E 4WJPA 1GKHA 3I4MH 1L0WA 4OVZA 2GBRA 3S2HH 2PW7A 1MHXA 3MTSA 2V4DA 4PMCA 1GJZA 2WX0A 2KCCA 1B1ZA 2OEOA 4DAPA 2CS4A 1GHKA 2VQFL 1VMCA 4Q0FA 4ZHOA 2X8XX 4DF7A 4GNXC 4P75A 5I9PA 2Z6KC 3BDCA 1M1KC 4CHKA 1QNKA 3F8TA 4QF4A 4TVAB 4ZKBB 3STBC 1NNXA 1X6OA 1C1YB 4QGUA 3CQZH 1TQOA 4NW2A 4CKEA 2KC2A 3Q8CA 2LGSA 5HKHA 3Q22A 1N62A 3S14H 2QSDA 2FHTA 3H6MA 3RZDB 3HOWH 5BMIA 4X65Q 5C0XH 2GB1A 2MX2A 2FIDA 1C4AA 2W82A 1VQHA 1WVLA 4JPBW 3OMCA 1YJ1A 4JOIC 3NBIA 4HAEA 4A3MG 1Q5WB 3OG5A 3RCZA 2F0UA 4LUOA 2WDQB 2ASQA 3BZCA 3OMGA 4YCUA 3DUZA 3VHTC 1V43A 2JQRB 5FLXc 1RHPA 2I46A 3GTKB 3IG3A 4K6DA 4CHTB 5C5MA 5M5XB 1EU4A 2L3ZA 4BS9A 2R93H 5IOIA 1TZ1A 4KDLB 5JH5C 5DM73 3ZJTA 3S1MB 5C4JH 2H1EA 4RGOS 2E6XA 3OTOL 1NDDA 1LTID 2I1KA 2OJWA 3AE5B 2ES2A 4JVZA 2JA8H 1XO3A 2IY0B 2VUMH 2Z0SA 1TIFA 1SIFA 2C9WB 3FAHA 3I9V1 4K7UA 3WANA 2KQ3A 4YCWA 1Y8PB 4NXNQ 1P3QU 4A3CG 1ZGUB 4K81A 3TBLD 2C60A 4W9HA 4CYEA 4B95A 2LUEA 3NZUA 5C3WA 1JWAD 3EFXD 2KWVB 2E2JH 1E2WA 5J39A 4H13C 2CW0C 2BGFA 4OVUA 5AZFA 3J80c 1FRRA 3W9CB 1WM2A 4G7ZC 2BS3B 2RKSA 3L7ZC 3AEEB 1EUJA 1PDXA 3QJZA 3V6EB 3PIOA 4JI0L 5EPKA 3PUYA 1WTPA 1XD3B 4J1MA 4YWLA 5TSSA 3W5VB 4GSWA 1N9WA 3LX0A 2PEAA 4GOPA 1Q12A 1QZGA 3M3YB 4X64L 1PRTC 2KWDA 1LYLA 1JE5A 2HIVA 4RM9A 1JQ4A 4ZRQA 2JJQA 1OEYJ 4US9A 4ME5A 1STGA 3GTMH 5K36H 1TTNA 3NRZA 2K52A 4HJ8A 4H2AA 1AEXA 1JB3A 1NMFA 2IZVB 2QC8A 1KD1C 1EOTA 4WWNA 2ZPNA 3RUIB 5CTRC 4KD3A 5C4XB 1D3ZA 5ISRA 3CC2A 1YIJA 1BMLC 1YD8U 3M7NA 4KLKA 3I2ZA 1WZ0A 5H92C 2KFKB 1V5OA 3P1MA 1FEHA 3AEAB 3IFDA 3SU8X 3H94A 1YQ3B 2WV6D 2F4VL 2IBIB 2UU9Q 2ZJQA 4H0LC 2IX0A 3P4RB 5IAAC 3ZDTA 1HXYD 2WQYB 3C19A 2EY1A 2LKVA 1WI0A 4BFRA 2EOTA 3A7LA 4ZQ3A 2RD0A 4Q2JA 2F0DA 3C2PA 2LHDA 3FILB 2E3TA 4C00A 4P72A 1K53A 2PQAA 5FK9C 2WAQE 2B2UC 3QOJA 3CPFA 4GKKL 4LF4Q 2K33A 4R4CA 5LL6S 4DR2L 3NS8A 3ZVVA 2KJXA 1UGJA 3ZDMC 1XF5L 1N32Q 4XDDA 2VS1A 4QY7A 3NELA 4ZLTF 4M0WA 4DV1Q 4KV6A 1LUZA 1TXYA 4LUZA 4N8X1 2PW9A 3KLSX 3B2GA 5EQ0A 1QVFA 3BINA 5CV9A 3PIPA 4ALPA 1EF5A 3MXNB 4USAA 1G8ZD 1DOKA 1U4LA 1LTGD 3QIAA 1LT6D 1Y8OB 4FO2A 1HNXL 3QWZB 2KN5A 3AXCA 2M17A 3VA7A 1UD7A 1PFDA 1E7VA 4ZUIA 2HD5B 4R3DA 1GC6A 1C9FA 3AE7B 4R8IA 1AH9A 4KV2A 3RUZA 4M8AA 1WR1A 3VTUA 5GAHC 4EKUA 4ANXA 3MTNB 3ZIMA 2MEKA 1EY0A 3NOBA 5D2MB 3PS6A 1CZPA 2B2TC 2B2VC 2J52A 2CWPA 1PTOB 1V9JA 1PYWD 1SYFA 3RNAC 1SYGA 3VYRA 2JA7H 5DPWA 2LXCA 4APVA 2O5IC 2K8BA 3Q6BA 5E7NA 3M4OB 5M5YH 2KFJA 4WWMA 1ENAA 1RF2D 3A56A 3ZXVA 5CGKA 1R4NI 2EJFC 4PK1A 4XQJA 2F52A 2PZUA 1UZXB 2V4LA 3PTFC 1F9RA 3A8JE 3Q24A 2Q8IB 4WURA 2PIAA 5HY6A 3QIJA 5ELBA 2A6HD 4DXGA 4OELB 4RF0A 3TJPA 2A68D 4KGRA 1MSGA 4JIOU 5IYBH 3HOZH 2N7JA 1SMXA 1D2BA 1FXIA 2KVZA 1HH2P 4FBJB 1Q8KA 5I4DA 3QAQA 3MP9A 3ZTDA 3PIO3 1E8ZA 3B08A 1SBBB 2KO3A 3DMUA 2JX5A 3KLRA 2WDVB 1NI2A 1WX8A 4WWOA 4B0EA 3HOVB 1K9MC 4A3BH 5KYLA 2L4NA 2LY7A 4OIJA 2IHEA 3BZKA 5IA7A 1XNRQ 1HPCA 1VZ7A 3A1QB 3CCLA 4WORA 2BYTA 3ZGZA 3SR1A 4N8FA 3J81j 2BVCA 3DBSA 3ALBA 4FULA 2PVOD 3IT6B 1PH2A 2DGYA 3AE1B 1RJTA 1X32A 1XMQQ 3H3VI 2AQ3B 2KVMA 3N1ZC 4XZ4A 2KECA 4X65L 4A3FB 4FJVB 4L1BA 3GZNI 5AFWA 3RN2A 4I6LB 2KDEB 2PNRC 4C3HB 1MFWA 2GLSA 3QO2A 4S3SA 5C3EH 5CHVC 3RMKC 1QUQB 2KX0A 4K3CA 2O4XA 5M3FH 4LTUA 2FMMA 4OONA 2J4XA 3HKZB 2GRIA 4WWPA 2SAKA 4JBJA 2CVRA 1NBFC 1YHQA 1HEZE 3PSIA 3PSEB 1UWVA 3SK6A 3RULA 1JROA 2AUJD 1E6EB 3PVLA 1YVCA 3LNNA 2JRHA 1Q90A 3APCA 4QUCA 1VQCA 2JA5B 1VF5C 3FDTA 2E74C 5JPMC 1ACCA 4DAVA 2OOBB 3PGZA 2YLMA 1D5XC 3RNFC 5LMNW 4WJ3M 2I5HA 4ZHPA 3WDNA 2JXTA 4MGZE 5G5GA 3P7JA 4HCSA 2GN5A 4NXNL 2ZJDA 2QIEB 1DM0B 1STHA 3AU4A 3RPFC 3R93A 1G2TA 2KX3A 2WIIB 1EUVB 5E6JA 2KT7A 1G6JA 3FHWA 1EIHA 1I6HB 4NNJB 3G6EA 1EM7A 3EECA 5IOCA 3PIP3 3UGBB 1II3A 1B3QA 1X3PA 3H9DA 3K5MA 1XCQL 1YJNA 4NJ6A 1E8WA 4ITKA 2UUAQ 3ZRFA 4UP9A 3CCUA 1VS0A 3KUZA 4MELA 2PPBC 3MZ5A 1PTOD 2DZMA 1CQFA 1GXDC 4LNOA 3U4EG 4K8IA 1KRHA 4GDLB 3IAM1 4ZK9B 2DJGC 1IYVA 5DAUA 4OX9L 2K25A 2IO0B 2FINB 4BBSH 3UDXA 1IBKL 3A9JB 1ET9A 4DV7L 1LM0A 4IFDH 2R7DA 3K59A 3Q23A 3TEYA 3TP6A 3C1FA 4AYBE 4K3BA 4NJCA 1RD9D 3SEBA 4DV0Q 4UAIA 1AARA 2YU9H 4KY6A 4RHRA 4AIMA 1T6BX 2RGFA 2N88A 3L2PA 2Z0DB 3LDZE 4FA6A 1PZJD 2XBBC 2NR2A 4N9TA 1RFKA 2F4IA 2KXJA 3K6OA 1N5WA 1S5CD 5LXHA 4A9AA 1IYJB 2YEPB 3J9CA 3MAQA 5FO8B 1SNQA 2EPBA 5HG2A 2NZ1D 1GM5A 1XNQQ 1KIXA 3P2BA 3B0AA 1WTRA 2UU9L 3TEZA 3A5ZB 4XDXA 2ENBA 2GBKA 4HPLB 4PG3A 1C76A 1O7ZA 1OQYA 4MSQB 2D3GA 3CWIA 3VVWB 3UI3A 1EWCA 1NEKB 3OHXC 3PUZA 1S3SG 1KLUD 2L8JA 3HVDA 4PNYA 4YWMA 3KJOA 2BYVE 3RYTA 5G55A 1PFMA 5EE1A 2A73B 1AWDA 5C5LA 4KTAA 4DUZL 2RF4A 2DZJA 3ZQ4A 1J7BA 2KFKA 4P74A 2AMCB 3S17H 2K8CA 2O2VB 5IN7A 1N32L 1R4NB 1RDPD 3ICEA 1WD1A 5ELFA 4A3MB 1QOFA 4LNFA 3RNGC 2EMSA 4IZ8A 3P20A 1JJGA 2KTRA 2FAZA 1HZ9A 2X6LA 3X0WA 1NCVA 4L63B 4CDEC 1YJWA 4OO1H 4C7ZA 1UEBA 1EYAA 2K50A 3G7LA 3FILA 4P7IA 3NVWA 3S2AA 1SNCA 5BMGA 4RG1A 2KVRA 4XT3B 5C44G 3AQQA 3DHGC 3AE4B 4C3JG 2D3BA 1VLBA 4NXMQ 2D5GA 3GD7A 1HTOA 4DUYQ 1IP9A 1Y1VB 2WINB 4YHHQ 2K9XA 2KANA 1K83B 2W9NA 3IVFA 3HP3A 2B8GA 5HHDG 3TP7A 3D6WA 3AEDB 1YMHE 1A0IA 3CCJA 2QKIC 3TQYA 2NVYB 3NP8A 3MFGA 3CMEA 3RZFA 3NVZA 1MI2A 1WZ3A 3CCVA 1PH8A 2EDGA 3K0YA 3UIOB 3UQBA 1J0GA 3N9YC 4EZKA 3Q8DA 4JV5Q 1P0RA 3AULA 2RCFA 2F0EA 1V1QA 4OEMB 2BW2A 2MLBA 3GV6A 1FR3A 2CQAA 1N60A 2FCSA 5IYDG 4HJ5A 3I4NB 2J0JA 2B2WC 1Z7TA 2V0GA 4JWSC 3JAMi 2JWZA 3NUHB 2O2LD 2WX1A 3IT4B 2ZNVC 2A74C 2DYMA 2IGGA 4FLHA 2BTEA 4YL8A 2F0VA 4IUTA 1J8CA 1V8CA 3S9WA 1WTWA 2FXQA 4HKZE 2LD9A 5JJLA 3L0OA 4DK3C 2NN6H 1EZ6A 2SOBA 2JP1A 4FF1A 1WXQA 3SHLA 3L54A 2CCZA 3GTQH 1WY8A 2L1BA 2PZWA 3W1SC 2DZIA 2N9PC 4CKBA 4JYAQ 2PKOA 4US8A 2E75C 3PLUA 2F0GA 3NS1A 1JWUD 2L76A 3L10B 5AEKB 5D14A 1SAPA 3OW7A 2QHOA 3MEFA 3GTJH 3SD5A 2RPQA 2N55A 2F0JA 3B2FA 4GN4B 4POFA 1B9RA 4EVOA 1IUEA 4FJYA 3TEHB 1X3FA 1UE5A 2N1WA 4RGTA 4UPAA 5D3DA 2WXNA 5ELCA 2MP1A 1IKLA 1HHVA 2R7ZB 1KOTA 1EZ8A 1SFOH 2AYOB 1WX9A 3BK2A 3S2DH 1MVKA 1O7YA 1R4PB 5DNFA 3O13A 1SYEA 3HVZA 5KIXA 2JA9A 1VQEA 1E10A 1NBWA 3VH4B 2D3CA 3X3NA 2PE6B 1X55A 4K0KL 5FLXE 1D7QA 4CO7A 2MGSA 2ATWA 1VDVA 1EY4A 3M85A 5LMNQ 2NCNA 2KBNA 3ERSX 3W1YA 2IPKD 2JY6A 1KJTA 2ZM6L 3N1XC 4MNOA 2UUAL 1G51A 1V6EA 4IM3A 2LWPA 3H3VC 3A8IE 3A8KE 1C78A 4NAWA 2KYWA 3SGIA 2BDNA 5BN5A 2LVQA 3TREA 3T51B 4GDKA 3H0GB 2BCOA 1OQRA 3KH0A 4WH4A 3SK5A 1A15A 1C48A 5C4XG 4ZOHC 2EXZA 2E76C 4KKSA 5KNDA 3J80E 4BY7H 1G91A 3NQIA 1VQOA 1PQSA 1ZXIA 4RKLA 4KIKA 1B4OA 2JSOA 1ICFB 4BKTA 3AFQA 4DV0L 5IP9G 4AS1A 1IBXB 3S1NH 1ILQA 2A6ED 3CSFA 2Z6BA 3E56A 1L0YB 5E1FA 3CRKC 4QMGA 2JRIB 1JB7A 3R3OA 3RNEC 4ARCA 4UDUC 1Y1WH 2VB3X 4A3PA 1E3PA 2DAJA 1JC7A 2YVCA 1JMCA 4A3DH 1D6EC 4F88A 1HNWL 1LXDA 3GTOH 5IYCG 2HCIA 3PO0A 4HJGE 4XQQA 3PF4A 4HDQA 3Q8EA 1Q46A 2QDLA 3TS2A 3DWMA 1WOCA 3MXGA 4MM3B 3GDEA 2R7FA 3P1HA 2EKIA 3QOLA 3Q3MC 2WXLA 5GAGC 2A5HA 3DVGX 4C4VA 4JI7L 2JA6B 4DHZB 3KYCD 4DK6C 3NHEB 4ANVA 1RYJA 3VTWA 1Y69U 4RMAA 1YEZA 1N61A 2MNAA 2LEKA 1IBML 1PRTF 1DD2A 3Q6SA 3O65B 3PUXA 5BN4A 1PH3A 3NXWA 3CF5A 1EIYB 4A93H 3IHPC 4NQKE 5A2QE 5EE3A 3V60A 1TKGA 3TS0A 4I65A 5I2XA 2UUCL 1CFMA 5JJZA 1QLBB 2BKFA 4EX5A 4R4IA 1C8CA 2NVXB 5F2DA 1FMAD 1FXTB 3NEMA 1K50A 1YN5A 3S15H 3SK4A 1PZKD 4CKCA 5LXIB 4NPSA 4L5QA 4DUYL 2QW7A 2CJOA 4XIGS 2YTXA 2KEEA 3S1QH 3HOYB 4GB9A 1V86A 4JI5L 4RMFA 3R7QA 3S1MH 1RRBA 4KY5A 4JPSA 3K8AA 4ME3A 4HPPA 3FP9A 4DR7L 1LTLA 1SROA 1X54A 4R9WA 1E0BA 4GLXA 1BF4A 1CQVA 2B63B 2BYFA 3C8YA 1X65A 3MJ5A 4PS7A 5GMVA 1TKWB 3HKSA 1YN4A 1B2TA 5CR3A 4QUFA 4HJKA 4BKGA 4M8NA 2VRRB 1SJED 3PQIA 1HTQA 3I4OA 1QZEA 2WXRA 3J7YW 2W54A 1KF6B 4IM0A 3CD6A 3PF5A 2L32A 2VY3A 2R2QA 1L1OB 3N52A 3DEOA 2L0TA 1E7ZA 2CU1A 3GO5A 3S1RH 1WYWB 4OVVA 1YZ6A 3J7ZC 4IO9A 3FMCA 4YWKA 3ZYYX 1L7YA 1K73C 1YNXA 4CGYB 5AZHA 1WI5A 2F3VA 1H4RA 1BCPC 3IL8A 1CZWA 2UUBL 2INCC 4M0WB 2EELA 2NBWB 4C3HG 4DNRB 1I94Q 1DZ1A 2M2LA 3OOCA 4LFBQ 2AX5A 1UUPA 1TKEA 2KACA 3KLWA 1XMOQ 1BVSA 1MKHA 3HKZG 3IFWB 5D6JB 1JE4A 2WXJA 2KUMA 1EEID 3S16B 1YI2A 2PMVA 4JYAL 4NB3A 4AQYQ 1WGKA 2D11A 4A3OA 3MC8A 2Y0SB 4DR4L 2JA5G 3JC66 5FKAC 1WRDB 1DGJA 2K6DB 3DHIC 4EQNA 2AKWB 2K5PA 1HQMC 1AE3A 2KENA 3A9KA 2JA8G 4HTHA 2MA9B 3EFCA 1VZ8A 1R9TB 1SNMA 1T0QC 3AMUA 2EJGC 2GBJA 2KMMA 3Q3NC 4LK1C 3D32A 3U7DA 2QA4A 4BVUC 2KOXA 2PMZB 4JI8Q 4GOPC 1S5ED 4IUUA 1UWMA 2NMQA 3IAS1 4GGQA 2VQEL 4G11A 3RT3B 3KJPA 2QGQA 1N36Q 5J1ZA 5IGEA 2WXQA 4FP5D 1PXUA 4X57B 1Q0WB 4N9F4 1JWMD 2KDBA 3HIZA 5H8YE 4BBRH 1NMGA 1VQAA 1L4ZB 4POGA 1SF0A 1VMPA 5E4XA 4JL9A 2LS01 1TWAB 3N1YC 1FIQA 3NK9A 1QNUA 4O2DA 1PFNA 4RWSC 5EKLA 5D65A 2REXA 4K1RB 4XX5A 5CV5A 3NPPA 1FNUA 3CU7A 1HE8A 2MQJA 4A3KB 4C3IH 2OHFA 1C79A 3DQVA 1LTTD 3ZNGC 2D3AA 4KKJA 1S3OA 4LF9Q 5IGCA 1TKYA 5GQOA 2ZW0A 4YSXB 4ZRPA 1L2NA 2LASA 4JK1C 2OCEA 2PPHA 2D5DA 2IW3A 2PYKA 3KBXA 2MBHA 3DBLB 4LWCA 1STBA 4NKLA 1GUAB 1U9RA 2LGIA 2E5LQ 2ASBA 1K8GA 4LNKA 2RPVA 2WKCA 2BE5D 4DAYA 2E2HB 1XQQA 1GO3E 3BIID 1E1TA 2LVOA 2A69C 4A20A 5JOBA 3RN5A 1SNDA 2BA0A 4AJYB 5AJ3L 1W2BA 4II2B 4HSPA 1K52A 3PO3H 2MUYA 1DXMA 1L0XB 4MTKA 4DV3Q 3PV1A 2KWCA 5E4WC 1A2UA 2INPE 2Z0EB 4QQBX 4GLAC 4HWIB 3NY5A 3P63A 1ZDXA 2K28A 3K5OA 3N6RA 3GTGH 3R2IA 2BQQA 3L17A 2NVUI 4DK1A 5LHY1 2WDRB 2D2CC 4ID6A 1V1OA 2FUHB 1I42A 4IPGA 4A3JH 4BZAA 2MJ8A 3VYUA 1Y8NB 2EYLA 1VR9A 2N7DA 1I35A 1IBXA 1EFWA 3V96A 1HZ6A 3HOVH 2IYDB 2NS5A 3KK7A 2LHEA 1YNJC 2F0TA 1L4DB 3V61A 1KTKA 1WGDA 2LI5A 3SFEB 1E2VA 3VXWA 3CCSA 3FVQA 1C4CA 2HDEA 2HJ8A 4S17A 1X56A 2H5XA 1HZCA 3LYYA 1IL8A 2TMPA 1YIWA 4ANUA 4FXGC 2TSSA 4W9JA 3B9JA 1J6QA 4HPMB 4EQPA 1EWYC 4D2KA 1AP0A 1BKBA 1Y1VG 1R4QB 3I72A 2BH8A 4BXXH 2O6VB 1OTRB 3OJ3A 4E3CA 1PYBA 2BPSA 3WOFA 4NPNA 1RTOA 1KFYB 1QT9A 5D94A 2N78A 4G0NB 2CFMA 2I5LX 5CV7A 1TT2A 2K1BA 4BY1H 2IGHA 1GVPA 1FFUA 3PO2B 2JA7G 5DPTA 1TWGB 1N8RC 1BQQT 1N34L 1O78A 2NVTB 4NDXA 2LRUA 1QOAA 3ZNID 5DCNA 1CSPA 1FM0D 1H8CA 1BBUA 1WXSA 1CA6A 1IW7C 3I4NG 3I8ZA 5IY0A 5IYBG 2ZXPA 3HOZG 4OXPA 3DLLA 2HQLA 5DLQE 3CRLC 3HOXH 4HIOA 1LTBD 1XJVA 3KUCB 1I50B 4GKJQ 1Q1EA 2WS3B 4XGAB 1Z6HA 3FKIH 1WJNA 1GD7A 4DR5Q 3K80C 1VQKA 4LNNA 4A3BG 1FO4A 4O1NA 3MHSD 1SRUA 2HD3A 4LLGM 3RFZB 1F52A 2M8SA 4JGHB 2KCNA 1T5EA 2GMIC 1JJCB 1VQIA 3K57A 4OZBA 1IBLQ 1RODA 1ISNA 1VQ4A 4GN3B 3VYSA 3RZOH 5JJKA 3PV0A 2DY8A 2MP2B 2Q2UA 4BOSC 3PREA 1TWFB 4JWUC 4JI2Q 1BBXC 3JYUA 2JN4A 5M3MB 2CHXA 1FD7D 1EY8A 4HCNB 1YOVB 3BWUD 1I3QB 1WD0A 1P16A 4JG2A 2WGSA 2K05A 3T16A 3B6YA 1I94L 3JW0X 2XVSA 2GBMA 4DN4M 3PUVA 2KTRB 3ML9A 2UXCL 4YTMB 5M3FG 1JQYD 1XMOL 2HQEA 1L1OA 3BDLA 4XYCA 4DV4Q 1PRTD 2QCPX 5KEEA 3ZJYC 2PNHA 4PZ6A 4AQYL 1EYGA 1TGZB 1BBWA 4L8JA 2ZEQA 1WCMH 4R1JA 3T13A 3UF8A 2ZXRA 2R7ZG 1KAWA 3MJWA 2FE8A 4N59A 1KLVA 3BK1A 4KZCA 1SB3C 3E0JA 3PRPB 4I7AA 1CA5A 1U4MA 1DOXA 1NSNS 1GOZA 3SE0A 4PQXA 5IKCM 4RF1A 1WJ6A 4LF6Q 1H9SA 2KDMA 5JXVA 4B3MQ 3H09A 1J7CA 4I6NB 2I07B 1MHHE 2FCQA 3PZDA 4YIJA 5KYIA 2EKEC 5IP4D 4LF5L 1PFBA 4J3OD 3G71A 3CCMA 1B7YB 4BBNC 2O6VD 4UY8C 2Z6KA 4OWXB 2DNFA 2EJMA 4RCNA 2NVQB 1EWHA 3HG9A 1N36L 5AZGA 3CMMB 3WAPA 2JUOA 2BS4B 2K5QA 2IX3A 5HGQA 4IALA 3H0GG 4A3EH 3E9HA 4H7BA 1K8RB 4A3LG 4DFAA 2XNAC 1SEBD 4P73A 2B3GA 1T0SC 4KZ0A 4GN1A 4PS8A 4EFOA 3SR6A 4ODGA 4WJOA 2XRQD 2IHFA 1I4XA 5FR3A 3NWTA 1N33Q 4X66L 1E90A 4F1SA 4G4KA 3GTPB 5CMDA 2PO4A 3F2CA 3I4MB 2KDIA 2RCNA 2XGTA 1VQPA 4REZA 4AWJA 3N3KB 1VDZA 3S2HB 2QEJC 2CQOA 2E5LL 5FJ8G 3LJ3A 3MWYW 4HRSA 5IO9A 3GE8C 4HJ7A 2MPMA 3QC8B 4EUTA 4GS3A 3ER0A 3BDOA 5IT9L 1PH9A 3H3VH 2ONQA 1K51A 2FBWB 4NMZA 4DV3L 4DR6Q 4DGZA 2JA6G 3CQZB
chains in the Genus database with same CATH topology
2N9LA 3FPPA 2WU5B 2F03A 1HCZA 3S14B 1E2ZA 1NR4A 1T3QA 2ON8A 1QF6A 3R2TA 1D1IA 2WACA 3LWEA 2MH7A 4ZYSA 4YSZB 4K2LA 4KKTA 1H9JA 1WTQA 1F2LA 4IUQA 1ZUD2 3V2TA 2K03A 5JEAG 1CHQD 5EKKA 1O80A 1FYCA 1VCIA 4OO1G 3Q8FA 2BB5A 2M19A 5T1IA 2WXFA 4PMWA 2KN4A 2R93B 5IODA 2F3WA 2ICIA 3AECB 5C4JB 4NAWB 4IFDJ 2JA8B 1F9PA 2VUMB 5D7GA 1QG7A 2JU6X 3AH7A 4GDKB 2F0OA 1FNVA 1HUNA 3KWVA 4FNFA 2K0PA 1LTAD 1EYCA 4XWWA 3ITPA 1F2RI 1XEEA 1PTOC 2E2JB 4XWTA 2ZW1A 3URYA 1NAPA 1S5FD 2ACZB 1SMYC 2VNUD 1KLGD 2BT6A 3Q8BA 1QOGA 4KI0A 3AE8B 3D6CA 1NUCA 5IIFA 2B2YC 1HFGA 1PMRA 1KABA 2M9VA 4Z9CB 4HMIA 1I4RA 2B2UA 1ILPA 5HGTA 3NBHA 3NTHA 5GXGB 2DBYA 1AN8A 3GTMB 1XXGA 1DOLA 1JRPA 2KHSA 3SDZA 3WOEA 4NZLB 4GZYC 3ND9A 4ARIA 5JEAJ 2EYPA 5LNK1 3JAML 1CTMA 3NQTA 4KN7C 2L52A 1GUGA 2RVLA 1ZYRC 2Q8RE 2B2VA 1U4RA 3I3CA 1B44D 3OIQA 4MT5A 3VR6A 1VF7A 3DXJC 4C1NI 3AEFB 4IFDI 3EJIA 1PGBA 4B08A 2F0QA 3MHBA 4KKIA 4CJ2C 1SNOA 1XCTL 2L9HA 1EQVA 2MHVA 3KQ4A 4IOIE 2W3SA 1ESFA 1BCPF 1SE2A 4QCLA 2JYOA 5EBDA 2EYMA 2L11A 3GTLB 2L55A 1NENB 1N63A 2WXMA 1J7AA 3C1EA 1YNND 5G5HA 2JA7B 2I2YA 3NSWA 3KUPA 3P4SB 5M5YB 2SDFA 1QJOA 3Q69A 2EYJA 4YTPB 3W5UB 2XSCA 1CT1D 5HURA 3IFTA 1GB4A 4HR7B 3AV8A 1M4VA 2JXMB 3DWAA 2KAJA 2D62A 4OO1I 3HOZB 2HCCA 3NE5B 3DWGC 1JOKA 2BDOA 4TRDA 2BA1A 3M7GA 2PW5A 1QB5D 1ZEQX 1JALA 2L1AA 4HSVA 4FVMA 4DK0A 4FF2A 4IUNA 4A3BB 1EL0A 2K6AA 3E5SA 4U673 1ESRA 2DNEA 2WU2B 3E6ZX 4XXEA 5BYSA 1ENCA 3VQIA 5FO9B 2JYTA 2MJEA 1ROEA 5CORA 3Q0AA 3MXUA 5JVG3 1V8QA 3SXHA 5C3EB 4ABNA 5M3FB 4B9XA 3GB1A 1EY7A 2F0WA 3PMFA 3PUWA 3T3OA 1O7LA 1PGAA 5ELEA 1MI0A 1A2TA 2PQEA 4ULLA 1JW9D 1B50A 2PVGC 3NWSA 1WRIA 2LMCA 1JCKB 2RBMA 3IAYA 1C77A 3QB3A 3QG1A 4OHJA 4F7XA 2KA7A 4TSSA 2Z4IA 4NP5A 4RGMA 1IGCA 2VXWA 4ZAIA 2EE1A 3FPUB 2QF7A 4P6VF 5C4HA 3AMZA 2F1MA 4KN4C 1VRAB 3OPOA 1OXXK 2OT2A 2BOSA 1PZID 4BBSB 3I90A 1Q3LA 2BBCA 1A3TA 2YU9B 5DM63 4TQUS 2INNE 4QIWB 2MJ3A 2F0HA 2EYHA 3OWFA 3U9OA 1NI3A 2Y5CA 4A90A 1UEAB 3BZDB 1QQRA 1TU2B 3A55A 1GHJA 1CJEA 5I6YA 3D8GA 3T4AC 3W3AA 4OIKA 1RTNA 1ZDVA 4TQ1A 1V97A 2H89B 3OWEB 2MJDA 2DNCA 1K8OA 5C3JB 3MXPA 4C80A 3S17B 4OZCA 2EY5A 4OW0A 3VA5A 2HDMA 3U7ZA 2DYOA 3TSSA 4MHEA 2DY7A 2R92B 5C3XA 3MFYA 3GQBA 2J42A 2B2WA 5MPOA 3SFDB 4IQZA 2Z8LA 2BB6A 3FEWX 1SSOA 3EA6A 1OQQA 4X3KA 5CBAE 2KEDA 4M1UB 4HROA 2EY6A 1NYQA 3OSOA 3DWPA 3A7AB 1Q1BA 5CV4A 1PDQA 2B76B 2QJLA 4OGQC 5COYA 4TQ0A 3TBIB 1Q10A 5CV8A 1H9KA 3LXFA 1D5ZC 4N58A 4KD4A 1HA5A 4DNTB 1TVXA 3I70A 1YN3A 1AZQA 1H9RA 3AEBB 4CBVA 1D1KA 5C0XG 4EGVA 2OXPA 3MA2B 1CM9A 4P16A 3NUCA 2RSNA 3EUB2 1ZOYB 1H9SB 4K14A 2M0AA 2N9KA 1EY5A 2I38A 2Y5PA 2WB1B 1IGDA 2EYOA 2PLPA 2JSVX 2L83A 2VB2X 2Q5WD 1WWTA 1JOQA 1N5XA 2AWNA 1ZP0B 3AU7A 2ID0A 1F9QA 4KGSA 3QWNA 4TKOB 4XDCA 1KAAA 2K5DA 1JOOA 5BYQA 5LL6X 1IKMA 1J8IA 1UNSA 1BCPD 3V05A 1SFOB 3I57A 1EEFD 1G2SA 3S2DB 4R8NA 1MBYA 2JE6I 1D4BA 4FF3A 4IUVA 1NYRA 1JICA 3CKIB 5AUIA 2WXIA 4WQMA 1UAPA 1K8MA 4RFBA 4LAAA 2IGDA 3ERQA 3K5NA 1KDCA 5J22A 5C0XJ 4IDIA 2WP8J 5K36G 1DCZA 1GJXA 4DQOC 1GB1A 1I4QA 2BE5C 3H91A 3X3MA 5KNBA 2LFNA 1PTOH 2H88B 3NZ3A 4BY7B 1MPEA 5JAVA 2F0LA 5ELDA 1F77A 4KMUC 4CJ1B 1TIID 1FNWA 3EVQA 3W2DA 2J7ZA 3S1NB 3BG3A 2EZVA 1XLQA 4X3UA 3I91A 1WSPA 1T5XD 2K22A 1Y1WB 1KDAA 1PRTB 4A3DB 5M5WB 3GTOB 3P42A 4CJ0B 1F2ZA 4JX1C 1JWBD 3HS0C 3GP7A 3MC0B 3U2SC 1UWXA 1S5DD 1XWEA 2RQXA 4ZKCB 2NUCA 4TMAB 1ZE3D 1KNAA 5BMHA 2A69D 4V190 5A35A 4A93B 3HRZC 1R7SA 2HDLA 1OXSC 4B9WA 3Q8AA 3U9SA 2M56B 1HUMA 2WP9B 3K7AB 5C0XI 1AZPA 1XYIA 1YNTE 3S15B 5EPLA 2JYEA 2AWOA 4U68A 2WKDA 1XX8A 5IT9E 1YNJD 2IDYA 1PLFA 3S1QB 3VR2A 3AM9A 3VR3A 3TZDA 4MN3A 1RKNA 2SNSA 1AYFA 1HTLD 1LLRD 3KBGA 3WCQA 1XTCD 3K5LA 1NR2A 2B8FA 3TP8A 3S1RB 1FXAA 2CW0D 1X3QA 2OEDA 2K01A 1MGSA 1TY0A 4P2CB 3J7AF 2WAQB 3QJYA 2VZKD 1LV9A 3L9AX 2RA4A 1LTSD 3VR4A 1BXTA 4HEDA 1IW7D 5T8IA 5EPJA 5C6AA 3DHQA 1GUOA 3HGBA 1QOHA 4FYDA 1BUVT 4QB4A 2XWJB 2LJIA 5IGDA 1HA6A 4BA1I 4NAMA 5D3IB 1ONLA 4RHSA 2GA4B 1SYBA 1F2YA 2ZXOA 1JWSD 4JBWA 5KNCA 2HUGA 1L0VB 1FD6A 2IWHA 3J81L 5JVH3 3H8HA 3IXSA 2CU3A 2W3RA 1ZXTA 2YEPF 1EU3A 4K5WA 2M00A 1NVID 3IKJA 1WTXA 5AUKA 4BBRB 3TUOA 2G9DA 4WJWA 4IKGA 1BDOA 1MSHA 3G6JB 3VYTA 4KJOA 3JAME 2A6HC 2A68C 1E0ZA 4IFDG 3F2UA 4KGTA 4A3GB 3EQLC 1GUSA 1Q8IA 3SK8A 3AE2B 5EGTA 1S5BD 5NUCA 3ONAB 4C3IB 5T1GA 4G7OC 2Z1CA 5K5PA 1PGXA 2RMMA 2Z4HA 4HCEA 2X38A 5CV6A 4RH6A 4IURA 3FRPB 5G3LD 4KK7A 3VRAB 4B0MA 3PO3B 2K04A 2Y3AA 1SYDA 4L2YA 1CHPD 1SE3A 2AUKA 2LFIA 2K32A 3GTGB 4MIUA 1LTRD 5IGGA 3HOWB 4WAFA 5M9OA 4IUPA 2L0CA 1HQRD 4A3JB 2IL8A 2KOLA 4C1NK 4RNAA 3AN1A 3BYTB 1TS4A 1VJKA 2V4IB 2LMCB 2G1EA 2LUMA 3D4DA 1M8AA 2NTSA 1ML0D 2WXPA 1KH0A 2IJ0A 1OXTA 2F0SA 3MEHA 2NBFA 4KX6B 1EY6A 5EKIA 1XLPA 1TZOA 1ZPSA 1A70A 3C46A 3T56B 1BUIC 1AW7A 1SYCA 1SXTA 1BNZA 3DM1A 4BY1B 2N0SB 1HFNA 3BYYB 5I6WA 4YT0B 3DEPA 1VZ6A 1YJIA 3MHZA 4RKBA 2F0IA 4XE0A 4YTNB 1WYGA 4EQOA 3P75A 4AYBB 4X3SA 4X3TA 3L4PA 2KQ4X 2L5TA 1YJJA 3DWQA 3BS1A 1XLNA 3HOXB 1SJHD 1OXUA 2X6GA 1BOSA 3BVMA 3FKIB 2WNMA 4LK0M 1TS5A 3HZXA 1KNEA 3ZJVA 2G9HD 2RSOA 1FCCC 4KHZA 5HI1A 2NN6G 2K3UA 4HMJA 1G291 3RZOB 2EYFA 2EVBA 2AQ2B 2B39A 4XT1B 1TJEA 1SMYD 4LMQD 2XIWA 4C56C 2B2TA 1FCLA 3AE6B 1LABA 2W55A 1QKZA 3TP5A 2X69A 3NTIA 4ZRZA 2F0NA 4WRDA 1WCMB 1STYA 4A8XC 1W6JA 3P4PB 3ND8A 4K5VA 1L5PA 3AB9A 2CHBD 2IX1A 5EE0A 4FF4A 1DOMA 3PZ7A 3BVGA 1ZYRD 1IHZA 4JE3B 4J6HA 3BVZA 2F0FA 1W6KA 3HRDD 1YNNC 2SEBD 3V3XA 1BR9A 3D4RA 1S4ZA 1TY2A 1SSNA 2F0KA 4F87A 1GUTA 3KWLA 4F8MA 2AQ1B 5I9OA 5JEAH 4A3EB 4HEA1 3TZUA 4H44C 3PZ8A 4J8QA 1LT3D 1QE6A 1STAA 3GS2A 1LT4D 4AQ7A 4KJNA 4RAUC 3A54A 1D5MC 4L6TB 3ABVB 4FXDA 2NB0A 4PMBA 3NHHA 2FUG1 1F2MA 1EY9A 1ZKOA 3J7AV 1STEA 3MXNA 2BS2B 1LT5D 5C4ZA 3HUIA 3RD4A 2CJNA 2YYZA 4ZUJA 3TDQA 4FXKC 5C2TB 1DOYA 3RMHA 1B9NA 4WFN3 1LACA 4G7HC 2L12A 4DXFA 1JR0D 3CIRB 1DYQA 2Q8TA 1QILA 1Y56A 4PT5A 2NWGA 1FGBD 1TS2A 2GI9A 3P4QB 1CK1A 4C7YA 2B2YA 2NYZD 3SVMA 3RLFA 2R6GA 3I73A 4YSYB 3AB5A 3EROA 3T53B 3ETRA 1HTPA 4PV1C 1B9MA 2QMTA 2EY2A 2NN6I 1PUTA 4OZAA 2PTLA 1P7FA 1V1PB 1GUNA 1QWYA 1I7HA 4CQNA 1OFFA 3VR8B 1HZ5A 4DA2A 1XLOA 2D9UA 3C3LA 1ZXHA 2H4OA 5CBEE 2HTME 3UI2A 1KDBA 1FFVA 5DEHA 1L6VA 3D31A 4ILWA 3LWUA 5FO7B 1E7PB 1U4PA 2JZPA 1QOBA 4RGNA 4MH8A 2A6EC 1AFPA 2FFKB 1MD2D 1SIJA 1TS3A 4K2KA 1A6XA 2XN9C 2ICEC 2O5JC 4I7ZC 5CC4A 3GV3A 4MACA 3TN2A 1DJRD 4EE2A 4FXCA 1LO5D 1TYGB 3TMEA 2F0PA 1GUWA 2PCFB 4A55A 2R61A 3EGRA 3NTKA 1F2RC 1CZGA 1GPXA 1GAQB 1A3VA 1SDFA 2RDHA 4K8JA 3KLSA 1BCPB 4GLSC 2XWBB 1JORA 1J9OA 3D4WA 2V3NA 1I6VC 4XTCS 3K58A 1RWSA 4XYOA 2E2IB 3KF8A 3LB8C 1B3AA 3NVVA 3E9SA 2WXKA 5FOBB 2PZTA 3NVYA 4V0BA 1E9MA 5IGBA 4WIPA 1F0ZA 1I4PA 4O42A 4E6IA 1C4PA 1L6UA 2XRSD 5BYRA 4Y7NB 3TEXA 4C3IG 2DN8A 3FC4A 1TR5A 1EYDA 4N9PA 1DONA 1YQ4B 2WLBA 5HFYA 3W1SA 4YWGG 1JMLA 4A6QA 2OF1A 3AE9B 1F9SA 5KGUA 3AE3B 2RDFA 5KRUA 2WXGA 4RCOA 4A3IB 3VR9B 1I4GA 1HRJA 2F0MA 4N6EB 1WTOA 1P7EA 5CYUA 1QCBD 4DU9A 1DOIA 1A3UA 3M4YA 4KY7A 1EFID 1G6ZA 3ZJUA 1STNA 2K7VA 5I2YA 1OO9B 2FJ2A 5G3LF 3AEGB 1IYUA 2ZT9C 3L3OC 4BWGB 2J53A 3GTQB 4HN7A 4KHVA 2DWQA 3HOUB 3VRBB 1EQTA 4IN3A 5FLXL 2JEBI 1OXVA 1ET6A 2E2DC 2DLBA 1RCVD 4K5XA 5E3FA 3GTJB 1ENFA 2RDGA 4YXDB 5JPNC 4LJZC 3MVVA 5IGFA 3U52E 4RA8A 3CHBD 4G57A 1BO0A 1WTVA 4XYQA 4HKQA 4OL7A 1B53A 3J80L 1RM6C 4Q5VA 3I4LA 2WXOA 5EJWA 1CI3M 3HEJA 3T3NA 3R8BA 2J0TD 5EBCA 1FRDA 1SE4A 5EE9A 1C4QA 2IT1A 4L23A 2WXHA 3OIPA 4K6LA 4C2MB 1Z47A 1EIGA 2QILA 1V1PA 5BN3A 3VR5A 2K5WA 2C5CA 2JWUA 3D3RA 4XQNA 2R3ZA 1H9MA 1I4HA 2SNMA 5C44B 4BA2I 4C3JB 2NTTA 2JEAI 2VZKB 2FMCA 4KKUA 2QDBA 1TWCB 5A2QL 1ICWA 1TWHB 2C9OA 3TEWA 1SNPA 1PTOF 2V3PA 3J81E 4OVZA 2PW7A 1MHXA 3MTSA 2V4DA 4PMCA 2KCCA 1B1ZA 2OEOA 4DAPA 1GHKA 4ZHOA 1VMCA 4Q0FA 4DF7A 5I9PA 3BDCA 1QNKA 4QF4A 4ZKBB 1TQOA 4NW2A 4CKEA 3Q8CA 3Q22A 1N62A 2QSDA 2FHTA 3H6MA 3RZDB 5BMIA 5C0XH 2GB1A 1C4AA 2W82A 1WVLA 3OMCA 3NBIA 4HAEA 2F0UA 2WDQB 3OMGA 3DUZA 1V43A 2JQRB 1RHPA 2I46A 3GTKB 4K6DA 4CHTB 5C5MA 5M5XB 1EU4A 4BS9A 3ZJTA 5DM73 3S1MB 2E6XA 2H1EA 4RGOS 3AE5B 1LTID 1XO3A 3I9V1 3FAHA 2KQ3A 1Y8PB 5C3WA 1JWAD 3EFXD 1E2WA 5J39A 4H13C 2CW0C 1FRRA 3W9CB 4G7ZC 2BS3B 2RKSA 3L7ZC 3AEEB 1PDXA 5EPKA 3PUYA 1WTPA 4J1MA 5TSSA 3W5VB 3LX0A 1Q12A 3M3YB 1PRTC 2KWDA 1JQ4A 4ZRQA 4US9A 4ME5A 1STGA 5K36H 3NRZA 4H2AA 1AEXA 1JB3A 1EOTA 4KD3A 5C4XB 5ISRA 1BMLC 3M7NA 5H92C 3P1MA 1FEHA 3AEAB 3IFDA 3H94A 1YQ3B 2WV6D 3P4RB 4H0LC 2IX0A 1HXYD 2WQYB 2EY1A 2LKVA 2EOTA 3A7LA 4ZQ3A 4Q2JA 2F0DA 3C2PA 2LHDA 3FILB 2E3TA 1K53A 5FK9C 2B2UC 3QOJA 2K33A 5LL6S 2KJXA 1UGJA 1XF5L 4XDDA 4ZLTF 4M0WA 4KV6A 3B2GA 2PW9A 3KLSX 5EQ0A 5CV9A 4USAA 1G8ZD 1DOKA 1U4LA 1LTGD 3QIAA 1LT6D 1Y8OB 4FO2A 3VA7A 1PFDA 4ZUIA 4R3DA 1C9FA 3AE7B 4R8IA 3RUZA 4M8AA 2MEKA 1EY0A 1CZPA 2B2TC 2B2VC 2J52A 1PTOB 1PYWD 1SYFA 1SYGA 3VYRA 2O5IC 3M4OB 4WWMA 1ENAA 1RF2D 3A56A 5CGKA 2EJFC 4XQJA 2PZUA 1F9RA 3A8JE 3Q24A 2Q8IB 4WURA 2PIAA 5ELBA 2A6HD 4DXGA 4RF0A 2A68D 4KGRA 1MSGA 2N7JA 1D2BA 1FXIA 5I4DA 3MP9A 3PIO3 1SBBB 3DMUA 2JX5A 3KLRA 2WDVB 4B0EA 3HOVB 5KYLA 2L4NA 2LY7A 4OIJA 1HPCA 1VZ7A 4WORA 2BYTA 3ZGZA 3SR1A 2PVOD 3IT6B 3AE1B 1RJTA 1X32A 2AQ3B 2KVMA 2KECA 4A3FB 4L1BA 5AFWA 2PNRC 4C3HB 3QO2A 4S3SA 2O4XA 4LTUA 2FMMA 2J4XA 3HKZB 2GRIA 2SAKA 2CVRA 1HEZE 3SK6A 1JROA 2AUJD 1E6EB 3LNNA 1Q90A 4QUCA 2JA5B 1VF5C 3FDTA 2E74C 5JPMC 1ACCA 4DAVA 1D5XC 4ZHPA 3WDNA 2JXTA 5G5GA 3P7JA 4HCSA 2QIEB 1DM0B 1STHA 3RPFC 3R93A 1G2TA 2WIIB 5E6JA 1EIHA 1I6HB 1EM7A 5IOCA 3PIP3 1II3A 1X3PA 3K5MA 1XCQL 4ITKA 2PPBC 3MZ5A 1PTOD 1CQFA 1GXDC 3U4EG 4K8IA 1KRHA 4GDLB 3IAM1 4ZK9B 1IYVA 5DAUA 2FINB 1ET9A 4IFDH 3K59A 3Q23A 3TEYA 3TP6A 3C1FA 4NJCA 1RD9D 3SEBA 4UAIA 4KY6A 4RHRA 1T6BX 2N88A 1PZJD 4N9TA 1RFKA 2F4IA 3K6OA 1N5WA 1S5CD 4A9AA 2YEPB 3J9CA 3MAQA 5FO8B 1SNQA 2EPBA 5HG2A 2NZ1D 3TEZA 1WTRA 4XDXA 2ENBA 1C76A 1O7ZA 3CWIA 3UI3A 1EWCA 1NEKB 3OHXC 3PUZA 1KLUD 3HVDA 4PNYA 1PFMA 5EE1A 2A73B 1AWDA 5C5LA 4KTAA 3ZQ4A 1J7BA 1RDPD 1WD1A 5ELFA 4A3MB 1QOFA 4IZ8A 3P20A 2X6LA 1NCVA 4L63B 4OO1H 4C7ZA 1EYAA 3G7LA 3FILA 3NVWA 1SNCA 5BMGA 4XT3B 3AE4B 4C3JG 1VLBA 2D5GA 3GD7A 1Y1VB 2WINB 2K9XA 1K83B 3HP3A 2B8GA 5HHDG 3TP7A 3D6WA 3AEDB 1YMHE 2QKIC 2NVYB 3NP8A 3MFGA 3NVZA 1MI2A 2EDGA 3K0YA 3N9YC 2F0EA 2BW2A 3GV6A 1FR3A 2CQAA 1N60A 3I4NB 2B2WC 1Z7TA 2V0GA 4JWSC 3NUHB 2O2LD 3IT4B 2A74C 2DYMA 2IGGA 2BTEA 2F0VA 4IUTA 1V8CA 3S9WA 1WTWA 4HKZE 2NN6H 1EZ6A 2SOBA 2JP1A 4FF1A 1WXQA 3SHLA 2L1BA 2PZWA 4CKBA 2PKOA 4US8A 2E75C 2F0GA 3NS1A 1JWUD 5D14A 1SAPA 3OW7A 2N55A 2F0JA 3B2FA 1B9RA 4EVOA 1IUEA 4RGTA 5D3DA 2WXNA 5ELCA 2MP1A 1IKLA 1HHVA 2R7ZB 1EZ8A 3BK2A 1MVKA 1O7YA 1R4PB 5DNFA 3O13A 1SYEA 3HVZA 5KIXA 1E10A 3X3NA 5FLXE 2MGSA 1VDVA 1EY4A 3M85A 2IPKD 3H3VC 3A8IE 3A8KE 1C78A 2BDNA 5BN5A 3T51B 3H0GB 2BCOA 1OQRA 4WH4A 3SK5A 1A15A 1C48A 4ZOHC 2EXZA 2E76C 4KKSA 5KNDA 3J80E 1G91A 1ZXIA 3NQIA 4RKLA 1B4OA 2JSOA 4AS1A 1IBXB 1ILQA 2A6ED 3E56A 1L0YB 5E1FA 3CRKC 4QMGA 3R3OA 4ARCA 4UDUC 2VB3X 1JC7A 1D6EC 4F88A 2HCIA 3PO0A 4HJGE 4XQQA 3Q8EA 3DWMA 3MXGA 4MM3B 3P1HA 2EKIA 3QOLA 2WXLA 2A5HA 2JA6B 1RYJA 1Y69U 2LEKA 1N61A 1PRTF 1DD2A 3Q6SA 3PUXA 5BN4A 3NXWA 5A2QE 5EE3A 1TKGA 4I65A 5I2XA 1CFMA 5JJZA 1QLBB 1C8CA 2NVXB 5F2DA 1FMAD 1K50A 1YN5A 3SK4A 1PZKD 4CKCA 2CJOA 4XIGS 2KEEA 3HOYB 4JPSA 4KY5A 4R9WA 2B63B 1BF4A 1E0BA 3C8YA 3MJ5A 1CQVA 1TKWB 1YN4A 1B2TA 5CR3A 4QUFA 1SJED 2WXRA 3J7YW 2W54A 1KF6B 2L32A 3N52A 3DEOA 3GO5A 3FMCA 3ZYYX 4CGYB 2F3VA 1BCPC 3IL8A 1CZWA 2EELA 4C3HG 4DNRB 1DZ1A 2M2LA 3OOCA 2AX5A 1UUPA 1TKEA 2KACA 1JE4A 2WXJA 2KUMA 1EEID 3S16B 2PMVA 1WGKA 2Y0SB 5FKAC 1DGJA 4EQNA 2K5PA 1HQMC 4HTHA 1VZ8A 1R9TB 1SNMA 3AMUA 2EJGC 2KMMA 4LK1C 2PMZB 1S5ED 4IUUA 1UWMA 2NMQA 3IAS1 5J1ZA 5IGEA 2WXQA 4FP5D 1PXUA 1JWMD 5H8YE 1L4ZB 1SF0A 1VMPA 5E4XA 2LS01 1TWAB 1FIQA 3NK9A 1QNUA 4RWSC 5EKLA 1PFNA 5D65A 5CV5A 3NPPA 1FNUA 3CU7A 4A3KB 2OHFA 1C79A 1LTTD 4KKJA 5IGCA 1TKYA 2ZW0A 4YSXB 4ZRPA 4JK1C 2D5DA 2IW3A 2PYKA 3KBXA 4NKLA 1STBA 1U9RA 2LGIA 2RPVA 2WKCA 2BE5D 4DAYA 2E2HB 3BIID 2A69C 5JOBA 1SNDA 2BA0A 4HSPA 1K52A 2MUYA 1DXMA 1L0XB 5E4WC 1A2UA 2INPE 3P63A 1ZDXA 2K28A 3K5OA 3N6RA 3R2IA 4DK1A 5LHY1 2WDRB 2D2CC 4ID6A 1V1OA 2MJ8A 3VYUA 1Y8NB 2EYLA 1VR9A 1IBXA 3V96A 1HZ6A 3KK7A 2LHEA 1YNJC 2F0TA 1L4DB 1KTKA 3SFEB 1E2VA 1C4CA 3FVQA 2HDEA 3LYYA 1IL8A 2TMPA 4FXGC 2TSSA 3B9JA 4EQPA 1EWYC 4D2KA 1AP0A 3I72A 1R4QB 3WOFA 1RTOA 1KFYB 1QT9A 5CV7A 1TT2A 2K1BA 2IGHA 1FFUA 3PO2B 1TWGB 1BQQT 1O78A 2NVTB 4NDXA 1QOAA 1FM0D 1CA6A 1IW7C 3I8ZA 2ZXPA 3CRLC 1LTBD 1I50B 1Q1EA 2WS3B 1Z6HA 1FO4A 4O1NA 3RFZB 4LLGM 2KCNA 1T5EA 3K57A 4OZBA 1RODA 3VYSA 3PV0A 2DY8A 1TWFB 4JWUC 1BBXC 5M3MB 1FD7D 1EY8A 3BWUD 1I3QB 1WD0A 2K05A 3T16A 2XVSA 4DN4M 3PUVA 4YTMB 1JQYD 2HQEA 3BDLA 1PRTD 2QCPX 5KEEA 4L8JA