1I4SA

Crystal structure of rnase iii endonuclease domain from aquifex aeolicus at 2.15 angstrom resolution
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
147
structure length
147
Chain Sequence
b'MKMLEQLEKKLGYTFKDKSLLEKALTHVSYSKKEHYETLEFLGDALVNFFIVDLLVQYSPNKREGFLSPLKAYLISEEFFNLLAQKLELHKFIRIKRGKINETIIGDVFEALWAAVYIDSGRDANFTRELFYKLFKEDILSAIKEGR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords RIBONUCLEASE III
publication title Crystallographic and modeling studies of RNase III suggest a mechanism for double-stranded RNA cleavage.
pubmed doi rcsb
source organism Aquifex aeolicus
molecule tags Hydrolase
total genus 45
structure length 147
sequence length 147
chains with identical sequence B
ec nomenclature ec 3.1.26.3: Ribonuclease III.
pdb deposition date 2001-02-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00636 Ribonuclease_3 Ribonuclease III domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1520.10 Mainly Alpha Orthogonal Bundle Ribonuclease iii, N-terminal Endonuclease Domain; Chain A Ribonuclease III domain 1i4sA00
1YYWA 3O2RB 1YYOA 3RV0A 2NUEA 2QVWA 3RV1A 3N3WA 1U61A 3C4TA 4OUNA 1YYKA 1I4SA 1RC5A 4M2ZA 4M30A 3O2RA 1O0WA 1JFZA 4OOGC 2EB1A 2NUGA 1RC7A 2GSLA 2NUFA 2EZ6A 2FFLA 2A11A 1YZ9A 3C4BA
chains in the Genus database with same CATH superfamily
1YYWA 3O2RB 1YYOA 3RV0A 2NUEA 2QVWA 3RV1A 3N3WA 1U61A 3C4TA 4OUNA 1YYKA 1I4SA 1RC5A 4M2ZA 1ZTDA 4M30A 3O2RA 1O0WA 1JFZA 4OOGC 2EB1A 2NUGA 1RC7A 2GSLA 2NUFA 2EZ6A 2FFLA 2A11A 1YZ9A 3C4BA
chains in the Genus database with same CATH topology
1YYWA 3O2RB 1YYOA 3RV0A 2NUEA 2QVWA 3RV1A 3N3WA 1U61A 3C4TA 4OUNA 1YYKA 1I4SA 1RC5A 4M2ZA 4M30A 3O2RA 1O0WA 1JFZA 4OOGC 2EB1A 2NUGA 1RC7A 2GSLA 2NUFA 2EZ6A 2FFLA 2A11A 1YZ9A 3C4BA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1YYW A;  3O2R B;  1YYO A;  3RV0 A;  2NUE A;  2QVW A;  3RV1 A;  3N3W A;  1U61 A;  3C4T A;  4OUN A;  1YYK A;  1I4S A;  1RC5 A;  4M2Z A;  4M30 A;  3O2R A;  1O0W A;  1JFZ A;  4OOG C;  2EB1 A;  2NUG A;  1RC7 A;  2GSL A;  2NUF A;  2EZ6 A;  2FFL A;  2A11 A;  1YZ9 A;  3C4B A; 
#chains in the Genus database with same CATH topology
 1YYW A;  3O2R B;  1YYO A;  3RV0 A;  2NUE A;  2QVW A;  3RV1 A;  3N3W A;  1U61 A;  3C4T A;  4OUN A;  1YYK A;  1I4S A;  1RC5 A;  4M2Z A;  1ZTD A;  4M30 A;  3O2R A;  1O0W A;  1JFZ A;  4OOG C;  2EB1 A;  2NUG A;  1RC7 A;  2GSL A;  2NUF A;  2EZ6 A;  2FFL A;  2A11 A;  1YZ9 A;  3C4B A; 
#chains in the Genus database with same CATH homology
 1YYW A;  3O2R B;  1YYO A;  3RV0 A;  2NUE A;  2QVW A;  3RV1 A;  3N3W A;  1U61 A;  3C4T A;  4OUN A;  1YYK A;  1I4S A;  1RC5 A;  4M2Z A;  4M30 A;  3O2R A;  1O0W A;  1JFZ A;  4OOG C;  2EB1 A;  2NUG A;  1RC7 A;  2GSL A;  2NUF A;  2EZ6 A;  2FFL A;  2A11 A;  1YZ9 A;  3C4B A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...