1I4UA

The c1 subunit of alpha-crustacyanin
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
181
structure length
181
Chain Sequence
b'DKIPDFVVPGKCASVDRNKLWAEQTPNRNSYAGVWYQFALTNNPYQLIEKCVRNEYSFDGKQFVIESTGIAYDGNLLKRNGKLYPNPFGEPHLSIDYENSFAAPLVILETDYSNYACLYSCIDYNFGYHSDFSFIFSRSANLADQYVKKCEAAFKNINVDTTRFVKTVQGSSCPYDTQKTL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CRUSTACYANIN
publication title The C1 subunit of alpha-crustacyanin: the de novo phasing of the crystal structure of a 40 kDa homodimeric protein using the anomalous scattering from S atoms combined with direct methods.
pubmed doi rcsb
molecule tags Transport protein
total genus 45
structure length 181
sequence length 181
chains with identical sequence B
ec nomenclature
pdb deposition date 2001-02-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00061 Lipocalin Lipocalin / cytosolic fatty-acid binding protein family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.128.20 Mainly Beta Beta Barrel Lipocalin Lipocalin 1i4uA00
1A18A 1D2UA 2LBAA 3WBGA 3FENA 2PY1A 2ACOA 2FWVA 1BRPA 3WVMA 3FEKA 3STKA 3U9PC 1SA8A 3AKMA 1A2DA 5HCEC 2OZQA 2NNQA 1YUPA 4D6AA 1O8VA 2GC9A 3O19A 5KHPA 3CQRA 5F58A 5DPQA 3KFGA 4EDEA 5LJBA 2OVDA 3PEDA 4NP1A 1AQBA 4MVKA 4AW8A 4WBKA 1IFBA 4GETA 3STMX 1LNMA 4AZPA 1FENA 1SY0A 1QWDA 2XKLA 3FA8A 3BRNA 4AZQA 1LFOA 3ELZA 4AZMA 1T8VA 4IB9A 2G78A 5LJDA 5FENA 1NGLA 3C77X 3BS2A 4D6BA 3FR5A 4R0BA 3APUA 1L6MA 1LIEA 1YP6A 2R73A 3C76X 5DG4A 5IO6A 3D96A 2WSJA 1QABE 4TNNA 1CJ5A 5B27A 1LF7A 1QQSA 1YP7A 2GJ5A 3UEUA 1OPAA 3HK1A 1E02A 4NLJA 1X89A 4M6SA 4IB8A 3FEPA 3VG3A 5BVTA 3NX1A 4GH7A 4IAWA 3ZUOA 1GT4A 1ZNKA 1TXLA 4KIIA 3TGBA 5HCDC 1OBQA 1IKEA 1PEEA 4M7MA 1KQXA 1R0UA 1S2PA 2R56A 1QY1A 3RZYA 4IB6A 1DF3A 5D48A 2JU3A 5HCCC 5AQ6A 2G7BA 1DV9A 2L67A 3PECA 1KGLA 4XMFA 1D3SA 1KT4A 3WJGA 2IFBA 4GKCA 2WQAE 3VG4A 5IO5A 3G7XA 5D47A 4LKTA 4QGWA 3EM0A 3BU1A 1OBPA 2L68A 4XMGA 2QM9A 3GAQA 3MBTA 5C0NA 1ADLA 4QAEA 5H8TA 1I4UA 1EPAA 2FR2A 1EUOA 3BU9A 4ES7A 2WUTA 2HMBA 1NP4A 1FEMA 3EMMA 3TZSA 1DZJA 2HZRA 4ODDA 2FS7A 3APVA 3MVFA 2O62A 5EZ2A 2CM4A 4EXZA 5HWZA 3P6CA 4RUNA 5HZ9A 1X8OA 4MVIA 1GT5A 1PBOA 1EXSA 1ACDA 1SXWA 1GM6A 1TVQA 3BSZE 4YFQA 3P6HA 1G85A 1HBQA 4YBPA 1DC9A 1X71A 1X8UA 1KOIA 1ZNDA 3APXA 1U18A 4A1YA 1SY1A 5HA0A 4HPBA 2Q2MA 3FELA 5HTEA 1JV4A 2MJIA 5H9NA 2QO4A 3BDRA 4QYPA 4I9SA 4BVMA 1SXYA 3C78X 1DFVA 4QZUA 3HWFA 3VG5A 2N93A 1DZKA 2F73A 2FLJA 1HMSA 1Z24A 3FW4A 2LB6A 4YFRA 2QOSC 3KZAA 4N7DA 5F1EA 4ZCBA 4QGXA 4BOEA 5CE4A 1ERXA 1I06A 4XMCA 1SY3A 4O9SA 3KFFA 1XKIA 3NP1A 1GT1A 4A60A 3NQ9A 1LICA 5KICA 5LKEA 3FLLA 2AMMX 5HZ5A 5LJHA 5LJCA 4K19A 5LKFA 4XMHA 1AB0A 2AT6X 2EU7X 1ZRYA 3D95A 4QZTA 3WJFA 4WFVA 3B2IA 3DTQA 1HBPA 4NNSA 3UEVA 2HYSA 2FS6A 4ZHHA 2FTBA 5F6ZA 4MVLA 1OEEA 2YG2A 2JN3A 1VYFA 3UEWA 1H91A 3CBCA 1RBPA 3CR6A 3RSWA 1BRQA 4AZOA 4BQUA 2AT5X 1JJJA 4GNWA 3SAOA 3B2JA 3NX2A 1SXXA 1GX9A 2A13A 4OS0A 4ZR2A 1BSOA 4ORUA 3EBWA 3P6EA 1B8EA 2AH7X 1A57A 2Q9SA 3WJEA 2RA6A 1VPRA 4AZRA 2CZTA 3FA7A 4NYQA 2CM9A 2WEWA 2WQ9A 3BLGA 1G5WA 4TQ2A 4HPDA 5HZQA 1AELA 1GKAA 1T0VA 2W2AA 4ORSA 5H9LA 1E00A 4LZVA 1KT6A 1ZNHA 2FR3A 2A2UA 1OEJA 1XCAA 4A1HA 1KZWA 2HLVA 2QO5A 4YGGA 2OVEA 4NYRA 2JU8A 1X8QA 3K3LA 4IBAA 1SY2A 1YWDA 4YDBA 1MUPA 1GGLA 3AKNA 2L9CA 3HWDA 1B4MA 1B56A 1SXUA 4CK4A 5HAEA 4YGHA 1ZNEA 2ACPX 1P6PA 4UU3A 2AL0X 3UEXA 1JZUA 4GRJA 3WJCA 4LKPA 4YCEA 4TKBA 3O22A 3OJYC 3Q6LA 3WXQA 1JJXA 1CBQA 4YKOA 3JSQA 2RCTA 3NQ3A 1KQWA 2RCQA 4IMNA 4Y0PA 1ERBA 5LJGA 5H9KA 4DQ3A 1MDCA 3NADA 4ZHDA 1LPJA 1ALBA 3BX8A 3EBKA 5IO7A 5HZ8A 3CBSA 1YWCA 2FRSA 1LKEA 5KIDA 1HQPA 4IB7A 3O2YA 3P6GA 4RUUA 5JR8A 5D4AA 2A2GA 2W2BA 3FA6A 2NNEA 2X46A 2OVAA 4HFOA 5B29A 4TKJA 3PH6A 2WEXA 1IIUA 2WWPA 1KXOA 3NR3A 3S26A 4YGZA 2GTFX 2MO5A 4YKMA 5HTDA 4PSQA 4GNYA 3T1DA 1HMTA 1FDQA 1FELA 1QY2A 2R74A 3F8AA 3NPOA 4ORXA 4HPAA 4Y0RA 4Y0SA 4ALOA 4YMYA 4A8ZA 2AT3X 3CWKA 3PH5A 5K06A 2Q4NA 1MX7A 1ML7A 2KT4B 2Q39A 1JYDA 4ARHA 4YH0A 1MVGA 1PM1X 2DM5A 1X8PA 1ICNA 4ZJ0A 1OEKA 2LBVA 1DZMA 4ZHCA 5EDCA 3APWA 2AKQA 3WJBA 3CQNA 2RD7C 5HA1A 3PPTA 4WFUA 3FA9A 1JBHA 1EIOA 1YIVA 1EW3A 5HBSA 4I3CA 4ORWA 1CBSA 2W2FA 4Y0QA 2AT8X 3FR4A 4TLJA 1IKJA 2CZUA 4ALBA 1CBRA 3BX7A 2Q2PA 4HPCA 2X45A 4YBUA 1A3YA 2K62A 4ZGUA 1BWYA 2LKKA 3WJDA 2CBSA 4OS8A 1AVGI 1GX8A 2L5PA 1KT3A 3FW5A 1EPBA 1I04A 5L8NA 4YCHA 1N0SA 1EQDA 1TW4A 1FTPA 3FR2A 1BSQA 2JU7A 3U0DA 3KFIA 2A0AA 5LJEA 3B2KA 4ZFXA 4AZNA 1EIIA 1KT7A 4ZHFA 4XMEA 1QG5A 2JOZA 1QFTA 1UREA 4UU2A 3VG2A 1I05A 3VG6A 3EYCA 3P6DA 1T68X 1BSYA 4I3DA 4QYNA 2RQ0A 3CMPA 2MM3A 4N7CA 5F6BA 4NNTA 1OBUA 5D45A 1U17A 1BM5A 2FT9A 5L8IA 2E4JA 1IFCA 1BBPA 3JS1A 4NLIA 1U0XA 3KQ0A 2AT0X 1S7DA 5D8JA 3PP6A 3HWGA 1O1UA 4OS3A 1YWAA 4I3BA 1E5PA 4ORRA 1OPBA 3TGCA 1O1VA 1GKAB 4OMXA 1CRBA 4OMWA 2CBRA 4AYHA 2HNXA 2OFMX 3KFHA 1X8NA 1BEBA 4IMOA 3FMZA 3IA8A 3VG7A 3ZUIA 5FFHA 1HN2A 3TGAA 1BJ7A 4GE1A 5EEDA 2OFRX 5F7GA 5H9AA 4QGVA 4I9RA 4LZUA 1ZNGA 1TOWA 1RLBE 2WR6A 4IAXA 4EEJA 2XSTA 2KTDA 4ZHGA 3STNA 1B0OA 5EEEA 3HWEA 4YFPA 3D97A 1IW2A 3L4RA 2BLGA 1E06A 2P8GA 1BLRA 3I17A 5LJKA 5L8OA 1G74A 3B2HA 5HZ6A 2NP1A 1QY0A 4TKHA 1UZ2X 1G7NA 3ELXA 1ICMA 3P6FA 3TF6A 2ANSA 3I0AA 2NNDA 3DSZA 4ZH6A 2LFOA 1EALA 1FE3A 4YDAA 3U03A 5EDBA 1GT3A 3ZQ3A 5BVQA 1MX8A 1NP1A 2POAA 1JYJA 4EFGA 1S44A 5FAZA 1HMRA 2K23A 3B2LA 1LIDA 1CBIA 3F9DA 4ZH9A 4ORYA 4TJZA 2ALLX 5BVSA 2HZQA 1VYGA 3BY0A 1TOUA 2A3FX 3QKGA 1KZXA 1LIBA 3FIQA 1DZPA 1KT5A 4DQ4A 3IFBA 1PMPA 1ZNLA 2ASNX 2G79A 5EPQA 1GXAA 2QO6A 1YWBA 4XMDA 1LIFA 1QFVA
chains in the Genus database with same CATH superfamily
1A18A 1D2UA 2LBAA 3WBGA 4BBOA 3FENA 2PY1A 2ACOA 1VWGB 2FWVA 2IZIA 4OKAA 1BRPA 4CDFA 2OL8O 1SWKA 3WVMA 3FEKA 3FDCA 3STKA 2FHNX 2C1QA 3U9PC 1RXKA 2WPUA 1SA8A 3AKMA 1A2DA 5HCEC 2OZQA 2NNQA 1YUPA 4D6AA 1O8VA 2GC9A 3O19A 2RTAA 3VHHA 2RTFB 4CDEA 5KHPA 2A5BA 3FIDA 1IJ8A 3CQRA 5F58A 2RTIB 5FQ7E 4GUZA 5DPQA 3KFGA 2QCBA 1SWEA 4EDEA 4ZGFA 3RKGA 5LJBA 2OVDA 2KTSA 2RTJA 1AQBA 2RTLA 3PEDA 4MVKA 4NP1A 4WBKA 1IFBA 4GETA 3RDOA 3STMX 1VWKB 3HPEA 1LNMA 4AZPA 1FENA 1SY0A 1QWDA 2XKLA 3OBLA 3FA8A 3T2WA 3BRNA 4AZQA 1LFOA 3ELZA 4AZMA 1K24A 1T8VA 4IB9A 2G78A 5LJDA 5FENA 1NGLA 3C77X 2MF6A 3BS2A 4D6BA 3FR5A 4R0BA 4BX5A 3APUA 1L6MA 3OD9A 1LIEA 1RAVA 5IXGA 1YP6A 2R73A 2RTQB 3C76X 5DG4A 5IO6A 5IRWA 2RN4A 3D96A 2LA7A 4WHIA 4CDDA 2WSJA 1QABE 4TNNA 1CJ5A 1I9HA 1LF7A 5B27A 1QQSA 1YP7A 2RTHB 4C5PA 2GJ5A 4GDZA 3UEUA 1OPAA 2G8CO 3HK1A 5FQ6E 1GX3A 1E02A 4NLJA 1X89A 1NBXA 4IB8A 1SRIA 2X8SA 3FEPA 4M6SA 4U8UO 3VG3A 5BVTA 4FBOA 3NX1A 4GJSA 2UZ2A 4GH7A 4IAWA 3ZUOA 1GT4A 1ZNKA 1TXLA 4KIIA 3TGBA 5HCDC 1OBQA 1IKEA 1RSUB 1PEEA 4M7MA 1KQXA 1R0UA 2IZKA 1S2PA 3V8UA 1VWDB 2OY8A 1QY1A 2R56A 2X8TA 3RE6A 3RZYA 4AW8A 4IB6A 1DF3A 1WBIA 2JU3A 5D48A 4BX6B 5HCCC 5AQ6A 2X55A 2G7BA 3ZW0B 4CV7A 3SZHA 1W4TA 1DV9A 2L67A 3PECA 1KGLA 4XMFA 1D3SA 1VWIB 1KT4A 3T6FA 3WJGA 2IFBA 4GKCA 2WQAE 4B55A 2IZFB 5IRUA 3VG4A 5IO5A 3G7XA 5D47A 4LKTA 4QGWA 3EM0A 3BU1A 1OBPA 1SWDA 2IZDB 2L68A 4XMGA 1HQQA 2QM9A 3GAQA 3MBTA 4I95A 2OY7A 5C0NA 1ADLA 4QAEA 5H8TA 1G5WA 4I6SA 1I4UA 1EPAA 5AJBA 2FR2A 5B2AO 1EUOA 3BU9A 3SZJA 4ES7A 3ZI8A 2WUTA 2HMBA 1NP4A 1FEMA 1SWLA 3EMMA 3TZSA 1DZJA 2HZRA 4ODDA 2FS7A 3APVA 3MVFA 2O62A 5EZ2A 2CM4A 2Z4HA 4EXZA 5HWZA 1VWQB 4O3YA 2X4MA 3P6CA 4RUNA 5HZ9A 1FJ1E 1X8OA 4MVIA 1GT5A 1SRFA 1PBOA 3PQSA 4GU8A 1EXSA 2BHVA 1ACDA 1SXWA 1KFFA 1GM6A 1TVQA 2RTMA 3BSZE 4YFQA 1HXLA 3VHMA 3P6HA 3ZW1A 1G85A 1HBQA 4YBPA 1LCZA 1DC9A 3FYFA 2OY1O 3ZZVA 1MK5A 1X71A 1X8UA 1KOIA 2GTLO 4GK9A 1SWPA 1ZNDA 2AF5A 3APXA 5IRAA 1U18A 4A1YA 1UYNX 1SY1A 1VWNB 1VWLB 4MIRA 1SWNA 3VHIA 5HA0A 4HPBA 1VWFB 1KL3A 2Q2MA 3LHNA 3WOVA 4COTA 1SWJA 5B5FA 5K67A 3FELA 5HTEA 1W5RA 1JV4A 2OF8A 1RXJA 1Y9TA 2MJIA 3RE5A 5H9NA 2QO4A 1Y53X 1LCWA 1SLDB 2GH7A 2VDFA 3BDRA 1VWRB 2QMIA 3H3IA 4QYPA 4I9SA 4BVMA 1SXYA 3C78X 1DFVA 4QZUA 3HWFA 3VG5A 2AVIA 2N93A 4INNA 1DZKA 1VWMB 4QNIA 2F73A 2FLJA 2GTLN 1HMSA 1DF8A 1Z24A 4LQZA 3FW4A 1SREA 1KL4A 2LB6A 3S60A 4YFRA 2QOSC 3KZAA 4GZVA 4JGLA 2IZEB 3PQUA 2KD2A 4N7DA 4QQ1A 5F1EA 4ZCBA 3RY2A 2JMBA 1SRGA 2DJFA 4PJ2A 4QGXA 4BOEA 1JQPA 5K68A 1ERXA 5CE4A 3NQKA 1LDQA 1I06A 4XMCA 1SY3A 3VE2A 2JW1A 4O9SA 4O3XB 3KFFA 3QQ2A 1XKIA 3NP1A 4MEEA 1GT1A 4A60A 3NQ9A 4O3ZA 1LICA 5KICA 4IRWA 5LKEA 3FLLA 2GTLM 2AMMX 2G5LA 3GE2A 4BX7A 5HZ5A 4K19A 5JD2A 5LJHA 5LKFA 4XMHA 1AB0A 2AT6X 2EU7X 1ZRYA 3D95A 4QZTA 3WJFA 4WFVA 1LDOA 3B2IA 3DTQA 4GJVA 1HBPA 4NNSA 3UEVA 2F09A 2FS6A 2HYSA 2OL7A 4ZHHA 2FTBA 4ML7B 5F6ZA 4MVLA 4Y59A 1OEEA 2YG2A 1OSPO 2JN3A 1VYFA 4I60A 3UEWA 1H91A 3PK2A 3CBCA 1RBPA 3CR6A 3RSWA 1BRQA 2BSZA 2FGSA 4AZOA 4BQUA 2OFAA 4GGZA 2AT5X 1JJJA 5L3YA 5LJCA 4EQAC 4GNWA 3RY1A 3SAOA 3B2JA 3NX2A 1SXXA 3MG5A 1SWOA 4U46A 1GX9A 1HY2A 2A13A 4OS0A 5AJCA 3WZPA 2F01A 4FGIB 4ZR2A 1BSOA 4ORUA 3EBWA 3P6EA 1B8EA 4JNJA 2AH7X 1A57A 4KC8A 2Q9SA 3WJEA 2RA6A 1VPRA 4AZRA 2CZTA 3FA7A 4GDAA 3SLOA 4FBRA 4FBVA 3CKGA 4KC7A 4GD9A 2CM9A 4NYQA 2WEWA 2WQ9A 3BLGA 4JO6A 4O4XA 4O4SA 4DNEA 4TQ2A 4HPDA 1JMZA 5HZQA 1GKAA 4Z2OA 1AELA 4BX5B 1T0VA 2HKDA 2W2AA 4ORSA 4QRLA 1E00A 5H9LA 3VU1A 2YMSA 4LZVA 1KT6A 1PTSA 1ZNHA 2FR3A 2A2UA 1OEJA 1XCAA 3ZW0A 4A1HA 1KZWA 2Z4IA 2HLVA 4BGFA 1K3BA 4EKVA 2QO5A 1MOYA 4YGGA 2OVEA 2IZAA 2JU8A 4NYRA 1X8QA 3K3LA 4IBAA 1SY2A 2X34A 4L1NA 3RWXA 2BC3A 1YWDA 4YDBA 1MUPA 1STSB 2PI3O 2X8FA 4Y5DA 1GGLA 3AKNA 3SOTA 2L9CA 3MM0A 1JIWI 3HWDA 4O49A 1B4MA 1B56A 1SXUA 4Z27A 4CK4A 2BS5A 5F2BA 5HAEA 1LELA 4YGHA 3SLTA 1ZNEA 2ACPX 1P6PA 4UU3A 2AL0X 4GGTA 2RTKA 3UEXA 4O3WA 1JZUA 4GRJA 3WJCA 4LKPA 4YCEA 4CPHA 4TKBA 3S5XA 3O22A 3OJYC 1SLGB 2OFBA 3Q6LA 3WXQA 1JJXA 1CBQA 4YKOA 3JSQA 2RCTA 1NQMA 1RXHA 3NQ3A 1KQWA 2RCQA 4IMNA 4Y0PA 2BT9A 1ERBA 5LJGA 5H9KA 2IZCB 4DQ3A 1MDCA 3NADA 2UYWA 1LPJA 1ALBA 3BX8A 3SZIA 2ZAIA 4ZHDA 2MWHA 4OELA 2ZSCA 1Y52X 3EBKA 1PBYA 3EC5A 5IO7A 4Z28A 5HZ8A 3CBSA 1YWCA 2FRSA 1LKEA 5KIDA 1HQPA 4IB7A 2RTOB 3O2YA 3P6GA 4RUUA 5JR8A 4IABA 2A2GA 2W2BA 2RTCB 2NNEA 2X46A 2OVAA 3FA6A 4HFOA 5D4AA 4TKJA 5B29A 1VWBB 3PH6A 2WEXA 1IIUA 2WWPA 1KXOA 1SWGA 3NR3A 1SMPI 3S26A 4GGRA 4YGZA 2Y3FA 1EI5A 2GTFX 2RTPB 2MO5A 4YKMA 5HTDA 2RTRB 4PSQA 4GNYA 3T1DA 1HMTA 3ZW1B 2IZLB 2IZHB 1FDQA 1FELA 1QY2A 2R74A 3F8AA 3NPOA 4ORXA 4HPAA 4Y0RA 5B11O 4Y0SA 4ALOA 1RSTB 3UAQA 1SWCA 4YMYA 3ZWEA 4A8ZA 1AVEA 1SWBA 2AT3X 2DJGA 3CWKA 2Q4NA 3PH5A 3WYPA 5K06A 1VWPB 1MX7A 1ML7A 1Y9LA 2KT4B 2Q39A 1JYDA 2C1SA 4YH0A 4ARHA 1MVGA 3RDQA 1PM1X 2DM5A 3HOLA 4CPIA 1X8PA 1ICNA 3VE1A 4ZJ0A 1OEKA 2LBVA 4L3RA 1DZMA 4ZHCA 5EDCA 3APWA 1I78A 2AKQA 3CQNA 2RD7C 1N7YA 3PPTA 4U9CA 4WFUA 5HA1A 3WJBA 3FA9A 1JBHA 1EIOA 4FQBB 2I5VO 1YIVA 2BS6A 1EW3A 3VPJE 5HBSA 4I3CA 4Z2VA 4ORWA 1CBSA 3T2XA 2W2FA 4BCSA 4Y0QA 1SWTA 2AT8X 3FR4A 3WZQA 4TLJA 5CYBA 1VWEB 1VWCB 2OF9A 1IKJA 2CZUA 4ALBA 1E2TA 1CBRA 3BX7A 2Q2PA 4HPCA 2X45A 4YBUA 1NC9A 2I5ZO 1VWAB 1A3YA 2K62A 4ZGUA 1BWYA 2LKKA 1SWSA 3WJDA 2OL6O 5B3MO 2CBSA 3D4RA 3E3CA 1AVGI 4OS8A 1GX8A 2L5PA 2KW1A 1KT3A 3FW5A 1EPBA 4CPFA 1W6FA 4NW4A 1I04A 2FKGA 4KH8A 5L8NA 3RDUA 2IZGB 1N0SA 2X32A 1EQDA 1TW4A 3F6ZB 1VYOA 1FTPA 3P24A 4YCHA 3FR2A 1BSQA 2JU7A 2OY5O 4CPEA 1SWHA 3KFIA 4BX7B 2A0AA 4JHQA 1N9MA 5CSEA 3U0DA 5LJEA 3B2KA 3MX7A 4ZFXA 1SWRA 4AZNA 4CSBA 1VWHB 4BJ8A 1EIIA 1KT7A 1AVDA 4ZHFA 4XMEA 1QG5A 2JOZA 4O4OA 1QFTA 1UREA 2RTDB 4UU2A 3VG2A 1I05A 1SWQA 2X56A 2OVSA 2VFBA 1KL5A 3EYCA 3HTYA 2QOMA 4NV7A 3VG6A 1Y0GA 3P6DA 1T68X 1BSYA 3X00A 4I3DA 2MHDA 3JQOA 3D9WA 4QYNA 4BX6A 2IZBA 2RQ0A 4MVEA 3CMPA 2MM3A 4N7CA 3P02A 1SLFB 1STRB 4NNTA 5F6BA 1VWJB 4ON1A 1OBUA 1N9YA 5D45A 1U17A 1BM5A 2FT9A 4KCAA 1SWAA 5L8IA 2E4JA 1IFCA 1BBPA 3JS1A 4NLIA 3AEHA 2M4LA 1U0XA 3KQ0A 2AT0X 3WYQA 1S7DA 5D8JA 3PP6A 3ZW2A 3HWGA 1O1UA 2OYBO 4OS3A 3WZNA 1YWAA 4I3BA 1E5PA 3KVNA 2CAMA 5BYPA 4ORRA 1OPBA 4ID2A 3S5VA 1O1VA 3TGCA 1GKAB 4OMXA 1CRBA 4OMWA 2CBRA 3HOEA 3OE3A 3RDMA 4AYHA 2HNXA 2OFMX 5AEOA 2Y32A 1JJUA 1X8NA 3KFHA 3NBXX 4U3QA 1BEBA 4IMOA 3FMZA 3IA8A 3VG7A 3ZUIA 5FFHA 1HN2A 1SWFA 1BJ7A 1N43A 4GE1A 5FQ8E 4U8UN 5EEDA 1JMXA 2OFRX 5F7GA 5H9AA 4CDCA 5B10O 4I9RA 4QGVA 4LZUA 1ZNGA 2RTEB 3CKFA 4HWMA 1TOWA 1RLBE 1MM9A 2WR6A 3AUMO 4IAXA 3TGAA 4EEJA 1VWOB 2XSTA 2KTDA 4ZHGA 3STNA 2IZJA 1WUBA 1B0OA 5EEEA 3HWEA 3N91A 4KT5A 1N4JA 2Y3EA 4YFPA 4NV8A 3D97A 1IW2A 3L4RA 2BLGA 1E06A 2P8GA 1LUQA 1BLRA 3I17A 5LJKA 1SWUA 5L8OA 1G74A 3B2HA 5HZ6A 2NP1A 1QY0A 4TKHA 1UZ2X 1G7NA 3ELXA 2JGSA 4CPHB 4YVBA 1Y55X 1ICMA 4U8UM 3P6FA 2VFCA 3TF6A 2ANSA 3I0AA 3VGWA 2NNDA 1STPA 3DSZA 2LFOA 4ZH6A 3WZOA 1HXZA 2RTGB 3EW2A 2FKJA 4Z6JA 1EALA 1FE3A 4YDAA 1MEPA 3U03A 1SRJA 4OEMA 5EDBA 5CHKA 3Q34A 1GT3A 4Z2PA 3EW1A 3LTWA 1MX8A 1NP1A 2POAA 5BVQA 3ZQ3A 1JYJA 1LCVA 1SLEB 2A5CA 2A8GA 3RDSA 4EFGA 1S44A 1NQNA 5FAZA 1HMRA 1SRHA 2K23A 3B2LA 1LIDA 5B5GA 1CBIA 3F9DA 4ZH9A 4ORYA 4TJZA 2ALLX 4MISA 5BVSA 2HZQA 1VYGA 4DCBA 2RTBB 4O4UA 1UYOX 3BY0A 1TOUA 2A3FX 3QKGA 3RBYA 1KZXA 3SLJA 1LIBA 3FIQA 1DZPA 1KT5A 4DQ4A 3IFBA 3RDXA 1PMPA 1ZNLA 2ASNX 2G79A 3T6LA 2FHLA 1NDJA 5EPQA 2C4IA 1GXAA 2QO6A 2ZAGA 1YWBA 3LV4A 2RTNB 3PDFA 4XMDA 1LIFA 1QFVA
chains in the Genus database with same CATH topology
1A18A 1D2UA 2LBAA 3WBGA 3FENA 2PY1A 2ACOA 2FWVA 1BRPA 3WVMA 3FEKA 3STKA 3U9PC 1SA8A 3AKMA 1A2DA 5HCEC 2OZQA 2NNQA 1YUPA 4D6AA 1O8VA 2GC9A 3O19A 5KHPA 3CQRA 5F58A 5FQ7E 5DPQA 3KFGA 4EDEA 4ZGFA 3RKGA 5LJBA 2OVDA 2KTSA 3PEDA 1AQBA 4MVKA 4NP1A 4AW8A 4WBKA 1IFBA 4GETA 3STMX 1LNMA 4AZPA 1FENA 1SY0A 1QWDA 2XKLA 3OBLA 3FA8A 3BRNA 4AZQA 1LFOA 3ELZA 4AZMA 1T8VA 4IB9A 2G78A 5LJDA 5FENA 1NGLA 3C77X 3BS2A 4D6BA 3FR5A 4R0BA 3APUA 1L6MA 3OD9A 1LIEA 1YP6A 2R73A 3C76X 5DG4A 5IO6A 2RN4A 3D96A 2LA7A 4WHIA 2WSJA 1QABE 4TNNA 1CJ5A 5B27A 1LF7A 1QQSA 1YP7A 2GJ5A 4GDZA 3UEUA 1OPAA 3HK1A 5FQ6E 1E02A 4NLJA 1X89A 4M6SA 4IB8A 3FEPA 2X8SA 4U8UO 3VG3A 5BVTA 4FBOA 3NX1A 4GH7A 4IAWA 3ZUOA 1GT4A 1ZNKA 1TXLA 4KIIA 3TGBA 5HCDC 1OBQA 1IKEA 1PEEA 4M7MA 1KQXA 1R0UA 1S2PA 3V8UA 1QY1A 2R56A 2X8TA 3RZYA 4IB6A 1DF3A 5D48A 2JU3A 5HCCC 5AQ6A 3ZW0B 2G7BA 4CV7A 1DV9A 2L67A 3PECA 1KGLA 4XMFA 1D3SA 1KT4A 3WJGA 2IFBA 4GKCA 2WQAE 3VG4A 5IO5A 3G7XA 5D47A 4LKTA 4QGWA 3EM0A 3BU1A 1OBPA 2L68A 4XMGA 2QM9A 4I95A 3GAQA 3MBTA 5C0NA 1ADLA 4QAEA 5H8TA 4I6SA 1I4UA 1EPAA 5AJBA 2FR2A 5AEOA 1EUOA 3BU9A 4ES7A 3ZI8A 2WUTA 2HMBA 1NP4A 1FEMA 3EMMA 3TZSA 1DZJA 2HZRA 4ODDA 2FS7A 3APVA 3MVFA 2O62A 5EZ2A 2CM4A 2Z4HA 4EXZA 5HWZA 4O3YA 3P6CA 4RUNA 5HZ9A 1X8OA 4MVIA 1GT5A 1PBOA 3PQSA 4GU8A 1EXSA 2BHVA 1ACDA 1SXWA 1GM6A 1TVQA 3ZW1A 3BSZE 4YFQA 3P6HA 1G85A 1HBQA 4YBPA 1DC9A 3FYFA 3ZZVA 1X71A 1X8UA 1KOIA 2GTLO 4GK9A 1ZNDA 3APXA 1U18A 4A1YA 1SY1A 4MIRA 5HA0A 4HPBA 2Q2MA 3LHNA 3WOVA 3FELA 5HTEA 1JV4A 2MJIA 1Y9TA 5H9NA 2QO4A 3BDRA 2QMIA 3H3IA 4QYPA 4I9SA 4BVMA 1SXYA 3C78X 1DFVA 4QZUA 3HWFA 3VG5A 2N93A 4INNA 1DZKA 4QNIA 2F73A 2FLJA 2GTLN 1HMSA 1Z24A 4LQZA 3FW4A 2LB6A 4YFRA 3S60A 2QOSC 3KZAA 4GZVA 4JGLA 3PQUA 2KD2A 4N7DA 4QQ1A 5F1EA 4ZCBA 2JMBA 4PJ2A 4QGXA 4BOEA 5CE4A 1ERXA 3NQKA 1I06A 4XMCA 1SY3A 3VE2A 2JW1A 4O9SA 4O3XB 3KFFA 1XKIA 3NP1A 1GT1A 4A60A 3NQ9A 4O3ZA 1LICA 5KICA 5LKEA 3FLLA 2GTLM 2AMMX 3GE2A 5HZ5A 5LJHA 5LJCA 4K19A 5LKFA 4XMHA 1AB0A 2AT6X 2EU7X 1ZRYA 3D95A 4QZTA 3WJFA 4WFVA 3B2IA 3DTQA 1HBPA 4NNSA 3UEVA 2F09A 2FS6A 2HYSA 4ZHHA 2FTBA 4ML7B 5F6ZA 4MVLA 1OEEA 2YG2A 2JN3A 1VYFA 3UEWA 1H91A 3CBCA 1RBPA 3CR6A 3RSWA 1BRQA 4AZOA 4BQUA 2AT5X 1JJJA 4EQAC 4GNWA 3SAOA 3B2JA 3NX2A 1SXXA 1GX9A 2A13A 4OS0A 5AJCA 4FGIB 4ZR2A 1BSOA 4ORUA 3EBWA 3P6EA 1B8EA 2AH7X 1A57A 4KC8A 2Q9SA 3WJEA 2RA6A 1VPRA 4AZRA 2CZTA 3FA7A 4FBRA 4FBVA 4KC7A 4NYQA 4O4XA 2CM9A 4O4SA 2WEWA 2WQ9A 3BLGA 1G5WA 4TQ2A 4HPDA 5HZQA 1AELA 1GKAA 1T0VA 2W2AA 4ORSA 4QRLA 1E00A 5H9LA 3VU1A 2YMSA 4LZVA 1KT6A 1ZNHA 2FR3A 2A2UA 1OEJA 1XCAA 3ZW0A 4A1HA 1KZWA 2Z4IA 2HLVA 2QO5A 4YGGA 2OVEA 4NYRA 2JU8A 1X8QA 3K3LA 4IBAA 1SY2A 4L1NA 3RWXA 1YWDA 4YDBA 1MUPA 2X8FA 1GGLA 3AKNA 3SOTA 2L9CA 1JIWI 3HWDA 4O49A 1B4MA 1B56A 1SXUA 4CK4A 2BS5A 5HAEA 4YGHA 1ZNEA 2ACPX 1P6PA 4UU3A 2AL0X 3UEXA 4O3WA 1JZUA 4GRJA 3WJCA 4LKPA 4YCEA 4TKBA 3S5XA 3O22A 3OJYC 3Q6LA 3WXQA 1JJXA 1CBQA 4YKOA 3JSQA 2RCTA 3NQ3A 1KQWA 2RCQA 4IMNA 4Y0PA 2BT9A 1ERBA 5LJGA 5H9KA 4DQ3A 1MDCA 3NADA 4ZHDA 1LPJA 1ALBA 3BX8A 2ZAIA 2MWHA 3EBKA 5IO7A 5HZ8A 3CBSA 1YWCA 2FRSA 1LKEA 5KIDA 1HQPA 4IB7A 3O2YA 3P6GA 4RUUA 5JR8A 4IABA 2A2GA 2W2BA 3FA6A 2NNEA 2X46A 2OVAA 4HFOA 5D4AA 5B29A 4TKJA 3PH6A 2WEXA 1IIUA 2WWPA 1KXOA 3NR3A 1SMPI 3S26A 4YGZA 1EI5A 2GTFX 2MO5A 4YKMA 5HTDA 4PSQA 4GNYA 3T1DA 1HMTA 3ZW1B 1FDQA 1FELA 1QY2A 2R74A 3F8AA 3NPOA 4ORXA 4HPAA 4Y0RA 4Y0SA 4ALOA 3UAQA 4YMYA 3ZWEA 4A8ZA 2AT3X 3CWKA 3PH5A 5K06A 2Q4NA 1MX7A 1ML7A 1Y9LA 2KT4B 2Q39A 1JYDA 4ARHA 4YH0A 1MVGA 1PM1X 2DM5A 3HOLA 1X8PA 1ICNA 3VE1A 4ZJ0A 1OEKA 2LBVA 4L3RA 1DZMA 4ZHCA 5EDCA 3APWA 2AKQA 3WJBA 3CQNA 2RD7C 5HA1A 3PPTA 4U9CA 4WFUA 3FA9A 1JBHA 1EIOA 4FQBB 1YIVA 2BS6A 1EW3A 3VPJE 5HBSA 4I3CA 4ORWA 1CBSA 2W2FA 4Y0QA 2AT8X 3FR4A 4TLJA 5CYBA 1IKJA 2CZUA 4ALBA 1CBRA 3BX7A 2Q2PA 4HPCA 2X45A 4YBUA 1A3YA 2K62A 4ZGUA 1BWYA 2LKKA 3WJDA 2CBSA 3D4RA 3E3CA 1AVGI 4OS8A 1GX8A 2L5PA 2KW1A 1KT3A 3FW5A 1EPBA 4NW4A 1I04A 4KH8A 5L8NA 4YCHA 1N0SA 1EQDA 1TW4A 3F6ZB 1FTPA 3P24A 4COTA 3FR2A 1BSQA 2JU7A 3U0DA 3KFIA 2A0AA 5LJEA 3B2KA 3MX7A 4ZFXA 4AZNA 4CSBA 1EIIA 1KT7A 4ZHFA 4XMEA 1QG5A 2JOZA 4O4OA 1QFTA 1UREA 4UU2A 3VG2A 1I05A 2OVSA 3VG6A 3EYCA 3HTYA 3P6DA 1T68X 1BSYA 4I3DA 2MHDA 3JQOA 4QYNA 2RQ0A 4MVEA 3CMPA 2MM3A 4N7CA 3P02A 5F6BA 4NNTA 4ON1A 1OBUA 5D45A 1U17A 1BM5A 2FT9A 4KCAA 5L8IA 2E4JA 1IFCA 1BBPA 3JS1A 4NLIA 2M4LA 1U0XA 3KQ0A 2AT0X 1S7DA 5D8JA 3PP6A 3ZW2A 3HWGA 1O1UA 4OS3A 1YWAA 4I3BA 1E5PA 5BYPA 4ORRA 1OPBA 4ID2A 3S5VA 1O1VA 3TGCA 1GKAB 4OMXA 1CRBA 4OMWA 2CBRA 3HOEA 3OE3A 4AYHA 2HNXA 2OFMX 3KFHA 1X8NA 3NBXX 4U3QA 1BEBA 4IMOA 3FMZA 3IA8A 3VG7A 3ZUIA 5FFHA 1HN2A 5FQ8E 1BJ7A 4GE1A 3TGAA 4U8UN 5EEDA 2OFRX 5F7GA 5H9AA 4QGVA 4I9RA 4LZUA 1ZNGA 4HWMA 1TOWA 1RLBE 2WR6A 4IAXA 4EEJA 2XSTA 2KTDA 4ZHGA 3STNA 1B0OA 5EEEA 3HWEA 3N91A 4KT5A 4YFPA 3D97A 1IW2A 3L4RA 2BLGA 1E06A 2P8GA 1BLRA 3I17A 5LJKA 5L8OA 1G74A 3B2HA 5HZ6A 2NP1A 1QY0A 4TKHA 1UZ2X 1G7NA 3ELXA 1ICMA 4U8UM 3P6FA 3TF6A 2ANSA 3I0AA 2NNDA 3DSZA 4ZH6A 2LFOA 1EALA 1FE3A 4YDAA 3U03A 5EDBA 1GT3A 3ZQ3A 5BVQA 1MX8A 1NP1A 2POAA 1JYJA 4EFGA 1S44A 5FAZA 1HMRA 2K23A 3B2LA 1LIDA 1CBIA 3F9DA 4ZH9A 4ORYA 4TJZA 2ALLX 4MISA 5BVSA 2HZQA 1VYGA 4O4UA 3BY0A 1TOUA 2A3FX 3QKGA 3RBYA 1KZXA 1LIBA 3FIQA 1DZPA 1KT5A 4DQ4A 3IFBA 1PMPA 1ZNLA 2ASNX 2G79A 5EPQA 1GXAA 2QO6A 2ZAGA 1YWBA 3LV4A 4XMDA 1LIFA 1QFVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1A18 A;  1D2U A;  2LBA A;  3WBG A;  3FEN A;  2PY1 A;  2ACO A;  2FWV A;  1BRP A;  3WVM A;  3FEK A;  3STK A;  3U9P C;  1SA8 A;  3AKM A;  1A2D A;  5HCE C;  2OZQ A;  2NNQ A;  1YUP A;  4D6A A;  1O8V A;  2GC9 A;  3O19 A;  5KHP A;  3CQR A;  5F58 A;  5DPQ A;  3KFG A;  4EDE A;  5LJB A;  2OVD A;  3PED A;  4NP1 A;  1AQB A;  4MVK A;  4AW8 A;  4WBK A;  1IFB A;  4GET A;  3STM X;  1LNM A;  4AZP A;  1FEN A;  1SY0 A;  1QWD A;  2XKL A;  3FA8 A;  3BRN A;  4AZQ A;  1LFO A;  3ELZ A;  4AZM A;  1T8V A;  4IB9 A;  2G78 A;  5LJD A;  5FEN A;  1NGL A;  3C77 X;  3BS2 A;  4D6B A;  3FR5 A;  4R0B A;  3APU A;  1L6M A;  1LIE A;  1YP6 A;  2R73 A;  3C76 X;  5DG4 A;  5IO6 A;  3D96 A;  2WSJ A;  1QAB E;  4TNN A;  1CJ5 A;  5B27 A;  1LF7 A;  1QQS A;  1YP7 A;  2GJ5 A;  3UEU A;  1OPA A;  3HK1 A;  1E02 A;  4NLJ A;  1X89 A;  4M6S A;  4IB8 A;  3FEP A;  3VG3 A;  5BVT A;  3NX1 A;  4GH7 A;  4IAW A;  3ZUO A;  1GT4 A;  1ZNK A;  1TXL A;  4KII A;  3TGB A;  5HCD C;  1OBQ A;  1IKE A;  1PEE A;  4M7M A;  1KQX A;  1R0U A;  1S2P A;  2R56 A;  1QY1 A;  3RZY A;  4IB6 A;  1DF3 A;  5D48 A;  2JU3 A;  5HCC C;  5AQ6 A;  2G7B A;  1DV9 A;  2L67 A;  3PEC A;  1KGL A;  4XMF A;  1D3S A;  1KT4 A;  3WJG A;  2IFB A;  4GKC A;  2WQA E;  3VG4 A;  5IO5 A;  3G7X A;  5D47 A;  4LKT A;  4QGW A;  3EM0 A;  3BU1 A;  1OBP A;  2L68 A;  4XMG A;  2QM9 A;  3GAQ A;  3MBT A;  5C0N A;  1ADL A;  4QAE A;  5H8T A;  1I4U A;  1EPA A;  2FR2 A;  1EUO A;  3BU9 A;  4ES7 A;  2WUT A;  2HMB A;  1NP4 A;  1FEM A;  3EMM A;  3TZS A;  1DZJ A;  2HZR A;  4ODD A;  2FS7 A;  3APV A;  3MVF A;  2O62 A;  5EZ2 A;  2CM4 A;  4EXZ A;  5HWZ A;  3P6C A;  4RUN A;  5HZ9 A;  1X8O A;  4MVI A;  1GT5 A;  1PBO A;  1EXS A;  1ACD A;  1SXW A;  1GM6 A;  1TVQ A;  3BSZ E;  4YFQ A;  3P6H A;  1G85 A;  1HBQ A;  4YBP A;  1DC9 A;  1X71 A;  1X8U A;  1KOI A;  1ZND A;  3APX A;  1U18 A;  4A1Y A;  1SY1 A;  5HA0 A;  4HPB A;  2Q2M A;  3FEL A;  5HTE A;  1JV4 A;  2MJI A;  5H9N A;  2QO4 A;  3BDR A;  4QYP A;  4I9S A;  4BVM A;  1SXY A;  3C78 X;  1DFV A;  4QZU A;  3HWF A;  3VG5 A;  2N93 A;  1DZK A;  2F73 A;  2FLJ A;  1HMS A;  1Z24 A;  3FW4 A;  2LB6 A;  4YFR A;  2QOS C;  3KZA A;  4N7D A;  5F1E A;  4ZCB A;  4QGX A;  4BOE A;  5CE4 A;  1ERX A;  1I06 A;  4XMC A;  1SY3 A;  4O9S A;  3KFF A;  1XKI A;  3NP1 A;  1GT1 A;  4A60 A;  3NQ9 A;  1LIC A;  5KIC A;  5LKE A;  3FLL A;  2AMM X;  5HZ5 A;  5LJH A;  5LJC A;  4K19 A;  5LKF A;  4XMH A;  1AB0 A;  2AT6 X;  2EU7 X;  1ZRY A;  3D95 A;  4QZT A;  3WJF A;  4WFV A;  3B2I A;  3DTQ A;  1HBP A;  4NNS A;  3UEV A;  2HYS A;  2FS6 A;  4ZHH A;  2FTB A;  5F6Z A;  4MVL A;  1OEE A;  2YG2 A;  2JN3 A;  1VYF A;  3UEW A;  1H91 A;  3CBC A;  1RBP A;  3CR6 A;  3RSW A;  1BRQ A;  4AZO A;  4BQU A;  2AT5 X;  1JJJ A;  4GNW A;  3SAO A;  3B2J A;  3NX2 A;  1SXX A;  1GX9 A;  2A13 A;  4OS0 A;  4ZR2 A;  1BSO A;  4ORU A;  3EBW A;  3P6E A;  1B8E A;  2AH7 X;  1A57 A;  2Q9S A;  3WJE A;  2RA6 A;  1VPR A;  4AZR A;  2CZT A;  3FA7 A;  4NYQ A;  2CM9 A;  2WEW A;  2WQ9 A;  3BLG A;  1G5W A;  4TQ2 A;  4HPD A;  5HZQ A;  1AEL A;  1GKA A;  1T0V A;  2W2A A;  4ORS A;  5H9L A;  1E00 A;  4LZV A;  1KT6 A;  1ZNH A;  2FR3 A;  2A2U A;  1OEJ A;  1XCA A;  4A1H A;  1KZW A;  2HLV A;  2QO5 A;  4YGG A;  2OVE A;  4NYR A;  2JU8 A;  1X8Q A;  3K3L A;  4IBA A;  1SY2 A;  1YWD A;  4YDB A;  1MUP A;  1GGL A;  3AKN A;  2L9C A;  3HWD A;  1B4M A;  1B56 A;  1SXU A;  4CK4 A;  5HAE A;  4YGH A;  1ZNE A;  2ACP X;  1P6P A;  4UU3 A;  2AL0 X;  3UEX A;  1JZU A;  4GRJ A;  3WJC A;  4LKP A;  4YCE A;  4TKB A;  3O22 A;  3OJY C;  3Q6L A;  3WXQ A;  1JJX A;  1CBQ A;  4YKO A;  3JSQ A;  2RCT A;  3NQ3 A;  1KQW A;  2RCQ A;  4IMN A;  4Y0P A;  1ERB A;  5LJG A;  5H9K A;  4DQ3 A;  1MDC A;  3NAD A;  4ZHD A;  1LPJ A;  1ALB A;  3BX8 A;  3EBK A;  5IO7 A;  5HZ8 A;  3CBS A;  1YWC A;  2FRS A;  1LKE A;  5KID A;  1HQP A;  4IB7 A;  3O2Y A;  3P6G A;  4RUU A;  5JR8 A;  5D4A A;  2A2G A;  2W2B A;  3FA6 A;  2NNE A;  2X46 A;  2OVA A;  4HFO A;  5B29 A;  4TKJ A;  3PH6 A;  2WEX A;  1IIU A;  2WWP A;  1KXO A;  3NR3 A;  3S26 A;  4YGZ A;  2GTF X;  2MO5 A;  4YKM A;  5HTD A;  4PSQ A;  4GNY A;  3T1D A;  1HMT A;  1FDQ A;  1FEL A;  1QY2 A;  2R74 A;  3F8A A;  3NPO A;  4ORX A;  4HPA A;  4Y0R A;  4Y0S A;  4ALO A;  4YMY A;  4A8Z A;  2AT3 X;  3CWK A;  3PH5 A;  5K06 A;  2Q4N A;  1MX7 A;  1ML7 A;  2KT4 B;  2Q39 A;  1JYD A;  4ARH A;  4YH0 A;  1MVG A;  1PM1 X;  2DM5 A;  1X8P A;  1ICN A;  4ZJ0 A;  1OEK A;  2LBV A;  1DZM A;  4ZHC A;  5EDC A;  3APW A;  2AKQ A;  3WJB A;  3CQN A;  2RD7 C;  5HA1 A;  3PPT A;  4WFU A;  3FA9 A;  1JBH A;  1EIO A;  1YIV A;  1EW3 A;  5HBS A;  4I3C A;  4ORW A;  1CBS A;  2W2F A;  4Y0Q A;  2AT8 X;  3FR4 A;  4TLJ A;  1IKJ A;  2CZU A;  4ALB A;  1CBR A;  3BX7 A;  2Q2P A;  4HPC A;  2X45 A;  4YBU A;  1A3Y A;  2K62 A;  4ZGU A;  1BWY A;  2LKK A;  3WJD A;  2CBS A;  4OS8 A;  1AVG I;  1GX8 A;  2L5P A;  1KT3 A;  3FW5 A;  1EPB A;  1I04 A;  5L8N A;  4YCH A;  1N0S A;  1EQD A;  1TW4 A;  1FTP A;  3FR2 A;  1BSQ A;  2JU7 A;  3U0D A;  3KFI A;  2A0A A;  5LJE A;  3B2K A;  4ZFX A;  4AZN A;  1EII A;  1KT7 A;  4ZHF A;  4XME A;  1QG5 A;  2JOZ A;  1QFT A;  1URE A;  4UU2 A;  3VG2 A;  1I05 A;  3VG6 A;  3EYC A;  3P6D A;  1T68 X;  1BSY A;  4I3D A;  4QYN A;  2RQ0 A;  3CMP A;  2MM3 A;  4N7C A;  5F6B A;  4NNT A;  1OBU A;  5D45 A;  1U17 A;  1BM5 A;  2FT9 A;  5L8I A;  2E4J A;  1IFC A;  1BBP A;  3JS1 A;  4NLI A;  1U0X A;  3KQ0 A;  2AT0 X;  1S7D A;  5D8J A;  3PP6 A;  3HWG A;  1O1U A;  4OS3 A;  1YWA A;  4I3B A;  1E5P A;  4ORR A;  1OPB A;  3TGC A;  1O1V A;  1GKA B;  4OMX A;  1CRB A;  4OMW A;  2CBR A;  4AYH A;  2HNX A;  2OFM X;  3KFH A;  1X8N A;  1BEB A;  4IMO A;  3FMZ A;  3IA8 A;  3VG7 A;  3ZUI A;  5FFH A;  1HN2 A;  3TGA A;  1BJ7 A;  4GE1 A;  5EED A;  2OFR X;  5F7G A;  5H9A A;  4QGV A;  4I9R A;  4LZU A;  1ZNG A;  1TOW A;  1RLB E;  2WR6 A;  4IAX A;  4EEJ A;  2XST A;  2KTD A;  4ZHG A;  3STN A;  1B0O A;  5EEE A;  3HWE A;  4YFP A;  3D97 A;  1IW2 A;  3L4R A;  2BLG A;  1E06 A;  2P8G A;  1BLR A;  3I17 A;  5LJK A;  5L8O A;  1G74 A;  3B2H A;  5HZ6 A;  2NP1 A;  1QY0 A;  4TKH A;  1UZ2 X;  1G7N A;  3ELX A;  1ICM A;  3P6F A;  3TF6 A;  2ANS A;  3I0A A;  2NND A;  3DSZ A;  4ZH6 A;  2LFO A;  1EAL A;  1FE3 A;  4YDA A;  3U03 A;  5EDB A;  1GT3 A;  3ZQ3 A;  5BVQ A;  1MX8 A;  1NP1 A;  2POA A;  1JYJ A;  4EFG A;  1S44 A;  5FAZ A;  1HMR A;  2K23 A;  3B2L A;  1LID A;  1CBI A;  3F9D A;  4ZH9 A;  4ORY A;  4TJZ A;  2ALL X;  5BVS A;  2HZQ A;  1VYG A;  3BY0 A;  1TOU A;  2A3F X;  3QKG A;  1KZX A;  1LIB A;  3FIQ A;  1DZP A;  1KT5 A;  4DQ4 A;  3IFB A;  1PMP A;  1ZNL A;  2ASN X;  2G79 A;  5EPQ A;  1GXA A;  2QO6 A;  1YWB A;  4XMD A;  1LIF A;  1QFV A; 
#chains in the Genus database with same CATH topology
 1A18 A;  1D2U A;  2LBA A;  3WBG A;  4BBO A;  3FEN A;  2PY1 A;  2ACO A;  1VWG B;  2FWV A;  2IZI A;  4OKA A;  1BRP A;  4CDF A;  2OL8 O;  1SWK A;  3WVM A;  3FEK A;  3FDC A;  3STK A;  2FHN X;  2C1Q A;  3U9P C;  1RXK A;  2WPU A;  1SA8 A;  3AKM A;  1A2D A;  5HCE C;  2OZQ A;  2NNQ A;  1YUP A;  4D6A A;  1O8V A;  2GC9 A;  3O19 A;  2RTA A;  3VHH A;  2RTF B;  4CDE A;  5KHP A;  2A5B A;  3FID A;  1IJ8 A;  3CQR A;  5F58 A;  2RTI B;  5FQ7 E;  4GUZ A;  5DPQ A;  3KFG A;  2QCB A;  1SWE A;  4EDE A;  4ZGF A;  3RKG A;  5LJB A;  2OVD A;  2KTS A;  2RTJ A;  1AQB A;  2RTL A;  3PED A;  4MVK A;  4NP1 A;  4WBK A;  1IFB A;  4GET A;  3RDO A;  3STM X;  1VWK B;  3HPE A;  1LNM A;  4AZP A;  1FEN A;  1SY0 A;  1QWD A;  2XKL A;  3OBL A;  3FA8 A;  3T2W A;  3BRN A;  4AZQ A;  1LFO A;  3ELZ A;  4AZM A;  1K24 A;  1T8V A;  4IB9 A;  2G78 A;  5LJD A;  5FEN A;  1NGL A;  3C77 X;  2MF6 A;  3BS2 A;  4D6B A;  3FR5 A;  4R0B A;  4BX5 A;  3APU A;  1L6M A;  3OD9 A;  1LIE A;  1RAV A;  5IXG A;  1YP6 A;  2R73 A;  2RTQ B;  3C76 X;  5DG4 A;  5IO6 A;  5IRW A;  2RN4 A;  3D96 A;  2LA7 A;  4WHI A;  4CDD A;  2WSJ A;  1QAB E;  4TNN A;  1CJ5 A;  1I9H A;  1LF7 A;  5B27 A;  1QQS A;  1YP7 A;  2RTH B;  4C5P A;  2GJ5 A;  4GDZ A;  3UEU A;  1OPA A;  2G8C O;  3HK1 A;  5FQ6 E;  1GX3 A;  1E02 A;  4NLJ A;  1X89 A;  1NBX A;  4IB8 A;  1SRI A;  2X8S A;  3FEP A;  4M6S A;  4U8U O;  3VG3 A;  5BVT A;  4FBO A;  3NX1 A;  4GJS A;  2UZ2 A;  4GH7 A;  4IAW A;  3ZUO A;  1GT4 A;  1ZNK A;  1TXL A;  4KII A;  3TGB A;  5HCD C;  1OBQ A;  1IKE A;  1RSU B;  1PEE A;  4M7M A;  1KQX A;  1R0U A;  2IZK A;  1S2P A;  3V8U A;  1VWD B;  2OY8 A;  1QY1 A;  2R56 A;  2X8T A;  3RE6 A;  3RZY A;  4AW8 A;  4IB6 A;  1DF3 A;  1WBI A;  2JU3 A;  5D48 A;  4BX6 B;  5HCC C;  5AQ6 A;  2X55 A;  2G7B A;  3ZW0 B;  4CV7 A;  3SZH A;  1W4T A;  1DV9 A;  2L67 A;  3PEC A;  1KGL A;  4XMF A;  1D3S A;  1VWI B;  1KT4 A;  3T6F A;  3WJG A;  2IFB A;  4GKC A;  2WQA E;  4B55 A;  2IZF B;  5IRU A;  3VG4 A;  5IO5 A;  3G7X A;  5D47 A;  4LKT A;  4QGW A;  3EM0 A;  3BU1 A;  1OBP A;  1SWD A;  2IZD B;  2L68 A;  4XMG A;  1HQQ A;  2QM9 A;  3GAQ A;  3MBT A;  4I95 A;  2OY7 A;  5C0N A;  1ADL A;  4QAE A;  5H8T A;  1G5W A;  4I6S A;  1I4U A;  1EPA A;  5AJB A;  2FR2 A;  5B2A O;  1EUO A;  3BU9 A;  3SZJ A;  4ES7 A;  3ZI8 A;  2WUT A;  2HMB A;  1NP4 A;  1FEM A;  1SWL A;  3EMM A;  3TZS A;  1DZJ A;  2HZR A;  4ODD A;  2FS7 A;  3APV A;  3MVF A;  2O62 A;  5EZ2 A;  2CM4 A;  2Z4H A;  4EXZ A;  5HWZ A;  1VWQ B;  4O3Y A;  2X4M A;  3P6C A;  4RUN A;  5HZ9 A;  1FJ1 E;  1X8O A;  4MVI A;  1GT5 A;  1SRF A;  1PBO A;  3PQS A;  4GU8 A;  1EXS A;  2BHV A;  1ACD A;  1SXW A;  1KFF A;  1GM6 A;  1TVQ A;  2RTM A;  3BSZ E;  4YFQ A;  1HXL A;  3VHM A;  3P6H A;  3ZW1 A;  1G85 A;  1HBQ A;  4YBP A;  1LCZ A;  1DC9 A;  3FYF A;  2OY1 O;  3ZZV A;  1MK5 A;  1X71 A;  1X8U A;  1KOI A;  2GTL O;  4GK9 A;  1SWP A;  1ZND A;  2AF5 A;  3APX A;  5IRA A;  1U18 A;  4A1Y A;  1UYN X;  1SY1 A;  1VWN B;  1VWL B;  4MIR A;  1SWN A;  3VHI A;  5HA0 A;  4HPB A;  1VWF B;  1KL3 A;  2Q2M A;  3LHN A;  3WOV A;  4COT A;  1SWJ A;  5B5F A;  5K67 A;  3FEL A;  5HTE A;  1W5R A;  1JV4 A;  2OF8 A;  1RXJ A;  1Y9T A;  2MJI A;  3RE5 A;  5H9N A;  2QO4 A;  1Y53 X;  1LCW A;  1SLD B;  2GH7 A;  2VDF A;  3BDR A;  1VWR B;  2QMI A;  3H3I A;  4QYP A;  4I9S A;  4BVM A;  1SXY A;  3C78 X;  1DFV A;  4QZU A;  3HWF A;  3VG5 A;  2AVI A;  2N93 A;  4INN A;  1DZK A;  1VWM B;  4QNI A;  2F73 A;  2FLJ A;  2GTL N;  1HMS A;  1DF8 A;  1Z24 A;  4LQZ A;  3FW4 A;  1SRE A;  1KL4 A;  2LB6 A;  3S60 A;  4YFR A;  2QOS C;  3KZA A;  4GZV A;  4JGL A;  2IZE B;  3PQU A;  2KD2 A;  4N7D A;  4QQ1 A;  5F1E A;  4ZCB A;  3RY2 A;  2JMB A;  1SRG A;  2DJF A;  4PJ2 A;  4QGX A;  4BOE A;  1JQP A;  5K68 A;  1ERX A;  5CE4 A;  3NQK A;  1LDQ A;  1I06 A;  4XMC A;  1SY3 A;  3VE2 A;  2JW1 A;  4O9S A;  4O3X B;  3KFF A;  3QQ2 A;  1XKI A;  3NP1 A;  4MEE A;  1GT1 A;  4A60 A;  3NQ9 A;  4O3Z A;  1LIC A;  5KIC A;  4IRW A;  5LKE A;  3FLL A;  2GTL M;  2AMM X;  2G5L A;  3GE2 A;  4BX7 A;  5HZ5 A;  4K19 A;  5JD2 A;  5LJH A;  5LKF A;  4XMH A;  1AB0 A;  2AT6 X;  2EU7 X;  1ZRY A;  3D95 A;  4QZT A;  3WJF A;  4WFV A;  1LDO A;  3B2I A;  3DTQ A;  4GJV A;  1HBP A;  4NNS A;  3UEV A;  2F09 A;  2FS6 A;  2HYS A;  2OL7 A;  4ZHH A;  2FTB A;  4ML7 B;  5F6Z A;  4MVL A;  4Y59 A;  1OEE A;  2YG2 A;  1OSP O;  2JN3 A;  1VYF A;  4I60 A;  3UEW A;  1H91 A;  3PK2 A;  3CBC A;  1RBP A;  3CR6 A;  3RSW A;  1BRQ A;  2BSZ A;  2FGS A;  4AZO A;  4BQU A;  2OFA A;  4GGZ A;  2AT5 X;  1JJJ A;  5L3Y A;  5LJC A;  4EQA C;  4GNW A;  3RY1 A;  3SAO A;  3B2J A;  3NX2 A;  1SXX A;  3MG5 A;  1SWO A;  4U46 A;  1GX9 A;  1HY2 A;  2A13 A;  4OS0 A;  5AJC A;  3WZP A;  2F01 A;  4FGI B;  4ZR2 A;  1BSO A;  4ORU A;  3EBW A;  3P6E A;  1B8E A;  4JNJ A;  2AH7 X;  1A57 A;  4KC8 A;  2Q9S A;  3WJE A;  2RA6 A;  1VPR A;  4AZR A;  2CZT A;  3FA7 A;  4GDA A;  3SLO A;  4FBR A;  4FBV A;  3CKG A;  4KC7 A;  4GD9 A;  2CM9 A;  4NYQ A;  2WEW A;  2WQ9 A;  3BLG A;  4JO6 A;  4O4X A;  4O4S A;  4DNE A;  4TQ2 A;  4HPD A;  1JMZ A;  5HZQ A;  1GKA A;  4Z2O A;  1AEL A;  4BX5 B;  1T0V A;  2HKD A;  2W2A A;  4ORS A;  4QRL A;  1E00 A;  5H9L A;  3VU1 A;  2YMS A;  4LZV A;  1KT6 A;  1PTS A;  1ZNH A;  2FR3 A;  2A2U A;  1OEJ A;  1XCA A;  3ZW0 A;  4A1H A;  1KZW A;  2Z4I A;  2HLV A;  4BGF A;  1K3B A;  4EKV A;  2QO5 A;  1MOY A;  4YGG A;  2OVE A;  2IZA A;  2JU8 A;  4NYR A;  1X8Q A;  3K3L A;  4IBA A;  1SY2 A;  2X34 A;  4L1N A;  3RWX A;  2BC3 A;  1YWD A;  4YDB A;  1MUP A;  1STS B;  2PI3 O;  2X8F A;  4Y5D A;  1GGL A;  3AKN A;  3SOT A;  2L9C A;  3MM0 A;  1JIW I;  3HWD A;  4O49 A;  1B4M A;  1B56 A;  1SXU A;  4Z27 A;  4CK4 A;  2BS5 A;  5F2B A;  5HAE A;  1LEL A;  4YGH A;  3SLT A;  1ZNE A;  2ACP X;  1P6P A;  4UU3 A;  2AL0 X;  4GGT A;  2RTK A;  3UEX A;  4O3W A;  1JZU A;  4GRJ A;  3WJC A;  4LKP A;  4YCE A;  4CPH A;  4TKB A;  3S5X A;  3O22 A;  3OJY C;  1SLG B;  2OFB A;  3Q6L A;  3WXQ A;  1JJX A;  1CBQ A;  4YKO A;  3JSQ A;  2RCT A;  1NQM A;  1RXH A;  3NQ3 A;  1KQW A;  2RCQ A;  4IMN A;  4Y0P A;  2BT9 A;  1ERB A;  5LJG A;  5H9K A;  2IZC B;  4DQ3 A;  1MDC A;  3NAD A;  2UYW A;  1LPJ A;  1ALB A;  3BX8 A;  3SZI A;  2ZAI A;  4ZHD A;  2MWH A;  4OEL A;  2ZSC A;  1Y52 X;  3EBK A;  1PBY A;  3EC5 A;  5IO7 A;  4Z28 A;  5HZ8 A;  3CBS A;  1YWC A;  2FRS A;  1LKE A;  5KID A;  1HQP A;  4IB7 A;  2RTO B;  3O2Y A;  3P6G A;  4RUU A;  5JR8 A;  4IAB A;  2A2G A;  2W2B A;  2RTC B;  2NNE A;  2X46 A;  2OVA A;  3FA6 A;  4HFO A;  5D4A A;  4TKJ A;  5B29 A;  1VWB B;  3PH6 A;  2WEX A;  1IIU A;  2WWP A;  1KXO A;  1SWG A;  3NR3 A;  1SMP I;  3S26 A;  4GGR A;  4YGZ A;  2Y3F A;  1EI5 A;  2GTF X;  2RTP B;  2MO5 A;  4YKM A;  5HTD A;  2RTR B;  4PSQ A;  4GNY A;  3T1D A;  1HMT A;  3ZW1 B;  2IZL B;  2IZH B;  1FDQ A;  1FEL A;  1QY2 A;  2R74 A;  3F8A A;  3NPO A;  4ORX A;  4HPA A;  4Y0R A;  5B11 O;  4Y0S A;  4ALO A;  1RST B;  3UAQ A;  1SWC A;  4YMY A;  3ZWE A;  4A8Z A;  1AVE A;  1SWB A;  2AT3 X;  2DJG A;  3CWK A;  2Q4N A;  3PH5 A;  3WYP A;  5K06 A;  1VWP B;  1MX7 A;  1ML7 A;  1Y9L A;  2KT4 B;  2Q39 A;  1JYD A;  2C1S A;  4YH0 A;  4ARH A;  1MVG A;  3RDQ A;  1PM1 X;  2DM5 A;  3HOL A;  4CPI A;  1X8P A;  1ICN A;  3VE1 A;  4ZJ0 A;  1OEK A;  2LBV A;  4L3R A;  1DZM A;  4ZHC A;  5EDC A;  3APW A;  1I78 A;  2AKQ A;  3CQN A;  2RD7 C;  1N7Y A;  3PPT A;  4U9C A;  4WFU A;  5HA1 A;  3WJB A;  3FA9 A;  1JBH A;  1EIO A;  4FQB B;  2I5V O;  1YIV A;  2BS6 A;  1EW3 A;  3VPJ E;  5HBS A;  4I3C A;  4Z2V A;  4ORW A;  1CBS A;  3T2X A;  2W2F A;  4BCS A;  4Y0Q A;  1SWT A;  2AT8 X;  3FR4 A;  3WZQ A;  4TLJ A;  5CYB A;  1VWE B;  1VWC B;  2OF9 A;  1IKJ A;  2CZU A;  4ALB A;  1E2T A;  1CBR A;  3BX7 A;  2Q2P A;  4HPC A;  2X45 A;  4YBU A;  1NC9 A;  2I5Z O;  1VWA B;  1A3Y A;  2K62 A;  4ZGU A;  1BWY A;  2LKK A;  1SWS A;  3WJD A;  2OL6 O;  5B3M O;  2CBS A;  3D4R A;  3E3C A;  1AVG I;  4OS8 A;  1GX8 A;  2L5P A;  2KW1 A;  1KT3 A;  3FW5 A;  1EPB A;  4CPF A;  1W6F A;  4NW4 A;  1I04 A;  2FKG A;  4KH8 A;  5L8N A;  3RDU A;  2IZG B;  1N0S A;  2X32 A;  1EQD A;  1TW4 A;  3F6Z B;  1VYO A;  1FTP A;  3P24 A;  4YCH A;  3FR2 A;  1BSQ A;  2JU7 A;  2OY5 O;  4CPE A;  1SWH A;  3KFI A;  4BX7 B;  2A0A A;  4JHQ A;  1N9M A;  5CSE A;  3U0D A;  5LJE A;  3B2K A;  3MX7 A;  4ZFX A;  1SWR A;  4AZN A;  4CSB A;  1VWH B;  4BJ8 A;  1EII A;  1KT7 A;  1AVD A;  4ZHF A;  4XME A;  1QG5 A;  2JOZ A;  4O4O A;  1QFT A;  1URE A;  2RTD B;  4UU2 A;  3VG2 A;  1I05 A;  1SWQ A;  2X56 A;  2OVS A;  2VFB A;  1KL5 A;  3EYC A;  3HTY A;  2QOM A;  4NV7 A;  3VG6 A;  1Y0G A;  3P6D A;  1T68 X;  1BSY A;  3X00 A;  4I3D A;  2MHD A;  3JQO A;  3D9W A;  4QYN A;  4BX6 A;  2IZB A;  2RQ0 A;  4MVE A;  3CMP A;  2MM3 A;  4N7C A;  3P02 A;  1SLF B;  1STR B;  4NNT A;  5F6B A;  1VWJ B;  4ON1 A;  1OBU A;  1N9Y A;  5D45 A;  1U17 A;  1BM5 A;  2FT9 A;  4KCA A;  1SWA A;  5L8I A;  2E4J A;  1IFC A;  1BBP A;  3JS1 A;  4NLI A;  3AEH A;  2M4L A;  1U0X A;  3KQ0 A;  2AT0 X;  3WYQ A;  1S7D A;  5D8J A;  3PP6 A;  3ZW2 A;  3HWG A;  1O1U A;  2OYB O;  4OS3 A;  3WZN A;  1YWA A;  4I3B A;  1E5P A;  3KVN A;  2CAM A;  5BYP A;  4ORR A;  1OPB A;  4ID2 A;  3S5V A;  1O1V A;  3TGC A;  1GKA B;  4OMX A;  1CRB A;  4OMW A;  2CBR A;  3HOE A;  3OE3 A;  3RDM A;  4AYH A;  2HNX A;  2OFM X;  5AEO A;  2Y32 A;  1JJU A;  1X8N A;  3KFH A;  3NBX X;  4U3Q A;  1BEB A;  4IMO A;  3FMZ A;  3IA8 A;  3VG7 A;  3ZUI A;  5FFH A;  1HN2 A;  1SWF A;  1BJ7 A;  1N43 A;  4GE1 A;  5FQ8 E;  4U8U N;  5EED A;  1JMX A;  2OFR X;  5F7G A;  5H9A A;  4CDC A;  5B10 O;  4I9R A;  4QGV A;  4LZU A;  1ZNG A;  2RTE B;  3CKF A;  4HWM A;  1TOW A;  1RLB E;  1MM9 A;  2WR6 A;  3AUM O;  4IAX A;  3TGA A;  4EEJ A;  1VWO B;  2XST A;  2KTD A;  4ZHG A;  3STN A;  2IZJ A;  1WUB A;  1B0O A;  5EEE A;  3HWE A;  3N91 A;  4KT5 A;  1N4J A;  2Y3E A;  4YFP A;  4NV8 A;  3D97 A;  1IW2 A;  3L4R A;  2BLG A;  1E06 A;  2P8G A;  1LUQ A;  1BLR A;  3I17 A;  5LJK A;  1SWU A;  5L8O A;  1G74 A;  3B2H A;  5HZ6 A;  2NP1 A;  1QY0 A;  4TKH A;  1UZ2 X;  1G7N A;  3ELX A;  2JGS A;  4CPH B;  4YVB A;  1Y55 X;  1ICM A;  4U8U M;  3P6F A;  2VFC A;  3TF6 A;  2ANS A;  3I0A A;  3VGW A;  2NND A;  1STP A;  3DSZ A;  2LFO A;  4ZH6 A;  3WZO A;  1HXZ A;  2RTG B;  3EW2 A;  2FKJ A;  4Z6J A;  1EAL A;  1FE3 A;  4YDA A;  1MEP A;  3U03 A;  1SRJ A;  4OEM A;  5EDB A;  5CHK A;  3Q34 A;  1GT3 A;  4Z2P A;  3EW1 A;  3LTW A;  1MX8 A;  1NP1 A;  2POA A;  5BVQ A;  3ZQ3 A;  1JYJ A;  1LCV A;  1SLE B;  2A5C A;  2A8G A;  3RDS A;  4EFG A;  1S44 A;  1NQN A;  5FAZ A;  1HMR A;  1SRH A;  2K23 A;  3B2L A;  1LID A;  5B5G A;  1CBI A;  3F9D A;  4ZH9 A;  4ORY A;  4TJZ A;  2ALL X;  4MIS A;  5BVS A;  2HZQ A;  1VYG A;  4DCB A;  2RTB B;  4O4U A;  1UYO X;  3BY0 A;  1TOU A;  2A3F X;  3QKG A;  3RBY A;  1KZX A;  3SLJ A;  1LIB A;  3FIQ A;  1DZP A;  1KT5 A;  4DQ4 A;  3IFB A;  3RDX A;  1PMP A;  1ZNL A;  2ASN X;  2G79 A;  3T6L A;  2FHL A;  1NDJ A;  5EPQ A;  2C4I A;  1GXA A;  2QO6 A;  2ZAG A;  1YWB A;  3LV4 A;  2RTN B;  3PDF A;  4XMD A;  1LIF A;  1QFV A; 
#chains in the Genus database with same CATH homology
 1A18 A;  1D2U A;  2LBA A;  3WBG A;  3FEN A;  2PY1 A;  2ACO A;  2FWV A;  1BRP A;  3WVM A;  3FEK A;  3STK A;  3U9P C;  1SA8 A;  3AKM A;  1A2D A;  5HCE C;  2OZQ A;  2NNQ A;  1YUP A;  4D6A A;  1O8V A;  2GC9 A;  3O19 A;  5KHP A;  3CQR A;  5F58 A;  5FQ7 E;  5DPQ A;  3KFG A;  4EDE A;  4ZGF A;  3RKG A;  5LJB A;  2OVD A;  2KTS A;  3PED A;  1AQB A;  4MVK A;  4NP1 A;  4AW8 A;  4WBK A;  1IFB A;  4GET A;  3STM X;  1LNM A;  4AZP A;  1FEN A;  1SY0 A;  1QWD A;  2XKL A;  3OBL A;  3FA8 A;  3BRN A;  4AZQ A;  1LFO A;  3ELZ A;  4AZM A;  1T8V A;  4IB9 A;  2G78 A;  5LJD A;  5FEN A;  1NGL A;  3C77 X;  3BS2 A;  4D6B A;  3FR5 A;  4R0B A;  3APU A;  1L6M A;  3OD9 A;  1LIE A;  1YP6 A;  2R73 A;  3C76 X;  5DG4 A;  5IO6 A;  2RN4 A;  3D96 A;  2LA7 A;  4WHI A;  2WSJ A;  1QAB E;  4TNN A;  1CJ5 A;  5B27 A;  1LF7 A;  1QQS A;  1YP7 A;  2GJ5 A;  4GDZ A;  3UEU A;  1OPA A;  3HK1 A;  5FQ6 E;  1E02 A;  4NLJ A;  1X89 A;  4M6S A;  4IB8 A;  3FEP A;  2X8S A;  4U8U O;  3VG3 A;  5BVT A;  4FBO A;  3NX1 A;  4GH7 A;  4IAW A;  3ZUO A;  1GT4 A;  1ZNK A;  1TXL A;  4KII A;  3TGB A;  5HCD C;  1OBQ A;  1IKE A;  1PEE A;  4M7M A;  1KQX A;  1R0U A;  1S2P A;  3V8U A;  1QY1 A;  2R56 A;  2X8T A;  3RZY A;  4IB6 A;  1DF3 A;  5D48 A;  2JU3 A;  5HCC C;  5AQ6 A;  3ZW0 B;  2G7B A;  4CV7 A;  1DV9 A;  2L67 A;  3PEC A;  1KGL A;  4XMF A;  1D3S A;  1KT4 A;  3WJG A;  2IFB A;  4GKC A;  2WQA E;  3VG4 A;  5IO5 A;  3G7X A;  5D47 A;  4LKT A;  4QGW A;  3EM0 A;  3BU1 A;  1OBP A;  2L68 A;  4XMG A;  2QM9 A;  4I95 A;  3GAQ A;  3MBT A;  5C0N A;  1ADL A;  4QAE A;  5H8T A;  4I6S A;  1I4U A;  1EPA A;  5AJB A;  2FR2 A;  5AEO A;  1EUO A;  3BU9 A;  4ES7 A;  3ZI8 A;  2WUT A;  2HMB A;  1NP4 A;  1FEM A;  3EMM A;  3TZS A;  1DZJ A;  2HZR A;  4ODD A;  2FS7 A;  3APV A;  3MVF A;  2O62 A;  5EZ2 A;  2CM4 A;  2Z4H A;  4EXZ A;  5HWZ A;  4O3Y A;  3P6C A;  4RUN A;  5HZ9 A;  1X8O A;  4MVI A;  1GT5 A;  1PBO A;  3PQS A;  4GU8 A;  1EXS A;  2BHV A;  1ACD A;  1SXW A;  1GM6 A;  1TVQ A;  3ZW1 A;  3BSZ E;  4YFQ A;  3P6H A;  1G85 A;  1HBQ A;  4YBP A;  1DC9 A;  3FYF A;  3ZZV A;  1X71 A;  1X8U A;  1KOI A;  2GTL O;  4GK9 A;  1ZND A;  3APX A;  1U18 A;  4A1Y A;  1SY1 A;  4MIR A;  5HA0 A;  4HPB A;  2Q2M A;  3LHN A;  3WOV A;  3FEL A;  5HTE A;  1JV4 A;  2MJI A;  1Y9T A;  5H9N A;  2QO4 A;  3BDR A;  2QMI A;  3H3I A;  4QYP A;  4I9S A;  4BVM A;  1SXY A;  3C78 X;  1DFV A;  4QZU A;  3HWF A;  3VG5 A;  2N93 A;  4INN A;  1DZK A;  4QNI A;  2F73 A;  2FLJ A;  2GTL N;  1HMS A;  1Z24 A;  4LQZ A;  3FW4 A;  2LB6 A;  4YFR A;  3S60 A;  2QOS C;  3KZA A;  4GZV A;  4JGL A;  3PQU A;  2KD2 A;  4N7D A;  4QQ1 A;  5F1E A;  4ZCB A;  2JMB A;  4PJ2 A;  4QGX A;  4BOE A;  5CE4 A;  1ERX A;  3NQK A;  1I06 A;  4XMC A;  1SY3 A;  3VE2 A;  2JW1 A;  4O9S A;  4O3X B;  3KFF A;  1XKI A;  3NP1 A;  1GT1 A;  4A60 A;  3NQ9 A;  4O3Z A;  1LIC A;  5KIC A;  5LKE A;  3FLL A;  2GTL M;  2AMM X;  3GE2 A;  5HZ5 A;  5LJH A;  5LJC A;  4K19 A;  5LKF A;  4XMH A;  1AB0 A;  2AT6 X;  2EU7 X;  1ZRY A;  3D95 A;  4QZT A;  3WJF A;  4WFV A;  3B2I A;  3DTQ A;  1HBP A;  4NNS A;  3UEV A;  2F09 A;  2FS6 A;  2HYS A;  4ZHH A;  2FTB A;  4ML7 B;  5F6Z A;  4MVL A;  1OEE A;  2YG2 A;  2JN3 A;  1VYF A;  3UEW A;  1H91 A;  3CBC A;  1RBP A;  3CR6 A;  3RSW A;  1BRQ A;  4AZO A;  4BQU A;  2AT5 X;  1JJJ A;  4EQA C;  4GNW A;  3SAO A;  3B2J A;  3NX2 A;  1SXX A;  1GX9 A;  2A13 A;  4OS0 A;  5AJC A;  4FGI B;  4ZR2 A;  1BSO A;  4ORU A;  3EBW A;  3P6E A;  1B8E A;  2AH7 X;  1A57 A;  4KC8 A;  2Q9S A;  3WJE A;  2RA6 A;  1VPR A;  4AZR A;  2CZT A;  3FA7 A;  4FBR A;  4FBV A;  4KC7 A;  4NYQ A;  4O4X A;  2CM9 A;  4O4S A;  2WEW A;  2WQ9 A;  3BLG A;  1G5W A;  4TQ2 A;  4HPD A;  5HZQ A;  1AEL A;  1GKA A;  1T0V A;  2W2A A;  4ORS A;  4QRL A;  1E00 A;  5H9L A;  3VU1 A;  2YMS A;  4LZV A;  1KT6 A;  1ZNH A;  2FR3 A;  2A2U A;  1OEJ A;  1XCA A;  3ZW0 A;  4A1H A;  1KZW A;  2Z4I A;  2HLV A;  2QO5 A;  4YGG A;  2OVE A;  4NYR A;  2JU8 A;  1X8Q A;  3K3L A;  4IBA A;  1SY2 A;  4L1N A;  3RWX A;  1YWD A;  4YDB A;  1MUP A;  2X8F A;  1GGL A;  3AKN A;  3SOT A;  2L9C A;  1JIW I;  3HWD A;  4O49 A;  1B4M A;  1B56 A;  1SXU A;  4CK4 A;  2BS5 A;  5HAE A;  4YGH A;  1ZNE A;  2ACP X;  1P6P A;  4UU3 A;  2AL0 X;  3UEX A;  4O3W A;  1JZU A;  4GRJ A;  3WJC A;  4LKP A;  4YCE A;  4TKB A;  3S5X A;  3O22 A;  3OJY C;  3Q6L A;  3WXQ A;  1JJX A;  1CBQ A;  4YKO A;  3JSQ A;  2RCT A;  3NQ3 A;  1KQW A;  2RCQ A;  4IMN A;  4Y0P A;  2BT9 A;  1ERB A;  5LJG A;  5H9K A;  4DQ3 A;  1MDC A;  3NAD A;  4ZHD A;  1LPJ A;  1ALB A;  3BX8 A;  2ZAI A;  2MWH A;  3EBK A;  5IO7 A;  5HZ8 A;  3CBS A;  1YWC A;  2FRS A;  1LKE A;  5KID A;  1HQP A;  4IB7 A;  3O2Y A;  3P6G A;  4RUU A;  5JR8 A;  4IAB A;  2A2G A;  2W2B A;  3FA6 A;  2NNE A;  2X46 A;  2OVA A;  4HFO A;  5D4A A;  5B29 A;  4TKJ A;  3PH6 A;  2WEX A;  1IIU A;  2WWP A;  1KXO A;  3NR3 A;  1SMP I;  3S26 A;  4YGZ A;  1EI5 A;  2GTF X;  2MO5 A;  4YKM A;  5HTD A;  4PSQ A;  4GNY A;  3T1D A;  1HMT A;  3ZW1 B;  1FDQ A;  1FEL A;  1QY2 A;  2R74 A;  3F8A A;  3NPO A;  4ORX A;  4HPA A;  4Y0R A;  4Y0S A;  4ALO A;  3UAQ A;  4YMY A;  3ZWE A;  4A8Z A;  2AT3 X;  3CWK A;  3PH5 A;  5K06 A;  2Q4N A;  1MX7 A;  1ML7 A;  1Y9L A;  2KT4 B;  2Q39 A;  1JYD A;  4ARH A;  4YH0 A;  1MVG A;  1PM1 X;  2DM5 A;  3HOL A;  1X8P A;  1ICN A;  3VE1 A;  4ZJ0 A;  1OEK A;  2LBV A;  4L3R A;  1DZM A;  4ZHC A;  5EDC A;  3APW A;  2AKQ A;  3WJB A;  3CQN A;  2RD7 C;  5HA1 A;  3PPT A;  4U9C A;  4WFU A;  3FA9 A;  1JBH A;  1EIO A;  4FQB B;  1YIV A;  2BS6 A;  1EW3 A;  3VPJ E;  5HBS A;  4I3C A;  4ORW A;  1CBS A;  2W2F A;  4Y0Q A;  2AT8 X;  3FR4 A;  4TLJ A;  5CYB A;  1IKJ A;  2CZU A;  4ALB A;  1CBR A;  3BX7 A;  2Q2P A;  4HPC A;  2X45 A;  4YBU A;  1A3Y A;  2K62 A;  4ZGU A;  1BWY A;  2LKK A;  3WJD A;  2CBS A;  3D4R A;  3E3C A;  1AVG I;  4OS8 A;  1GX8 A;  2L5P A;  2KW1 A;  1KT3 A;  3FW5 A;  1EPB A;  4NW4 A;  1I04 A;  4KH8 A;  5L8N A;  4YCH A;  1N0S A;  1EQD A;  1TW4 A;  3F6Z B;  1FTP A;  3P24 A;  4COT A;  3FR2 A;  1BSQ A;  2JU7 A;  3U0D A;  3KFI A;  2A0A A;  5LJE A;  3B2K A;  3MX7 A;  4ZFX A;  4AZN A;  4CSB A;  1EII A;  1KT7 A;  4ZHF A;  4XME A;  1QG5 A;  2JOZ A;  4O4O A;  1QFT A;  1URE A;  4UU2 A;  3VG2 A;  1I05 A;  2OVS A;  3VG6 A;  3EYC A;  3HTY A;  3P6D A;  1T68 X;  1BSY A;  4I3D A;  2MHD A;  3JQO A;  4QYN A;  2RQ0 A;  4MVE A;  3CMP A;  2MM3 A;  4N7C A;  3P02 A;  5F6B A;  4NNT A;  4ON1 A;  1OBU A;  5D45 A;  1U17 A;  1BM5 A;  2FT9 A;  4KCA A;  5L8I A;  2E4J A;  1IFC A;  1BBP A;  3JS1 A;  4NLI A;  2M4L A;  1U0X A;  3KQ0 A;  2AT0 X;  1S7D A;  5D8J A;  3PP6 A;  3ZW2 A;  3HWG A;  1O1U A;  4OS3 A;  1YWA A;  4I3B A;  1E5P A;  5BYP A;  4ORR A;  1OPB A;  4ID2 A;  3S5V A;  1O1V A;  3TGC A;  1GKA B;  4OMX A;  1CRB A;  4OMW A;  2CBR A;  3HOE A;  3OE3 A;  4AYH A;  2HNX A;  2OFM X;  3KFH A;  1X8N A;  3NBX X;  4U3Q A;  1BEB A;  4IMO A;  3FMZ A;  3IA8 A;  3VG7 A;  3ZUI A;  5FFH A;  1HN2 A;  5FQ8 E;  1BJ7 A;  4GE1 A;  3TGA A;  4U8U N;  5EED A;  2OFR X;  5F7G A;  5H9A A;  4QGV A;  4I9R A;  4LZU A;  1ZNG A;  4HWM A;  1TOW A;  1RLB E;  2WR6 A;  4IAX A;  4EEJ A;  2XST A;  2KTD A;  4ZHG A;  3STN A;  1B0O A;  5EEE A;  3HWE A;  3N91 A;  4KT5 A;  4YFP A;  3D97 A;  1IW2 A;  3L4R A;  2BLG A;  1E06 A;  2P8G A;  1BLR A;  3I17 A;  5LJK A;  5L8O A;  1G74 A;  3B2H A;  5HZ6 A;  2NP1 A;  1QY0 A;  4TKH A;  1UZ2 X;  1G7N A;  3ELX A;  1ICM A;  4U8U M;  3P6F A;  3TF6 A;  2ANS A;  3I0A A;  2NND A;  3DSZ A;  4ZH6 A;  2LFO A;  1EAL A;  1FE3 A;  4YDA A;  3U03 A;  5EDB A;  1GT3 A;  3ZQ3 A;  5BVQ A;  1MX8 A;  1NP1 A;  2POA A;  1JYJ A;  4EFG A;  1S44 A;  5FAZ A;  1HMR A;  2K23 A;  3B2L A;  1LID A;  1CBI A;  3F9D A;  4ZH9 A;  4ORY A;  4TJZ A;  2ALL X;  4MIS A;  5BVS A;  2HZQ A;  1VYG A;  4O4U A;  3BY0 A;  1TOU A;  2A3F X;  3QKG A;  3RBY A;  1KZX A;  1LIB A;  3FIQ A;  1DZP A;  1KT5 A;  4DQ4 A;  3IFB A;  1PMP A;  1ZNL A;  2ASN X;  2G79 A;  5EPQ A;  1GXA A;  2QO6 A;  2ZAG A;  1YWB A;  3LV4 A;  4XMD A;  1LIF A;  1QFV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...