1I4VA

Solution structure of the umud' homodimer
Total Genus 8
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
8
sequence length
115
structure length
115
Chain Sequence
AFPSPAADYVEQRIDLNQLLIQHPSATYFVKASGDSMIDGGISDGDLLIVDSAITASHGDIVIAAVDGEFTVKKLQLRPTVQLIPMNSAYSPITISSEDTLDVFGVVIHVVKAMR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Converting a DNA damage checkpoint effector (UmuD2C) into a lesion bypass polymerase (UmuD'2C).
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase
molecule keywords UMUD' PROTEIN
total genus 8
structure length 115
sequence length 115
chains with identical sequence B
ec nomenclature ec 3.4.21.-:
pdb deposition date 2001-02-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00717 Peptidase_S24 Peptidase S24-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.10.109.10 Mainly Beta Ribbon Umud Fragment, subunit A Umud Fragment, subunit A 1i4vA00
3JSOA 4N31A 4NV4A 3IIQA 1B12A 1JHEA 2HO0A 3K2ZA 1JHHA 1JHCA 1UMUA 1T7DA 2FKDA 1I4VA 4K8WA 3JSPA 2HNFA 2FJRA 3S04A 4ME8A 1JHFA 1AY9A 1F39A 1KN9A 3BDNA 1KCAA
chains in the Genus database with same CATH superfamily
3JSOA 4N31A 4NV4A 3IIQA 1B12A 1JHEA 2HO0A 3K2ZA 1JHHA 1JHCA 1UMUA 1T7DA 2FKDA 1I4VA 4K8WA 3JSPA 2HNFA 2FJRA 3S04A 4ME8A 1JHFA 1AY9A 1F39A 1KN9A 3BDNA 1KCAA
chains in the Genus database with same CATH topology
3JSOA 4N31A 4NV4A 3IIQA 1B12A 1JHEA 2HO0A 3K2ZA 1JHHA 1JHCA 1UMUA 1T7DA 2FKDA 1I4VA 4K8WA 3JSPA 2HNFA 2FJRA 3S04A 4ME8A 1JHFA 1AY9A 1F39A 1KN9A 3BDNA 1KCAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3JSO A;  4N31 A;  4NV4 A;  3IIQ A;  1B12 A;  1JHE A;  2HO0 A;  3K2Z A;  1JHH A;  1JHC A;  1UMU A;  1T7D A;  2FKD A;  1I4V A;  4K8W A;  3JSP A;  2HNF A;  2FJR A;  3S04 A;  4ME8 A;  1JHF A;  1AY9 A;  1F39 A;  1KN9 A;  3BDN A;  1KCA A; 
#chains in the Genus database with same CATH topology
 3JSO A;  4N31 A;  4NV4 A;  3IIQ A;  1B12 A;  1JHE A;  2HO0 A;  3K2Z A;  1JHH A;  1JHC A;  1UMU A;  1T7D A;  2FKD A;  1I4V A;  4K8W A;  3JSP A;  2HNF A;  2FJR A;  3S04 A;  4ME8 A;  1JHF A;  1AY9 A;  1F39 A;  1KN9 A;  3BDN A;  1KCA A; 
#chains in the Genus database with same CATH homology
 3JSO A;  4N31 A;  4NV4 A;  3IIQ A;  1B12 A;  1JHE A;  2HO0 A;  3K2Z A;  1JHH A;  1JHC A;  1UMU A;  1T7D A;  2FKD A;  1I4V A;  4K8W A;  3JSP A;  2HNF A;  2FJR A;  3S04 A;  4ME8 A;  1JHF A;  1AY9 A;  1F39 A;  1KN9 A;  3BDN A;  1KCA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...