1I50J

Rna polymerase ii crystal form ii at 2.8 a resolution
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
65
structure length
65
Chain Sequence
MIVPVRCFSCGKVVGDKWESYLNLLQEDELDEGTALSRLGLKRYCCRRMILTHVDLIEKFLRYNP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis of transcription: RNA polymerase II at 2.8 angstrom resolution.
pubmed doi rcsb
molecule tags Transcription
molecule keywords DNA-DIRECTED RNA POLYMERASE II LARGEST SUBUNIT
total genus 17
structure length 65
sequence length 65
ec nomenclature
pdb deposition date 2001-02-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
J PF01194 RNA_pol_N RNA polymerases N / 8 kDa subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 1i50J00
3ZQHA 4GFBA 4S0HB 1P7JA 3S2DJ 3UKGA 4G12A 2D5VA 1E3OC 3JRBA 2LKXA 3Q0UA 3RKQA 2HDDA 3M3YJ 5FKKA 1JGGA 1IV6A 5EDNA 1LFUP 2DA3A 4CYCA 3LSJA 3BTCA 1MBGA 2DA4A 5J1UA 3GTGJ 2HXIA 5E3OA 4CYCB 2LVSA 1Y1VJ 4MLOA 4V2FA 2R93J 1H8AC 2PMZN 4BBRJ 3GTPJ 1FIAA 4DW6A 1MBHA 1LE8A 3E7LA 2ME0A 4C3HJ 4QSHA 4L5EA 5K7ZA 5C4XJ 3OIOA 2QF7A 3Q0WA 5FKMA 1AKHB 2JA5J 3JRGA 1H88C 1IJWC 1ETWA 4DYRA 1ZTRA 1OCTC 1VF9A 2DA7A 2WB1N 3OSGA 2TCTA 1U9NA 1TWAJ 1GUUA 5DTDA 3HEFA 1FIPA 5IYDJ 3B6AA 2KT0A 1RESA 2NS8A 1WH7A 3PO2J 1DU6A 2HOTA 5DS9A 3LSGA 1ZK8A 3MN2A 3IV5A 2JN6A 3D1NI 4FTHA 1RKWA 4X6AJ 1GV2A 1X2MA 1O4XA 4A3JJ 3IH4A 2NOGA 2GLOA 3SJMA 4JP0A 4NDLA 2EZKA 1JTXA 5HODA 2JA6J 1B8IB 3HDDA 2XPVA 2CRGA 2ME6A 5J1RA 3S1NJ 1ZR2A 1TWCJ 2LTPA 4QIWN 4MFDA 1T56A 5M3MJ 5IOYA 1A6IA 1WI3A 2M8GX 5J3LA 5EG0B 1DU0A 2IBDA 1B8IA 2E2HJ 5EGOA 2EZLA 1JKPC 3S2HJ 5C4JJ 1RR7A 2XRLA 5GPCA 1SFOJ 1BW6A 3BR6A 5IYBJ 3DEWA 3ZOBA 1ETKA 1MSFC 3GTMJ 4A3FJ 3GTKJ 4RBOA 1F43A 1ZR4A 1X58A 3VPRA 1RPWA 2VUMJ 2R7ZJ 2KDZA 3A01A 3OSFA 1QPIA 5FLVA 2YUSA 3BG5A 3HBLA 2LR8A 4M3FA 3BR2A 1I6HJ 2ID6A 4RDUA 2JA7J 2EZHA 3JRDA 3BTLA 4UUTA 4W97A 4W1UA 1TC3C 1IC8A 1U9OA 2X48A 5JLWA 2XGCA 5C3EJ 3HOVJ 4XICA 4XIDA 3BG9A 1TWGJ 4UUSA 1G2HA 4DZJA 2DA2A 2NS7A 2LLKA 2M34A 3A02A 5EZGA 4A69C 3FK7A 4C3JJ 2HYJA 2DJNA 2DMNA 1WCMJ 3TW6A 2Y30A 4BY1J 2X6OA 3NARA 1HCRA 2NVQJ 2YU9J 4QTRA 1I50J 2XB0X 3CQZJ 2EBIA 3K2AA 1ENHA 3ZQGA 2E1OA 3S17J 3G1OA 4I76A 3S15J 2VI6A 2HXOA 3BTIA 2DMTA 2DA5A 3M4OJ 4J19A 2K9QA 4BY7J 2H1KA 1OFCX 5F1JA 4FCYA 3S1RJ 2XSDC 4FE7A 3JRHA 3JRIA 5EZHA 2MG4A 5IP9J 5FKLA 3MVPA 1LFBA 3HGGA 1JJ6C 3HGYA 2O9LA 1MH3A 3JRCA 3FKIJ 1TWFJ 3ZQCA 2NVXJ 2G0EA 5F0FA 1FTTA 3OOUA 1B72B 4C3IJ 3RQIA 1X2NA 4B4CA 1ZGWA 2Y9YA 2OPTA 1T33A 2XGDA 1GDTA 3BT9A 1VFCA 3CDLA 1Q1VA 2OF7A 1U8BA 2FQ4A 1QVUA 2R92J 2WV1A 1SANA 2O7OA 1JKQC 2N8GA 1UG2A 1Z77A 4M3EA 2GBYA 2E2JJ 2ECCA 1HDPA 3CCYA 5GPAA 4IHWA 3HOWJ 4M3DA 3I4MJ 1RETA 4M6VA 2RAEA 4IEJA 3BR5A 4DZPA 2MSYA 1VNDA 3LSRA 1XS9A 4A3CJ 2K9NA 4LOCA 3FK6A 2FD5A 3BG3A 4IHYA 1GVDA 3IH2A 2R0QC 5F27A 1MSEC 3H0GJ 4MFEA 3HOYJ 3S14J 1K83J 2DN0A 2FJ1A 1MNMC 2L7ZA 2M0CA 1ETQA 3LSPA 1QVTA 4HNVA 1ETOA 2AO9A 4A3GJ 4BBSJ 1W0TA 3HOZJ 3S1QJ 3JRAA 3BR1A 2E19A 4DYCA 3BQYA 4XRSG 3FISA 2HOSA 1MBJA 3TP3A 1LE8B 2HI3A 2WAQN 4A3DJ 1OCPA 4IHXA 3S16J 1XG1A 1POGA 1AKHA 2EZIA 1APLC 3TEDA 2EH3A 4D5FA 3RZDJ 4XRSA 1ZQ3P 2HQ5A 3TW7A 5M5WJ 2L7MP 1IRZA 1ETVA 1ETXA 5K7HA 1IDYA 3CMYA 2Y0SN 1FTZA 3GTLJ 3BR0A 2DMPA 1NK3P 2JA8J 3QPLA 4FE4A 4I6ZA 4A93J 2IAIA 4V2GA 2XGEA 1GT0C 1IGNA 2LK2A 1FEXA 3JREA 4A3IJ 1ITYA 1JKOC 3HOUJ 3G1MA 5J1YA 5IYCJ 1IDZA 2B63J 1WGXA 2XPWA 1WPKA 4D7NA 3H3VK 1GV5A 2FX0A 3LNQA 2R5YB 3S1MJ 2YS9A 3DCFA 3HB9A 4A3BJ 5IPAA 3F0CA 3O8HA 3Q3SA 1U78A 9ANTA 4A3EJ 5EG0A 1MBFA 4B3AA 2R5YA 2CU7A 4DYQA 2LFBA 4XRMA 1BJZA 2Y9ZA 2NVYJ 1HLVA 4FISA 1Y1WJ 2R5ZB 5F0HA 2W48A 2JWTA 2L0KA 2NVTJ 1MH4A 5BNGA 4IHVA 5EYRA 5IP6A 5E3NA 3A01B 3QPSA 2R5ZA 2K9SA 5EGOB 4Y52J 1NK2P 3FIWA 3G1LA 2CJJA 5M3FJ 1HOMA 2L9RA 1IG7A 3QQAA 2CUEA 1IUFA 3JRFA 1JKRC 1D5YA 4AYBN 5FKNA 2MGQA 4D7MA 1YRNB 1CQTA 2COBA 5FJ8J 1ORKA 3HM5A 3WHBA 1FJLA 3BQZA 4A3KJ 2JJ7A 1JUMA 4XK4A 1AU7A 4B1RA 5C44J 4C2MJ 2JK3A 1YRNA 2MW8A 5F0CA 1JT6A 2DMQA 5M5XJ 2ECBA 3B6CA 4D5CA 3ZQIA 4JX5A 5F08A 2AHQA 2JMWA 2M2EA 1W0UA 1VI0A 5EEAA 2CQQA 1XC5A 1MBEA 1F36A 3GTJJ 4EEFG 2QCOA 2LD5A 4AC0A 1MBKA 4UUSB 4X1EA 3I4NJ 1EF4A 5IP7J 4MO7A 2DA1A 3O8GA 2X9DA 2DTZA 3WHCA 5E3LA 2VKVA 3W6VA 3BTJA 3K7AJ 4Y7NJ 2HOAA 2I10A 1R9TJ 3L1PA 2ZB9A 5EF6A 3JR9A 1Z0XA 4A3LJ 2P81A 4AUXA 2Y2ZA 1P7IA 1AHDP 5JLXA 3A03A 3NAUA 3C2BA 1ETYA 1K61A 1BA5A 3TP0A 1RKTA 4M3GA 1BW5A 2IEKA 3GTOJ 1QRYA 4JX4A 3MKLA 1S7EA 1JUSA 2ELKA 3SFIA 5E3MA 3ZQLA 5F04A 3GBGA 3Q0VA 2XB5A 2K40A 3GTQJ 2CUFA 3PO3J 4ABZA 4JYKA 3ZQFA 5FLMJ 3HKZN 3BR3A 3PM1A 1JT0A 1BL0A 1NTCA 1UHSA 4JX6A 3IH3A 1JTYA 3LOCA 5GP9A 1JJ8C 3SDGA 1ZKGA 4MIMA 1B72A 1HDDC 1HF0A 4BXXJ 2LY9A 1H89C 4M3BA 2ID3A 2EQRA 2Y31A 1UMQA 2O8KA 2DMUA 2TRTA 2VPRA 3HOXJ 1PUFA 2DA6A 5IOZA 2LP0A 2M9HA 2E2IJ 3RZOJ 2H8RA 1I3QJ 1A5JA 1OJLA 2XPUA 4BKXA 2CQXA 2VKEA 1WH5A 1TWHJ 5K7FA 1PUFB 2GM4A 5FKOA 1JUPA 2L7FP 5M5YJ 4A3MJ
chains in the Genus database with same CATH superfamily
3ZQHA 2XGXA 1YJ9I 3EQLF 3BCAA 1MZBA 2M8EA 3FXKA 4LK1F 3S2DJ 3DP7A 1ZGAA 3NQOA 4G12A 2D5VA 1E3OC 2LKXA 4XQFA 1WJDA 1OCOH 3RKQA 1DUXC 3WTTC 5FKKA 4Y33A 1LPQA 2BHZA 5D4SA 1LFUP 4CYCA 1KQ8A 3BTCA 3CF2A 3TOBA 4ZDOA 2DA4A 1MJBA 2HXIA 1GLNA 2ISZA 2D1VA 2JQ7A 3TO7A 2QQ9A 3F6VA 5LGTA 2V26A 3EETA 4LG3A 1X3WB 3SEQA 2OZ6A 1OCZH 4BBRJ 3REOA 1MW7A 4BHPA 4WXCA 2VN2A 2MC3A 1LEBA 2Y75A 4AIHA 5GADJ 1F9NA 2QQBA 4L5EA 4FASD 4II3A 1BI0A 5K7ZA 2QSFX 1N75A 2E7WA 2D2WA 2L01A 3VYUB 2JA5J 5BS6A 1ZTRA 3IKVA 5L3EA 3HYIA 1VF9A 2DA7A 2F5CA 2VIXA 3V7SA 3QP6A 1IN8A 1X3UA 5HLTA 3ZQQA 3T1BA 2F5DA 3PNVA 1R5HA 1XD7A 2L02A 2LKSA 1K6YA 1RESA 2NS8A 1YS7A 1WH7A 1DU6A 2HOTA 2EPFA 5DS9A 2XAFA 2LY1A 3DU5A 1GV2A 1O4XA 4CCLA 1BIAA 4BU2A 4A3JJ 3CZ6A 4PCQA 5HVQC 5LRRA 3SJMA 4OU0A 4PJMA 2DQRA 1G3YA 1XMAA 3CESA 2FMLA 1MDMB 5HNFA 1BOBA 4BQNA 1JGSA 2K27A 3RKWA 5J1RA 3S1NJ 3CCLI 1IXSB 1FSEA 2DYRH 2LMDA 1Z6TA 1TWCJ 2JA2A 1HSJA 3BJOA 3M1EA 4RA2A 1TLHB 2HKXA 2FXAA 5EG0B 2M8GX 2E36A 2KISA 3BROA 4BQAA 2XRLA 2ZMEB 1SFOJ 5IYBJ 1F4KA 2J5PA 3GTMJ 5E18F 4A3FJ 3GTKJ 2DT5A 3V42A 1F43A 1ZR4A 1BR4A 4DBRA 3AL0B 1YIOA 3VPRA 1GXQA 2R7ZJ 1FC3A 5J8CA 3I59B 3DBHB 3OSFA 1QPIA 2DU9A 2R7QA 2OQGA 4UVAA 1QPMA 4RDUA 2EZHA 3BTLA 1OR7A 3SHFA 3DKWA 5KCMA 2EFOA 3KFWX 1U9OA 4A0ZA 3VYSB 3WTYC 1XGSA 4KMUX 1MMAA 3G4SI 1I1GA 1S3JA 1WJ5A 2HDWA 4F91B 3N05A 1OYYA 4HQMA 3T8RA 1G3SA 2LY2A 4DZJA 3I9V2 1WJCA 3MKWB 2NS7A 4EV0A 2H94A 4EM0B 2V1UA 2HQNA 2LLKA 3A02A 5EZGA 1FX7A 4HRIA 2LNBA 4E7JA 3FBIB 4RB0A 1YQAA 1J0RA 3OYDA 2VC0A 5D5VB 4P9UA 1ZREA 2QYOA 4NB5A 2EBIA 3K2AA 4NQWA 4OAYA 4YFKF 3P9CA 2G7HA 2DMTA 2DA5A 4LJZF 2IA1A 2K9QA 4BY7J 1VQ4I 5DUKA 2H1KA 4XKWA 3M7GA 3S1RJ 4FE7A 1D0YA 5DDGA 2VE8A 4HX7A 4B48A 5EZHA 1R36A 3I0TA 4BE0A 5IP9J 2HVSA 3MVPA 4CA0A 4EVIA 3CDIA 5HDNA 2VT2A 3F9KA 1HW2A 1YLFA 2O9LA 3VYRB 5FRNA 3JRCA 2F5EA 3R60A 1FTTA 3OOUA 1U5TC 3RQIA 2BY1A 1X2NA 4JBAA 2QKMB 2WADA 1T0FC 4B4CA 1SD4A 3SFZA 4HX4A 2OPTA 1GDTA 3ZXSA 2HPMA 2OUMA 4RAGA 1I27A 2WV1A 5CYVA 2O7OA 2NRAC 5J4YA 3GFLA 4HZFA 5J8FA 3ZMDA 1T95A 4M3EA 2KRFA 4IJAA 2E2JJ 2E1NA 1P9QC 1BR1A 2ECCA 2E7XA 2HFHA 2M4GA 3K1MA 3RDIA 2FE3A 3CCJI 1LB2A 2R7XA 2KJBA 4G6QA 1K4TA 1S6LA 5FGMA 1V54H 3BR5A 1A04A 4DJAA 4AM3A 2MSYA 3FXMA 2QQ8A 1VNDA 2E60A 3OL4A 5LHIA 4L5IA 4P1WA 3K2ZA 4TV7A 4IHYA 2P7VB 4UXNA 1GVDA 4IX7A 1G3TA 3FMSA 2R0QC 3SZGA 3FHZA 3H0GJ 2A07F 4ENNA 4H0EA 3HOYJ 3PFYA 2DN0A 2FJ1A 4UHTA 5AIPA 1MNMC 3J81K 1ZRCA 3L7WA 2F4OB 1ETQA 3BZKA 1BI3A 4KDPA 3CCEI 3EYIA 4HNVA 3WTZA 1ETOA 1XN7A 4G94A 4MGRA 1W0TA 3QYBA 4M73A 2XIGA 2XRNA 3V8LA 2A5YB 3LQQA 3FBNB 1MBJA 3WU2C 1LE8B 3H5RA 3SDBA 5GTIC 2IW5A 4C9YA 4YFXF 4XLHA 1O57A 3FXQA 3ZCOA 1B59A 1H0MA 1LDDA 4BHCA 3RZDJ 2L4AA 3U1KA 4L9JA 1ZQ3P 5CVVA 2HQ5A 2KFDA 4BQOA 1R4MB 1V5EA 3O3KA 4MEXF 2WC2A 4EJVA 4M9XA 4EJTA 3ZMVA 5KK1A 2WY7Q 4I0BA 2DFEA 1FTZA 3LFUA 3PIOF 2ZC2A 4Q47A 4IPAA 2V1NA 3AG2H 2JA8J 3QPLA 4FE4A 3OYMA 2XGEA 4IOAF 4K2EA 2OCCH 3CMAI 2GXGA 4AIJA 3DPTA 1UHWA 3MCZA 1XCVA 2VQHA 2KPMA 3WU0A 2OU2A 5JVTA 2E5ZA 2FX0A 2IVMA 2R5YB 1FPQA 2YS9A 2K85A 4XLPF 4QLCU 5FRMA 9ANTA 4RB1A 4KIGA 2P6TA 4B3AA 3FWEA 3E5UA 3PNTA 3KYLA 2C6YA 2W25A 5TGTA 4XRMA 1BJZA 1J75A 2NVYJ 3I54A 2L9NA 1SFEA 4LLGF 3P9KA 4ZH4F 2L0KA 4A0YA 2M5WA 3V7CA 4IHVA 2KMUA 3KP2A 4XOPA 5IP6A 5KHDA 3A01B 3QPSA 3H9JA 4NHJA 5HDKA 2BY3A 1VQ5I 4AIKA 3S93A 3ISPA 1IG7A 2PJRA 4A0XA 5FKNA 2XDVA 1FNNA 2M7BA 4YELA 5DYMA 3K4LA 1ACIA 3LSIA 2M87A 1R49A 5ICGA 2M30A 4A2UA 2JK3A 3GZNB 5IT3A 4BE2A 1YRNA 3DLLF 3CF5F 4XN0A 5A2QZ 2IJLA 3MD2A 4X0GA 4KNYA 1BR2A 5B5EC 3H5NA 4U0WA 1WJBA 2VXDA 1DDNA 2EFWA 2VJIA 3ZQIA 2JMWA 2V1DA 2CQQA 3WU1B 1W4MA 1XC5A 4ZYDA 3OYHA 3BY6A 1QGPA 3J7AO 3L2VA 4PFOA 2PJPA 1P6RA 3K9TA 4UUSB 4KIBA 1KGSA 2DA1A 2GA1A 5E3LA 2VKVA 1XSVA 2ETHA 2BGCA 4E7HA 3W6VA 3I53A 4XOTA 4JQFA 1RZ4A 3KEOA 4DIQA 1YITI 3EUAA 1HW5A 1R9TJ 1JXSA 3I58A 5JHUA 5CQGA 1G4DA 3JR9A 4A12A 1D0ZA 5CVRA 3QRFF 4LITA 2P81A 4AUXA 2VBYA 3CP2A 1LNWA 2LF7A 2P4WA 4RB2C 1AHDP 3A03A 1OCRH 4LLNA 4IL6C 3HHHA 3VOEA 5DM7F 4DQ2A 3C2BA 4IRIA 1V55H 3LFKA 1RKTA 4G6TB 4M3GA 2IEKA 2P5KA 2ZJRF 3HG9A 3OR2C 4CCMA 3GTOJ 3J7AY 4JX4A 2F5VA 1JUSA 3ELKA 1FBUA 2RN7A 3OOPA 2HQAA 4NUBA 2H6CA 2MBFA 1X1BA 3Q0VA 3TQNA 3ERED 1YW7A 3ASNH 2DJIA 3S3OA 2CUFA 3ZQFA 5H6QA 1YFHA 1G8XA 3ASOH 2QZ8A 1JT0A 4E7IA 1BL0A 5DD4A 2PBIA 2H6BA 4KT5C 4IVNA 1B4AA 1MNDA 1UHSA 3MMYB 2QSHX 3ERMA 5LEJA 3RJPA 1JJ8C 3KP6A 2CFXA 4E4HA 3IAM2 5F6FA 3HJEA 2CYYA 4PGGA 4B3XA 3OYLA 4L9VA 4J00A 1U3EM 3WE3A 1VQMI 1J59A 4LB6B 3F3XA 3PQJA 2TRTA 4XLAA 3HOXJ 4KJZA 1OKRA 4H4KC 2GAUA 3E3VA 5IOZA 3CCUI 2AS5F 1JI8A 3DEEA 1WSUA 3HOSA 2CQXA 4OIOF 3RCOA 2JT1A 1TWHJ 1PUFB 2W24A 1AU7A 4RS8A 1S72I 3MZ8A 3E6CC 4XKVA 3HRMA 2RV8A 1ONVA 1N25A 1QBJA 5FLXK 2Z33A 2RGVA 1YI2I 3Q0UA 3RPUA 5B1AH 2HDDA 4WCGA 2XSJC 4ZDPA 1RC9A 3QU3A 2DCEA 2IPQX 1F1ZA 5JFRA 4U0YA 3ABMH 3GTGJ 2K9LA 4XLNF 3H1CA 1HSTA 1Z67A 4MEYF 3JW4A 1Y1VJ 4MLOA 4V2FA 1UAAA 4GO1A 1SAXA 1H8AC 2HKOA 1FMWA 3GMEA 3S3MA 4PJNA 2ME0A 5F64A 2IGNA 4DBQA 1OCCH 3OYEA 2QF7A 1O3TA 2K3FA 3P5JA 4AVPA 5A2QK 1E3PA 2FRHA 2CW7A 1H88C 1FY7A 2V7FA 1VQPI 2PG4A 4HV6A 1ZRFA 3QODA 4XR6A 4HG2A 4HDUA 2TCTA 2WAQA 3IUOA 4CYDA 4EGZA 4IHSA 2W1OA 1U9NA 2BZTA 2XASA 1ZG3A 1S5LC 1ODDA 4CCJA 3GWZA 2A5WA 1LEAA 2VT3A 4ESBA 1XSDA 4AIDA 2KIMA 3PO2J 3OL3A 3LSGA 1ZK8A 2EV5A 4HX8A 4XBFA 3D1NI 1Q1HA 1RKWA 1VZ0A 1X2MA 4ZZLA 3OYAA 2DK5A 3P7NA 3ZR8X 5E8IA 3IH4A 2NOGA 4KN7X 1ZG5A 4C30A 3WODF 2R4GA 4S05A 2EZKA 1YJNI 5HDGA 4PSXA 5HODA 3MEXA 2VC1A 1XX5A 2HU9A 2VXZA 4LB5A 3A0HC 2FNAA 4AVZA 3HDDA 2FA5A 2ME6A 2W7NA 1ZR2A 2O6GE 1MJAA 2RKHA 3GVAA 2ESNA 1T56A 5IOYA 3F8FA 1A6IA 1WI3A 5J3LA 3JAMZ 1NG6A 1DU0A 5HS9A 3BLYA 2EZLA 5AIQA 1RR7A 5GPCA 2RREA 4IO9F 3HPHA 4KN4X 1BW6A 3BR6A 3ZOBA 3H9QA 5K5QA 1ETKA 3AKZA 3LA2A 4RBOA 2L9SA 2X85A 1PDNC 2EIKH 1WKMA 3HRSA 2GWRA 4I02A 2KDZA 3OYFA 2ZJPF 5FLVA 3V8JA 3VDXA 2EJRA 3QOEA 2E1MC 1D5VA 2L4MA 3BR2A 1IXCA 1I6HJ 4AD9A 4FT8A 2ID6A 2ZXWH 2YX7A 3JRDA 4UUTA 2JZYA 3EPZA 2VJ5A 4W1UA 4Q5SF 1PYVA 3F22A 5C3EJ 2CO5A 3HSEA 2VQGA 4XICA 4XIDA 1W36C 3W2AA 2R7UA 3DF8A 4DOZA 3HKZA 3F6OA 3S32A 2MC4A 4A5NA 3DTKA 5D4RA 5KNLA 4A69C 3E6MA 4C3JJ 4KT6A 2V9KA 2YX4A 2DJNA 1A31A 2R7VA 1EV7A 2GOMA 2KRCA 2EIMH 2MFZA 3TW6A 5FB2A 3IAS2 2CV0A 2YU9J 1DGRM 1O3SA 4PJLA 2HVRA 3W6KB 4QTRA 1L0OC 3QPHA 4OIRF 2KZVA 2HWVA 4UV9A 1KA8A 4RGXA 1YG2A 1ENHA 3ECHA 2VI6A 3J81Z 5L3BA 3BTIA 2CG4A 3M4OJ 2QQAA 1JHFA 4UV8A 5KAFC 2QSGX 2M7AA 5F1JA 4FCYA 2OV7A 4ZJZA 3K4KA 4YEJA 5FKLA 2VL8A 2ZFUA 3UNGC 1VQNI 1JJ6C 1ZLJA 3CJTB 3GX4X 1XGOA 2CQKA 3Q5FA 5ICEA 3D5RC 1TWFJ 4CSWA 1HBXG 2G0EA 3GEZA 3F8NA 3K4NA 4C3IJ 3A1YA 2QWWA 4M6XA 2QBYB 4XLCA 3DBLB 3SEZA 3M07A 1ZGWA 1W7PD 2XGDA 2W57A 2WY8Q 2OF7A 1FP2A 2GXAA 2R92J 4GXOA 2OTJI 2P5VA 1ZHFA 3LMMA 1K4SA 1XDUA 2E34A 4IHWA 4N9HA 1HDPA 3CCYA 3HOWJ 1IW7F 4M6VA 4IEJA 1YX5A 2IT0A 2ACJA 4HA8A 3E5XA 3F8MA 2JRTA 3CUQA 5DCFA 3BPVA 5HS7A 5D6EA 2XAUA 4S04A 2DLLA 4RLFA 4LOCA 3V8KA 3FK6A 3FX3A 2MLGA 3IH2A 1IAWA 3WGIA 3BPXA 2QEXI 1MSEC 2HDCA 2JSPA 3GZ6A 1K83J 1Z3YA 1DGWY 1BI2A 1RNLA 4CZZA 2L7ZA 2X51A 2M0CA 2XVCA 4EJUA 4HQEA 5BOXA 1VQKI 3LQRA 4N0BA 3CCQI 4EMSA 2XKOA 4IF4A 1S7OA 5GAHJ 3HOZJ 5DV5A 1KZHA 2MH9A 1ZLKA 4DYCA 4WK8F 2UWMA 4XRSG 2HOSA 4EGYA 4ZYEA 2IS2A 2ELJA 2HI3A 2XV4S 3QYEA 1OCPA 4MNUA 5DD8A 3DPUA 1POGA 1AKHA 1Y8QB 4YG2F 4I7HA 3B02A 1BIBA 2PMHA 2DW4A 3C18A 3TEDA 1TT5B 4CICA 2LKPA 3KIOA 2FBKA 4Y15A 3D5LA 3TW7A 3J7YJ 2L7MP 2KKOA 1TNSA 1IRZA 4RGRA 1ETVA 3DQVC 5K7HA 2LYCA 5D8LB 3BDDA 2DTRA 3DTIA 2Y0SN 1RR8C 5JR3A 3QOPA 1RRJA 4AWXB 2ZCWA 5E8GA 1NK3P 4A93J 4BHBA 3M8FA 4V2GA 5KVRA 1IGNA 1FEXA 2DK8A 5CKTA 2CV2A 2V6CA 2MABA 2X0LA 2EB7A 1JKOC 3HOUJ 1FZPB 4BAYA 3PUFA 5IYCJ 3H92A 4BDYA 1IDZA 4YIIA 1D3YA 2CGPA 2B63J 1WPKA 5EEGA 4D7NA 2AQFA 3S1MJ 2PMUA 1EKEA 1BC7C 5H20A 2G9WA 3F0CA 3LSTA 1U5TB 5ILVA 5EG0A 1MBFA 4IZZA 1SFUA 2R5YA 3HSRA 1UZCA 1TTYA 2CU7A 2LFBA 3RYRA 2BXZA 4HSRA 2XAHA 4DYQA 1AOYA 4FISA 5LRSA 1BI1A 3PSIA 1O7LA 3W6JB 1HKQA 5J6XA 1VQ7I 1FYLA 1MH4A 2E1CA 3FM3A 3I3LA 2IA2A 1T8IA 5EYRA 3QAHA 5E3NA 2PJRB 2Z9OA 4E70A 3X2QH 2X6WA 5TISC 1HKSA 3KP5A 5EGOB 2LDUA 3FIWA 2L7KA 3ZRGA 2CJJA 1KQ0A 4HV5A 4ZDLA 5M3FJ 2X6YA 2OJED 2CUEA 5HS8A 4D7MA 5LHHA 5L3GA 2H27A 4FX4A 2COBA 2WA0A 5CPRB 4PJJA 3ZMSA 1IRXA 3HM5A 3WHBA 3BWGA 2YR2A 3BQZA 4A3KJ 2JJ7A 1FJLA 3ABKH 3FHNA 4XK4A 4B1RA 5C44J 2XF5A 3FXJA 4C2MJ 4HLYA 2XHKA 2MW8A 1XCBA 1FT9A 3JSPA 1R23A 4BE1A 4U87A 1XPXA 2ECBA 1IN6A 3FXRA 3KLNA 4GYGA 1XGNA 3G6EI 2LH9A 2JTVA 5F08A 2AHQA 4ZYGA 1VI0A 1W0UA 3L09A 3E0JB 2V1XA 1MBEA 1EH8A 1F36A 4RLQA 3GTJJ 5H6RA 1XDSA 2HYFA 5IP7J 2X9DA 3WG9A 3WTWC 3BC8A 1R5ID 6PAXA 3MKZA 1R1UA 1RI7A 2BE5F 3KEYA 1Z91A 2DXIA 3K7AJ 2FBIA 3F8BA 1QZYA 1AA7A 2I10A 4L9TA 2K4JA 3OWTA 4Y7NJ 1ZN2A 4ZYHA 3L1PA 2AXLA 2BV6A 2DDBA 2YU3A 4BACA 5LBQA 5BMZA 2CS3A 1Z0XA 3F72A 2JUCA 1W5SA 2Y2ZA 1V3FA 4I01A 2XKPA 2JPCA 3ECOA 4NQWB 4CXFA 1ETYA 1K61A 5CVJA 1BA5A 3AG3H 1FBSA 1LUJB 3TDUC 3W2WA 1BW5A 1W7PA 2VOPA 1R5GA 2RQPA 4L0YB 2FBHA 2EK5A 3MKLA 4PK4A 3VSKA 5F04A 1FYKA 4MQ9F 1X1DA 4BS9A 3ZMUA 2UZKA 4G7OF 2XB5A 2K40A 3GTQJ 3DTEA 2HR3A 4ABZA 4E6KG 1S9HA 4UB6C 1QHHD 3HKZN 3QU6A 3HTUA 4BGDA 3M8EA 2VBWA 4R1HA 3H0DA 3CCRI 2H1LA 2HEOA 3IH3A 3PJRA 1JTYA 2QGUA 3SDGA 1Z6RA 1QZZA 1T0FA 1Y8RB 2EWNA 3PQKA 4MIMA 3OYCA 2JVGA 5CVUA 3JCUC 1HDDC 4ZZDA 1VQLI 4B09A 2LC2A 3RTRA 1H89C 4M3BA 2ID3A 2Y31A 2DMUA 2CH0A 4O3MA 1ZYRF 2M9HA 2FSWA 3DKXA 2E2IJ 2H8RA 2R7TA 4G8XA 4HF2A 2XPUA 4BKXA 4U7BA 3I56I 3E97A 4ZTJA 3BCBA 3CUOA 1WH5A 2ZSHB 4F52A 5K7FA 3I5UA 5FKOA 3K4JA 1ZRDA 2L7FP 2FOKA 5M5YJ 1DQUA 5E3OA 1FWZA 2HS5A 2VOOA 1NH3A 1QQIA 4GFBA 1DP7P 3KX2A 2D45A 1QA6A 5ED4A 5HOOA 2VONA 1Z3XA 1C0WA 4I98B 1B9MA 2TDXA 3K69A 4M9SA 2X1DA 2IGMA 3BZCA 4QPOA 4UVCA 1TL8A 2VQCA 1UFMA 5D5XB 3JRBA 2FNPA 2VASA 1ZG1A 3S3NA 3M3YJ 4LG0A 1T2KA 2EFNA 1JGGA 5EDNA 1CF7A 1BOAA 2A6EF 1X3ZB 2A68F 2K02A 2Z16A 2FMYA 3VEPA 3ZN0A 3TL4X 5J1UA 1IUYA 2B9SA 3FXUA 3EYYA 4HPQA 4IQJA 2LVSA 1TNTA 2FQ3A 2GQQA 3CLOA 1I3AA 4HAMA 2P8TA 4B44A 2R93J 1ERDA 1R7JA 1LFPA 1UELB 3BZ6A 2YPRA 3ZPLA 4ZTFA 1MBHA 1A36A 4BQQA 4QSHA 2CUZA 5C4XJ 3OIOA 1TZLA 3U9GA 5FKMA 1BBYA 1AKHB 3FMRA 2DFHA 2WTEA 2L54A 5FD5A 1D8KA 3RKYA 2YSRA 2DPDA 3JRGA 2RC4A 4KITB 1IJWC 3LAPA 2P7CB 1YS6A 1ETWA 5IY5H 1A35A 3N97A 1OCTC 3U21A 1SMTA 3WG7H 3J80K 4FQGA 4CCOA 4WWCA 1V5GA 2O8XA 5JHFA 3H9GA 3HEFA 2E71A 2XUBA 5DEQA 5DTDA 1Y6IA 1FIPA 3RSNA 5IYDJ 2KT0A 5HLHA 2NNYA 1FOWA 1XB4A 4M71A 4RGSA 1TBXA 3MN2A 4RMNA 2P6SA 1SFXA 4PJ0C 4XORA 1SC7A 2IS4A 2E5NA 3D0SA 4RM3A 1KQ9A 2PMZA 3BG6A 4CZCA 1N77A 2A69F 2GLOA 4IQ4A 3VB2A 3VODA 2HTJA 1RIOH 2IRFG 3ZQ7A 4JP0A 3GF2A 4NDLA 2NNNA 1JTXA 4CUGA 1MGTA 5J40A 1ZH5A 2Y0MA 4B8XA 3HRTA 2WAEA 3R61A 2JUGA 3KYCB 5ICFA 4C2UA 2XPVA 2CRGA 1SVLA 4CDGA 1O7FA 1QHGA 1Y0NA 2MLKA 3Q9SA 2ZMEA 1VQOI 2Z2SB 5M3MJ 2Q1ZB 3OS0A 2IBDA 1B8IA 2FUG2 1FOKA 1JKPC 3H3UA 3S2HJ 4IOCF 2L3DA 1MSFC 3LL7A 1D8JA 3JAMK 4OINF 3R0JA 2BOLA 3D5SC 3KZIC 2O5RA 2VUMJ 1QNTA 3OY9A 1KONA 3A01A 3L9FA 2CV1A 4PUSA 3CC4I 4A6DA 2LR8A 4M3FA 1OR7C 5B66C 4GRIA 1HC8A 2WAFA 3HC7A 3W2VA 4I09A 2JA7J 4W97A 2HZDA 3CDHA 1R4NB 1IC8A 2ZXJA 2V4JC 1KYWA 2X48A 2XGCA 2K5CA 1P2FA 3HOVJ 1BC8C 4O6JA 1TWGJ 3LWFA 1G2HA 2IXSA 4M74A 4E7LA 3CCVI 2KIUA 1P4XA 2M34A 2Z1DA 2IS6A 1XGMA 4BH9A 2KLOA 3FK7A 2HYJA 1J7KA 2EV6A 3R0AA 1WCMJ 1YE9A 2Y30A 3UR3C 2OZUA 2NVUB 2COMA 2Q8KA 5LD2C 2NVQJ 3FKJA 5GAEJ 5DUIA 2X1EA 3WTUC 3RPUD 1I50J 2XB0X 2VB6A 3K6GA 2R7RA 1GXPA 3ZQGA 3S17J 2QA4I 1N78A 3S15J 2K4BA 5ILSA 2KHMA 2Y69H 3DFGA 1K6OA 4Z6YA 2VE9A 3C3WA 3I55I 2DBBA 3L00A 2PI0A 2F6CA 3H3ZA 2AXTC 3ZGKA 2XSDC 3JRHA 1WJFA 1Z05A 4Y17A 2KIFA 2R7WA 2MG4A 2ESHA 1LFBA 4UUVA 3HGGA 2R7SA 1VQ6I 3HGYA 4ENMA 2WB1A 3R6SA 2DT6A 3H35A 3FKIJ 2NVXJ 1IN7A 5F0FA 4I0AA 1T6SA 5FLXZ 4BJ6C 1B72B 5D8KB 3C2GA 4Y3OA 4PFPA 5DM6F 2GZWA 4JK1X 3CJQB 1MMNA 2L2OA 4KIFA 2HOEA 2LF8A 4P5OA 3I71A 3OYBA 2V6EA 3BT9A 1TQPA 1PJRA 2OBPA 2IGKA 4LLLA 3K1PA 1U8BA 2QBYA 3OR1C 3JSOA 4J01A 5FROA 1JKQC 4UVBA 5L3DA 2JVHA 5BQTA 2OA4A 2N8GA 4F92B 3G73A 1UG2A 1Z77A 2GBYA 5L3FA 2E35A 1D1AA 4LD5A 5GPAA 4M3DA 2CQNA 2RAEA 3OYNA 1PP7U 1IN4A 3RKXA 4XSZF 2XF7A 2Z5UA 4DZPA 2ZMEC 2LG4A 1XS9A 2AQEA 5FO5A 5IT9K 1Z1DA 3F8CA 2ZFWA 1TP4A 2FD5A 3BG3A 3KP3A 2W4SA 4BXFA 5F27A 1CF7B 1W1WE 3C2HA 3CP8A 4KYWA 3S14J 3E5QA 3GXOA 1HA8A 3MKYB 3MZHA 5FFZA 3HZJA 3KYDB 1PVEA 5H2FC 4HYEA 1GHCA 1QVTA 2RQQA 4UNOA 2MH2A 4A3GJ 1A6QA 4BBSJ 4CCNA 3JRAA 2E19A 3ZN1A 2HNHA 3BQYA 3MQ0A 3TO9A 3COAC 4LG0B 1WJAA 2BYVE 4OIPF 3A4CA 1DPUA 4ANJA 1PUEE 2R7DA 2WAQN 3BJ6A 4F3QA 5K5RA 1WZ2A 4A3DJ 2PEXA 3S16J 1XG1A 2HVQA 1OYIA 1SD6A 2EZIA 3HUGA 4CHUA 1APLC 3KP4A 5BPDA 2BHYA 3IP4B 2EH3A 4D5FA 1YIJI 4QPQA 1E0EA 1U0JA 1YW9A 4DGWB 2D1HA 2A6HF 3KZZA 2NXNB 5D5UB 3AG4H 1ETXA 1JHHA 3DV8A 1IDYA 3CMYA 3IKTA 2XAJA 2H09A 3BR0A 2BVLA 4OWRB 4I6ZA 2IAIA 1GT0C 3M9AA 2DT7B 2LK2A 3NRVA 4BJTA 5LFAA 2DODA 1IRFA 1LJ9A 2HPIA 4WX9A 3N4MA 3JREA 1ITYA 4LIVA 3KPHA 2PX9A 3AAFA 2STTA 2DFFA 2GIVA 2ICWG 5CJ9A 1WGXA 4XLEA 2KL4A 1GV5A 3F23A 3LNQA 4ESJA 1D1CA 2I5UA 1J9IA 3CCMI 3A2KA 4OAZA 2STWA 1W5TA 4A3BJ 5IPAA 1EH7A 3O8HA 1U78A 4YIFA 2ZNYA 4A3EJ 3HRUA 4KICA 2V9PA 2ADUA 3TGNA 2DDAA 2PN6A 3U1DA 4HF0A 4MTEA 3FXOA 1K7AA 3NWSA 3GFIA 1HLVA 5LGUA 2ZO4A 4PZJA 1Y1WJ 2R5ZB 1MJ9A 4IKFA 3L2RA 2W48A 1Y56A 2EINH 2JWTA 2NVTJ 2DPUA 3DPLC 3I59A 4WXDA 3FDYA 4GCVA 4WF2A 2VJJA 4E7ZA 1K78B 1V5FA 4XKCA 4DNCA 2CFOA 1OISA 3TOAA 4Q4ZF 1KU9A 3H36A 1HOMA 1IN5A 1JKRC 1IUFA 1X4OA 1D5YA 2KZGA 4WXHA 3J7ZI 1CQTA 1MKMA 1H9TA 5FJ8J 1MMDA 1ORKA 4ESFA 3KP7A 5E17F 2LBFA 4MTDA 2FF4A 3GFMA 2P5LC 1BM9A 4E7KA 1XMKA 4IHTA 2VODA 3SZPA 4HBLA 2EV0A 2DMQA 4BXUA 2BW3A 4D5CA 1HXDA 1G6NA 1HW1A 5FFXA 1VTNC 2M2EA 4B43A 4IXAA 2LD5A 4HSTA 4N9IA 3E6DA 4AC0A 2KJCA 3CLQA 1USSA 2K86A 1X1CA 2VBZA 2DTZA 3WHCA 1SMYF 3BTJA 2ZJQF 3DU6A 3KZYA 2W00A 5FD6A 5ICCA 1UG0A 4JOMA 1YJWI 2VJ4A 3CC7I 2CW0F 2M45A 3BG7A 5TJJA 4A3LJ 4NNJA 5JLXA 3BP8A 2XC7A 2IS1A 3NAUA 4ZC3A 2CMPA 4ZYAA 2M3AA 2W82A 3ABLH 1QRYA 2OC6A 3HL2A 4I99C 1QU3A 3Q9VA 3SFIA 5E3MA 3WGHA 2LSOA 5D6FA 3ZQLA 1R71A 3TDZC 3DKYA 3GZ5A 1X1PA 2QENA 1W7PB 2P0WA 3PO3J 4JYKA 5FLMJ 3BJAA 3BR3A 3PM1A 2QKLB 2X4HA 3O6BB 1VQ9I 5ERIA 4JX6A 4XM3A 4I2OA 2F4IA 3LOCA 3MAJA 3SZTA 3HTSB 4G6DA 1ZKGA 1B72A 1KYZA 2RNGA 1HF0A 1W36D 4LMYA 4BXXJ 2LY9A 4D1QA 2VPLA 2DQLA 1NG7A 2FU4A 2MYSA 4N4OB 1ZARA 2UV1A 2NYXA 2O8KA 1PUFA 1R1TA 2ZSIB 2DA6A 4MHGA 2M0MA 4D0PA 1FYMA 5JI6A 1I3QJ 2Q2EA 1A5JA 2ZBKA 3IRQA 2GM4A 2A6TA 4BNCA 1JUPA 3NEUA 3ROUA 2BEOA 4ENKA 1J09A 3E1SA 3L2UA 3IWZA 3BOQA 4EJWA 2K3PA 4LFUA 2PFBA 4S0HB 1FBQA 1P7JA 3CUQB 3UKGA 3CTAA 3I64A 2RDPA 2F4MB 3S2WA 2ISYA 5K5OA 2DYSH 4EATA 2K7LA 4G7ZF 3MFKA 3CO7C 1IV6A 5EJCA 4OMYA 4M9ZA 2DA3A 3LSJA 5DCMB 2O03A 1OLTA 3OYJA 3OS1A 1MBGA 4OIQF 3T8TA 3PUBA 2BXYA 2QVOA 1Z21A 3O2PE 4LK0F 1XSXA 4UY8I 1I5ZA 2ELHA 3PFIA 4U88A 3CMMA 1WFXA 4A6EA 4CYCB 1O3QA 1DPRA 5GAGJ 4UB8C 1IV8A 3MWMA 1I6XA 4L0ZB 2PMZN 3NWTA 4BYYA 4L9NA 3GTPJ 1FIAA 4DW6A 1LE8A 3E7LA 3GO5A 2HYGD 1YO5C 4C3HJ 2QUFA 3TKYA 1SD7A 2KDOA 3Q0WA 5BPIA 2KRHA 4RAFA 3SXYA 2WWYA 1Z9CA 1B9NA 1RUOA 3LSKA 1J2XA 5HLIA 2DO7A 4A5MA 4DYRA 1I39A 1U8RA 4EJOA 3VWBA 3HIFA 2CWEA 3OYIA 1IO2A 2WB1N 2Z3YA 3OSGA 3VYTB 2WV0A 1E17A 3IWFA 1WWXA 2HGCA 1LQ1A 1TWAJ 1RUNA 1GUUA 4F7ZA 2CUJA 2A05A 4PDKA 2F2EA 3B6AA 3EUHA 1I1SA 5B3SH 2MD0A 4P96A 3IV5A 2JN6A 4FTHA 1YX3A 1PP8F 4X6AJ 1U5TA 1YHQI 5LGNA 1REPC 2X6XA 5GTHC 2A61A 2HQRA 4KUMA 3VFZA 1G3WA 4V19K 1YW8A 4QWQA 5KAIC 2EA4A 4L5JA 1OYWA 4L18B 2VKDA 2IA0A 2R7OA 3IC7A 3OS2A 2JA6J 3GLXA 1B8IB 1WRJA 1Z7LA 3PSFA 2LTPA 3FM5A 4QIWN 4MFDA 2OTLI 2CQ7A 3RQ4A 3K4CA 4ETSA 1T39A 2E2HJ 3V4GA 5EGOA 2EA2A 5C4JJ 2EFPA 2PLYA 1FMVA 3DEWA 1FSHA 1SVMA 1X58A 2M1BA 5LLQA 1X19A 1RPWA 3OIQA 2DFIA 4EM2A 4CGZA 3WGGA 2YUSA 3BG5A 3RI4A 3HBLA 3CJNA 5LEKA 3C1DA 5J47A 2PQ8A 1UCRA 3FXLA 2BW3B 3HXLA 3KE2A 1FLIA 2EFQA 1T98A 5ILUA 3QPTA 4Q48A 1TC3C 3TMOA 2W84A 4HEA2 2QLZA 5JLWA 4HOBA 2BBYA 3F21A 3M8JA 1J5YA 2QM3A 4P9FA 4M6YA 4R8HA 3BG9A 5JVGF 2JPBA 4UUSA 3MZYA 3LA3A 1R00A 3M1CA 2Y0SA 2DA2A 4G9YA 4HNTA 2MA3A 3OIPA 4B47A 4NC7A 2KQRA 3KLOA 1WHUA 3ONQA 3G71I 1SEUA 1WVRA 2HTSA 1EA3A 2DOEA 2DMNA 3ZMZA 2WBMA 3HPGA 3DWLE 3I4PA 1F5TA 2X6OA 4BY1J 4IRGA 4BUPA 3NARA 3WTXC 1HCRA 1LDJA 2RNJA 3K70D 3U2RA 4XSXF 3S8PA 3WE2A 1UHMA 1SVOA 3CQZJ 1R6RA 5L3CA 1AWCA 3L2CA 2X1CA 1S8NA 2E1OA 1WI9A 1YYVA 3G1OA 4I76A 1W5CC 2HXOA 2CW8A 2XAGA 4HW0A 2V79A 4J19A 4PGHA 1YTYA 1Z7UA 1UB9A 4ITVA 1IXRC 1OFCX 4U7DA 3JRIA 1ON2A 4CH7A 5IT9Z 1TW3A 1MH3A 4ON0A 2Q0OA 2K9MA 1M1EB 4U0VA 3ZQCA 2EILH 2JRMA 5B1BH 1MD0A 2J5OA 2BY0A 3LSHA 1ZAOA 2Y9YA 1T33A 3WTSC 1VFCA 3CDLA 1Q1VA 1E3HA 1STZA 3P9IA 4RAZA 4XN3A 2A3SA 2FQ4A 1QVUA 4RAYA 1T08B 4RB3C 2W85A 4RGUA 1SANA 3K1NA 3T0YA 4HLXA 1ZGJA 3LAJA 4G7HF 2O3FA 3LA7A 2R7FA 5E1XA 3I4MJ 4CO8A 1RETA 3ZMTA 2IGOA 2Z99A 2VKHA 4XKBA 2GA2A 4YFNF 3GCMA 3LSRA 2LRDA 3DLAA 3ULQB 4GGGA 2L9VA 3RIRA 4HDVA 4A3CJ 2XF6A 2XROA 2K9NA 1B6AA 1R1VA 4XRFA 2Q2EB 4RM2A 4BEHB 2GIZA 3HOTA 3L2QA 3K4BA 2E1MB 4MFEA 1E2XA 5DCMA 1ON1A 2XAQA 3CUQC 4Y4RA 4BEHA 4GYIA 1U6GA 1K79A 3LSPA 3FZVA 2OQRA 3H5AA 4MQVA 2BY2A 4NC6A 4F93B 3PIPF 2GXBA 2AO9A 1SD5A 3SQNA 3AFHA 3QP5A 2VQLA 4P55A 2LREA 5LHGA 3S1QJ 4YIRX 3BR1A 1LVAA 3FISA 1X1AA 3TP3A 1U2WA 3T5XA 3CC2I 4IHXA 2DOFA 1IF1A 1WJEA 3CD6I 4FX0A 1H9GA 5AONA 3CJRB 4XRSA 2BVMA 2HZTA 2FOWA 4AYBA 2Y48A 2FEZA 5M5WJ 4BJ5C 2ZXHA 3HUGB 4D9JA 1BN5A 4XL9A 3GTLJ 5K1YA 3JTHA 1EJ9A 2DMPA 4Y13A 1KU2A 5E79C 1IZ1A 1QO0D 3OYGA 1OPCA 2KP6A 1MMGA 1HQCA 2G7UA 4HF1A 1X4PA 3AG1H 3QYFA 4A3IJ 4M72A 4CCKA 5E1WA 1P92A 1CGPA 4PSWA 3HHGA 3G1MA 5J1YA 3K0LA 2ZXIA 3TBIA 2XPWA 3H3VK 5E20A 1G59A 3SYTA 5CQEA 3LSMA 2V9VA 3OMYA 3DCFA 1MNEA 3L2WA 3HB9A 1QZEA 2MD5A 3Q3SA 1MMSA 4HNUA 2CSOA 1Y39A 3GYHX 1TQMA 3IHUA 4AU7A 3WTVC 2OD5A 3A0BC 3GLLA 2I8DA 1S29A 2M4KA 2F5FA 2Y9ZA 4FETA 5D5WB 1D1BA 1MDMA 3ESWB 5F0HA 3HSFA 1K78A 3G3ZA 3CCSI 1XTAA 3ABTA 1LKXA 5BNGA 4KISA 1P4WA 5E1ZB 3GUDA 2ZJ2A 1USTA 4OOIA 2R5ZA 3AL0C 3DEUA 2GOXB 3RPQA 5HLGA 4R79A 4Y52J 2O0YA 1NK2P 3G1LA 4KMFA 3VSLA 3W3CA 2L9RA 2LBFB 3QQAA 1LVKA 3JRFA 5F1RA 1P4AA 1XMXA 2MGQA 4XONA 4AYBN 4EQQA 3V7RA 1YRNB 1LDKB 3IRRA 4ASNA 4Z2YA 4EM1A 4KA4A 1WQ2A 1VQ8I 3J80Z 1FOXA 2O61A 2OCEA 1JUMA 3FF5A 5CVIA 3QWLA 2UXNA 2UXXA 3EDPA 1V4RA 5EEHA 5F0CA 1JT6A 3JTGA 3ML6A 5M5XJ 3B6CA 1FOYA 1TQIA 3R4KA 3OV8A 4XNFA 1R22A 1UJ8A 4JX5A 4FHTA 5HNHA 1EH6A 5EEAA 3EUKL 1YOVB 2IP2A 4EEFG 2QCOA 2R3SA 4KFCA 1MBKA 4NBQA 4X1EA 3I4NJ 1EF4A 1TW2A 3DXJF 4MO7A 3O8GA 1FP1D 3DBRB 2EIJH 2ZNZA 3GFJA 1L3LA 2ZKZA 2DI3A 5J4VA 4BL0B 4F55A 3B73A 2HOAA 1JE8A 3K70C 4ENJA 3KCCA 1B1BA 4E7SA 4NC8A 2B7EA 2ZB9A 4OMZA 5EF6A 1BJAA 1KU7A 1GVJA 4O5VA 4BDZA 1P7IA 3IL2A 4LGWA 1O3RA 3RYPA 2B0LA 3KEQA 3TP0A 2VLAA 2L5QA 3TO6A 4XLFA 1S7AA 1S7EA 2ELKA 2RVCA 1KU3A 1NHAA 1Y0UA 4II2A 3PL8A 3GBGA 4IRHA 1T38A 3CO6C 1HKTA 3E6BA 1SAUA 3K10A 3PNYA 2NS0A 3GW2A 2JSCA 2VBXA 1SFKA 1NTCA 1TT0A 2OAZA 4GDFA 3EUHC 4YRVA 3OYKA 1OMIA 2DAOA 5GP9A 2LOOA 4C2TA 5TRDA 3FMQA 3ABUA 1IRGA 1DP3A 1OQYA 2H8WA 3KETA 2NOJB 1ZELA 4XMYA 2UUZA 3C7JA 1ULYA 2F48A 3CMEI 2EQRA 1D0XA 3ZP5A 1UMQA 2KIQA 2VPRA 4LIUA 2LP0A 3RZOJ 1R58A 1OJLA 3G2BA 2NAZA 2VKEA 3K4MA 2DOAA 4N4NB 1MIJA 5CLSA 2K9SA 4A3MJ
chains in the Genus database with same CATH topology
3ZQHA 4GFBA 4S0HB 1P7JA 3S2DJ 3UKGA 4G12A 2D5VA 1E3OC 3JRBA 2LKXA 3Q0UA 3RKQA 2HDDA 3M3YJ 5FKKA 1JGGA 1IV6A 5EDNA 1LFUP 2DA3A 4CYCA 3LSJA 3BTCA 1MBGA 2DA4A 5J1UA 3GTGJ 2HXIA 5E3OA 4CYCB 2LVSA 1Y1VJ 4MLOA 4V2FA 2R93J 1H8AC 2PMZN 4BBRJ 3GTPJ 1FIAA 4DW6A 1MBHA 1LE8A 3E7LA 2ME0A 4C3HJ 4QSHA 4L5EA 5K7ZA 5C4XJ 3OIOA 2QF7A 3Q0WA 5FKMA 1AKHB 2JA5J 3JRGA 1H88C 1IJWC 1ETWA 4DYRA 1ZTRA 1OCTC 1VF9A 2DA7A 2WB1N 3OSGA 2TCTA 1U9NA 1TWAJ 1GUUA 5DTDA 3HEFA 1FIPA 5IYDJ 3B6AA 2KT0A 1RESA 2NS8A 1WH7A 3PO2J 1DU6A 2HOTA 5DS9A 3LSGA 1ZK8A 3MN2A 3IV5A 2JN6A 3D1NI 4FTHA 1RKWA 4X6AJ 1GV2A 1X2MA 1O4XA 4A3JJ 3IH4A 2NOGA 2GLOA 3SJMA 4JP0A 4NDLA 2EZKA 1JTXA 5HODA 2JA6J 1B8IB 3HDDA 2XPVA 2CRGA 2ME6A 5J1RA 3S1NJ 1ZR2A 1TWCJ 2LTPA 4QIWN 4MFDA 1T56A 5M3MJ 5IOYA 1A6IA 1WI3A 2M8GX 5J3LA 5EG0B 1DU0A 2IBDA 1B8IA 2E2HJ 5EGOA 2EZLA 1JKPC 3S2HJ 5C4JJ 1RR7A 2XRLA 5GPCA 1SFOJ 1BW6A 3BR6A 5IYBJ 3DEWA 3ZOBA 1ETKA 1MSFC 3GTMJ 4A3FJ 3GTKJ 4RBOA 1F43A 1ZR4A 1X58A 3VPRA 1RPWA 2VUMJ 2R7ZJ 2KDZA 3A01A 3OSFA 1QPIA 5FLVA 2YUSA 3BG5A 3HBLA 2LR8A 4M3FA 3BR2A 1I6HJ 2ID6A 4RDUA 2JA7J 2EZHA 3JRDA 3BTLA 4UUTA 4W97A 4W1UA 1TC3C 1IC8A 1U9OA 2X48A 5JLWA 2XGCA 5C3EJ 3HOVJ 4XICA 4XIDA 3BG9A 1TWGJ 4UUSA 1G2HA 4DZJA 2DA2A 2NS7A 2LLKA 2M34A 3A02A 5EZGA 4A69C 3FK7A 4C3JJ 2HYJA 2DJNA 2DMNA 1WCMJ 3TW6A 2Y30A 4BY1J 2X6OA 3NARA 1HCRA 2NVQJ 2YU9J 4QTRA 1I50J 2XB0X 3CQZJ 2EBIA 3K2AA 1ENHA 3ZQGA 2E1OA 3S17J 3G1OA 4I76A 3S15J 2VI6A 2HXOA 3BTIA 2DMTA 2DA5A 3M4OJ 4J19A 2K9QA 4BY7J 2H1KA 1OFCX 5F1JA 4FCYA 3S1RJ 2XSDC 4FE7A 3JRHA 3JRIA 5EZHA 2MG4A 5IP9J 5FKLA 3MVPA 1LFBA 3HGGA 1JJ6C 3HGYA 2O9LA 1MH3A 3JRCA 3FKIJ 1TWFJ 3ZQCA 2NVXJ 2G0EA 5F0FA 1FTTA 3OOUA 1B72B 4C3IJ 3RQIA 1X2NA 4B4CA 1ZGWA 2Y9YA 2OPTA 1T33A 2XGDA 1GDTA 3BT9A 1VFCA 3CDLA 1Q1VA 2OF7A 1U8BA 2FQ4A 1QVUA 2R92J 2WV1A 1SANA 2O7OA 1JKQC 2N8GA 1UG2A 1Z77A 4M3EA 2GBYA 2E2JJ 2ECCA 1HDPA 3CCYA 5GPAA 4IHWA 3HOWJ 4M3DA 3I4MJ 1RETA 4M6VA 2RAEA 4IEJA 3BR5A 4DZPA 2MSYA 1VNDA 3LSRA 1XS9A 4A3CJ 2K9NA 4LOCA 3FK6A 2FD5A 3BG3A 4IHYA 1GVDA 3IH2A 2R0QC 5F27A 1MSEC 3H0GJ 4MFEA 3HOYJ 3S14J 1K83J 2DN0A 2FJ1A 1MNMC 2L7ZA 2M0CA 1ETQA 3LSPA 1QVTA 4HNVA 1ETOA 2AO9A 4A3GJ 4BBSJ 1W0TA 3HOZJ 3S1QJ 3JRAA 3BR1A 2E19A 4DYCA 3BQYA 4XRSG 3FISA 2HOSA 1MBJA 3TP3A 1LE8B 2HI3A 2WAQN 4A3DJ 1OCPA 4IHXA 3S16J 1XG1A 1POGA 1AKHA 2EZIA 1APLC 3TEDA 2EH3A 4D5FA 3RZDJ 4XRSA 1ZQ3P 2HQ5A 3TW7A 5M5WJ 2L7MP 1IRZA 1ETVA 1ETXA 5K7HA 1IDYA 3CMYA 2Y0SN 1FTZA 3GTLJ 3BR0A 2DMPA 1NK3P 2JA8J 3QPLA 4FE4A 4I6ZA 4A93J 2IAIA 4V2GA 2XGEA 1GT0C 1IGNA 2LK2A 1FEXA 3JREA 4A3IJ 1ITYA 1JKOC 3HOUJ 3G1MA 5J1YA 5IYCJ 1IDZA 2B63J 1WGXA 2XPWA 1WPKA 4D7NA 3H3VK 1GV5A 2FX0A 3LNQA 2R5YB 3S1MJ 2YS9A 3DCFA 3HB9A 4A3BJ 5IPAA 3F0CA 3O8HA 3Q3SA 1U78A 9ANTA 4A3EJ 5EG0A 1MBFA 4B3AA 2R5YA 2CU7A 4DYQA 2LFBA 4XRMA 1BJZA 2Y9ZA 2NVYJ 1HLVA 4FISA 1Y1WJ 2R5ZB 5F0HA 2W48A 2JWTA 2L0KA 2NVTJ 1MH4A 5BNGA 4IHVA 5EYRA 5IP6A 5E3NA 3A01B 3QPSA 2R5ZA 2K9SA 5EGOB 4Y52J 1NK2P 3FIWA 3G1LA 2CJJA 5M3FJ 1HOMA 2L9RA 1IG7A 3QQAA 2CUEA 1IUFA 3JRFA 1JKRC 1D5YA 4AYBN 5FKNA 2MGQA 4D7MA 1YRNB 1CQTA 2COBA 5FJ8J 1ORKA 3HM5A 3WHBA 1FJLA 3BQZA 4A3KJ 2JJ7A 1JUMA 4XK4A 1AU7A 4B1RA 5C44J 4C2MJ 2JK3A 1YRNA 2MW8A 5F0CA 1JT6A 2DMQA 5M5XJ 2ECBA 3B6CA 4D5CA 3ZQIA 4JX5A 5F08A 2AHQA 2JMWA 2M2EA 1W0UA 1VI0A 5EEAA 2CQQA 1XC5A 1MBEA 1F36A 3GTJJ 4EEFG 2QCOA 2LD5A 4AC0A 1MBKA 4UUSB 4X1EA 3I4NJ 1EF4A 5IP7J 4MO7A 2DA1A 3O8GA 2X9DA 2DTZA 3WHCA 5E3LA 2VKVA 3W6VA 3BTJA 3K7AJ 4Y7NJ 2HOAA 2I10A 1R9TJ 3L1PA 2ZB9A 5EF6A 3JR9A 1Z0XA 4A3LJ 2P81A 4AUXA 2Y2ZA 1P7IA 1AHDP 5JLXA 3A03A 3NAUA 3C2BA 1ETYA 1K61A 1BA5A 3TP0A 1RKTA 4M3GA 1BW5A 2IEKA 3GTOJ 1QRYA 4JX4A 3MKLA 1S7EA 1JUSA 2ELKA 3SFIA 5E3MA 3ZQLA 5F04A 3GBGA 3Q0VA 2XB5A 2K40A 3GTQJ 2CUFA 3PO3J 4ABZA 4JYKA 3ZQFA 5FLMJ 3HKZN 3BR3A 3PM1A 1JT0A 1BL0A 1NTCA 1UHSA 4JX6A 3IH3A 1JTYA 3LOCA 5GP9A 1JJ8C 3SDGA 1ZKGA 4MIMA 1B72A 1HDDC 1HF0A 4BXXJ 2LY9A 1H89C 4M3BA 2ID3A 2EQRA 2Y31A 1UMQA 2O8KA 2DMUA 2TRTA 2VPRA 3HOXJ 1PUFA 2DA6A 5IOZA 2LP0A 2M9HA 2E2IJ 3RZOJ 2H8RA 1I3QJ 1A5JA 1OJLA 2XPUA 4BKXA 2CQXA 2VKEA 1WH5A 1TWHJ 5K7FA 1PUFB 2GM4A 5FKOA 1JUPA 2L7FP 5M5YJ 4A3MJ
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3ZQH A;  4GFB A;  4S0H B;  1P7J A;  3S2D J;  3UKG A;  4G12 A;  2D5V A;  1E3O C;  3JRB A;  2LKX A;  3Q0U A;  3RKQ A;  2HDD A;  3M3Y J;  5FKK A;  1JGG A;  1IV6 A;  5EDN A;  1LFU P;  2DA3 A;  4CYC A;  3LSJ A;  3BTC A;  1MBG A;  2DA4 A;  5J1U A;  3GTG J;  2HXI A;  5E3O A;  4CYC B;  2LVS A;  1Y1V J;  4MLO A;  4V2F A;  2R93 J;  1H8A C;  2PMZ N;  4BBR J;  3GTP J;  1FIA A;  4DW6 A;  1MBH A;  1LE8 A;  3E7L A;  2ME0 A;  4C3H J;  4QSH A;  4L5E A;  5K7Z A;  5C4X J;  3OIO A;  2QF7 A;  3Q0W A;  5FKM A;  1AKH B;  2JA5 J;  3JRG A;  1H88 C;  1IJW C;  1ETW A;  4DYR A;  1ZTR A;  1OCT C;  1VF9 A;  2DA7 A;  2WB1 N;  3OSG A;  2TCT A;  1U9N A;  1TWA J;  1GUU A;  5DTD A;  3HEF A;  1FIP A;  5IYD J;  3B6A A;  2KT0 A;  1RES A;  2NS8 A;  1WH7 A;  3PO2 J;  1DU6 A;  2HOT A;  5DS9 A;  3LSG A;  1ZK8 A;  3MN2 A;  3IV5 A;  2JN6 A;  3D1N I;  4FTH A;  1RKW A;  4X6A J;  1GV2 A;  1X2M A;  1O4X A;  4A3J J;  3IH4 A;  2NOG A;  2GLO A;  3SJM A;  4JP0 A;  4NDL A;  2EZK A;  1JTX A;  5HOD A;  2JA6 J;  1B8I B;  3HDD A;  2XPV A;  2CRG A;  2ME6 A;  5J1R A;  3S1N J;  1ZR2 A;  1TWC J;  2LTP A;  4QIW N;  4MFD A;  1T56 A;  5M3M J;  5IOY A;  1A6I A;  1WI3 A;  2M8G X;  5J3L A;  5EG0 B;  1DU0 A;  2IBD A;  1B8I A;  2E2H J;  5EGO A;  2EZL A;  1JKP C;  3S2H J;  5C4J J;  1RR7 A;  2XRL A;  5GPC A;  1SFO J;  1BW6 A;  3BR6 A;  5IYB J;  3DEW A;  3ZOB A;  1ETK A;  1MSF C;  3GTM J;  4A3F J;  3GTK J;  4RBO A;  1F43 A;  1ZR4 A;  1X58 A;  3VPR A;  1RPW A;  2VUM J;  2R7Z J;  2KDZ A;  3A01 A;  3OSF A;  1QPI A;  5FLV A;  2YUS A;  3BG5 A;  3HBL A;  2LR8 A;  4M3F A;  3BR2 A;  1I6H J;  2ID6 A;  4RDU A;  2JA7 J;  2EZH A;  3JRD A;  3BTL A;  4UUT A;  4W97 A;  4W1U A;  1TC3 C;  1IC8 A;  1U9O A;  2X48 A;  5JLW A;  2XGC A;  5C3E J;  3HOV J;  4XIC A;  4XID A;  3BG9 A;  1TWG J;  4UUS A;  1G2H A;  4DZJ A;  2DA2 A;  2NS7 A;  2LLK A;  2M34 A;  3A02 A;  5EZG A;  4A69 C;  3FK7 A;  4C3J J;  2HYJ A;  2DJN A;  2DMN A;  1WCM J;  3TW6 A;  2Y30 A;  4BY1 J;  2X6O A;  3NAR A;  1HCR A;  2NVQ J;  2YU9 J;  4QTR A;  1I50 J;  2XB0 X;  3CQZ J;  2EBI A;  3K2A A;  1ENH A;  3ZQG A;  2E1O A;  3S17 J;  3G1O A;  4I76 A;  3S15 J;  2VI6 A;  2HXO A;  3BTI A;  2DMT A;  2DA5 A;  3M4O J;  4J19 A;  2K9Q A;  4BY7 J;  2H1K A;  1OFC X;  5F1J A;  4FCY A;  3S1R J;  2XSD C;  4FE7 A;  3JRH A;  3JRI A;  5EZH A;  2MG4 A;  5IP9 J;  5FKL A;  3MVP A;  1LFB A;  3HGG A;  1JJ6 C;  3HGY A;  2O9L A;  1MH3 A;  3JRC A;  3FKI J;  1TWF J;  3ZQC A;  2NVX J;  2G0E A;  5F0F A;  1FTT A;  3OOU A;  1B72 B;  4C3I J;  3RQI A;  1X2N A;  4B4C A;  1ZGW A;  2Y9Y A;  2OPT A;  1T33 A;  2XGD A;  1GDT A;  3BT9 A;  1VFC A;  3CDL A;  1Q1V A;  2OF7 A;  1U8B A;  2FQ4 A;  1QVU A;  2R92 J;  2WV1 A;  1SAN A;  2O7O A;  1JKQ C;  2N8G A;  1UG2 A;  1Z77 A;  4M3E A;  2GBY A;  2E2J J;  2ECC A;  1HDP A;  3CCY A;  5GPA A;  4IHW A;  3HOW J;  4M3D A;  3I4M J;  1RET A;  4M6V A;  2RAE A;  4IEJ A;  3BR5 A;  4DZP A;  2MSY A;  1VND A;  3LSR A;  1XS9 A;  4A3C J;  2K9N A;  4LOC A;  3FK6 A;  2FD5 A;  3BG3 A;  4IHY A;  1GVD A;  3IH2 A;  2R0Q C;  5F27 A;  1MSE C;  3H0G J;  4MFE A;  3HOY J;  3S14 J;  1K83 J;  2DN0 A;  2FJ1 A;  1MNM C;  2L7Z A;  2M0C A;  1ETQ A;  3LSP A;  1QVT A;  4HNV A;  1ETO A;  2AO9 A;  4A3G J;  4BBS J;  1W0T A;  3HOZ J;  3S1Q J;  3JRA A;  3BR1 A;  2E19 A;  4DYC A;  3BQY A;  4XRS G;  3FIS A;  2HOS A;  1MBJ A;  3TP3 A;  1LE8 B;  2HI3 A;  2WAQ N;  4A3D J;  1OCP A;  4IHX A;  3S16 J;  1XG1 A;  1POG A;  1AKH A;  2EZI A;  1APL C;  3TED A;  2EH3 A;  4D5F A;  3RZD J;  4XRS A;  1ZQ3 P;  2HQ5 A;  3TW7 A;  5M5W J;  2L7M P;  1IRZ A;  1ETV A;  1ETX A;  5K7H A;  1IDY A;  3CMY A;  2Y0S N;  1FTZ A;  3GTL J;  3BR0 A;  2DMP A;  1NK3 P;  2JA8 J;  3QPL A;  4FE4 A;  4I6Z A;  4A93 J;  2IAI A;  4V2G A;  2XGE A;  1GT0 C;  1IGN A;  2LK2 A;  1FEX A;  3JRE A;  4A3I J;  1ITY A;  1JKO C;  3HOU J;  3G1M A;  5J1Y A;  5IYC J;  1IDZ A;  2B63 J;  1WGX A;  2XPW A;  1WPK A;  4D7N A;  3H3V K;  1GV5 A;  2FX0 A;  3LNQ A;  2R5Y B;  3S1M J;  2YS9 A;  3DCF A;  3HB9 A;  4A3B J;  5IPA A;  3F0C A;  3O8H A;  3Q3S A;  1U78 A;  9ANT A;  4A3E J;  5EG0 A;  1MBF A;  4B3A A;  2R5Y A;  2CU7 A;  4DYQ A;  2LFB A;  4XRM A;  1BJZ A;  2Y9Z A;  2NVY J;  1HLV A;  4FIS A;  1Y1W J;  2R5Z B;  5F0H A;  2W48 A;  2JWT A;  2L0K A;  2NVT J;  1MH4 A;  5BNG A;  4IHV A;  5EYR A;  5IP6 A;  5E3N A;  3A01 B;  3QPS A;  2R5Z A;  2K9S A;  5EGO B;  4Y52 J;  1NK2 P;  3FIW A;  3G1L A;  2CJJ A;  5M3F J;  1HOM A;  2L9R A;  1IG7 A;  3QQA A;  2CUE A;  1IUF A;  3JRF A;  1JKR C;  1D5Y A;  4AYB N;  5FKN A;  2MGQ A;  4D7M A;  1YRN B;  1CQT A;  2COB A;  5FJ8 J;  1ORK A;  3HM5 A;  3WHB A;  1FJL A;  3BQZ A;  4A3K J;  2JJ7 A;  1JUM A;  4XK4 A;  1AU7 A;  4B1R A;  5C44 J;  4C2M J;  2JK3 A;  1YRN A;  2MW8 A;  5F0C A;  1JT6 A;  2DMQ A;  5M5X J;  2ECB A;  3B6C A;  4D5C A;  3ZQI A;  4JX5 A;  5F08 A;  2AHQ A;  2JMW A;  2M2E A;  1W0U A;  1VI0 A;  5EEA A;  2CQQ A;  1XC5 A;  1MBE A;  1F36 A;  3GTJ J;  4EEF G;  2QCO A;  2LD5 A;  4AC0 A;  1MBK A;  4UUS B;  4X1E A;  3I4N J;  1EF4 A;  5IP7 J;  4MO7 A;  2DA1 A;  3O8G A;  2X9D A;  2DTZ A;  3WHC A;  5E3L A;  2VKV A;  3W6V A;  3BTJ A;  3K7A J;  4Y7N J;  2HOA A;  2I10 A;  1R9T J;  3L1P A;  2ZB9 A;  5EF6 A;  3JR9 A;  1Z0X A;  4A3L J;  2P81 A;  4AUX A;  2Y2Z A;  1P7I A;  1AHD P;  5JLX A;  3A03 A;  3NAU A;  3C2B A;  1ETY A;  1K61 A;  1BA5 A;  3TP0 A;  1RKT A;  4M3G A;  1BW5 A;  2IEK A;  3GTO J;  1QRY A;  4JX4 A;  3MKL A;  1S7E A;  1JUS A;  2ELK A;  3SFI A;  5E3M A;  3ZQL A;  5F04 A;  3GBG A;  3Q0V A;  2XB5 A;  2K40 A;  3GTQ J;  2CUF A;  3PO3 J;  4ABZ A;  4JYK A;  3ZQF A;  5FLM J;  3HKZ N;  3BR3 A;  3PM1 A;  1JT0 A;  1BL0 A;  1NTC A;  1UHS A;  4JX6 A;  3IH3 A;  1JTY A;  3LOC A;  5GP9 A;  1JJ8 C;  3SDG A;  1ZKG A;  4MIM A;  1B72 A;  1HDD C;  1HF0 A;  4BXX J;  2LY9 A;  1H89 C;  4M3B A;  2ID3 A;  2EQR A;  2Y31 A;  1UMQ A;  2O8K A;  2DMU A;  2TRT A;  2VPR A;  3HOX J;  1PUF A;  2DA6 A;  5IOZ A;  2LP0 A;  2M9H A;  2E2I J;  3RZO J;  2H8R A;  1I3Q J;  1A5J A;  1OJL A;  2XPU A;  4BKX A;  2CQX A;  2VKE A;  1WH5 A;  1TWH J;  5K7F A;  1PUF B;  2GM4 A;  5FKO A;  1JUP A;  2L7F P;  5M5Y J;  4A3M J; 
#chains in the Genus database with same CATH topology
 3ZQH A;  2XGX A;  1YJ9 I;  3EQL F;  3BCA A;  1MZB A;  2M8E A;  3FXK A;  4LK1 F;  3S2D J;  3DP7 A;  1ZGA A;  3NQO A;  4G12 A;  2D5V A;  1E3O C;  2LKX A;  4XQF A;  1WJD A;  1OCO H;  3RKQ A;  1DUX C;  3WTT C;  5FKK A;  4Y33 A;  1LPQ A;  2BHZ A;  5D4S A;  1LFU P;  4CYC A;  1KQ8 A;  3BTC A;  3CF2 A;  3TOB A;  4ZDO A;  2DA4 A;  1MJB A;  2HXI A;  1GLN A;  2ISZ A;  2D1V A;  2JQ7 A;  3TO7 A;  2QQ9 A;  3F6V A;  5LGT A;  2V26 A;  3EET A;  4LG3 A;  1X3W B;  3SEQ A;  2OZ6 A;  1OCZ H;  4BBR J;  3REO A;  1MW7 A;  4BHP A;  4WXC A;  2VN2 A;  2MC3 A;  1LEB A;  2Y75 A;  4AIH A;  5GAD J;  1F9N A;  2QQB A;  4L5E A;  4FAS D;  4II3 A;  1BI0 A;  5K7Z A;  2QSF X;  1N75 A;  2E7W A;  2D2W A;  2L01 A;  3VYU B;  2JA5 J;  5BS6 A;  1ZTR A;  3IKV A;  5L3E A;  3HYI A;  1VF9 A;  2DA7 A;  2F5C A;  2VIX A;  3V7S A;  3QP6 A;  1IN8 A;  1X3U A;  5HLT A;  3ZQQ A;  3T1B A;  2F5D A;  3PNV A;  1R5H A;  1XD7 A;  2L02 A;  2LKS A;  1K6Y A;  1RES A;  2NS8 A;  1YS7 A;  1WH7 A;  1DU6 A;  2HOT A;  2EPF A;  5DS9 A;  2XAF A;  2LY1 A;  3DU5 A;  1GV2 A;  1O4X A;  4CCL A;  1BIA A;  4BU2 A;  4A3J J;  3CZ6 A;  4PCQ A;  5HVQ C;  5LRR A;  3SJM A;  4OU0 A;  4PJM A;  2DQR A;  1G3Y A;  1XMA A;  3CES A;  2FML A;  1MDM B;  5HNF A;  1BOB A;  4BQN A;  1JGS A;  2K27 A;  3RKW A;  5J1R A;  3S1N J;  3CCL I;  1IXS B;  1FSE A;  2DYR H;  2LMD A;  1Z6T A;  1TWC J;  2JA2 A;  1HSJ A;  3BJO A;  3M1E A;  4RA2 A;  1TLH B;  2HKX A;  2FXA A;  5EG0 B;  2M8G X;  2E36 A;  2KIS A;  3BRO A;  4BQA A;  2XRL A;  2ZME B;  1SFO J;  5IYB J;  1F4K A;  2J5P A;  3GTM J;  5E18 F;  4A3F J;  3GTK J;  2DT5 A;  3V42 A;  1F43 A;  1ZR4 A;  1BR4 A;  4DBR A;  3AL0 B;  1YIO A;  3VPR A;  1GXQ A;  2R7Z J;  1FC3 A;  5J8C A;  3I59 B;  3DBH B;  3OSF A;  1QPI A;  2DU9 A;  2R7Q A;  2OQG A;  4UVA A;  1QPM A;  4RDU A;  2EZH A;  3BTL A;  1OR7 A;  3SHF A;  3DKW A;  5KCM A;  2EFO A;  3KFW X;  1U9O A;  4A0Z A;  3VYS B;  3WTY C;  1XGS A;  4KMU X;  1MMA A;  3G4S I;  1I1G A;  1S3J A;  1WJ5 A;  2HDW A;  4F91 B;  3N05 A;  1OYY A;  4HQM A;  3T8R A;  1G3S A;  2LY2 A;  4DZJ A;  3I9V 2;  1WJC A;  3MKW B;  2NS7 A;  4EV0 A;  2H94 A;  4EM0 B;  2V1U A;  2HQN A;  2LLK A;  3A02 A;  5EZG A;  1FX7 A;  4HRI A;  2LNB A;  4E7J A;  3FBI B;  4RB0 A;  1YQA A;  1J0R A;  3OYD A;  2VC0 A;  5D5V B;  4P9U A;  1ZRE A;  2QYO A;  4NB5 A;  2EBI A;  3K2A A;  4NQW A;  4OAY A;  4YFK F;  3P9C A;  2G7H A;  2DMT A;  2DA5 A;  4LJZ F;  2IA1 A;  2K9Q A;  4BY7 J;  1VQ4 I;  5DUK A;  2H1K A;  4XKW A;  3M7G A;  3S1R J;  4FE7 A;  1D0Y A;  5DDG A;  2VE8 A;  4HX7 A;  4B48 A;  5EZH A;  1R36 A;  3I0T A;  4BE0 A;  5IP9 J;  2HVS A;  3MVP A;  4CA0 A;  4EVI A;  3CDI A;  5HDN A;  2VT2 A;  3F9K A;  1HW2 A;  1YLF A;  2O9L A;  3VYR B;  5FRN A;  3JRC A;  2F5E A;  3R60 A;  1FTT A;  3OOU A;  1U5T C;  3RQI A;  2BY1 A;  1X2N A;  4JBA A;  2QKM B;  2WAD A;  1T0F C;  4B4C A;  1SD4 A;  3SFZ A;  4HX4 A;  2OPT A;  1GDT A;  3ZXS A;  2HPM A;  2OUM A;  4RAG A;  1I27 A;  2WV1 A;  5CYV A;  2O7O A;  2NRA C;  5J4Y A;  3GFL A;  4HZF A;  5J8F A;  3ZMD A;  1T95 A;  4M3E A;  2KRF A;  4IJA A;  2E2J J;  2E1N A;  1P9Q C;  1BR1 A;  2ECC A;  2E7X A;  2HFH A;  2M4G A;  3K1M A;  3RDI A;  2FE3 A;  3CCJ I;  1LB2 A;  2R7X A;  2KJB A;  4G6Q A;  1K4T A;  1S6L A;  5FGM A;  1V54 H;  3BR5 A;  1A04 A;  4DJA A;  4AM3 A;  2MSY A;  3FXM A;  2QQ8 A;  1VND A;  2E60 A;  3OL4 A;  5LHI A;  4L5I A;  4P1W A;  3K2Z A;  4TV7 A;  4IHY A;  2P7V B;  4UXN A;  1GVD A;  4IX7 A;  1G3T A;  3FMS A;  2R0Q C;  3SZG A;  3FHZ A;  3H0G J;  2A07 F;  4ENN A;  4H0E A;  3HOY J;  3PFY A;  2DN0 A;  2FJ1 A;  4UHT A;  5AIP A;  1MNM C;  3J81 K;  1ZRC A;  3L7W A;  2F4O B;  1ETQ A;  3BZK A;  1BI3 A;  4KDP A;  3CCE I;  3EYI A;  4HNV A;  3WTZ A;  1ETO A;  1XN7 A;  4G94 A;  4MGR A;  1W0T A;  3QYB A;  4M73 A;  2XIG A;  2XRN A;  3V8L A;  2A5Y B;  3LQQ A;  3FBN B;  1MBJ A;  3WU2 C;  1LE8 B;  3H5R A;  3SDB A;  5GTI C;  2IW5 A;  4C9Y A;  4YFX F;  4XLH A;  1O57 A;  3FXQ A;  3ZCO A;  1B59 A;  1H0M A;  1LDD A;  4BHC A;  3RZD J;  2L4A A;  3U1K A;  4L9J A;  1ZQ3 P;  5CVV A;  2HQ5 A;  2KFD A;  4BQO A;  1R4M B;  1V5E A;  3O3K A;  4MEX F;  2WC2 A;  4EJV A;  4M9X A;  4EJT A;  3ZMV A;  5KK1 A;  2WY7 Q;  4I0B A;  2DFE A;  1FTZ A;  3LFU A;  3PIO F;  2ZC2 A;  4Q47 A;  4IPA A;  2V1N A;  3AG2 H;  2JA8 J;  3QPL A;  4FE4 A;  3OYM A;  2XGE A;  4IOA F;  4K2E A;  2OCC H;  3CMA I;  2GXG A;  4AIJ A;  3DPT A;  1UHW A;  3MCZ A;  1XCV A;  2VQH A;  2KPM A;  3WU0 A;  2OU2 A;  5JVT A;  2E5Z A;  2FX0 A;  2IVM A;  2R5Y B;  1FPQ A;  2YS9 A;  2K85 A;  4XLP F;  4QLC U;  5FRM A;  9ANT A;  4RB1 A;  4KIG A;  2P6T A;  4B3A A;  3FWE A;  3E5U A;  3PNT A;  3KYL A;  2C6Y A;  2W25 A;  5TGT A;  4XRM A;  1BJZ A;  1J75 A;  2NVY J;  3I54 A;  2L9N A;  1SFE A;  4LLG F;  3P9K A;  4ZH4 F;  2L0K A;  4A0Y A;  2M5W A;  3V7C A;  4IHV A;  2KMU A;  3KP2 A;  4XOP A;  5IP6 A;  5KHD A;  3A01 B;  3QPS A;  3H9J A;  4NHJ A;  5HDK A;  2BY3 A;  1VQ5 I;  4AIK A;  3S93 A;  3ISP A;  1IG7 A;  2PJR A;  4A0X A;  5FKN A;  2XDV A;  1FNN A;  2M7B A;  4YEL A;  5DYM A;  3K4L A;  1ACI A;  3LSI A;  2M87 A;  1R49 A;  5ICG A;  2M30 A;  4A2U A;  2JK3 A;  3GZN B;  5IT3 A;  4BE2 A;  1YRN A;  3DLL F;  3CF5 F;  4XN0 A;  5A2Q Z;  2IJL A;  3MD2 A;  4X0G A;  4KNY A;  1BR2 A;  5B5E C;  3H5N A;  4U0W A;  1WJB A;  2VXD A;  1DDN A;  2EFW A;  2VJI A;  3ZQI A;  2JMW A;  2V1D A;  2CQQ A;  3WU1 B;  1W4M A;  1XC5 A;  4ZYD A;  3OYH A;  3BY6 A;  1QGP A;  3J7A O;  3L2V A;  4PFO A;  2PJP A;  1P6R A;  3K9T A;  4UUS B;  4KIB A;  1KGS A;  2DA1 A;  2GA1 A;  5E3L A;  2VKV A;  1XSV A;  2ETH A;  2BGC A;  4E7H A;  3W6V A;  3I53 A;  4XOT A;  4JQF A;  1RZ4 A;  3KEO A;  4DIQ A;  1YIT I;  3EUA A;  1HW5 A;  1R9T J;  1JXS A;  3I58 A;  5JHU A;  5CQG A;  1G4D A;  3JR9 A;  4A12 A;  1D0Z A;  5CVR A;  3QRF F;  4LIT A;  2P81 A;  4AUX A;  2VBY A;  3CP2 A;  1LNW A;  2LF7 A;  2P4W A;  4RB2 C;  1AHD P;  3A03 A;  1OCR H;  4LLN A;  4IL6 C;  3HHH A;  3VOE A;  5DM7 F;  4DQ2 A;  3C2B A;  4IRI A;  1V55 H;  3LFK A;  1RKT A;  4G6T B;  4M3G A;  2IEK A;  2P5K A;  2ZJR F;  3HG9 A;  3OR2 C;  4CCM A;  3GTO J;  3J7A Y;  4JX4 A;  2F5V A;  1JUS A;  3ELK A;  1FBU A;  2RN7 A;  3OOP A;  2HQA A;  4NUB A;  2H6C A;  2MBF A;  1X1B A;  3Q0V A;  3TQN A;  3ERE D;  1YW7 A;  3ASN H;  2DJI A;  3S3O A;  2CUF A;  3ZQF A;  5H6Q A;  1YFH A;  1G8X A;  3ASO H;  2QZ8 A;  1JT0 A;  4E7I A;  1BL0 A;  5DD4 A;  2PBI A;  2H6B A;  4KT5 C;  4IVN A;  1B4A A;  1MND A;  1UHS A;  3MMY B;  2QSH X;  3ERM A;  5LEJ A;  3RJP A;  1JJ8 C;  3KP6 A;  2CFX A;  4E4H A;  3IAM 2;  5F6F A;  3HJE A;  2CYY A;  4PGG A;  4B3X A;  3OYL A;  4L9V A;  4J00 A;  1U3E M;  3WE3 A;  1VQM I;  1J59 A;  4LB6 B;  3F3X A;  3PQJ A;  2TRT A;  4XLA A;  3HOX J;  4KJZ A;  1OKR A;  4H4K C;  2GAU A;  3E3V A;  5IOZ A;  3CCU I;  2AS5 F;  1JI8 A;  3DEE A;  1WSU A;  3HOS A;  2CQX A;  4OIO F;  3RCO A;  2JT1 A;  1TWH J;  1PUF B;  2W24 A;  1AU7 A;  4RS8 A;  1S72 I;  3MZ8 A;  3E6C C;  4XKV A;  3HRM A;  2RV8 A;  1ONV A;  1N25 A;  1QBJ A;  5FLX K;  2Z33 A;  2RGV A;  1YI2 I;  3Q0U A;  3RPU A;  5B1A H;  2HDD A;  4WCG A;  2XSJ C;  4ZDP A;  1RC9 A;  3QU3 A;  2DCE A;  2IPQ X;  1F1Z A;  5JFR A;  4U0Y A;  3ABM H;  3GTG J;  2K9L A;  4XLN F;  3H1C A;  1HST A;  1Z67 A;  4MEY F;  3JW4 A;  1Y1V J;  4MLO A;  4V2F A;  1UAA A;  4GO1 A;  1SAX A;  1H8A C;  2HKO A;  1FMW A;  3GME A;  3S3M A;  4PJN A;  2ME0 A;  5F64 A;  2IGN A;  4DBQ A;  1OCC H;  3OYE A;  2QF7 A;  1O3T A;  2K3F A;  3P5J A;  4AVP A;  5A2Q K;  1E3P A;  2FRH A;  2CW7 A;  1H88 C;  1FY7 A;  2V7F A;  1VQP I;  2PG4 A;  4HV6 A;  1ZRF A;  3QOD A;  4XR6 A;  4HG2 A;  4HDU A;  2TCT A;  2WAQ A;  3IUO A;  4CYD A;  4EGZ A;  4IHS A;  2W1O A;  1U9N A;  2BZT A;  2XAS A;  1ZG3 A;  1S5L C;  1ODD A;  4CCJ A;  3GWZ A;  2A5W A;  1LEA A;  2VT3 A;  4ESB A;  1XSD A;  4AID A;  2KIM A;  3PO2 J;  3OL3 A;  3LSG A;  1ZK8 A;  2EV5 A;  4HX8 A;  4XBF A;  3D1N I;  1Q1H A;  1RKW A;  1VZ0 A;  1X2M A;  4ZZL A;  3OYA A;  2DK5 A;  3P7N A;  3ZR8 X;  5E8I A;  3IH4 A;  2NOG A;  4KN7 X;  1ZG5 A;  4C30 A;  3WOD F;  2R4G A;  4S05 A;  2EZK A;  1YJN I;  5HDG A;  4PSX A;  5HOD A;  3MEX A;  2VC1 A;  1XX5 A;  2HU9 A;  2VXZ A;  4LB5 A;  3A0H C;  2FNA A;  4AVZ A;  3HDD A;  2FA5 A;  2ME6 A;  2W7N A;  1ZR2 A;  2O6G E;  1MJA A;  2RKH A;  3GVA A;  2ESN A;  1T56 A;  5IOY A;  3F8F A;  1A6I A;  1WI3 A;  5J3L A;  3JAM Z;  1NG6 A;  1DU0 A;  5HS9 A;  3BLY A;  2EZL A;  5AIQ A;  1RR7 A;  5GPC A;  2RRE A;  4IO9 F;  3HPH A;  4KN4 X;  1BW6 A;  3BR6 A;  3ZOB A;  3H9Q A;  5K5Q A;  1ETK A;  3AKZ A;  3LA2 A;  4RBO A;  2L9S A;  2X85 A;  1PDN C;  2EIK H;  1WKM A;  3HRS A;  2GWR A;  4I02 A;  2KDZ A;  3OYF A;  2ZJP F;  5FLV A;  3V8J A;  3VDX A;  2EJR A;  3QOE A;  2E1M C;  1D5V A;  2L4M A;  3BR2 A;  1IXC A;  1I6H J;  4AD9 A;  4FT8 A;  2ID6 A;  2ZXW H;  2YX7 A;  3JRD A;  4UUT A;  2JZY A;  3EPZ A;  2VJ5 A;  4W1U A;  4Q5S F;  1PYV A;  3F22 A;  5C3E J;  2CO5 A;  3HSE A;  2VQG A;  4XIC A;  4XID A;  1W36 C;  3W2A A;  2R7U A;  3DF8 A;  4DOZ A;  3HKZ A;  3F6O A;  3S32 A;  2MC4 A;  4A5N A;  3DTK A;  5D4R A;  5KNL A;  4A69 C;  3E6M A;  4C3J J;  4KT6 A;  2V9K A;  2YX4 A;  2DJN A;  1A31 A;  2R7V A;  1EV7 A;  2GOM A;  2KRC A;  2EIM H;  2MFZ A;  3TW6 A;  5FB2 A;  3IAS 2;  2CV0 A;  2YU9 J;  1DGR M;  1O3S A;  4PJL A;  2HVR A;  3W6K B;  4QTR A;  1L0O C;  3QPH A;  4OIR F;  2KZV A;  2HWV A;  4UV9 A;  1KA8 A;  4RGX A;  1YG2 A;  1ENH A;  3ECH A;  2VI6 A;  3J81 Z;  5L3B A;  3BTI A;  2CG4 A;  3M4O J;  2QQA A;  1JHF A;  4UV8 A;  5KAF C;  2QSG X;  2M7A A;  5F1J A;  4FCY A;  2OV7 A;  4ZJZ A;  3K4K A;  4YEJ A;  5FKL A;  2VL8 A;  2ZFU A;  3UNG C;  1VQN I;  1JJ6 C;  1ZLJ A;  3CJT B;  3GX4 X;  1XGO A;  2CQK A;  3Q5F A;  5ICE A;  3D5R C;  1TWF J;  4CSW A;  1HBX G;  2G0E A;  3GEZ A;  3F8N A;  3K4N A;  4C3I J;  3A1Y A;  2QWW A;  4M6X A;  2QBY B;  4XLC A;  3DBL B;  3SEZ A;  3M07 A;  1ZGW A;  1W7P D;  2XGD A;  2W57 A;  2WY8 Q;  2OF7 A;  1FP2 A;  2GXA A;  2R92 J;  4GXO A;  2OTJ I;  2P5V A;  1ZHF A;  3LMM A;  1K4S A;  1XDU A;  2E34 A;  4IHW A;  4N9H A;  1HDP A;  3CCY A;  3HOW J;  1IW7 F;  4M6V A;  4IEJ A;  1YX5 A;  2IT0 A;  2ACJ A;  4HA8 A;  3E5X A;  3F8M A;  2JRT A;  3CUQ A;  5DCF A;  3BPV A;  5HS7 A;  5D6E A;  2XAU A;  4S04 A;  2DLL A;  4RLF A;  4LOC A;  3V8K A;  3FK6 A;  3FX3 A;  2MLG A;  3IH2 A;  1IAW A;  3WGI A;  3BPX A;  2QEX I;  1MSE C;  2HDC A;  2JSP A;  3GZ6 A;  1K83 J;  1Z3Y A;  1DGW Y;  1BI2 A;  1RNL A;  4CZZ A;  2L7Z A;  2X51 A;  2M0C A;  2XVC A;  4EJU A;  4HQE A;  5BOX A;  1VQK I;  3LQR A;  4N0B A;  3CCQ I;  4EMS A;  2XKO A;  4IF4 A;  1S7O A;  5GAH J;  3HOZ J;  5DV5 A;  1KZH A;  2MH9 A;  1ZLK A;  4DYC A;  4WK8 F;  2UWM A;  4XRS G;  2HOS A;  4EGY A;  4ZYE A;  2IS2 A;  2ELJ A;  2HI3 A;  2XV4 S;  3QYE A;  1OCP A;  4MNU A;  5DD8 A;  3DPU A;  1POG A;  1AKH A;  1Y8Q B;  4YG2 F;  4I7H A;  3B02 A;  1BIB A;  2PMH A;  2DW4 A;  3C18 A;  3TED A;  1TT5 B;  4CIC A;  2LKP A;  3KIO A;  2FBK A;  4Y15 A;  3D5L A;  3TW7 A;  3J7Y J;  2L7M P;  2KKO A;  1TNS A;  1IRZ A;  4RGR A;  1ETV A;  3DQV C;  5K7H A;  2LYC A;  5D8L B;  3BDD A;  2DTR A;  3DTI A;  2Y0S N;  1RR8 C;  5JR3 A;  3QOP A;  1RRJ A;  4AWX B;  2ZCW A;  5E8G A;  1NK3 P;  4A93 J;  4BHB A;  3M8F A;  4V2G A;  5KVR A;  1IGN A;  1FEX A;  2DK8 A;  5CKT A;  2CV2 A;  2V6C A;  2MAB A;  2X0L A;  2EB7 A;  1JKO C;  3HOU J;  1FZP B;  4BAY A;  3PUF A;  5IYC J;  3H92 A;  4BDY A;  1IDZ A;  4YII A;  1D3Y A;  2CGP A;  2B63 J;  1WPK A;  5EEG A;  4D7N A;  2AQF A;  3S1M J;  2PMU A;  1EKE A;  1BC7 C;  5H20 A;  2G9W A;  3F0C A;  3LST A;  1U5T B;  5ILV A;  5EG0 A;  1MBF A;  4IZZ A;  1SFU A;  2R5Y A;  3HSR A;  1UZC A;  1TTY A;  2CU7 A;  2LFB A;  3RYR A;  2BXZ A;  4HSR A;  2XAH A;  4DYQ A;  1AOY A;  4FIS A;  5LRS A;  1BI1 A;  3PSI A;  1O7L A;  3W6J B;  1HKQ A;  5J6X A;  1VQ7 I;  1FYL A;  1MH4 A;  2E1C A;  3FM3 A;  3I3L A;  2IA2 A;  1T8I A;  5EYR A;  3QAH A;  5E3N A;  2PJR B;  2Z9O A;  4E70 A;  3X2Q H;  2X6W A;  5TIS C;  1HKS A;  3KP5 A;  5EGO B;  2LDU A;  3FIW A;  2L7K A;  3ZRG A;  2CJJ A;  1KQ0 A;  4HV5 A;  4ZDL A;  5M3F J;  2X6Y A;  2OJE D;  2CUE A;  5HS8 A;  4D7M A;  5LHH A;  5L3G A;  2H27 A;  4FX4 A;  2COB A;  2WA0 A;  5CPR B;  4PJJ A;  3ZMS A;  1IRX A;  3HM5 A;  3WHB A;  3BWG A;  2YR2 A;  3BQZ A;  4A3K J;  2JJ7 A;  1FJL A;  3ABK H;  3FHN A;  4XK4 A;  4B1R A;  5C44 J;  2XF5 A;  3FXJ A;  4C2M J;  4HLY A;  2XHK A;  2MW8 A;  1XCB A;  1FT9 A;  3JSP A;  1R23 A;  4BE1 A;  4U87 A;  1XPX A;  2ECB A;  1IN6 A;  3FXR A;  3KLN A;  4GYG A;  1XGN A;  3G6E I;  2LH9 A;  2JTV A;  5F08 A;  2AHQ A;  4ZYG A;  1VI0 A;  1W0U A;  3L09 A;  3E0J B;  2V1X A;  1MBE A;  1EH8 A;  1F36 A;  4RLQ A;  3GTJ J;  5H6R A;  1XDS A;  2HYF A;  5IP7 J;  2X9D A;  3WG9 A;  3WTW C;  3BC8 A;  1R5I D;  6PAX A;  3MKZ A;  1R1U A;  1RI7 A;  2BE5 F;  3KEY A;  1Z91 A;  2DXI A;  3K7A J;  2FBI A;  3F8B A;  1QZY A;  1AA7 A;  2I10 A;  4L9T A;  2K4J A;  3OWT A;  4Y7N J;  1ZN2 A;  4ZYH A;  3L1P A;  2AXL A;  2BV6 A;  2DDB A;  2YU3 A;  4BAC A;  5LBQ A;  5BMZ A;  2CS3 A;  1Z0X A;  3F72 A;  2JUC A;  1W5S A;  2Y2Z A;  1V3F A;  4I01 A;  2XKP A;  2JPC A;  3ECO A;  4NQW B;  4CXF A;  1ETY A;  1K61 A;  5CVJ A;  1BA5 A;  3AG3 H;  1FBS A;  1LUJ B;  3TDU C;  3W2W A;  1BW5 A;  1W7P A;  2VOP A;  1R5G A;  2RQP A;  4L0Y B;  2FBH A;  2EK5 A;  3MKL A;  4PK4 A;  3VSK A;  5F04 A;  1FYK A;  4MQ9 F;  1X1D A;  4BS9 A;  3ZMU A;  2UZK A;  4G7O F;  2XB5 A;  2K40 A;  3GTQ J;  3DTE A;  2HR3 A;  4ABZ A;  4E6K G;  1S9H A;  4UB6 C;  1QHH D;  3HKZ N;  3QU6 A;  3HTU A;  4BGD A;  3M8E A;  2VBW A;  4R1H A;  3H0D A;  3CCR I;  2H1L A;  2HEO A;  3IH3 A;  3PJR A;  1JTY A;  2QGU A;  3SDG A;  1Z6R A;  1QZZ A;  1T0F A;  1Y8R B;  2EWN A;  3PQK A;  4MIM A;  3OYC A;  2JVG A;  5CVU A;  3JCU C;  1HDD C;  4ZZD A;  1VQL I;  4B09 A;  2LC2 A;  3RTR A;  1H89 C;  4M3B A;  2ID3 A;  2Y31 A;  2DMU A;  2CH0 A;  4O3M A;  1ZYR F;  2M9H A;  2FSW A;  3DKX A;  2E2I J;  2H8R A;  2R7T A;  4G8X A;  4HF2 A;  2XPU A;  4BKX A;  4U7B A;  3I56 I;  3E97 A;  4ZTJ A;  3BCB A;  3CUO A;  1WH5 A;  2ZSH B;  4F52 A;  5K7F A;  3I5U A;  5FKO A;  3K4J A;  1ZRD A;  2L7F P;  2FOK A;  5M5Y J;  1DQU A;  5E3O A;  1FWZ A;  2HS5 A;  2VOO A;  1NH3 A;  1QQI A;  4GFB A;  1DP7 P;  3KX2 A;  2D45 A;  1QA6 A;  5ED4 A;  5HOO A;  2VON A;  1Z3X A;  1C0W A;  4I98 B;  1B9M A;  2TDX A;  3K69 A;  4M9S A;  2X1D A;  2IGM A;  3BZC A;  4QPO A;  4UVC A;  1TL8 A;  2VQC A;  1UFM A;  5D5X B;  3JRB A;  2FNP A;  2VAS A;  1ZG1 A;  3S3N A;  3M3Y J;  4LG0 A;  1T2K A;  2EFN A;  1JGG A;  5EDN A;  1CF7 A;  1BOA A;  2A6E F;  1X3Z B;  2A68 F;  2K02 A;  2Z16 A;  2FMY A;  3VEP A;  3ZN0 A;  3TL4 X;  5J1U A;  1IUY A;  2B9S A;  3FXU A;  3EYY A;  4HPQ A;  4IQJ A;  2LVS A;  1TNT A;  2FQ3 A;  2GQQ A;  3CLO A;  1I3A A;  4HAM A;  2P8T A;  4B44 A;  2R93 J;  1ERD A;  1R7J A;  1LFP A;  1UEL B;  3BZ6 A;  2YPR A;  3ZPL A;  4ZTF A;  1MBH A;  1A36 A;  4BQQ A;  4QSH A;  2CUZ A;  5C4X J;  3OIO A;  1TZL A;  3U9G A;  5FKM A;  1BBY A;  1AKH B;  3FMR A;  2DFH A;  2WTE A;  2L54 A;  5FD5 A;  1D8K A;  3RKY A;  2YSR A;  2DPD A;  3JRG A;  2RC4 A;  4KIT B;  1IJW C;  3LAP A;  2P7C B;  1YS6 A;  1ETW A;  5IY5 H;  1A35 A;  3N97 A;  1OCT C;  3U21 A;  1SMT A;  3WG7 H;  3J80 K;  4FQG A;  4CCO A;  4WWC A;  1V5G A;  2O8X A;  5JHF A;  3H9G A;  3HEF A;  2E71 A;  2XUB A;  5DEQ A;  5DTD A;  1Y6I A;  1FIP A;  3RSN A;  5IYD J;  2KT0 A;  5HLH A;  2NNY A;  1FOW A;  1XB4 A;  4M71 A;  4RGS A;  1TBX A;  3MN2 A;  4RMN A;  2P6S A;  1SFX A;  4PJ0 C;  4XOR A;  1SC7 A;  2IS4 A;  2E5N A;  3D0S A;  4RM3 A;  1KQ9 A;  2PMZ A;  3BG6 A;  4CZC A;  1N77 A;  2A69 F;  2GLO A;  4IQ4 A;  3VB2 A;  3VOD A;  2HTJ A;  1RIO H;  2IRF G;  3ZQ7 A;  4JP0 A;  3GF2 A;  4NDL A;  2NNN A;  1JTX A;  4CUG A;  1MGT A;  5J40 A;  1ZH5 A;  2Y0M A;  4B8X A;  3HRT A;  2WAE A;  3R61 A;  2JUG A;  3KYC B;  5ICF A;  4C2U A;  2XPV A;  2CRG A;  1SVL A;  4CDG A;  1O7F A;  1QHG A;  1Y0N A;  2MLK A;  3Q9S A;  2ZME A;  1VQO I;  2Z2S B;  5M3M J;  2Q1Z B;  3OS0 A;  2IBD A;  1B8I A;  2FUG 2;  1FOK A;  1JKP C;  3H3U A;  3S2H J;  4IOC F;  2L3D A;  1MSF C;  3LL7 A;  1D8J A;  3JAM K;  4OIN F;  3R0J A;  2BOL A;  3D5S C;  3KZI C;  2O5R A;  2VUM J;  1QNT A;  3OY9 A;  1KON A;  3A01 A;  3L9F A;  2CV1 A;  4PUS A;  3CC4 I;  4A6D A;  2LR8 A;  4M3F A;  1OR7 C;  5B66 C;  4GRI A;  1HC8 A;  2WAF A;  3HC7 A;  3W2V A;  4I09 A;  2JA7 J;  4W97 A;  2HZD A;  3CDH A;  1R4N B;  1IC8 A;  2ZXJ A;  2V4J C;  1KYW A;  2X48 A;  2XGC A;  2K5C A;  1P2F A;  3HOV J;  1BC8 C;  4O6J A;  1TWG J;  3LWF A;  1G2H A;  2IXS A;  4M74 A;  4E7L A;  3CCV I;  2KIU A;  1P4X A;  2M34 A;  2Z1D A;  2IS6 A;  1XGM A;  4BH9 A;  2KLO A;  3FK7 A;  2HYJ A;  1J7K A;  2EV6 A;  3R0A A;  1WCM J;  1YE9 A;  2Y30 A;  3UR3 C;  2OZU A;  2NVU B;  2COM A;  2Q8K A;  5LD2 C;  2NVQ J;  3FKJ A;  5GAE J;  5DUI A;  2X1E A;  3WTU C;  3RPU D;  1I50 J;  2XB0 X;  2VB6 A;  3K6G A;  2R7R A;  1GXP A;  3ZQG A;  3S17 J;  2QA4 I;  1N78 A;  3S15 J;  2K4B A;  5ILS A;  2KHM A;  2Y69 H;  3DFG A;  1K6O A;  4Z6Y A;  2VE9 A;  3C3W A;  3I55 I;  2DBB A;  3L00 A;  2PI0 A;  2F6C A;  3H3Z A;  2AXT C;  3ZGK A;  2XSD C;  3JRH A;  1WJF A;  1Z05 A;  4Y17 A;  2KIF A;  2R7W A;  2MG4 A;  2ESH A;  1LFB A;  4UUV A;  3HGG A;  2R7S A;  1VQ6 I;  3HGY A;  4ENM A;  2WB1 A;  3R6S A;  2DT6 A;  3H35 A;  3FKI J;  2NVX J;  1IN7 A;  5F0F A;  4I0A A;  1T6S A;  5FLX Z;  4BJ6 C;  1B72 B;  5D8K B;  3C2G A;  4Y3O A;  4PFP A;  5DM6 F;  2GZW A;  4JK1 X;  3CJQ B;  1MMN A;  2L2O A;  4KIF A;  2HOE A;  2LF8 A;  4P5O A;  3I71 A;  3OYB A;  2V6E A;  3BT9 A;  1TQP A;  1PJR A;  2OBP A;  2IGK A;  4LLL A;  3K1P A;  1U8B A;  2QBY A;  3OR1 C;  3JSO A;  4J01 A;  5FRO A;  1JKQ C;  4UVB A;  5L3D A;  2JVH A;  5BQT A;  2OA4 A;  2N8G A;  4F92 B;  3G73 A;  1UG2 A;  1Z77 A;  2GBY A;  5L3F A;  2E35 A;  1D1A A;  4LD5 A;  5GPA A;  4M3D A;  2CQN A;  2RAE A;  3OYN A;  1PP7 U;  1IN4 A;  3RKX A;  4XSZ F;  2XF7 A;  2Z5U A;  4DZP A;  2ZME C;  2LG4 A;  1XS9 A;  2AQE A;  5FO5 A;  5IT9 K;  1Z1D A;  3F8C A;  2ZFW A;  1TP4 A;  2FD5 A;  3BG3 A;  3KP3 A;  2W4S A;  4BXF A;  5F27 A;  1CF7 B;  1W1W E;  3C2H A;  3CP8 A;  4KYW A;  3S14 J;  3E5Q A;  3GXO A;  1HA8 A;  3MKY B;  3MZH A;  5FFZ A;  3HZJ A;  3KYD B;  1PVE A;  5H2F C;  4HYE A;  1GHC A;  1QVT A;  2RQQ A;  4UNO A;  2MH2 A;  4A3G J;  1A6Q A;  4BBS J;  4CCN A;  3JRA A;  2E19 A;  3ZN1 A;  2HNH A;  3BQY A;  3MQ0 A;  3TO9 A;  3COA C;  4LG0 B;  1WJA A;  2BYV E;  4OIP F;  3A4C A;  1DPU A;  4ANJ A;  1PUE E;  2R7D A;  2WAQ N;  3BJ6 A;  4F3Q A;  5K5R A;  1WZ2 A;  4A3D J;  2PEX A;  3S16 J;  1XG1 A;  2HVQ A;  1OYI A;  1SD6 A;  2EZI A;  3HUG A;  4CHU A;  1APL C;  3KP4 A;  5BPD A;  2BHY A;  3IP4 B;  2EH3 A;  4D5F A;  1YIJ I;  4QPQ A;  1E0E A;  1U0J A;  1YW9 A;  4DGW B;  2D1H A;  2A6H F;  3KZZ A;  2NXN B;  5D5U B;  3AG4 H;  1ETX A;  1JHH A;  3DV8 A;  1IDY A;  3CMY A;  3IKT A;  2XAJ A;  2H09 A;  3BR0 A;  2BVL A;  4OWR B;  4I6Z A;  2IAI A;  1GT0 C;  3M9A A;  2DT7 B;  2LK2 A;  3NRV A;  4BJT A;  5LFA A;  2DOD A;  1IRF A;  1LJ9 A;  2HPI A;  4WX9 A;  3N4M A;  3JRE A;  1ITY A;  4LIV A;  3KPH A;  2PX9 A;  3AAF A;  2STT A;  2DFF A;  2GIV A;  2ICW G;  5CJ9 A;  1WGX A;  4XLE A;  2KL4 A;  1GV5 A;  3F23 A;  3LNQ A;  4ESJ A;  1D1C A;  2I5U A;  1J9I A;  3CCM I;  3A2K A;  4OAZ A;  2STW A;  1W5T A;  4A3B J;  5IPA A;  1EH7 A;  3O8H A;  1U78 A;  4YIF A;  2ZNY A;  4A3E J;  3HRU A;  4KIC A;  2V9P A;  2ADU A;  3TGN A;  2DDA A;  2PN6 A;  3U1D A;  4HF0 A;  4MTE A;  3FXO A;  1K7A A;  3NWS A;  3GFI A;  1HLV A;  5LGU A;  2ZO4 A;  4PZJ A;  1Y1W J;  2R5Z B;  1MJ9 A;  4IKF A;  3L2R A;  2W48 A;  1Y56 A;  2EIN H;  2JWT A;  2NVT J;  2DPU A;  3DPL C;  3I59 A;  4WXD A;  3FDY A;  4GCV A;  4WF2 A;  2VJJ A;  4E7Z A;  1K78 B;  1V5F A;  4XKC A;  4DNC A;  2CFO A;  1OIS A;  3TOA A;  4Q4Z F;  1KU9 A;  3H36 A;  1HOM A;  1IN5 A;  1JKR C;  1IUF A;  1X4O A;  1D5Y A;  2KZG A;  4WXH A;  3J7Z I;  1CQT A;  1MKM A;  1H9T A;  5FJ8 J;  1MMD A;  1ORK A;  4ESF A;  3KP7 A;  5E17 F;  2LBF A;  4MTD A;  2FF4 A;  3GFM A;  2P5L C;  1BM9 A;  4E7K A;  1XMK A;  4IHT A;  2VOD A;  3SZP A;  4HBL A;  2EV0 A;  2DMQ A;  4BXU A;  2BW3 A;  4D5C A;  1HXD A;  1G6N A;  1HW1 A;  5FFX A;  1VTN C;  2M2E A;  4B43 A;  4IXA A;  2LD5 A;  4HST A;  4N9I A;  3E6D A;  4AC0 A;  2KJC A;  3CLQ A;  1USS A;  2K86 A;  1X1C A;  2VBZ A;  2DTZ A;  3WHC A;  1SMY F;  3BTJ A;  2ZJQ F;  3DU6 A;  3KZY A;  2W00 A;  5FD6 A;  5ICC A;  1UG0 A;  4JOM A;  1YJW I;  2VJ4 A;  3CC7 I;  2CW0 F;  2M45 A;  3BG7 A;  5TJJ A;  4A3L J;  4NNJ A;  5JLX A;  3BP8 A;  2XC7 A;  2IS1 A;  3NAU A;  4ZC3 A;  2CMP A;  4ZYA A;  2M3A A;  2W82 A;  3ABL H;  1QRY A;  2OC6 A;  3HL2 A;  4I99 C;  1QU3 A;  3Q9V A;  3SFI A;  5E3M A;  3WGH A;  2LSO A;  5D6F A;  3ZQL A;  1R71 A;  3TDZ C;  3DKY A;  3GZ5 A;  1X1P A;  2QEN A;  1W7P B;  2P0W A;  3PO3 J;  4JYK A;  5FLM J;  3BJA A;  3BR3 A;  3PM1 A;  2QKL B;  2X4H A;  3O6B B;  1VQ9 I;  5ERI A;  4JX6 A;  4XM3 A;  4I2O A;  2F4I A;  3LOC A;  3MAJ A;  3SZT A;  3HTS B;  4G6D A;  1ZKG A;  1B72 A;  1KYZ A;  2RNG A;  1HF0 A;  1W36 D;  4LMY A;  4BXX J;  2LY9 A;  4D1Q A;  2VPL A;  2DQL A;  1NG7 A;  2FU4 A;  2MYS A;  4N4O B;  1ZAR A;  2UV1 A;  2NYX A;  2O8K A;  1PUF A;  1R1T A;  2ZSI B;  2DA6 A;  4MHG A;  2M0M A;  4D0P A;  1FYM A;  5JI6 A;  1I3Q J;  2Q2E A;  1A5J A;  2ZBK A;  3IRQ A;  2GM4 A;  2A6T A;  4BNC A;  1JUP A;  3NEU A;  3ROU A;  2BEO A;  4ENK A;  1J09 A;  3E1S A;  3L2U A;  3IWZ A;  3BOQ A;  4EJW A;  2K3P A;  4LFU A;  2PFB A;  4S0H B;  1FBQ A;  1P7J A;  3CUQ B;  3UKG A;  3CTA A;  3I64 A;  2RDP A;  2F4M B;  3S2W A;  2ISY A;  5K5O A;  2DYS H;  4EAT A;  2K7L A;  4G7Z F;  3MFK A;  3CO7 C;  1IV6 A;  5EJC A;  4OMY A;  4M9Z A;  2DA3 A;  3LSJ A;  5DCM B;  2O03 A;  1OLT A;  3OYJ A;  3OS1 A;  1MBG A;  4OIQ F;  3T8T A;  3PUB A;  2BXY A;  2QVO A;  1Z21 A;  3O2P E;  4LK0 F;  1XSX A;  4UY8 I;  1I5Z A;  2ELH A;  3PFI A;  4U88 A;  3CMM A;  1WFX A;  4A6E A;  4CYC B;  1O3Q A;  1DPR A;  5GAG J;  4UB8 C;  1IV8 A;  3MWM A;  1I6X A;  4L0Z B;  2PMZ N;  3NWT A;  4BYY A;  4L9N A;  3GTP J;  1FIA A;  4DW6 A;  1LE8 A;  3E7L A;  3GO5 A;  2HYG D;  1YO5 C;  4C3H J;  2QUF A;  3TKY A;  1SD7 A;  2KDO A;  3Q0W A;  5BPI A;  2KRH A;  4RAF A;  3SXY A;  2WWY A;  1Z9C A;  1B9N A;  1RUO A;  3LSK A;  1J2X A;  5HLI A;  2DO7 A;  4A5M A;  4DYR A;  1I39 A;  1U8R A;  4EJO A;  3VWB A;  3HIF A;  2CWE A;  3OYI A;  1IO2 A;  2WB1 N;  2Z3Y A;  3OSG A;  3VYT B;  2WV0 A;  1E17 A;  3IWF A;  1WWX A;  2HGC A;  1LQ1 A;  1TWA J;  1RUN A;  1GUU A;  4F7Z A;  2CUJ A;  2A05 A;  4PDK A;  2F2E A;  3B6A A;  3EUH A;  1I1S A;  5B3S H;  2MD0 A;  4P96 A;  3IV5 A;  2JN6 A;  4FTH A;  1YX3 A;  1PP8 F;  4X6A J;  1U5T A;  1YHQ I;  5LGN A;  1REP C;  2X6X A;  5GTH C;  2A61 A;  2HQR A;  4KUM A;  3VFZ A;  1G3W A;  4V19 K;  1YW8 A;  4QWQ A;  5KAI C;  2EA4 A;  4L5J A;  1OYW A;  4L18 B;  2VKD A;  2IA0 A;  2R7O A;  3IC7 A;  3OS2 A;  2JA6 J;  3GLX A;  1B8I B;  1WRJ A;  1Z7L A;  3PSF A;  2LTP A;  3FM5 A;  4QIW N;  4MFD A;  2OTL I;  2CQ7 A;  3RQ4 A;  3K4C A;  4ETS A;  1T39 A;  2E2H J;  3V4G A;  5EGO A;  2EA2 A;  5C4J J;  2EFP A;  2PLY A;  1FMV A;  3DEW A;  1FSH A;  1SVM A;  1X58 A;  2M1B A;  5LLQ A;  1X19 A;  1RPW A;  3OIQ A;  2DFI A;  4EM2 A;  4CGZ A;  3WGG A;  2YUS A;  3BG5 A;  3RI4 A;  3HBL A;  3CJN A;  5LEK A;  3C1D A;  5J47 A;  2PQ8 A;  1UCR A;  3FXL A;  2BW3 B;  3HXL A;  3KE2 A;  1FLI A;  2EFQ A;  1T98 A;  5ILU A;  3QPT A;  4Q48 A;  1TC3 C;  3TMO A;  2W84 A;  4HEA 2;  2QLZ A;  5JLW A;  4HOB A;  2BBY A;  3F21 A;  3M8J A;  1J5Y A;  2QM3 A;  4P9F A;  4M6Y A;  4R8H A;  3BG9 A;  5JVG F;  2JPB A;  4UUS A;  3MZY A;  3LA3 A;  1R00 A;  3M1C A;  2Y0S A;  2DA2 A;  4G9Y A;  4HNT A;  2MA3 A;  3OIP A;  4B47 A;  4NC7 A;  2KQR A;  3KLO A;  1WHU A;  3ONQ A;  3G71 I;  1SEU A;  1WVR A;  2HTS A;  1EA3 A;  2DOE A;  2DMN A;  3ZMZ A;  2WBM A;  3HPG A;  3DWL E;  3I4P A;  1F5T A;  2X6O A;  4BY1 J;  4IRG A;  4BUP A;  3NAR A;  3WTX C;  1HCR A;  1LDJ A;  2RNJ A;  3K70 D;  3U2R A;  4XSX F;  3S8P A;  3WE2 A;  1UHM A;  1SVO A;  3CQZ J;  1R6R A;  5L3C A;  1AWC A;  3L2C A;  2X1C A;  1S8N A;  2E1O A;  1WI9 A;  1YYV A;  3G1O A;  4I76 A;  1W5C C;  2HXO A;  2CW8 A;  2XAG A;  4HW0 A;  2V79 A;  4J19 A;  4PGH A;  1YTY A;  1Z7U A;  1UB9 A;  4ITV A;  1IXR C;  1OFC X;  4U7D A;  3JRI A;  1ON2 A;  4CH7 A;  5IT9 Z;  1TW3 A;  1MH3 A;  4ON0 A;  2Q0O A;  2K9M A;  1M1E B;  4U0V A;  3ZQC A;  2EIL H;  2JRM A;  5B1B H;  1MD0 A;  2J5O A;  2BY0 A;  3LSH A;  1ZAO A;  2Y9Y A;  1T33 A;  3WTS C;  1VFC A;  3CDL A;  1Q1V A;  1E3H A;  1STZ A;  3P9I A;  4RAZ A;  4XN3 A;  2A3S A;  2FQ4 A;  1QVU A;  4RAY A;  1T08 B;  4RB3 C;  2W85 A;  4RGU A;  1SAN A;  3K1N A;  3T0Y A;  4HLX A;  1ZGJ A;  3LAJ A;  4G7H F;  2O3F A;  3LA7 A;  2R7F A;  5E1X A;  3I4M J;  4CO8 A;  1RET A;  3ZMT A;  2IGO A;  2Z99 A;  2VKH A;  4XKB A;  2GA2 A;  4YFN F;  3GCM A;  3LSR A;  2LRD A;  3DLA A;  3ULQ B;  4GGG A;  2L9V A;  3RIR A;  4HDV A;  4A3C J;  2XF6 A;  2XRO A;  2K9N A;  1B6A A;  1R1V A;  4XRF A;  2Q2E B;  4RM2 A;  4BEH B;  2GIZ A;  3HOT A;  3L2Q A;  3K4B A;  2E1M B;  4MFE A;  1E2X A;  5DCM A;  1ON1 A;  2XAQ A;  3CUQ C;  4Y4R A;  4BEH A;  4GYI A;  1U6G A;  1K79 A;  3LSP A;  3FZV A;  2OQR A;  3H5A A;  4MQV A;  2BY2 A;  4NC6 A;  4F93 B;  3PIP F;  2GXB A;  2AO9 A;  1SD5 A;  3SQN A;  3AFH A;  3QP5 A;  2VQL A;  4P55 A;  2LRE A;  5LHG A;  3S1Q J;  4YIR X;  3BR1 A;  1LVA A;  3FIS A;  1X1A A;  3TP3 A;  1U2W A;  3T5X A;  3CC2 I;  4IHX A;  2DOF A;  1IF1 A;  1WJE A;  3CD6 I;  4FX0 A;  1H9G A;  5AON A;  3CJR B;  4XRS A;  2BVM A;  2HZT A;  2FOW A;  4AYB A;  2Y48 A;  2FEZ A;  5M5W J;  4BJ5 C;  2ZXH A;  3HUG B;  4D9J A;  1BN5 A;  4XL9 A;  3GTL J;  5K1Y A;  3JTH A;  1EJ9 A;  2DMP A;  4Y13 A;  1KU2 A;  5E79 C;  1IZ1 A;  1QO0 D;  3OYG A;  1OPC A;  2KP6 A;  1MMG A;  1HQC A;  2G7U A;  4HF1 A;  1X4P A;  3AG1 H;  3QYF A;  4A3I J;  4M72 A;  4CCK A;  5E1W A;  1P92 A;  1CGP A;  4PSW A;  3HHG A;  3G1M A;  5J1Y A;  3K0L A;  2ZXI A;  3TBI A;  2XPW A;  3H3V K;  5E20 A;  1G59 A;  3SYT A;  5CQE A;  3LSM A;  2V9V A;  3OMY A;  3DCF A;  1MNE A;  3L2W A;  3HB9 A;  1QZE A;  2MD5 A;  3Q3S A;  1MMS A;  4HNU A;  2CSO A;  1Y39 A;  3GYH X;  1TQM A;  3IHU A;  4AU7 A;  3WTV C;  2OD5 A;  3A0B C;  3GLL A;  2I8D A;  1S29 A;  2M4K A;  2F5F A;  2Y9Z A;  4FET A;  5D5W B;  1D1B A;  1MDM A;  3ESW B;  5F0H A;  3HSF A;  1K78 A;  3G3Z A;  3CCS I;  1XTA A;  3ABT A;  1LKX A;  5BNG A;  4KIS A;  1P4W A;  5E1Z B;  3GUD A;  2ZJ2 A;  1UST A;  4OOI A;  2R5Z A;  3AL0 C;  3DEU A;  2GOX B;  3RPQ A;  5HLG A;  4R79 A;  4Y52 J;  2O0Y A;  1NK2 P;  3G1L A;  4KMF A;  3VSL A;  3W3C A;  2L9R A;  2LBF B;  3QQA A;  1LVK A;  3JRF A;  5F1R A;  1P4A A;  1XMX A;  2MGQ A;  4XON A;  4AYB N;  4EQQ A;  3V7R A;  1YRN B;  1LDK B;  3IRR A;  4ASN A;  4Z2Y A;  4EM1 A;  4KA4 A;  1WQ2 A;  1VQ8 I;  3J80 Z;  1FOX A;  2O61 A;  2OCE A;  1JUM A;  3FF5 A;  5CVI A;  3QWL A;  2UXN A;  2UXX A;  3EDP A;  1V4R A;  5EEH A;  5F0C A;  1JT6 A;  3JTG A;  3ML6 A;  5M5X J;  3B6C A;  1FOY A;  1TQI A;  3R4K A;  3OV8 A;  4XNF A;  1R22 A;  1UJ8 A;  4JX5 A;  4FHT A;  5HNH A;  1EH6 A;  5EEA A;  3EUK L;  1YOV B;  2IP2 A;  4EEF G;  2QCO A;  2R3S A;  4KFC A;  1MBK A;  4NBQ A;  4X1E A;  3I4N J;  1EF4 A;  1TW2 A;  3DXJ F;  4MO7 A;  3O8G A;  1FP1 D;  3DBR B;  2EIJ H;  2ZNZ A;  3GFJ A;  1L3L A;  2ZKZ A;  2DI3 A;  5J4V A;  4BL0 B;  4F55 A;  3B73 A;  2HOA A;  1JE8 A;  3K70 C;  4ENJ A;  3KCC A;  1B1B A;  4E7S A;  4NC8 A;  2B7E A;  2ZB9 A;  4OMZ A;  5EF6 A;  1BJA A;  1KU7 A;  1GVJ A;  4O5V A;  4BDZ A;  1P7I A;  3IL2 A;  4LGW A;  1O3R A;  3RYP A;  2B0L A;  3KEQ A;  3TP0 A;  2VLA A;  2L5Q A;  3TO6 A;  4XLF A;  1S7A A;  1S7E A;  2ELK A;  2RVC A;  1KU3 A;  1NHA A;  1Y0U A;  4II2 A;  3PL8 A;  3GBG A;  4IRH A;  1T38 A;  3CO6 C;  1HKT A;  3E6B A;  1SAU A;  3K10 A;  3PNY A;  2NS0 A;  3GW2 A;  2JSC A;  2VBX A;  1SFK A;  1NTC A;  1TT0 A;  2OAZ A;  4GDF A;  3EUH C;  4YRV A;  3OYK A;  1OMI A;  2DAO A;  5GP9 A;  2LOO A;  4C2T A;  5TRD A;  3FMQ A;  3ABU A;  1IRG A;  1DP3 A;  1OQY A;  2H8W A;  3KET A;  2NOJ B;  1ZEL A;  4XMY A;  2UUZ A;  3C7J A;  1ULY A;  2F48 A;  3CME I;  2EQR A;  1D0X A;  3ZP5 A;  1UMQ A;  2KIQ A;  2VPR A;  4LIU A;  2LP0 A;  3RZO J;  1R58 A;  1OJL A;  3G2B A;  2NAZ A;  2VKE A;  3K4M A;  2DOA A;  4N4N B;  1MIJ A;  5CLS A;  2K9S A;  4A3M J; 
#chains in the Genus database with same CATH homology
 3ZQH A;  4GFB A;  4S0H B;  1P7J A;  3S2D J;  3UKG A;  4G12 A;  2D5V A;  1E3O C;  3JRB A;  2LKX A;  3Q0U A;  3RKQ A;  2HDD A;  3M3Y J;  5FKK A;  1JGG A;  1IV6 A;  5EDN A;  1LFU P;  2DA3 A;  4CYC A;  3LSJ A;  3BTC A;  1MBG A;  2DA4 A;  5J1U A;  3GTG J;  2HXI A;  5E3O A;  4CYC B;  2LVS A;  1Y1V J;  4MLO A;  4V2F A;  2R93 J;  1H8A C;  2PMZ N;  4BBR J;  3GTP J;  1FIA A;  4DW6 A;  1MBH A;  1LE8 A;  3E7L A;  2ME0 A;  4C3H J;  4QSH A;  4L5E A;  5K7Z A;  5C4X J;  3OIO A;  2QF7 A;  3Q0W A;  5FKM A;  1AKH B;  2JA5 J;  3JRG A;  1H88 C;  1IJW C;  1ETW A;  4DYR A;  1ZTR A;  1OCT C;  1VF9 A;  2DA7 A;  2WB1 N;  3OSG A;  2TCT A;  1U9N A;  1TWA J;  1GUU A;  5DTD A;  3HEF A;  1FIP A;  5IYD J;  3B6A A;  2KT0 A;  1RES A;  2NS8 A;  1WH7 A;  3PO2 J;  1DU6 A;  2HOT A;  5DS9 A;  3LSG A;  1ZK8 A;  3MN2 A;  3IV5 A;  2JN6 A;  3D1N I;  4FTH A;  1RKW A;  4X6A J;  1GV2 A;  1X2M A;  1O4X A;  4A3J J;  3IH4 A;  2NOG A;  2GLO A;  3SJM A;  4JP0 A;  4NDL A;  2EZK A;  1JTX A;  5HOD A;  2JA6 J;  1B8I B;  3HDD A;  2XPV A;  2CRG A;  2ME6 A;  5J1R A;  3S1N J;  1ZR2 A;  1TWC J;  2LTP A;  4QIW N;  4MFD A;  1T56 A;  5M3M J;  5IOY A;  1A6I A;  1WI3 A;  2M8G X;  5J3L A;  5EG0 B;  1DU0 A;  2IBD A;  1B8I A;  2E2H J;  5EGO A;  2EZL A;  1JKP C;  3S2H J;  5C4J J;  1RR7 A;  2XRL A;  5GPC A;  1SFO J;  1BW6 A;  3BR6 A;  5IYB J;  3DEW A;  3ZOB A;  1ETK A;  1MSF C;  3GTM J;  4A3F J;  3GTK J;  4RBO A;  1F43 A;  1ZR4 A;  1X58 A;  3VPR A;  1RPW A;  2VUM J;  2R7Z J;  2KDZ A;  3A01 A;  3OSF A;  1QPI A;  5FLV A;  2YUS A;  3BG5 A;  3HBL A;  2LR8 A;  4M3F A;  3BR2 A;  1I6H J;  2ID6 A;  4RDU A;  2JA7 J;  2EZH A;  3JRD A;  3BTL A;  4UUT A;  4W97 A;  4W1U A;  1TC3 C;  1IC8 A;  1U9O A;  2X48 A;  5JLW A;  2XGC A;  5C3E J;  3HOV J;  4XIC A;  4XID A;  3BG9 A;  1TWG J;  4UUS A;  1G2H A;  4DZJ A;  2DA2 A;  2NS7 A;  2LLK A;  2M34 A;  3A02 A;  5EZG A;  4A69 C;  3FK7 A;  4C3J J;  2HYJ A;  2DJN A;  2DMN A;  1WCM J;  3TW6 A;  2Y30 A;  4BY1 J;  2X6O A;  3NAR A;  1HCR A;  2NVQ J;  2YU9 J;  4QTR A;  1I50 J;  2XB0 X;  3CQZ J;  2EBI A;  3K2A A;  1ENH A;  3ZQG A;  2E1O A;  3S17 J;  3G1O A;  4I76 A;  3S15 J;  2VI6 A;  2HXO A;  3BTI A;  2DMT A;  2DA5 A;  3M4O J;  4J19 A;  2K9Q A;  4BY7 J;  2H1K A;  1OFC X;  5F1J A;  4FCY A;  3S1R J;  2XSD C;  4FE7 A;  3JRH A;  3JRI A;  5EZH A;  2MG4 A;  5IP9 J;  5FKL A;  3MVP A;  1LFB A;  3HGG A;  1JJ6 C;  3HGY A;  2O9L A;  1MH3 A;  3JRC A;  3FKI J;  1TWF J;  3ZQC A;  2NVX J;  2G0E A;  5F0F A;  1FTT A;  3OOU A;  1B72 B;  4C3I J;  3RQI A;  1X2N A;  4B4C A;  1ZGW A;  2Y9Y A;  2OPT A;  1T33 A;  2XGD A;  1GDT A;  3BT9 A;  1VFC A;  3CDL A;  1Q1V A;  2OF7 A;  1U8B A;  2FQ4 A;  1QVU A;  2R92 J;  2WV1 A;  1SAN A;  2O7O A;  1JKQ C;  2N8G A;  1UG2 A;  1Z77 A;  4M3E A;  2GBY A;  2E2J J;  2ECC A;  1HDP A;  3CCY A;  5GPA A;  4IHW A;  3HOW J;  4M3D A;  3I4M J;  1RET A;  4M6V A;  2RAE A;  4IEJ A;  3BR5 A;  4DZP A;  2MSY A;  1VND A;  3LSR A;  1XS9 A;  4A3C J;  2K9N A;  4LOC A;  3FK6 A;  2FD5 A;  3BG3 A;  4IHY A;  1GVD A;  3IH2 A;  2R0Q C;  5F27 A;  1MSE C;  3H0G J;  4MFE A;  3HOY J;  3S14 J;  1K83 J;  2DN0 A;  2FJ1 A;  1MNM C;  2L7Z A;  2M0C A;  1ETQ A;  3LSP A;  1QVT A;  4HNV A;  1ETO A;  2AO9 A;  4A3G J;  4BBS J;  1W0T A;  3HOZ J;  3S1Q J;  3JRA A;  3BR1 A;  2E19 A;  4DYC A;  3BQY A;  4XRS G;  3FIS A;  2HOS A;  1MBJ A;  3TP3 A;  1LE8 B;  2HI3 A;  2WAQ N;  4A3D J;  1OCP A;  4IHX A;  3S16 J;  1XG1 A;  1POG A;  1AKH A;  2EZI A;  1APL C;  3TED A;  2EH3 A;  4D5F A;  3RZD J;  4XRS A;  1ZQ3 P;  2HQ5 A;  3TW7 A;  5M5W J;  2L7M P;  1IRZ A;  1ETV A;  1ETX A;  5K7H A;  1IDY A;  3CMY A;  2Y0S N;  1FTZ A;  3GTL J;  3BR0 A;  2DMP A;  1NK3 P;  2JA8 J;  3QPL A;  4FE4 A;  4I6Z A;  4A93 J;  2IAI A;  4V2G A;  2XGE A;  1GT0 C;  1IGN A;  2LK2 A;  1FEX A;  3JRE A;  4A3I J;  1ITY A;  1JKO C;  3HOU J;  3G1M A;  5J1Y A;  5IYC J;  1IDZ A;  2B63 J;  1WGX A;  2XPW A;  1WPK A;  4D7N A;  3H3V K;  1GV5 A;  2FX0 A;  3LNQ A;  2R5Y B;  3S1M J;  2YS9 A;  3DCF A;  3HB9 A;  4A3B J;  5IPA A;  3F0C A;  3O8H A;  3Q3S A;  1U78 A;  9ANT A;  4A3E J;  5EG0 A;  1MBF A;  4B3A A;  2R5Y A;  2CU7 A;  4DYQ A;  2LFB A;  4XRM A;  1BJZ A;  2Y9Z A;  2NVY J;  1HLV A;  4FIS A;  1Y1W J;  2R5Z B;  5F0H A;  2W48 A;  2JWT A;  2L0K A;  2NVT J;  1MH4 A;  5BNG A;  4IHV A;  5EYR A;  5IP6 A;  5E3N A;  3A01 B;  3QPS A;  2R5Z A;  2K9S A;  5EGO B;  4Y52 J;  1NK2 P;  3FIW A;  3G1L A;  2CJJ A;  5M3F J;  1HOM A;  2L9R A;  1IG7 A;  3QQA A;  2CUE A;  1IUF A;  3JRF A;  1JKR C;  1D5Y A;  4AYB N;  5FKN A;  2MGQ A;  4D7M A;  1YRN B;  1CQT A;  2COB A;  5FJ8 J;  1ORK A;  3HM5 A;  3WHB A;  1FJL A;  3BQZ A;  4A3K J;  2JJ7 A;  1JUM A;  4XK4 A;  1AU7 A;  4B1R A;  5C44 J;  4C2M J;  2JK3 A;  1YRN A;  2MW8 A;  5F0C A;  1JT6 A;  2DMQ A;  5M5X J;  2ECB A;  3B6C A;  4D5C A;  3ZQI A;  4JX5 A;  5F08 A;  2AHQ A;  2JMW A;  2M2E A;  1W0U A;  1VI0 A;  5EEA A;  2CQQ A;  1XC5 A;  1MBE A;  1F36 A;  3GTJ J;  4EEF G;  2QCO A;  2LD5 A;  4AC0 A;  1MBK A;  4UUS B;  4X1E A;  3I4N J;  1EF4 A;  5IP7 J;  4MO7 A;  2DA1 A;  3O8G A;  2X9D A;  2DTZ A;  3WHC A;  5E3L A;  2VKV A;  3W6V A;  3BTJ A;  3K7A J;  4Y7N J;  2HOA A;  2I10 A;  1R9T J;  3L1P A;  2ZB9 A;  5EF6 A;  3JR9 A;  1Z0X A;  4A3L J;  2P81 A;  4AUX A;  2Y2Z A;  1P7I A;  1AHD P;  5JLX A;  3A03 A;  3NAU A;  3C2B A;  1ETY A;  1K61 A;  1BA5 A;  3TP0 A;  1RKT A;  4M3G A;  1BW5 A;  2IEK A;  3GTO J;  1QRY A;  4JX4 A;  3MKL A;  1S7E A;  1JUS A;  2ELK A;  3SFI A;  5E3M A;  3ZQL A;  5F04 A;  3GBG A;  3Q0V A;  2XB5 A;  2K40 A;  3GTQ J;  2CUF A;  3PO3 J;  4ABZ A;  4JYK A;  3ZQF A;  5FLM J;  3HKZ N;  3BR3 A;  3PM1 A;  1JT0 A;  1BL0 A;  1NTC A;  1UHS A;  4JX6 A;  3IH3 A;  1JTY A;  3LOC A;  5GP9 A;  1JJ8 C;  3SDG A;  1ZKG A;  4MIM A;  1B72 A;  1HDD C;  1HF0 A;  4BXX J;  2LY9 A;  1H89 C;  4M3B A;  2ID3 A;  2EQR A;  2Y31 A;  1UMQ A;  2O8K A;  2DMU A;  2TRT A;  2VPR A;  3HOX J;  1PUF A;  2DA6 A;  5IOZ A;  2LP0 A;  2M9H A;  2E2I J;  3RZO J;  2H8R A;  1I3Q J;  1A5J A;  1OJL A;  2XPU A;  4BKX A;  2CQX A;  2VKE A;  1WH5 A;  1TWH J;  5K7F A;  1PUF B;  2GM4 A;  5FKO A;  1JUP A;  2L7F P;  5M5Y J;  4A3M J; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...