1I59A

Structure of the histidine kinase chea atp-binding domain in complex with adpnp and magensium
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
188
structure length
180
Chain Sequence
SHMVPISFVFNRFPRMVRDLAKKMNKEVNFIMRGEDTELDRTFVEEIGEPLLHLLRNAIDHGIEPKEERIAKGKPPIGTLILSARHEGNNVVIEVEDDGRGIDKEKIIRKAIEKGLIDESKAATLSDQEILNFLFVPGFSTKRGVGMDVVKNVVESLNGSISIESEKDKGTKVTIRLPLT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords CHEMOTAXIS PROTEIN CHEA
publication title Nucleotide binding by the histidine kinase CheA.
pubmed doi rcsb
source organism Thermotoga maritima
molecule tags Signaling protein, transferase
total genus 57
structure length 180
sequence length 188
chains with identical sequence B
ec nomenclature ec 2.7.13.3: Histidine kinase.
pdb deposition date 2001-02-26
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.565.10 Alpha Beta 2-Layer Sandwich Heat Shock Protein 90 Histidine kinase-like ATPase, C-terminal domain 1i59A00
2YI7A 2BTZA 2YI0A 4P8OA 2XDUA 1TIDA 4YKWA 2WI1A 4FCQA 2VCIA 1QYEA 2CCTA 2YE8A 1YT2A 2XABA 3R4OA 3OW6A 5FNFA 1GKXA 2Q8GA 3FV5A 3CWVA 3INWA 3CRKA 3VADA 1BKNA 3GIGB 3G7EA 1B63A 3EHJA 3D0BA 1Z59A 1I5BA 2YE9A 4CWOA 1YS3A 3K97A 3HHUA 3A0ZA 4GFNA 3TUHA 4AS9A 3LNUA 4NH9A 3INXA 4I5SA 4ASBA 3U2KA 3GIFA 1YETA 2QFOA 4HYMA 2WEQA 2YK2A 2YEHA 2CH4A 2CCSA 3VHDA 3BM9A 3D2RA 4QPJA 4EGIA 5IDMA 4L93A 1U2OA 1A4HA 1UYHA 3HZ5A 3B25A 3EHFA 4LPBA 1YC1A 1Y8NA 1KIJA 3VHAA 2YI5A 4P7AA 4FMTA 3T0HA 1BYQA 2XHXA 4CWRA 1UYCA 2ZDXA 2XDSA 2XJXA 4HZ5A 4CE1A 4EM7A 2YKIA 4CE3A 1YSRA 1UYLA 3B26A 1S14A 3A0YA 4GCZA 2XJJA 2YE6A 3OMUA 1UYKA 4X9LA 2CGFA 2BU8A 3HYYA 3T1KA 2BSMA 4MOTA 2VCJA 4YKXA 1ID0A 2XX2A 1Z5BA 3MNRP 2VWCA 2PNRA 4H81A 4B7PA 1NHHA 4XKOA 4L91A 1JM6A 3O2FA 3TZ2A 3EHGA 1OSFA 2YECA 4XTJA 3H80A 5CTXA 4AWOA 4EGKA 5D6PA 3O0IA 5CF0A 4HYPA 3B27A 4XDMA 3B28A 1H7UA 5BODA 4O0BA 4FCRA 2AKPA 4MPCA 3C11A 1AMWA 4URMA 2WEPA 1YERA 3T2SA 4V25A 2QG0A 4CWSA 3A0XA 4L94A 4O05A 2GFDA 4URLA 4E02A 4EEHA 3CRLA 4XE2A 2JKIA 1PVGA 2ZKJA 1NHIA 1GKZA 4NH7A 1ZWHA 3QDDA 3HYZA 4V26A 4BIZA 1UY6A 1Y8PA 1YT1A 2XDLA 1ZW9A 2HG1A 4EMVA 4H85A 4XKAA 1Y4UA 1ZXNA 1MU5A 4EFUA 4BQGA 1AH6A 3RLPA 1U0ZA 5F3KA 5FNCA 4K4OA 2BZ5A 4ASFA 4BAEA 3Q5KA 2HCHA 4QPKA 3O6OA 2K5BA 5CTUA 4LWEA 1AJ6A 2FWZA 1Y4SA 2YEGA 4JQLA 4YKTA 4AWQA 4HXWA 1UY7A 4B6CA 4FPPA 2JJCA 5L3JA 4O04A 4HZ0A 1EA6A 3C0EA 1I59A 2IWXA 3U2DA 1I5CA 2WI2A 2O1VA 3K99A 2IWUA 3RKZA 5CTWA 4YKYA 1UY8A 2WI7A 4KFGA 4XCJA 2WI5A 5M4PA 3EKRA 2IWSA 4KSGA 3OPDA 1TC0A 2XDXA 4KSHA 3JZ3A 4KP4A 1UYDA 2CG9A 5M4KA 4XKKA 4XC0A 3KE6A 1Z5AA 1MX0A 4ZVIA 2ESAA 4XIPA 2QF6A 2YEBA 2YEEA 2YE7A 4LWGA 3EKOA 2CCUA 2YE3A 4XIQA 2YEJA 1YC4A 4ASAA 2BU2A 4JAUA 2IOPA 2Q8IA 1I58A 3GIGA 3TZ5A 2WI6A 1Y8OA 2IOQA 1TH8A 3B24A 4XCLA 1TC6A 2YGAA 3SL2A 4NH8A 4R3MA 1R62A 4PL9A 4R3AA 3R4MA 4KQVA 4CWPA 1I5DA 2C2AA 3RLQA 2XDKA 2GQPA 2EXLA 4MB9A 3D36A 2HKJA 4PRVA 4GT8A 2BYIA 1UYFA 1UYMA 3Q5LA 2XX4A 3G75A 5M4MA 4U7OA 5BOCA 2IORA 1AM1A 4ZKIA 2XHRA 3A0WA 5FNDA 4I3HA 4BXIA 4YKRA 2YGEA 2ZDYA 4U7NA 3CGZA 1BGQA 4CWTA 3EHHA 3T10A 1TILA 3ZM7A 2YEFA 3K60A 4E00A 4EGHA 4YKUA 4Q20A 4WUDA 1B62A 4XD8A 3A0RA 4W7TA 1EI1A 4U93A 2ZBKB 5D7DA 4PU9A 3RLRA 3TTZA 4BIUA 4GEEA 2XX5A 1UYEA 2WERA 4AWPA 1NHJA 2Q2EB 4CE2A 4MPNA 1YESA 2XCMA 4WUBA 3OWDA 5GGZA 5M4NA 2WI4A 2XK2A 2YEIA 4R1FA 4XITA 2FXSA 5FWKA 5D6QA 3R4NA 2YEDA 2YI6A 1YC3A 4LP0A 3U67A 2YJWA 3PEHA 2BU5A 3TZ0A 2BRCA 4JASA 3VHCA 3LPSA 3GIEA 1L0OA 1AH8A 3TZ4A 5D7RA 3R91A 1S16A 3NMQA 2BU7A 3OWBA 3WQ9A 4BQJA 2FWYA 1QY8A 2BT0A 3ZKDA 4ASGA 2YKCA 4JAVA 1ZXMA 1UYIA 4YKQA 1Z5CA 1B3QA 1US7A 5C93A 2Q8FA 3PEJA 2BREA 4MBCA 4CWNA 4DUHA 4HY6A 4MPEA 2QG2A 4LWHA 2BYHA 3G7BA 4CWQA 4E01A 4LWIA 5J6AA 1QZRA 3A0TA 3FT8A 2YKJA 2BU6A 3CGYA 1I5AA 3BMYA 4XIRA 3R4PA 2Q8HA 2O1WA 3ZXOA 1GJVA 3IEDA 2YE2A 2E0AA 4H7QA 4PRXA 2XD6A 3ZXQA 5CPHA 3H4LA 3HZ1A 3QTFA 4GQTA 2O1UA 2YK9A 4CWFA 5D7CA 2VW5A 1TBWA 4YKZA 3K98A 3Q5JA 1THNA 4O07A 5IDJA 4FCPA 5M4HA 3ZKBA 2YE4A 2WI3A 3R92A 2XJGA 4L90A 5F5RA 3WHAA 1H7SA 1YSZA 1UY9A 2YE5A 4UROA 4WUCA 5CTYA 3HEKA 2FYPA 2H8MA 4DZYA 4LWFA 2XHTA 3DGEA 4HY1A 4MP7A 2H55A 5IN9A 4HXZA 4O09A 2YKBA 4MP2A 2YEAA 3T0ZA 5J71A 2YGFA 4L8ZA 4KTNA 1UYGA 4GGLA 3FT5A 4URNA 5M4EA 1BXDA 4EFTA 2YJXA 1KZNA 2YKEA 2UWDA 1YT0A
chains in the Genus database with same CATH superfamily
2YI7A 2BTZA 2YI0A 4P8OA 2XDUA 1TIDA 4YKWA 2WI1A 4FCQA 2VCIA 1QYEA 2CCTA 2YE8A 1YT2A 2XABA 3R4OA 3OW6A 5FNFA 1GKXA 2Q8GA 3FV5A 3CWVA 3INWA 3CRKA 3VADA 1BKNA 3GIGB 3G7EA 1B63A 3EHJA 3D0BA 1Z59A 1I5BA 2YE9A 4CWOA 1YS3A 3K97A 3HHUA 3A0ZA 4GFNA 3TUHA 4AS9A 3LNUA 4NH9A 3INXA 4I5SA 4ASBA 3U2KA 3GIFA 1YETA 2QFOA 4HYMA 2WEQA 2YK2A 2YEHA 2CH4A 2CCSA 3VHDA 3BM9A 3D2RA 4QPJA 4EGIA 5IDMA 4L93A 1U2OA 1A4HA 1UYHA 3HZ5A 3B25A 3EHFA 4LPBA 1YC1A 1Y8NA 1KIJA 3VHAA 2YI5A 4P7AA 4FMTA 3T0HA 1BYQA 2XHXA 4CWRA 1UYCA 2ZDXA 2XDSA 2XJXA 4HZ5A 4CE1A 4EM7A 2YKIA 4CE3A 1YSRA 1UYLA 3B26A 1S14A 3A0YA 4GCZA 2XJJA 2YE6A 3OMUA 1UYKA 4X9LA 2CGFA 2BU8A 3HYYA 3T1KA 2BSMA 4MOTA 2VCJA 4YKXA 1ID0A 2XX2A 1Z5BA 3MNRP 2VWCA 2PNRA 4H81A 4B7PA 1NHHA 4XKOA 4L91A 1JM6A 3O2FA 3TZ2A 3EHGA 1OSFA 2YECA 4XTJA 2FTKA 3H80A 5CTXA 4AWOA 4EGKA 5D6PA 3O0IA 5CF0A 4HYPA 3B27A 4XDMA 3B28A 1H7UA 5BODA 4O0BA 4FCRA 2AKPA 4MPCA 3C11A 1AMWA 4URMA 2WEPA 1YERA 3T2SA 4V25A 2QG0A 4CWSA 3A0XA 4L94A 4O05A 2GFDA 4URLA 4E02A 4EEHA 3CRLA 4XE2A 2JKIA 1PVGA 2ZKJA 1NHIA 1GKZA 4NH7A 1ZWHA 3QDDA 3HYZA 4V26A 4BIZA 1UY6A 1Y8PA 1YT1A 2XDLA 1ZW9A 2HG1A 4EMVA 4H85A 4XKAA 1Y4UA 1ZXNA 1MU5A 4EFUA 5JENA 4BQGA 1AH6A 3RLPA 1U0ZA 3S5TA 5F3KA 5FNCA 4K4OA 2BZ5A 4ASFA 4BAEA 3Q5KA 2HCHA 2HHIA 4QPKA 3O6OA 2K5BA 5CTUA 4LWEA 1AJ6A 2FWZA 1Y4SA 2YEGA 4JQLA 4YKTA 4AWQA 4HXWA 1UY7A 4B6CA 4FPPA 2JJCA 5L3JA 4O04A 4HZ0A 1EA6A 3C0EA 1I59A 2IWXA 3U2DA 1I5CA 2WI2A 2O1VA 3K99A 2IWUA 3RKZA 5CTWA 4YKYA 1UY8A 2WI7A 4KFGA 4XCJA 2WI5A 5M4PA 3EKRA 2IWSA 4KSGA 3OPDA 1TC0A 2XDXA 4KSHA 3JZ3A 4KP4A 1UYDA 2CG9A 5M4KA 4XKKA 4XC0A 3KE6A 1Z5AA 1MX0A 4ZVIA 2ESAA 4XIPA 2QF6A 2YEBA 2YEEA 2YE7A 4LWGA 3EKOA 2CCUA 2C1GA 2YE3A 4XIQA 2YEJA 1YC4A 4ASAA 2BU2A 4JAUA 2IOPA 2Q8IA 1I58A 3GIGA 3TZ5A 2WI6A 1Y8OA 2IOQA 1TH8A 3B24A 4XCLA 1TC6A 2YGAA 1F51A 3SL2A 4NH8A 4R3MA 1R62A 4PL9A 4R3AA 3R4MA 4KQVA 4CWPA 1I5DA 2C2AA 3RLQA 2XDKA 2GQPA 2EXLA 4MB9A 3D36A 2HKJA 4PRVA 4GT8A 2BYIA 1UYFA 1UYMA 3Q5LA 2XX4A 3G75A 5M4MA 4U7OA 5BOCA 2IORA 4E72A 1AM1A 4ZKIA 2XHRA 3A0WA 5FNDA 4I3HA 4BXIA 4YKRA 2YGEA 2ZDYA 4U7NA 3CGZA 1BGQA 4CWTA 3EHHA 3T10A 1TILA 3ZM7A 2YEFA 2C1IA 3K60A 4E00A 4EGHA 4YKUA 4Q20A 4WUDA 1B62A 4XD8A 3A0RA 4W7TA 1EI1A 4U93A 2ZBKB 5D7DA 4PU9A 3RLRA 3TTZA 4BIUA 4GEEA 2XX5A 1UYEA 2WERA 4AWPA 1NHJA 2Q2EB 4CE2A 4MPNA 1YESA 2XCMA 4WUBA 3OWDA 5GGZA 5M4NA 2WI4A 2XK2A 2YEIA 1IXMA 4R1FA 4XITA 2FXSA 5FWKA 5D6QA 3R4NA 2YEDA 2YI6A 1YC3A 4LP0A 3U67A 2YJWA 3PEHA 2BU5A 3TZ0A 2BRCA 4JASA 3VHCA 3LPSA 3GIEA 1L0OA 1AH8A 3TZ4A 5D7RA 3R91A 1S16A 3NMQA 2BU7A 3OWBA 3WQ9A 4BQJA 2FWYA 1QY8A 2BT0A 3ZKDA 4ASGA 2YKCA 4JAVA 1ZXMA 1UYIA 4YKQA 1Z5CA 1B3QA 1US7A 5C93A 2Q8FA 3PEJA 2BREA 4MBCA 4CWNA 4DUHA 4HY6A 4MPEA 2QG2A 4LWHA 2BYHA 3G7BA 4CWQA 4E01A 4LWIA 5J6AA 3CYGA 1QZRA 3A0TA 3FT8A 2YKJA 2BU6A 3CGYA 1I5AA 3BMYA 4XIRA 3R4PA 2Q8HA 2O1WA 3ZXOA 1GJVA 3IEDA 2YE2A 2E0AA 4H7QA 4PRXA 2XD6A 3ZXQA 5CPHA 3H4LA 3HZ1A 3QTFA 4GQTA 2O1UA 2YK9A 4CWFA 5D7CA 2VW5A 1TBWA 4YKZA 3K98A 3Q5JA 1THNA 4O07A 5IDJA 4FCPA 5M4HA 3ZKBA 2YE4A 2WI3A 3R92A 2XJGA 4L90A 5F5RA 3WHAA 1H7SA 1YSZA 1UY9A 2YE5A 4UROA 4WUCA 5CTYA 3HEKA 2FYPA 2H8MA 4DZYA 4LWFA 2XHTA 3DGEA 4HY1A 4MP7A 2H55A 5IN9A 4HXZA 4O09A 2YKBA 4MP2A 2YEAA 3LMMA 3T0ZA 5J71A 2YGFA 4L8ZA 4KTNA 1UYGA 4GGLA 3FT5A 4URNA 5M4EA 1BXDA 4EFTA 2YJXA 1KZNA 2YKEA 2UWDA 1YT0A
chains in the Genus database with same CATH topology
2YI7A 2BTZA 2YI0A 4P8OA 2XDUA 1TIDA 4YKWA 2WI1A 4FCQA 2VCIA 1QYEA 2CCTA 2YE8A 1YT2A 2XABA 3R4OA 3OW6A 5FNFA 1GKXA 2Q8GA 3FV5A 3CWVA 3INWA 3CRKA 3VADA 1BKNA 3GIGB 3G7EA 1B63A 3EHJA 3D0BA 1Z59A 1I5BA 2YE9A 4CWOA 1YS3A 3K97A 3HHUA 3A0ZA 4GFNA 3TUHA 4AS9A 3LNUA 4NH9A 3INXA 4I5SA 4ASBA 3U2KA 3GIFA 1YETA 2QFOA 4HYMA 2WEQA 2YK2A 2YEHA 2CH4A 2CCSA 3VHDA 3BM9A 3D2RA 4QPJA 4EGIA 5IDMA 4L93A 1U2OA 1A4HA 1UYHA 3HZ5A 3B25A 3EHFA 4LPBA 1YC1A 1Y8NA 1KIJA 3VHAA 2YI5A 4P7AA 4FMTA 3T0HA 1BYQA 2XHXA 4CWRA 1UYCA 2ZDXA 2XDSA 2XJXA 4HZ5A 4CE1A 4EM7A 2YKIA 4CE3A 1YSRA 1UYLA 3B26A 1S14A 3A0YA 4GCZA 2XJJA 2YE6A 3OMUA 1UYKA 4X9LA 2CGFA 2BU8A 3HYYA 3T1KA 2BSMA 4MOTA 2VCJA 4YKXA 1ID0A 2XX2A 1Z5BA 3MNRP 2VWCA 2PNRA 4H81A 4B7PA 1NHHA 4XKOA 4L91A 1JM6A 3O2FA 3TZ2A 3EHGA 1OSFA 2YECA 4XTJA 3H80A 5CTXA 4AWOA 4EGKA 5D6PA 3O0IA 5CF0A 4HYPA 3B27A 4XDMA 3B28A 1H7UA 5BODA 4O0BA 4FCRA 2AKPA 4MPCA 3C11A 1AMWA 4URMA 2WEPA 1YERA 3T2SA 4V25A 2QG0A 4CWSA 3A0XA 4L94A 4O05A 2GFDA 4URLA 4E02A 4EEHA 3CRLA 4XE2A 2JKIA 1PVGA 2ZKJA 1NHIA 1GKZA 4NH7A 1ZWHA 3QDDA 3HYZA 4V26A 4BIZA 1UY6A 1Y8PA 1YT1A 2XDLA 1ZW9A 2HG1A 4EMVA 4H85A 4XKAA 1Y4UA 1ZXNA 1MU5A 4EFUA 4BQGA 1AH6A 3RLPA 1U0ZA 5F3KA 5FNCA 4K4OA 2BZ5A 4ASFA 4BAEA 3Q5KA 2HCHA 4QPKA 3O6OA 2K5BA 5CTUA 4LWEA 1AJ6A 2FWZA 1Y4SA 2YEGA 4JQLA 4YKTA 4AWQA 4HXWA 1UY7A 4B6CA 4FPPA 2JJCA 5L3JA 4O04A 4HZ0A 1EA6A 3C0EA 1I59A 2IWXA 3U2DA 1I5CA 2WI2A 2O1VA 3K99A 2IWUA 3RKZA 5CTWA 4YKYA 1UY8A 2WI7A 4KFGA 4XCJA 2WI5A 5M4PA 3EKRA 2IWSA 4KSGA 3OPDA 1TC0A 2XDXA 4KSHA 3JZ3A 4KP4A 1UYDA 2CG9A 5M4KA 4XKKA 4XC0A 3KE6A 1Z5AA 1MX0A 4ZVIA 2ESAA 4XIPA 2QF6A 2YEBA 2YEEA 2YE7A 4LWGA 3EKOA 2CCUA 2YE3A 4XIQA 2YEJA 1YC4A 4ASAA 2BU2A 4JAUA 2IOPA 2Q8IA 1I58A 3GIGA 3TZ5A 2WI6A 1Y8OA 2IOQA 1TH8A 3B24A 4XCLA 1TC6A 2YGAA 3SL2A 4NH8A 4R3MA 1R62A 4PL9A 4R3AA 3R4MA 4KQVA 4CWPA 1I5DA 2C2AA 3RLQA 2XDKA 2GQPA 2EXLA 4MB9A 3D36A 2HKJA 4PRVA 4GT8A 2BYIA 1UYFA 1UYMA 3Q5LA 2XX4A 3G75A 5M4MA 4U7OA 5BOCA 2IORA 1AM1A 4ZKIA 2XHRA 3A0WA 5FNDA 4I3HA 4BXIA 4YKRA 2YGEA 2ZDYA 4U7NA 3CGZA 1BGQA 4CWTA 3EHHA 3T10A 1TILA 3ZM7A 2YEFA 3K60A 4E00A 4EGHA 4YKUA 4Q20A 4WUDA 1B62A 4XD8A 3A0RA 4W7TA 1EI1A 4U93A 2ZBKB 5D7DA 4PU9A 3RLRA 3TTZA 4BIUA 4GEEA 2XX5A 1UYEA 2WERA 4AWPA 1NHJA 2Q2EB 4CE2A 4MPNA 1YESA 2XCMA 4WUBA 3OWDA 5GGZA 5M4NA 2WI4A 2XK2A 2YEIA 4R1FA 4XITA 2FXSA 5FWKA 5D6QA 3R4NA 2YEDA 2YI6A 1YC3A 4LP0A 3U67A 2YJWA 3PEHA 2BU5A 3TZ0A 2BRCA 4JASA 3VHCA 3LPSA 3GIEA 1L0OA 1AH8A 3TZ4A 5D7RA 3R91A 1S16A 3NMQA 2BU7A 3OWBA 3WQ9A 4BQJA 2FWYA 1QY8A 2BT0A 3ZKDA 4ASGA 2YKCA 4JAVA 1ZXMA 1UYIA 4YKQA 1Z5CA 1B3QA 1US7A 5C93A 2Q8FA 3PEJA 2BREA 4MBCA 4CWNA 4DUHA 4HY6A 4MPEA 2QG2A 4LWHA 2BYHA 3G7BA 4CWQA 4E01A 4LWIA 5J6AA 1QZRA 3A0TA 3FT8A 2YKJA 2BU6A 3CGYA 1I5AA 3BMYA 4XIRA 3R4PA 2Q8HA 2O1WA 3ZXOA 1GJVA 3IEDA 2YE2A 2E0AA 4H7QA 4PRXA 2XD6A 3ZXQA 5CPHA 3H4LA 3HZ1A 3QTFA 4GQTA 2O1UA 2YK9A 4CWFA 5D7CA 2VW5A 1TBWA 4YKZA 3K98A 3Q5JA 1THNA 4O07A 5IDJA 4FCPA 5M4HA 3ZKBA 2YE4A 2WI3A 3R92A 2XJGA 4L90A 5F5RA 3WHAA 1H7SA 1YSZA 1UY9A 2YE5A 4UROA 4WUCA 5CTYA 3HEKA 2FYPA 2H8MA 4DZYA 4LWFA 2XHTA 3DGEA 4HY1A 4MP7A 2H55A 5IN9A 4HXZA 4O09A 2YKBA 4MP2A 2YEAA 3T0ZA 5J71A 2YGFA 4L8ZA 4KTNA 1UYGA 4GGLA 3FT5A 4URNA 5M4EA 1BXDA 4EFTA 2YJXA 1KZNA 2YKEA 2UWDA 1YT0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2YI7 A;  2BTZ A;  2YI0 A;  4P8O A;  2XDU A;  1TID A;  4YKW A;  2WI1 A;  4FCQ A;  2VCI A;  1QYE A;  2CCT A;  2YE8 A;  1YT2 A;  2XAB A;  3R4O A;  3OW6 A;  5FNF A;  1GKX A;  2Q8G A;  3FV5 A;  3CWV A;  3INW A;  3CRK A;  3VAD A;  1BKN A;  3GIG B;  3G7E A;  1B63 A;  3EHJ A;  3D0B A;  1Z59 A;  1I5B A;  2YE9 A;  4CWO A;  1YS3 A;  3K97 A;  3HHU A;  3A0Z A;  4GFN A;  3TUH A;  4AS9 A;  3LNU A;  4NH9 A;  3INX A;  4I5S A;  4ASB A;  3U2K A;  3GIF A;  1YET A;  2QFO A;  4HYM A;  2WEQ A;  2YK2 A;  2YEH A;  2CH4 A;  2CCS A;  3VHD A;  3BM9 A;  3D2R A;  4QPJ A;  4EGI A;  5IDM A;  4L93 A;  1U2O A;  1A4H A;  1UYH A;  3HZ5 A;  3B25 A;  3EHF A;  4LPB A;  1YC1 A;  1Y8N A;  1KIJ A;  3VHA A;  2YI5 A;  4P7A A;  4FMT A;  3T0H A;  1BYQ A;  2XHX A;  4CWR A;  1UYC A;  2ZDX A;  2XDS A;  2XJX A;  4HZ5 A;  4CE1 A;  4EM7 A;  2YKI A;  4CE3 A;  1YSR A;  1UYL A;  3B26 A;  1S14 A;  3A0Y A;  4GCZ A;  2XJJ A;  2YE6 A;  3OMU A;  1UYK A;  4X9L A;  2CGF A;  2BU8 A;  3HYY A;  3T1K A;  2BSM A;  4MOT A;  2VCJ A;  4YKX A;  1ID0 A;  2XX2 A;  1Z5B A;  3MNR P;  2VWC A;  2PNR A;  4H81 A;  4B7P A;  1NHH A;  4XKO A;  4L91 A;  1JM6 A;  3O2F A;  3TZ2 A;  3EHG A;  1OSF A;  2YEC A;  4XTJ A;  3H80 A;  5CTX A;  4AWO A;  4EGK A;  5D6P A;  3O0I A;  5CF0 A;  4HYP A;  3B27 A;  4XDM A;  3B28 A;  1H7U A;  5BOD A;  4O0B A;  4FCR A;  2AKP A;  4MPC A;  3C11 A;  1AMW A;  4URM A;  2WEP A;  1YER A;  3T2S A;  4V25 A;  2QG0 A;  4CWS A;  3A0X A;  4L94 A;  4O05 A;  2GFD A;  4URL A;  4E02 A;  4EEH A;  3CRL A;  4XE2 A;  2JKI A;  1PVG A;  2ZKJ A;  1NHI A;  1GKZ A;  4NH7 A;  1ZWH A;  3QDD A;  3HYZ A;  4V26 A;  4BIZ A;  1UY6 A;  1Y8P A;  1YT1 A;  2XDL A;  1ZW9 A;  2HG1 A;  4EMV A;  4H85 A;  4XKA A;  1Y4U A;  1ZXN A;  1MU5 A;  4EFU A;  4BQG A;  1AH6 A;  3RLP A;  1U0Z A;  5F3K A;  5FNC A;  4K4O A;  2BZ5 A;  4ASF A;  4BAE A;  3Q5K A;  2HCH A;  4QPK A;  3O6O A;  2K5B A;  5CTU A;  4LWE A;  1AJ6 A;  2FWZ A;  1Y4S A;  2YEG A;  4JQL A;  4YKT A;  4AWQ A;  4HXW A;  1UY7 A;  4B6C A;  4FPP A;  2JJC A;  5L3J A;  4O04 A;  4HZ0 A;  1EA6 A;  3C0E A;  1I59 A;  2IWX A;  3U2D A;  1I5C A;  2WI2 A;  2O1V A;  3K99 A;  2IWU A;  3RKZ A;  5CTW A;  4YKY A;  1UY8 A;  2WI7 A;  4KFG A;  4XCJ A;  2WI5 A;  5M4P A;  3EKR A;  2IWS A;  4KSG A;  3OPD A;  1TC0 A;  2XDX A;  4KSH A;  3JZ3 A;  4KP4 A;  1UYD A;  2CG9 A;  5M4K A;  4XKK A;  4XC0 A;  3KE6 A;  1Z5A A;  1MX0 A;  4ZVI A;  2ESA A;  4XIP A;  2QF6 A;  2YEB A;  2YEE A;  2YE7 A;  4LWG A;  3EKO A;  2CCU A;  2YE3 A;  4XIQ A;  2YEJ A;  1YC4 A;  4ASA A;  2BU2 A;  4JAU A;  2IOP A;  2Q8I A;  1I58 A;  3GIG A;  3TZ5 A;  2WI6 A;  1Y8O A;  2IOQ A;  1TH8 A;  3B24 A;  4XCL A;  1TC6 A;  2YGA A;  3SL2 A;  4NH8 A;  4R3M A;  1R62 A;  4PL9 A;  4R3A A;  3R4M A;  4KQV A;  4CWP A;  1I5D A;  2C2A A;  3RLQ A;  2XDK A;  2GQP A;  2EXL A;  4MB9 A;  3D36 A;  2HKJ A;  4PRV A;  4GT8 A;  2BYI A;  1UYF A;  1UYM A;  3Q5L A;  2XX4 A;  3G75 A;  5M4M A;  4U7O A;  5BOC A;  2IOR A;  1AM1 A;  4ZKI A;  2XHR A;  3A0W A;  5FND A;  4I3H A;  4BXI A;  4YKR A;  2YGE A;  2ZDY A;  4U7N A;  3CGZ A;  1BGQ A;  4CWT A;  3EHH A;  3T10 A;  1TIL A;  3ZM7 A;  2YEF A;  3K60 A;  4E00 A;  4EGH A;  4YKU A;  4Q20 A;  4WUD A;  1B62 A;  4XD8 A;  3A0R A;  4W7T A;  1EI1 A;  4U93 A;  2ZBK B;  5D7D A;  4PU9 A;  3RLR A;  3TTZ A;  4BIU A;  4GEE A;  2XX5 A;  1UYE A;  2WER A;  4AWP A;  1NHJ A;  2Q2E B;  4CE2 A;  4MPN A;  1YES A;  2XCM A;  4WUB A;  3OWD A;  5GGZ A;  5M4N A;  2WI4 A;  2XK2 A;  2YEI A;  4R1F A;  4XIT A;  2FXS A;  5FWK A;  5D6Q A;  3R4N A;  2YED A;  2YI6 A;  1YC3 A;  4LP0 A;  3U67 A;  2YJW A;  3PEH A;  2BU5 A;  3TZ0 A;  2BRC A;  4JAS A;  3VHC A;  3LPS A;  3GIE A;  1L0O A;  1AH8 A;  3TZ4 A;  5D7R A;  3R91 A;  1S16 A;  3NMQ A;  2BU7 A;  3OWB A;  3WQ9 A;  4BQJ A;  2FWY A;  1QY8 A;  2BT0 A;  3ZKD A;  4ASG A;  2YKC A;  4JAV A;  1ZXM A;  1UYI A;  4YKQ A;  1Z5C A;  1B3Q A;  1US7 A;  5C93 A;  2Q8F A;  3PEJ A;  2BRE A;  4MBC A;  4CWN A;  4DUH A;  4HY6 A;  4MPE A;  2QG2 A;  4LWH A;  2BYH A;  3G7B A;  4CWQ A;  4E01 A;  4LWI A;  5J6A A;  1QZR A;  3A0T A;  3FT8 A;  2YKJ A;  2BU6 A;  3CGY A;  1I5A A;  3BMY A;  4XIR A;  3R4P A;  2Q8H A;  2O1W A;  3ZXO A;  1GJV A;  3IED A;  2YE2 A;  2E0A A;  4H7Q A;  4PRX A;  2XD6 A;  3ZXQ A;  5CPH A;  3H4L A;  3HZ1 A;  3QTF A;  4GQT A;  2O1U A;  2YK9 A;  4CWF A;  5D7C A;  2VW5 A;  1TBW A;  4YKZ A;  3K98 A;  3Q5J A;  1THN A;  4O07 A;  5IDJ A;  4FCP A;  5M4H A;  3ZKB A;  2YE4 A;  2WI3 A;  3R92 A;  2XJG A;  4L90 A;  5F5R A;  3WHA A;  1H7S A;  1YSZ A;  1UY9 A;  2YE5 A;  4URO A;  4WUC A;  5CTY A;  3HEK A;  2FYP A;  2H8M A;  4DZY A;  4LWF A;  2XHT A;  3DGE A;  4HY1 A;  4MP7 A;  2H55 A;  5IN9 A;  4HXZ A;  4O09 A;  2YKB A;  4MP2 A;  2YEA A;  3T0Z A;  5J71 A;  2YGF A;  4L8Z A;  4KTN A;  1UYG A;  4GGL A;  3FT5 A;  4URN A;  5M4E A;  1BXD A;  4EFT A;  2YJX A;  1KZN A;  2YKE A;  2UWD A;  1YT0 A; 
#chains in the Genus database with same CATH topology
 2YI7 A;  2BTZ A;  2YI0 A;  4P8O A;  2XDU A;  1TID A;  4YKW A;  2WI1 A;  4FCQ A;  2VCI A;  1QYE A;  2CCT A;  2YE8 A;  1YT2 A;  2XAB A;  3R4O A;  3OW6 A;  5FNF A;  1GKX A;  2Q8G A;  3FV5 A;  3CWV A;  3INW A;  3CRK A;  3VAD A;  1BKN A;  3GIG B;  3G7E A;  1B63 A;  3EHJ A;  3D0B A;  1Z59 A;  1I5B A;  2YE9 A;  4CWO A;  1YS3 A;  3K97 A;  3HHU A;  3A0Z A;  4GFN A;  3TUH A;  4AS9 A;  3LNU A;  4NH9 A;  3INX A;  4I5S A;  4ASB A;  3U2K A;  3GIF A;  1YET A;  2QFO A;  4HYM A;  2WEQ A;  2YK2 A;  2YEH A;  2CH4 A;  2CCS A;  3VHD A;  3BM9 A;  3D2R A;  4QPJ A;  4EGI A;  5IDM A;  4L93 A;  1U2O A;  1A4H A;  1UYH A;  3HZ5 A;  3B25 A;  3EHF A;  4LPB A;  1YC1 A;  1Y8N A;  1KIJ A;  3VHA A;  2YI5 A;  4P7A A;  4FMT A;  3T0H A;  1BYQ A;  2XHX A;  4CWR A;  1UYC A;  2ZDX A;  2XDS A;  2XJX A;  4HZ5 A;  4CE1 A;  4EM7 A;  2YKI A;  4CE3 A;  1YSR A;  1UYL A;  3B26 A;  1S14 A;  3A0Y A;  4GCZ A;  2XJJ A;  2YE6 A;  3OMU A;  1UYK A;  4X9L A;  2CGF A;  2BU8 A;  3HYY A;  3T1K A;  2BSM A;  4MOT A;  2VCJ A;  4YKX A;  1ID0 A;  2XX2 A;  1Z5B A;  3MNR P;  2VWC A;  2PNR A;  4H81 A;  4B7P A;  1NHH A;  4XKO A;  4L91 A;  1JM6 A;  3O2F A;  3TZ2 A;  3EHG A;  1OSF A;  2YEC A;  4XTJ A;  2FTK A;  3H80 A;  5CTX A;  4AWO A;  4EGK A;  5D6P A;  3O0I A;  5CF0 A;  4HYP A;  3B27 A;  4XDM A;  3B28 A;  1H7U A;  5BOD A;  4O0B A;  4FCR A;  2AKP A;  4MPC A;  3C11 A;  1AMW A;  4URM A;  2WEP A;  1YER A;  3T2S A;  4V25 A;  2QG0 A;  4CWS A;  3A0X A;  4L94 A;  4O05 A;  2GFD A;  4URL A;  4E02 A;  4EEH A;  3CRL A;  4XE2 A;  2JKI A;  1PVG A;  2ZKJ A;  1NHI A;  1GKZ A;  4NH7 A;  1ZWH A;  3QDD A;  3HYZ A;  4V26 A;  4BIZ A;  1UY6 A;  1Y8P A;  1YT1 A;  2XDL A;  1ZW9 A;  2HG1 A;  4EMV A;  4H85 A;  4XKA A;  1Y4U A;  1ZXN A;  1MU5 A;  4EFU A;  5JEN A;  4BQG A;  1AH6 A;  3RLP A;  1U0Z A;  3S5T A;  5F3K A;  5FNC A;  4K4O A;  2BZ5 A;  4ASF A;  4BAE A;  3Q5K A;  2HCH A;  2HHI A;  4QPK A;  3O6O A;  2K5B A;  5CTU A;  4LWE A;  1AJ6 A;  2FWZ A;  1Y4S A;  2YEG A;  4JQL A;  4YKT A;  4AWQ A;  4HXW A;  1UY7 A;  4B6C A;  4FPP A;  2JJC A;  5L3J A;  4O04 A;  4HZ0 A;  1EA6 A;  3C0E A;  1I59 A;  2IWX A;  3U2D A;  1I5C A;  2WI2 A;  2O1V A;  3K99 A;  2IWU A;  3RKZ A;  5CTW A;  4YKY A;  1UY8 A;  2WI7 A;  4KFG A;  4XCJ A;  2WI5 A;  5M4P A;  3EKR A;  2IWS A;  4KSG A;  3OPD A;  1TC0 A;  2XDX A;  4KSH A;  3JZ3 A;  4KP4 A;  1UYD A;  2CG9 A;  5M4K A;  4XKK A;  4XC0 A;  3KE6 A;  1Z5A A;  1MX0 A;  4ZVI A;  2ESA A;  4XIP A;  2QF6 A;  2YEB A;  2YEE A;  2YE7 A;  4LWG A;  3EKO A;  2CCU A;  2C1G A;  2YE3 A;  4XIQ A;  2YEJ A;  1YC4 A;  4ASA A;  2BU2 A;  4JAU A;  2IOP A;  2Q8I A;  1I58 A;  3GIG A;  3TZ5 A;  2WI6 A;  1Y8O A;  2IOQ A;  1TH8 A;  3B24 A;  4XCL A;  1TC6 A;  2YGA A;  1F51 A;  3SL2 A;  4NH8 A;  4R3M A;  1R62 A;  4PL9 A;  4R3A A;  3R4M A;  4KQV A;  4CWP A;  1I5D A;  2C2A A;  3RLQ A;  2XDK A;  2GQP A;  2EXL A;  4MB9 A;  3D36 A;  2HKJ A;  4PRV A;  4GT8 A;  2BYI A;  1UYF A;  1UYM A;  3Q5L A;  2XX4 A;  3G75 A;  5M4M A;  4U7O A;  5BOC A;  2IOR A;  4E72 A;  1AM1 A;  4ZKI A;  2XHR A;  3A0W A;  5FND A;  4I3H A;  4BXI A;  4YKR A;  2YGE A;  2ZDY A;  4U7N A;  3CGZ A;  1BGQ A;  4CWT A;  3EHH A;  3T10 A;  1TIL A;  3ZM7 A;  2YEF A;  2C1I A;  3K60 A;  4E00 A;  4EGH A;  4YKU A;  4Q20 A;  4WUD A;  1B62 A;  4XD8 A;  3A0R A;  4W7T A;  1EI1 A;  4U93 A;  2ZBK B;  5D7D A;  4PU9 A;  3RLR A;  3TTZ A;  4BIU A;  4GEE A;  2XX5 A;  1UYE A;  2WER A;  4AWP A;  1NHJ A;  2Q2E B;  4CE2 A;  4MPN A;  1YES A;  2XCM A;  4WUB A;  3OWD A;  5GGZ A;  5M4N A;  2WI4 A;  2XK2 A;  2YEI A;  1IXM A;  4R1F A;  4XIT A;  2FXS A;  5FWK A;  5D6Q A;  3R4N A;  2YED A;  2YI6 A;  1YC3 A;  4LP0 A;  3U67 A;  2YJW A;  3PEH A;  2BU5 A;  3TZ0 A;  2BRC A;  4JAS A;  3VHC A;  3LPS A;  3GIE A;  1L0O A;  1AH8 A;  3TZ4 A;  5D7R A;  3R91 A;  1S16 A;  3NMQ A;  2BU7 A;  3OWB A;  3WQ9 A;  4BQJ A;  2FWY A;  1QY8 A;  2BT0 A;  3ZKD A;  4ASG A;  2YKC A;  4JAV A;  1ZXM A;  1UYI A;  4YKQ A;  1Z5C A;  1B3Q A;  1US7 A;  5C93 A;  2Q8F A;  3PEJ A;  2BRE A;  4MBC A;  4CWN A;  4DUH A;  4HY6 A;  4MPE A;  2QG2 A;  4LWH A;  2BYH A;  3G7B A;  4CWQ A;  4E01 A;  4LWI A;  5J6A A;  3CYG A;  1QZR A;  3A0T A;  3FT8 A;  2YKJ A;  2BU6 A;  3CGY A;  1I5A A;  3BMY A;  4XIR A;  3R4P A;  2Q8H A;  2O1W A;  3ZXO A;  1GJV A;  3IED A;  2YE2 A;  2E0A A;  4H7Q A;  4PRX A;  2XD6 A;  3ZXQ A;  5CPH A;  3H4L A;  3HZ1 A;  3QTF A;  4GQT A;  2O1U A;  2YK9 A;  4CWF A;  5D7C A;  2VW5 A;  1TBW A;  4YKZ A;  3K98 A;  3Q5J A;  1THN A;  4O07 A;  5IDJ A;  4FCP A;  5M4H A;  3ZKB A;  2YE4 A;  2WI3 A;  3R92 A;  2XJG A;  4L90 A;  5F5R A;  3WHA A;  1H7S A;  1YSZ A;  1UY9 A;  2YE5 A;  4URO A;  4WUC A;  5CTY A;  3HEK A;  2FYP A;  2H8M A;  4DZY A;  4LWF A;  2XHT A;  3DGE A;  4HY1 A;  4MP7 A;  2H55 A;  5IN9 A;  4HXZ A;  4O09 A;  2YKB A;  4MP2 A;  2YEA A;  3LMM A;  3T0Z A;  5J71 A;  2YGF A;  4L8Z A;  4KTN A;  1UYG A;  4GGL A;  3FT5 A;  4URN A;  5M4E A;  1BXD A;  4EFT A;  2YJX A;  1KZN A;  2YKE A;  2UWD A;  1YT0 A; 
#chains in the Genus database with same CATH homology
 2YI7 A;  2BTZ A;  2YI0 A;  4P8O A;  2XDU A;  1TID A;  4YKW A;  2WI1 A;  4FCQ A;  2VCI A;  1QYE A;  2CCT A;  2YE8 A;  1YT2 A;  2XAB A;  3R4O A;  3OW6 A;  5FNF A;  1GKX A;  2Q8G A;  3FV5 A;  3CWV A;  3INW A;  3CRK A;  3VAD A;  1BKN A;  3GIG B;  3G7E A;  1B63 A;  3EHJ A;  3D0B A;  1Z59 A;  1I5B A;  2YE9 A;  4CWO A;  1YS3 A;  3K97 A;  3HHU A;  3A0Z A;  4GFN A;  3TUH A;  4AS9 A;  3LNU A;  4NH9 A;  3INX A;  4I5S A;  4ASB A;  3U2K A;  3GIF A;  1YET A;  2QFO A;  4HYM A;  2WEQ A;  2YK2 A;  2YEH A;  2CH4 A;  2CCS A;  3VHD A;  3BM9 A;  3D2R A;  4QPJ A;  4EGI A;  5IDM A;  4L93 A;  1U2O A;  1A4H A;  1UYH A;  3HZ5 A;  3B25 A;  3EHF A;  4LPB A;  1YC1 A;  1Y8N A;  1KIJ A;  3VHA A;  2YI5 A;  4P7A A;  4FMT A;  3T0H A;  1BYQ A;  2XHX A;  4CWR A;  1UYC A;  2ZDX A;  2XDS A;  2XJX A;  4HZ5 A;  4CE1 A;  4EM7 A;  2YKI A;  4CE3 A;  1YSR A;  1UYL A;  3B26 A;  1S14 A;  3A0Y A;  4GCZ A;  2XJJ A;  2YE6 A;  3OMU A;  1UYK A;  4X9L A;  2CGF A;  2BU8 A;  3HYY A;  3T1K A;  2BSM A;  4MOT A;  2VCJ A;  4YKX A;  1ID0 A;  2XX2 A;  1Z5B A;  3MNR P;  2VWC A;  2PNR A;  4H81 A;  4B7P A;  1NHH A;  4XKO A;  4L91 A;  1JM6 A;  3O2F A;  3TZ2 A;  3EHG A;  1OSF A;  2YEC A;  4XTJ A;  3H80 A;  5CTX A;  4AWO A;  4EGK A;  5D6P A;  3O0I A;  5CF0 A;  4HYP A;  3B27 A;  4XDM A;  3B28 A;  1H7U A;  5BOD A;  4O0B A;  4FCR A;  2AKP A;  4MPC A;  3C11 A;  1AMW A;  4URM A;  2WEP A;  1YER A;  3T2S A;  4V25 A;  2QG0 A;  4CWS A;  3A0X A;  4L94 A;  4O05 A;  2GFD A;  4URL A;  4E02 A;  4EEH A;  3CRL A;  4XE2 A;  2JKI A;  1PVG A;  2ZKJ A;  1NHI A;  1GKZ A;  4NH7 A;  1ZWH A;  3QDD A;  3HYZ A;  4V26 A;  4BIZ A;  1UY6 A;  1Y8P A;  1YT1 A;  2XDL A;  1ZW9 A;  2HG1 A;  4EMV A;  4H85 A;  4XKA A;  1Y4U A;  1ZXN A;  1MU5 A;  4EFU A;  4BQG A;  1AH6 A;  3RLP A;  1U0Z A;  5F3K A;  5FNC A;  4K4O A;  2BZ5 A;  4ASF A;  4BAE A;  3Q5K A;  2HCH A;  4QPK A;  3O6O A;  2K5B A;  5CTU A;  4LWE A;  1AJ6 A;  2FWZ A;  1Y4S A;  2YEG A;  4JQL A;  4YKT A;  4AWQ A;  4HXW A;  1UY7 A;  4B6C A;  4FPP A;  2JJC A;  5L3J A;  4O04 A;  4HZ0 A;  1EA6 A;  3C0E A;  1I59 A;  2IWX A;  3U2D A;  1I5C A;  2WI2 A;  2O1V A;  3K99 A;  2IWU A;  3RKZ A;  5CTW A;  4YKY A;  1UY8 A;  2WI7 A;  4KFG A;  4XCJ A;  2WI5 A;  5M4P A;  3EKR A;  2IWS A;  4KSG A;  3OPD A;  1TC0 A;  2XDX A;  4KSH A;  3JZ3 A;  4KP4 A;  1UYD A;  2CG9 A;  5M4K A;  4XKK A;  4XC0 A;  3KE6 A;  1Z5A A;  1MX0 A;  4ZVI A;  2ESA A;  4XIP A;  2QF6 A;  2YEB A;  2YEE A;  2YE7 A;  4LWG A;  3EKO A;  2CCU A;  2YE3 A;  4XIQ A;  2YEJ A;  1YC4 A;  4ASA A;  2BU2 A;  4JAU A;  2IOP A;  2Q8I A;  1I58 A;  3GIG A;  3TZ5 A;  2WI6 A;  1Y8O A;  2IOQ A;  1TH8 A;  3B24 A;  4XCL A;  1TC6 A;  2YGA A;  3SL2 A;  4NH8 A;  4R3M A;  1R62 A;  4PL9 A;  4R3A A;  3R4M A;  4KQV A;  4CWP A;  1I5D A;  2C2A A;  3RLQ A;  2XDK A;  2GQP A;  2EXL A;  4MB9 A;  3D36 A;  2HKJ A;  4PRV A;  4GT8 A;  2BYI A;  1UYF A;  1UYM A;  3Q5L A;  2XX4 A;  3G75 A;  5M4M A;  4U7O A;  5BOC A;  2IOR A;  1AM1 A;  4ZKI A;  2XHR A;  3A0W A;  5FND A;  4I3H A;  4BXI A;  4YKR A;  2YGE A;  2ZDY A;  4U7N A;  3CGZ A;  1BGQ A;  4CWT A;  3EHH A;  3T10 A;  1TIL A;  3ZM7 A;  2YEF A;  3K60 A;  4E00 A;  4EGH A;  4YKU A;  4Q20 A;  4WUD A;  1B62 A;  4XD8 A;  3A0R A;  4W7T A;  1EI1 A;  4U93 A;  2ZBK B;  5D7D A;  4PU9 A;  3RLR A;  3TTZ A;  4BIU A;  4GEE A;  2XX5 A;  1UYE A;  2WER A;  4AWP A;  1NHJ A;  2Q2E B;  4CE2 A;  4MPN A;  1YES A;  2XCM A;  4WUB A;  3OWD A;  5GGZ A;  5M4N A;  2WI4 A;  2XK2 A;  2YEI A;  4R1F A;  4XIT A;  2FXS A;  5FWK A;  5D6Q A;  3R4N A;  2YED A;  2YI6 A;  1YC3 A;  4LP0 A;  3U67 A;  2YJW A;  3PEH A;  2BU5 A;  3TZ0 A;  2BRC A;  4JAS A;  3VHC A;  3LPS A;  3GIE A;  1L0O A;  1AH8 A;  3TZ4 A;  5D7R A;  3R91 A;  1S16 A;  3NMQ A;  2BU7 A;  3OWB A;  3WQ9 A;  4BQJ A;  2FWY A;  1QY8 A;  2BT0 A;  3ZKD A;  4ASG A;  2YKC A;  4JAV A;  1ZXM A;  1UYI A;  4YKQ A;  1Z5C A;  1B3Q A;  1US7 A;  5C93 A;  2Q8F A;  3PEJ A;  2BRE A;  4MBC A;  4CWN A;  4DUH A;  4HY6 A;  4MPE A;  2QG2 A;  4LWH A;  2BYH A;  3G7B A;  4CWQ A;  4E01 A;  4LWI A;  5J6A A;  1QZR A;  3A0T A;  3FT8 A;  2YKJ A;  2BU6 A;  3CGY A;  1I5A A;  3BMY A;  4XIR A;  3R4P A;  2Q8H A;  2O1W A;  3ZXO A;  1GJV A;  3IED A;  2YE2 A;  2E0A A;  4H7Q A;  4PRX A;  2XD6 A;  3ZXQ A;  5CPH A;  3H4L A;  3HZ1 A;  3QTF A;  4GQT A;  2O1U A;  2YK9 A;  4CWF A;  5D7C A;  2VW5 A;  1TBW A;  4YKZ A;  3K98 A;  3Q5J A;  1THN A;  4O07 A;  5IDJ A;  4FCP A;  5M4H A;  3ZKB A;  2YE4 A;  2WI3 A;  3R92 A;  2XJG A;  4L90 A;  5F5R A;  3WHA A;  1H7S A;  1YSZ A;  1UY9 A;  2YE5 A;  4URO A;  4WUC A;  5CTY A;  3HEK A;  2FYP A;  2H8M A;  4DZY A;  4LWF A;  2XHT A;  3DGE A;  4HY1 A;  4MP7 A;  2H55 A;  5IN9 A;  4HXZ A;  4O09 A;  2YKB A;  4MP2 A;  2YEA A;  3T0Z A;  5J71 A;  2YGF A;  4L8Z A;  4KTN A;  1UYG A;  4GGL A;  3FT5 A;  4URN A;  5M4E A;  1BXD A;  4EFT A;  2YJX A;  1KZN A;  2YKE A;  2UWD A;  1YT0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...