1I59A

Structure of the histidine kinase chea atp-binding domain in complex with adpnp and magensium
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
188
structure length
180
Chain Sequence
SHMVPISFVFNRFPRMVRDLAKKMNKEVNFIMRGEDTELDRTFVEEIGEPLLHLLRNAIDHGIEPKEERIAKGKPPIGTLILSARHEGNNVVIEVEDDGRGIDKEKIIRKAIEKGLIDESKAATLSDQEILNFLFVPGFSTKRGVGMDVVKNVVESLNGSISIESEKDKGTKVTIRLPLT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Nucleotide binding by the histidine kinase CheA.
pubmed doi rcsb
molecule keywords CHEMOTAXIS PROTEIN CHEA
molecule tags Signaling protein, transferase
source organism Thermotoga maritima
total genus 57
structure length 180
sequence length 188
chains with identical sequence B
ec nomenclature ec 2.7.13.3: Histidine kinase.
pdb deposition date 2001-02-26
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.565.10 Alpha Beta 2-Layer Sandwich Heat Shock Protein 90 Histidine kinase-like ATPase, C-terminal domain 1i59A00
3A0TA 4V25A 4CWPA 4CWNA 1R62A 3A0YA 2WI7A 4LWIA 3A0XA 2CCUA 1Y8OA 2YI7A 4HY6A 4UROA 1UY7A 3G75A 2IWSA 2XDLA 1QYEA 1YSZA 3TZ4A 4FMTA 4XD8A 4EGIA 1US7A 1I58A 1ZWHA 2YJWA 4LWEA 4XTJA 4O07A 3EKOA 4EEHA 4HXZA 4HXWA 3EHHA 4EM7A 4Q20A 2HKJA 4LWFA 5F5RA 1UYHA 2K5BA 3Q5KA 4JAVA 3RLPA 2CCSA 1NHHA 3T1KA 3LNUA 3B25A 3ZKBA 2FYPA 1AH8A 5M4PA 1AJ6A 2BRCA 1ID0A 2GFDA 2QFOA 4U7OA 3SL2A 3HZ1A 3VHDA 2H55A 1EA6A 2IWXA 2YK9A 3GIGB 2QG2A 1NHIA 3C11A 4P7AA 2O1UA 3TZ0A 1U2OA 3MNRP 4EGKA 2YEDA 4XE2A 2XCMA 1YS3A 1THNA 2WI5A 2FWYA 1UY6A 4BXIA 2XDUA 2YJXA 2BU6A 3CWVA 3O6OA 1AMWA 4CWOA 5J71A 2FWZA 3CGYA 3R92A 1QZRA 4JAUA 3EKRA 3OW6A 1UYIA 2YKEA 4GT8A 4H7QA 4ASFA 1AM1A 4JASA 3D2RA 3TTZA 4E02A 3NMQA 1YT1A 2Q8FA 2CH4A 3VADA 5IN9A 4FPPA 2WERA 3K99A 4B7PA 4R3MA 3K98A 2XHRA 1YC3A 3OWDA 3HYZA 4KTNA 1YT0A 1BGQA 2YKCA 3TUHA 4YKWA 2HCHA 4EGHA 3R4NA 3EHGA 3PEJA 3DGEA 2QF6A 5F3KA 3ZM7A 2WEQA 3EHJA 3T0ZA 2YE4A 4HY1A 1UY9A 5CTWA 2VCJA 2YKBA 3D36A 4ASGA 2IWUA 3IEDA 2BU8A 4R1FA 3FT8A 4GEEA 4YKUA 5CF0A 2YE2A 4V26A 1GJVA 2BREA 4O09A 1NHJA 3A0ZA 4W7TA 4EFUA 4FCPA 4HYPA 4MPEA 2CCTA 3O2FA 4O05A 2IOQA 4HZ5A 4PRXA 2XJGA 4HZ0A 4YKZA 3T0HA 2YE5A 3U67A 4NH8A 4AWQA 4XKOA 4ASBA 3CGZA 2YEHA 2CGFA 4AWPA 4BQGA 4YKTA 2YGFA 1BXDA 5FNDA 5CTUA 2YECA 1B63A 5J6AA 2XHTA 1JM6A 2YI5A 4GQTA 4GCZA 5CPHA 2WEPA 2XD6A 1B62A 1I5AA 3HHUA 4XCJA 5D7CA 1YSRA 4QPKA 2YI6A 2YEIA 4I5SA 4L93A 4GGLA 2YE3A 5IDMA 3U2DA 1Z5CA 2ZBKB 4BIUA 3EHFA 3GIEA 1A4HA 5FNFA 4I3HA 2WI3A 3Q5LA 5M4EA 3ZXQA 4CE3A 4QPJA 4MB9A 2BU5A 2E0AA 5CTYA 2BZ5A 3Q5JA 3INXA 4LWHA 4CWSA 4AS9A 2YEEA 5D7RA 2YEAA 4CWRA 4FCRA 2WI1A 4L90A 1ZW9A 4MP7A 2YE6A 5FNCA 3OPDA 4KSHA 3O0IA 2BSMA 2PNRA 2XJXA 4HYMA 4PRVA 2YKJA 3R91A 1I5CA 4CWFA 4XIQA 4KP4A 2XABA 4URNA 4K4OA 5M4KA 4YKYA 1YESA 3TZ5A 4LPBA 2Q8IA 1TC6A 4XC0A 3K97A 4MPCA 3QDDA 2ZDXA 4BAEA 4CE1A 4NH7A 3RLQA 1H7UA 4URLA 4XDMA 4MOTA 1TH8A 3RLRA 4WUDA 2YI0A 4XCLA 4XIPA 5M4NA 2UWDA 1EI1A 1YETA 4O0BA 2YEGA 1I5DA 5BOCA 2JJCA 4U7NA 3OWBA 2XDSA 1YERA 1GKXA 1Z59A 2Q8GA 3T10A 2IOPA 4KFGA 2CG9A 4U93A 2BT0A 1GKZA 2VCIA 4WUBA 3FV5A 4MP2A 3R4PA 2YEJA 2YE7A 1TIDA 1KIJA 4L91A 4H81A 4BIZA 4ASAA 1H7SA 2XK2A 4L94A 4MBCA 2GQPA 1MU5A 5C93A 1UYMA 2AKPA 1Y8NA 3B24A 4O04A 4XITA 1BYQA 2HG1A 4KSGA 3G7BA 4E00A 4YKQA 1MX0A 2XDKA 5D6QA 3OMUA 2ESAA 1Y4SA 1UYLA 3B28A 1UYDA 1B3QA 1Z5BA 2YE8A 2XDXA 3R4OA 4ZVIA 1TC0A 5D6PA 4AWOA 2WI4A 3WQ9A 2YGEA 3H80A 4CWQA 1S16A 5GGZA 3HYYA 4GFNA 4PL9A 1UYCA 2XHXA 4CE2A 1UYEA 2C2AA 3CRKA 4XKAA 5BODA 3B26A 4LWGA 4WUCA 1PVGA 2YEBA 2BYIA 2VWCA 4LP0A 4XKKA 3INWA 4DZYA 1UYGA 5L3JA 3WHAA 2WI6A 1QY8A 4YKXA 3BM9A 1I59A 3PEHA 1YC4A 3G7EA 4JQLA 3HZ5A 3U2KA 2FXSA 3K60A 1UYKA 4URMA 1UY8A 2BTZA 4X9LA 2Q8HA 3VHCA 1KZNA 2YE9A 4E01A 3D0BA 1UYFA 5D7DA 4CWTA 2XX2A 1ZXMA 2O1VA 2XX4A 4DUHA 2VW5A 1I5BA 4B6CA 3A0RA 4BQJA 4ZKIA 2XX5A 1ZXNA 5IDJA 5M4HA 4XIRA 4H85A 1Y4UA 2Q2EB 2YEFA 4P8OA 4L8ZA 2YGAA 2ZKJA 4YKRA 2XJJA 4MPNA 2YKIA 4FCQA 3TZ2A 2QG0A 2WI2A 3A0WA 5FWKA 4EMVA 1OSFA 1L0OA 3JZ3A 3R4MA 1S14A 2BYHA 3BMYA 2O1WA 1TBWA 1BKNA 1YT2A 2H8MA 2ZDYA 3VHAA 3ZKDA 2JKIA 4EFTA 3RKZA 1YC1A 3GIGA 3C0EA 1U0ZA 2BU2A 2EXLA 3HEKA 5CTXA 1Y8PA 3B27A 3FT5A 3GIFA 4KQVA 3T2SA 1AH6A 3LPSA 4PU9A 5M4MA 2BU7A 3KE6A 2IORA 3H4LA 3CRLA 2YK2A 1TILA 4NH9A 3ZXOA 4R3AA 3QTFA 1Z5AA
chains in the Genus database with same CATH superfamily
3A0TA 4V25A 4CWPA 4CWNA 1R62A 3A0YA 2WI7A 4LWIA 3A0XA 2CCUA 1Y8OA 2YI7A 4HY6A 4UROA 1UY7A 3G75A 2IWSA 2XDLA 1QYEA 1YSZA 3TZ4A 4FMTA 4XD8A 4EGIA 1US7A 1I58A 1ZWHA 2YJWA 4LWEA 4XTJA 4O07A 3EKOA 4EEHA 4HXZA 4HXWA 3EHHA 4EM7A 4Q20A 2HKJA 4LWFA 5F5RA 1UYHA 2K5BA 3Q5KA 4JAVA 3RLPA 2CCSA 1NHHA 3T1KA 3LNUA 3B25A 3ZKBA 2FYPA 4E72A 1AH8A 5M4PA 1AJ6A 2BRCA 1ID0A 2GFDA 2QFOA 4U7OA 3SL2A 3HZ1A 3VHDA 2H55A 1EA6A 2IWXA 2YK9A 3GIGB 2QG2A 1NHIA 3C11A 4P7AA 2O1UA 3TZ0A 1U2OA 3MNRP 3CYGA 4EGKA 2YEDA 4XE2A 2XCMA 1YS3A 1THNA 2WI5A 2FWYA 1UY6A 4BXIA 2XDUA 2YJXA 2BU6A 3CWVA 3O6OA 1AMWA 4CWOA 5J71A 2FWZA 3CGYA 3R92A 1QZRA 4JAUA 3EKRA 3OW6A 1UYIA 2YKEA 3S5TA 4GT8A 4H7QA 4ASFA 1AM1A 4JASA 3D2RA 3TTZA 4E02A 3NMQA 1YT1A 2Q8FA 2CH4A 3VADA 5IN9A 4FPPA 2WERA 3K99A 4B7PA 4R3MA 3K98A 2XHRA 1YC3A 3OWDA 3HYZA 4KTNA 1YT0A 1BGQA 2YKCA 3TUHA 4YKWA 2HCHA 4EGHA 3R4NA 3EHGA 3PEJA 3DGEA 2QF6A 5F3KA 3ZM7A 2WEQA 3EHJA 3T0ZA 2YE4A 4HY1A 1UY9A 5CTWA 2VCJA 2YKBA 3D36A 4ASGA 2IWUA 3IEDA 2BU8A 4R1FA 3FT8A 4GEEA 4YKUA 5CF0A 2YE2A 4V26A 1GJVA 2BREA 4O09A 1NHJA 1F51A 3A0ZA 4W7TA 4EFUA 4FCPA 4HYPA 4MPEA 2CCTA 3O2FA 4O05A 2IOQA 4HZ5A 4PRXA 2XJGA 4HZ0A 4YKZA 3T0HA 2YE5A 3U67A 4NH8A 4AWQA 4XKOA 4ASBA 3CGZA 2YEHA 2CGFA 4AWPA 4BQGA 4YKTA 2YGFA 1BXDA 5FNDA 5CTUA 2YECA 1B63A 5J6AA 2XHTA 1JM6A 2YI5A 4GQTA 4GCZA 5CPHA 2WEPA 2XD6A 1B62A 2C1GA 1I5AA 3HHUA 4XCJA 5D7CA 1YSRA 4QPKA 2YI6A 2YEIA 4I5SA 4L93A 4GGLA 2YE3A 5IDMA 3U2DA 1Z5CA 2ZBKB 4BIUA 3EHFA 3GIEA 1A4HA 5FNFA 4I3HA 2WI3A 3Q5LA 5M4EA 3ZXQA 4CE3A 4QPJA 4MB9A 2BU5A 2E0AA 5CTYA 2BZ5A 3Q5JA 3INXA 4LWHA 4CWSA 4AS9A 2YEEA 5D7RA 2YEAA 4CWRA 4FCRA 2WI1A 4L90A 1ZW9A 4MP7A 2YE6A 5FNCA 3OPDA 4KSHA 3O0IA 2BSMA 2PNRA 2XJXA 4HYMA 4PRVA 2YKJA 3R91A 1I5CA 4CWFA 4XIQA 4KP4A 2XABA 4URNA 4K4OA 5M4KA 4YKYA 1YESA 3TZ5A 4LPBA 2Q8IA 1TC6A 4XC0A 3K97A 4MPCA 3QDDA 2ZDXA 4BAEA 4CE1A 4NH7A 3RLQA 1H7UA 4URLA 4XDMA 4MOTA 2C1IA 1TH8A 3RLRA 4WUDA 2YI0A 4XCLA 4XIPA 5M4NA 2UWDA 1EI1A 1YETA 4O0BA 2YEGA 1I5DA 5BOCA 2JJCA 4U7NA 3OWBA 2XDSA 1YERA 1GKXA 1Z59A 2Q8GA 3T10A 2IOPA 4KFGA 2CG9A 4U93A 2BT0A 1GKZA 2VCIA 2FTKA 4WUBA 3FV5A 4MP2A 3R4PA 2YEJA 2YE7A 1TIDA 1KIJA 4L91A 4H81A 4BIZA 4ASAA 1H7SA 2XK2A 4L94A 4MBCA 2GQPA 1MU5A 5C93A 1UYMA 2AKPA 1Y8NA 3B24A 4O04A 4XITA 1BYQA 2HG1A 4KSGA 3G7BA 4E00A 4YKQA 1MX0A 2XDKA 5D6QA 3OMUA 2ESAA 1Y4SA 1UYLA 3B28A 1UYDA 1B3QA 1Z5BA 2YE8A 2XDXA 3R4OA 4ZVIA 1TC0A 5D6PA 4AWOA 2WI4A 3WQ9A 2YGEA 3H80A 4CWQA 1S16A 5GGZA 3HYYA 4GFNA 4PL9A 1UYCA 2XHXA 4CE2A 1UYEA 2C2AA 3CRKA 4XKAA 5BODA 3B26A 4LWGA 4WUCA 1PVGA 2YEBA 2BYIA 2VWCA 4LP0A 4XKKA 3INWA 4DZYA 1UYGA 5L3JA 3WHAA 2WI6A 1QY8A 4YKXA 3BM9A 1I59A 3LMMA 3PEHA 1YC4A 3G7EA 4JQLA 3HZ5A 3U2KA 2FXSA 3K60A 1UYKA 1IXMA 4URMA 1UY8A 2BTZA 4X9LA 2Q8HA 3VHCA 1KZNA 2HHIA 2YE9A 4E01A 3D0BA 1UYFA 5D7DA 4CWTA 2XX2A 1ZXMA 2O1VA 2XX4A 4DUHA 2VW5A 1I5BA 4B6CA 3A0RA 4BQJA 4ZKIA 2XX5A 1ZXNA 5IDJA 5M4HA 4XIRA 4H85A 1Y4UA 2Q2EB 2YEFA 4P8OA 4L8ZA 2YGAA 2ZKJA 4YKRA 2XJJA 4MPNA 2YKIA 4FCQA 3TZ2A 2QG0A 2WI2A 3A0WA 5FWKA 4EMVA 1OSFA 1L0OA 3JZ3A 3R4MA 1S14A 2BYHA 3BMYA 2O1WA 1TBWA 1BKNA 1YT2A 2H8MA 2ZDYA 3VHAA 3ZKDA 2JKIA 4EFTA 3RKZA 1YC1A 3GIGA 3C0EA 1U0ZA 2BU2A 2EXLA 3HEKA 5CTXA 1Y8PA 3B27A 3FT5A 3GIFA 4KQVA 3T2SA 1AH6A 3LPSA 4PU9A 5M4MA 2BU7A 3KE6A 2IORA 3H4LA 5JENA 3CRLA 2YK2A 1TILA 4NH9A 3ZXOA 4R3AA 3QTFA 1Z5AA
chains in the Genus database with same CATH topology
3A0TA 4V25A 4CWPA 4CWNA 1R62A 3A0YA 2WI7A 4LWIA 3A0XA 2CCUA 1Y8OA 2YI7A 4HY6A 4UROA 1UY7A 3G75A 2IWSA 2XDLA 1QYEA 1YSZA 3TZ4A 4FMTA 4XD8A 4EGIA 1US7A 1I58A 1ZWHA 2YJWA 4LWEA 4XTJA 4O07A 3EKOA 4EEHA 4HXZA 4HXWA 3EHHA 4EM7A 4Q20A 2HKJA 4LWFA 5F5RA 1UYHA 2K5BA 3Q5KA 4JAVA 3RLPA 2CCSA 1NHHA 3T1KA 3LNUA 3B25A 3ZKBA 2FYPA 1AH8A 5M4PA 1AJ6A 2BRCA 1ID0A 2GFDA 2QFOA 4U7OA 3SL2A 3HZ1A 3VHDA 2H55A 1EA6A 2IWXA 2YK9A 3GIGB 2QG2A 1NHIA 3C11A 4P7AA 2O1UA 3TZ0A 1U2OA 3MNRP 4EGKA 2YEDA 4XE2A 2XCMA 1YS3A 1THNA 2WI5A 2FWYA 1UY6A 4BXIA 2XDUA 2YJXA 2BU6A 3CWVA 3O6OA 1AMWA 4CWOA 5J71A 2FWZA 3CGYA 3R92A 1QZRA 4JAUA 3EKRA 3OW6A 1UYIA 2YKEA 4GT8A 4H7QA 4ASFA 1AM1A 4JASA 3D2RA 3TTZA 4E02A 3NMQA 1YT1A 2Q8FA 2CH4A 3VADA 5IN9A 4FPPA 2WERA 3K99A 4B7PA 4R3MA 3K98A 2XHRA 1YC3A 3OWDA 3HYZA 4KTNA 1YT0A 1BGQA 2YKCA 3TUHA 4YKWA 2HCHA 4EGHA 3R4NA 3EHGA 3PEJA 3DGEA 2QF6A 5F3KA 3ZM7A 2WEQA 3EHJA 3T0ZA 2YE4A 4HY1A 1UY9A 5CTWA 2VCJA 2YKBA 3D36A 4ASGA 2IWUA 3IEDA 2BU8A 4R1FA 3FT8A 4GEEA 4YKUA 5CF0A 2YE2A 4V26A 1GJVA 2BREA 4O09A 1NHJA 3A0ZA 4W7TA 4EFUA 4FCPA 4HYPA 4MPEA 2CCTA 3O2FA 4O05A 2IOQA 4HZ5A 4PRXA 2XJGA 4HZ0A 4YKZA 3T0HA 2YE5A 3U67A 4NH8A 4AWQA 4XKOA 4ASBA 3CGZA 2YEHA 2CGFA 4AWPA 4BQGA 4YKTA 2YGFA 1BXDA 5FNDA 5CTUA 2YECA 1B63A 5J6AA 2XHTA 1JM6A 2YI5A 4GQTA 4GCZA 5CPHA 2WEPA 2XD6A 1B62A 1I5AA 3HHUA 4XCJA 5D7CA 1YSRA 4QPKA 2YI6A 2YEIA 4I5SA 4L93A 4GGLA 2YE3A 5IDMA 3U2DA 1Z5CA 2ZBKB 4BIUA 3EHFA 3GIEA 1A4HA 5FNFA 4I3HA 2WI3A 3Q5LA 5M4EA 3ZXQA 4CE3A 4QPJA 4MB9A 2BU5A 2E0AA 5CTYA 2BZ5A 3Q5JA 3INXA 4LWHA 4CWSA 4AS9A 2YEEA 5D7RA 2YEAA 4CWRA 4FCRA 2WI1A 4L90A 1ZW9A 4MP7A 2YE6A 5FNCA 3OPDA 4KSHA 3O0IA 2BSMA 2PNRA 2XJXA 4HYMA 4PRVA 2YKJA 3R91A 1I5CA 4CWFA 4XIQA 4KP4A 2XABA 4URNA 4K4OA 5M4KA 4YKYA 1YESA 3TZ5A 4LPBA 2Q8IA 1TC6A 4XC0A 3K97A 4MPCA 3QDDA 2ZDXA 4BAEA 4CE1A 4NH7A 3RLQA 1H7UA 4URLA 4XDMA 4MOTA 1TH8A 3RLRA 4WUDA 2YI0A 4XCLA 4XIPA 5M4NA 2UWDA 1EI1A 1YETA 4O0BA 2YEGA 1I5DA 5BOCA 2JJCA 4U7NA 3OWBA 2XDSA 1YERA 1GKXA 1Z59A 2Q8GA 3T10A 2IOPA 4KFGA 2CG9A 4U93A 2BT0A 1GKZA 2VCIA 4WUBA 3FV5A 4MP2A 3R4PA 2YEJA 2YE7A 1TIDA 1KIJA 4L91A 4H81A 4BIZA 4ASAA 1H7SA 2XK2A 4L94A 4MBCA 2GQPA 1MU5A 5C93A 1UYMA 2AKPA 1Y8NA 3B24A 4O04A 4XITA 1BYQA 2HG1A 4KSGA 3G7BA 4E00A 4YKQA 1MX0A 2XDKA 5D6QA 3OMUA 2ESAA 1Y4SA 1UYLA 3B28A 1UYDA 1B3QA 1Z5BA 2YE8A 2XDXA 3R4OA 4ZVIA 1TC0A 5D6PA 4AWOA 2WI4A 3WQ9A 2YGEA 3H80A 4CWQA 1S16A 5GGZA 3HYYA 4GFNA 4PL9A 1UYCA 2XHXA 4CE2A 1UYEA 2C2AA 3CRKA 4XKAA 5BODA 3B26A 4LWGA 4WUCA 1PVGA 2YEBA 2BYIA 2VWCA 4LP0A 4XKKA 3INWA 4DZYA 1UYGA 5L3JA 3WHAA 2WI6A 1QY8A 4YKXA 3BM9A 1I59A 3PEHA 1YC4A 3G7EA 4JQLA 3HZ5A 3U2KA 2FXSA 3K60A 1UYKA 4URMA 1UY8A 2BTZA 4X9LA 2Q8HA 3VHCA 1KZNA 2YE9A 4E01A 3D0BA 1UYFA 5D7DA 4CWTA 2XX2A 1ZXMA 2O1VA 2XX4A 4DUHA 2VW5A 1I5BA 4B6CA 3A0RA 4BQJA 4ZKIA 2XX5A 1ZXNA 5IDJA 5M4HA 4XIRA 4H85A 1Y4UA 2Q2EB 2YEFA 4P8OA 4L8ZA 2YGAA 2ZKJA 4YKRA 2XJJA 4MPNA 2YKIA 4FCQA 3TZ2A 2QG0A 2WI2A 3A0WA 5FWKA 4EMVA 1OSFA 1L0OA 3JZ3A 3R4MA 1S14A 2BYHA 3BMYA 2O1WA 1TBWA 1BKNA 1YT2A 2H8MA 2ZDYA 3VHAA 3ZKDA 2JKIA 4EFTA 3RKZA 1YC1A 3GIGA 3C0EA 1U0ZA 2BU2A 2EXLA 3HEKA 5CTXA 1Y8PA 3B27A 3FT5A 3GIFA 4KQVA 3T2SA 1AH6A 3LPSA 4PU9A 5M4MA 2BU7A 3KE6A 2IORA 3H4LA 3CRLA 2YK2A 1TILA 4NH9A 3ZXOA 4R3AA 3QTFA 1Z5AA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3A0T A;  4V25 A;  4CWP A;  4CWN A;  1R62 A;  3A0Y A;  2WI7 A;  4LWI A;  3A0X A;  2CCU A;  1Y8O A;  2YI7 A;  4HY6 A;  4URO A;  1UY7 A;  3G75 A;  2IWS A;  2XDL A;  1QYE A;  1YSZ A;  3TZ4 A;  4FMT A;  4XD8 A;  4EGI A;  1US7 A;  1I58 A;  1ZWH A;  2YJW A;  4LWE A;  4XTJ A;  4O07 A;  3EKO A;  4EEH A;  4HXZ A;  4HXW A;  3EHH A;  4EM7 A;  4Q20 A;  2HKJ A;  4LWF A;  5F5R A;  1UYH A;  2K5B A;  3Q5K A;  4JAV A;  3RLP A;  2CCS A;  1NHH A;  3T1K A;  3LNU A;  3B25 A;  3ZKB A;  2FYP A;  1AH8 A;  5M4P A;  1AJ6 A;  2BRC A;  1ID0 A;  2GFD A;  2QFO A;  4U7O A;  3SL2 A;  3HZ1 A;  3VHD A;  2H55 A;  1EA6 A;  2IWX A;  2YK9 A;  3GIG B;  2QG2 A;  1NHI A;  3C11 A;  4P7A A;  2O1U A;  3TZ0 A;  1U2O A;  3MNR P;  4EGK A;  2YED A;  4XE2 A;  2XCM A;  1YS3 A;  1THN A;  2WI5 A;  2FWY A;  1UY6 A;  4BXI A;  2XDU A;  2YJX A;  2BU6 A;  3CWV A;  3O6O A;  1AMW A;  4CWO A;  5J71 A;  2FWZ A;  3CGY A;  3R92 A;  1QZR A;  4JAU A;  3EKR A;  3OW6 A;  1UYI A;  2YKE A;  4GT8 A;  4H7Q A;  4ASF A;  1AM1 A;  4JAS A;  3D2R A;  3TTZ A;  4E02 A;  3NMQ A;  1YT1 A;  2Q8F A;  2CH4 A;  3VAD A;  5IN9 A;  4FPP A;  2WER A;  3K99 A;  4B7P A;  4R3M A;  3K98 A;  2XHR A;  1YC3 A;  3OWD A;  3HYZ A;  4KTN A;  1YT0 A;  1BGQ A;  2YKC A;  3TUH A;  4YKW A;  2HCH A;  4EGH A;  3R4N A;  3EHG A;  3PEJ A;  3DGE A;  2QF6 A;  5F3K A;  3ZM7 A;  2WEQ A;  3EHJ A;  3T0Z A;  2YE4 A;  4HY1 A;  1UY9 A;  5CTW A;  2VCJ A;  2YKB A;  3D36 A;  4ASG A;  2IWU A;  3IED A;  2BU8 A;  4R1F A;  3FT8 A;  4GEE A;  4YKU A;  5CF0 A;  2YE2 A;  4V26 A;  1GJV A;  2BRE A;  4O09 A;  1NHJ A;  3A0Z A;  4W7T A;  4EFU A;  4FCP A;  4HYP A;  4MPE A;  2CCT A;  3O2F A;  4O05 A;  2IOQ A;  4HZ5 A;  4PRX A;  2XJG A;  4HZ0 A;  4YKZ A;  3T0H A;  2YE5 A;  3U67 A;  4NH8 A;  4AWQ A;  4XKO A;  4ASB A;  3CGZ A;  2YEH A;  2CGF A;  4AWP A;  4BQG A;  4YKT A;  2YGF A;  1BXD A;  5FND A;  5CTU A;  2YEC A;  1B63 A;  5J6A A;  2XHT A;  1JM6 A;  2YI5 A;  4GQT A;  4GCZ A;  5CPH A;  2WEP A;  2XD6 A;  1B62 A;  1I5A A;  3HHU A;  4XCJ A;  5D7C A;  1YSR A;  4QPK A;  2YI6 A;  2YEI A;  4I5S A;  4L93 A;  4GGL A;  2YE3 A;  5IDM A;  3U2D A;  1Z5C A;  2ZBK B;  4BIU A;  3EHF A;  3GIE A;  1A4H A;  5FNF A;  4I3H A;  2WI3 A;  3Q5L A;  5M4E A;  3ZXQ A;  4CE3 A;  4QPJ A;  4MB9 A;  2BU5 A;  2E0A A;  5CTY A;  2BZ5 A;  3Q5J A;  3INX A;  4LWH A;  4CWS A;  4AS9 A;  2YEE A;  5D7R A;  2YEA A;  4CWR A;  4FCR A;  2WI1 A;  4L90 A;  1ZW9 A;  4MP7 A;  2YE6 A;  5FNC A;  3OPD A;  4KSH A;  3O0I A;  2BSM A;  2PNR A;  2XJX A;  4HYM A;  4PRV A;  2YKJ A;  3R91 A;  1I5C A;  4CWF A;  4XIQ A;  4KP4 A;  2XAB A;  4URN A;  4K4O A;  5M4K A;  4YKY A;  1YES A;  3TZ5 A;  4LPB A;  2Q8I A;  1TC6 A;  4XC0 A;  3K97 A;  4MPC A;  3QDD A;  2ZDX A;  4BAE A;  4CE1 A;  4NH7 A;  3RLQ A;  1H7U A;  4URL A;  4XDM A;  4MOT A;  1TH8 A;  3RLR A;  4WUD A;  2YI0 A;  4XCL A;  4XIP A;  5M4N A;  2UWD A;  1EI1 A;  1YET A;  4O0B A;  2YEG A;  1I5D A;  5BOC A;  2JJC A;  4U7N A;  3OWB A;  2XDS A;  1YER A;  1GKX A;  1Z59 A;  2Q8G A;  3T10 A;  2IOP A;  4KFG A;  2CG9 A;  4U93 A;  2BT0 A;  1GKZ A;  2VCI A;  4WUB A;  3FV5 A;  4MP2 A;  3R4P A;  2YEJ A;  2YE7 A;  1TID A;  1KIJ A;  4L91 A;  4H81 A;  4BIZ A;  4ASA A;  1H7S A;  2XK2 A;  4L94 A;  4MBC A;  2GQP A;  1MU5 A;  5C93 A;  1UYM A;  2AKP A;  1Y8N A;  3B24 A;  4O04 A;  4XIT A;  1BYQ A;  2HG1 A;  4KSG A;  3G7B A;  4E00 A;  4YKQ A;  1MX0 A;  2XDK A;  5D6Q A;  3OMU A;  2ESA A;  1Y4S A;  1UYL A;  3B28 A;  1UYD A;  1B3Q A;  1Z5B A;  2YE8 A;  2XDX A;  3R4O A;  4ZVI A;  1TC0 A;  5D6P A;  4AWO A;  2WI4 A;  3WQ9 A;  2YGE A;  3H80 A;  4CWQ A;  1S16 A;  5GGZ A;  3HYY A;  4GFN A;  4PL9 A;  1UYC A;  2XHX A;  4CE2 A;  1UYE A;  2C2A A;  3CRK A;  4XKA A;  5BOD A;  3B26 A;  4LWG A;  4WUC A;  1PVG A;  2YEB A;  2BYI A;  2VWC A;  4LP0 A;  4XKK A;  3INW A;  4DZY A;  1UYG A;  5L3J A;  3WHA A;  2WI6 A;  1QY8 A;  4YKX A;  3BM9 A;  1I59 A;  3PEH A;  1YC4 A;  3G7E A;  4JQL A;  3HZ5 A;  3U2K A;  2FXS A;  3K60 A;  1UYK A;  4URM A;  1UY8 A;  2BTZ A;  4X9L A;  2Q8H A;  3VHC A;  1KZN A;  2YE9 A;  4E01 A;  3D0B A;  1UYF A;  5D7D A;  4CWT A;  2XX2 A;  1ZXM A;  2O1V A;  2XX4 A;  4DUH A;  2VW5 A;  1I5B A;  4B6C A;  3A0R A;  4BQJ A;  4ZKI A;  2XX5 A;  1ZXN A;  5IDJ A;  5M4H A;  4XIR A;  4H85 A;  1Y4U A;  2Q2E B;  2YEF A;  4P8O A;  4L8Z A;  2YGA A;  2ZKJ A;  4YKR A;  2XJJ A;  4MPN A;  2YKI A;  4FCQ A;  3TZ2 A;  2QG0 A;  2WI2 A;  3A0W A;  5FWK A;  4EMV A;  1OSF A;  1L0O A;  3JZ3 A;  3R4M A;  1S14 A;  2BYH A;  3BMY A;  2O1W A;  1TBW A;  1BKN A;  1YT2 A;  2H8M A;  2ZDY A;  3VHA A;  3ZKD A;  2JKI A;  4EFT A;  3RKZ A;  1YC1 A;  3GIG A;  3C0E A;  1U0Z A;  2BU2 A;  2EXL A;  3HEK A;  5CTX A;  1Y8P A;  3B27 A;  3FT5 A;  3GIF A;  4KQV A;  3T2S A;  1AH6 A;  3LPS A;  4PU9 A;  5M4M A;  2BU7 A;  3KE6 A;  2IOR A;  3H4L A;  3CRL A;  2YK2 A;  1TIL A;  4NH9 A;  3ZXO A;  4R3A A;  3QTF A;  1Z5A A; 
#chains in the Genus database with same CATH topology
 3A0T A;  4V25 A;  4CWP A;  4CWN A;  1R62 A;  3A0Y A;  2WI7 A;  4LWI A;  3A0X A;  2CCU A;  1Y8O A;  2YI7 A;  4HY6 A;  4URO A;  1UY7 A;  3G75 A;  2IWS A;  2XDL A;  1QYE A;  1YSZ A;  3TZ4 A;  4FMT A;  4XD8 A;  4EGI A;  1US7 A;  1I58 A;  1ZWH A;  2YJW A;  4LWE A;  4XTJ A;  4O07 A;  3EKO A;  4EEH A;  4HXZ A;  4HXW A;  3EHH A;  4EM7 A;  4Q20 A;  2HKJ A;  4LWF A;  5F5R A;  1UYH A;  2K5B A;  3Q5K A;  4JAV A;  3RLP A;  2CCS A;  1NHH A;  3T1K A;  3LNU A;  3B25 A;  3ZKB A;  2FYP A;  4E72 A;  1AH8 A;  5M4P A;  1AJ6 A;  2BRC A;  1ID0 A;  2GFD A;  2QFO A;  4U7O A;  3SL2 A;  3HZ1 A;  3VHD A;  2H55 A;  1EA6 A;  2IWX A;  2YK9 A;  3GIG B;  2QG2 A;  1NHI A;  3C11 A;  4P7A A;  2O1U A;  3TZ0 A;  1U2O A;  3MNR P;  3CYG A;  4EGK A;  2YED A;  4XE2 A;  2XCM A;  1YS3 A;  1THN A;  2WI5 A;  2FWY A;  1UY6 A;  4BXI A;  2XDU A;  2YJX A;  2BU6 A;  3CWV A;  3O6O A;  1AMW A;  4CWO A;  5J71 A;  2FWZ A;  3CGY A;  3R92 A;  1QZR A;  4JAU A;  3EKR A;  3OW6 A;  1UYI A;  2YKE A;  3S5T A;  4GT8 A;  4H7Q A;  4ASF A;  1AM1 A;  4JAS A;  3D2R A;  3TTZ A;  4E02 A;  3NMQ A;  1YT1 A;  2Q8F A;  2CH4 A;  3VAD A;  5IN9 A;  4FPP A;  2WER A;  3K99 A;  4B7P A;  4R3M A;  3K98 A;  2XHR A;  1YC3 A;  3OWD A;  3HYZ A;  4KTN A;  1YT0 A;  1BGQ A;  2YKC A;  3TUH A;  4YKW A;  2HCH A;  4EGH A;  3R4N A;  3EHG A;  3PEJ A;  3DGE A;  2QF6 A;  5F3K A;  3ZM7 A;  2WEQ A;  3EHJ A;  3T0Z A;  2YE4 A;  4HY1 A;  1UY9 A;  5CTW A;  2VCJ A;  2YKB A;  3D36 A;  4ASG A;  2IWU A;  3IED A;  2BU8 A;  4R1F A;  3FT8 A;  4GEE A;  4YKU A;  5CF0 A;  2YE2 A;  4V26 A;  1GJV A;  2BRE A;  4O09 A;  1NHJ A;  1F51 A;  3A0Z A;  4W7T A;  4EFU A;  4FCP A;  4HYP A;  4MPE A;  2CCT A;  3O2F A;  4O05 A;  2IOQ A;  4HZ5 A;  4PRX A;  2XJG A;  4HZ0 A;  4YKZ A;  3T0H A;  2YE5 A;  3U67 A;  4NH8 A;  4AWQ A;  4XKO A;  4ASB A;  3CGZ A;  2YEH A;  2CGF A;  4AWP A;  4BQG A;  4YKT A;  2YGF A;  1BXD A;  5FND A;  5CTU A;  2YEC A;  1B63 A;  5J6A A;  2XHT A;  1JM6 A;  2YI5 A;  4GQT A;  4GCZ A;  5CPH A;  2WEP A;  2XD6 A;  1B62 A;  2C1G A;  1I5A A;  3HHU A;  4XCJ A;  5D7C A;  1YSR A;  4QPK A;  2YI6 A;  2YEI A;  4I5S A;  4L93 A;  4GGL A;  2YE3 A;  5IDM A;  3U2D A;  1Z5C A;  2ZBK B;  4BIU A;  3EHF A;  3GIE A;  1A4H A;  5FNF A;  4I3H A;  2WI3 A;  3Q5L A;  5M4E A;  3ZXQ A;  4CE3 A;  4QPJ A;  4MB9 A;  2BU5 A;  2E0A A;  5CTY A;  2BZ5 A;  3Q5J A;  3INX A;  4LWH A;  4CWS A;  4AS9 A;  2YEE A;  5D7R A;  2YEA A;  4CWR A;  4FCR A;  2WI1 A;  4L90 A;  1ZW9 A;  4MP7 A;  2YE6 A;  5FNC A;  3OPD A;  4KSH A;  3O0I A;  2BSM A;  2PNR A;  2XJX A;  4HYM A;  4PRV A;  2YKJ A;  3R91 A;  1I5C A;  4CWF A;  4XIQ A;  4KP4 A;  2XAB A;  4URN A;  4K4O A;  5M4K A;  4YKY A;  1YES A;  3TZ5 A;  4LPB A;  2Q8I A;  1TC6 A;  4XC0 A;  3K97 A;  4MPC A;  3QDD A;  2ZDX A;  4BAE A;  4CE1 A;  4NH7 A;  3RLQ A;  1H7U A;  4URL A;  4XDM A;  4MOT A;  2C1I A;  1TH8 A;  3RLR A;  4WUD A;  2YI0 A;  4XCL A;  4XIP A;  5M4N A;  2UWD A;  1EI1 A;  1YET A;  4O0B A;  2YEG A;  1I5D A;  5BOC A;  2JJC A;  4U7N A;  3OWB A;  2XDS A;  1YER A;  1GKX A;  1Z59 A;  2Q8G A;  3T10 A;  2IOP A;  4KFG A;  2CG9 A;  4U93 A;  2BT0 A;  1GKZ A;  2VCI A;  2FTK A;  4WUB A;  3FV5 A;  4MP2 A;  3R4P A;  2YEJ A;  2YE7 A;  1TID A;  1KIJ A;  4L91 A;  4H81 A;  4BIZ A;  4ASA A;  1H7S A;  2XK2 A;  4L94 A;  4MBC A;  2GQP A;  1MU5 A;  5C93 A;  1UYM A;  2AKP A;  1Y8N A;  3B24 A;  4O04 A;  4XIT A;  1BYQ A;  2HG1 A;  4KSG A;  3G7B A;  4E00 A;  4YKQ A;  1MX0 A;  2XDK A;  5D6Q A;  3OMU A;  2ESA A;  1Y4S A;  1UYL A;  3B28 A;  1UYD A;  1B3Q A;  1Z5B A;  2YE8 A;  2XDX A;  3R4O A;  4ZVI A;  1TC0 A;  5D6P A;  4AWO A;  2WI4 A;  3WQ9 A;  2YGE A;  3H80 A;  4CWQ A;  1S16 A;  5GGZ A;  3HYY A;  4GFN A;  4PL9 A;  1UYC A;  2XHX A;  4CE2 A;  1UYE A;  2C2A A;  3CRK A;  4XKA A;  5BOD A;  3B26 A;  4LWG A;  4WUC A;  1PVG A;  2YEB A;  2BYI A;  2VWC A;  4LP0 A;  4XKK A;  3INW A;  4DZY A;  1UYG A;  5L3J A;  3WHA A;  2WI6 A;  1QY8 A;  4YKX A;  3BM9 A;  1I59 A;  3LMM A;  3PEH A;  1YC4 A;  3G7E A;  4JQL A;  3HZ5 A;  3U2K A;  2FXS A;  3K60 A;  1UYK A;  1IXM A;  4URM A;  1UY8 A;  2BTZ A;  4X9L A;  2Q8H A;  3VHC A;  1KZN A;  2HHI A;  2YE9 A;  4E01 A;  3D0B A;  1UYF A;  5D7D A;  4CWT A;  2XX2 A;  1ZXM A;  2O1V A;  2XX4 A;  4DUH A;  2VW5 A;  1I5B A;  4B6C A;  3A0R A;  4BQJ A;  4ZKI A;  2XX5 A;  1ZXN A;  5IDJ A;  5M4H A;  4XIR A;  4H85 A;  1Y4U A;  2Q2E B;  2YEF A;  4P8O A;  4L8Z A;  2YGA A;  2ZKJ A;  4YKR A;  2XJJ A;  4MPN A;  2YKI A;  4FCQ A;  3TZ2 A;  2QG0 A;  2WI2 A;  3A0W A;  5FWK A;  4EMV A;  1OSF A;  1L0O A;  3JZ3 A;  3R4M A;  1S14 A;  2BYH A;  3BMY A;  2O1W A;  1TBW A;  1BKN A;  1YT2 A;  2H8M A;  2ZDY A;  3VHA A;  3ZKD A;  2JKI A;  4EFT A;  3RKZ A;  1YC1 A;  3GIG A;  3C0E A;  1U0Z A;  2BU2 A;  2EXL A;  3HEK A;  5CTX A;  1Y8P A;  3B27 A;  3FT5 A;  3GIF A;  4KQV A;  3T2S A;  1AH6 A;  3LPS A;  4PU9 A;  5M4M A;  2BU7 A;  3KE6 A;  2IOR A;  3H4L A;  5JEN A;  3CRL A;  2YK2 A;  1TIL A;  4NH9 A;  3ZXO A;  4R3A A;  3QTF A;  1Z5A A; 
#chains in the Genus database with same CATH homology
 3A0T A;  4V25 A;  4CWP A;  4CWN A;  1R62 A;  3A0Y A;  2WI7 A;  4LWI A;  3A0X A;  2CCU A;  1Y8O A;  2YI7 A;  4HY6 A;  4URO A;  1UY7 A;  3G75 A;  2IWS A;  2XDL A;  1QYE A;  1YSZ A;  3TZ4 A;  4FMT A;  4XD8 A;  4EGI A;  1US7 A;  1I58 A;  1ZWH A;  2YJW A;  4LWE A;  4XTJ A;  4O07 A;  3EKO A;  4EEH A;  4HXZ A;  4HXW A;  3EHH A;  4EM7 A;  4Q20 A;  2HKJ A;  4LWF A;  5F5R A;  1UYH A;  2K5B A;  3Q5K A;  4JAV A;  3RLP A;  2CCS A;  1NHH A;  3T1K A;  3LNU A;  3B25 A;  3ZKB A;  2FYP A;  1AH8 A;  5M4P A;  1AJ6 A;  2BRC A;  1ID0 A;  2GFD A;  2QFO A;  4U7O A;  3SL2 A;  3HZ1 A;  3VHD A;  2H55 A;  1EA6 A;  2IWX A;  2YK9 A;  3GIG B;  2QG2 A;  1NHI A;  3C11 A;  4P7A A;  2O1U A;  3TZ0 A;  1U2O A;  3MNR P;  4EGK A;  2YED A;  4XE2 A;  2XCM A;  1YS3 A;  1THN A;  2WI5 A;  2FWY A;  1UY6 A;  4BXI A;  2XDU A;  2YJX A;  2BU6 A;  3CWV A;  3O6O A;  1AMW A;  4CWO A;  5J71 A;  2FWZ A;  3CGY A;  3R92 A;  1QZR A;  4JAU A;  3EKR A;  3OW6 A;  1UYI A;  2YKE A;  4GT8 A;  4H7Q A;  4ASF A;  1AM1 A;  4JAS A;  3D2R A;  3TTZ A;  4E02 A;  3NMQ A;  1YT1 A;  2Q8F A;  2CH4 A;  3VAD A;  5IN9 A;  4FPP A;  2WER A;  3K99 A;  4B7P A;  4R3M A;  3K98 A;  2XHR A;  1YC3 A;  3OWD A;  3HYZ A;  4KTN A;  1YT0 A;  1BGQ A;  2YKC A;  3TUH A;  4YKW A;  2HCH A;  4EGH A;  3R4N A;  3EHG A;  3PEJ A;  3DGE A;  2QF6 A;  5F3K A;  3ZM7 A;  2WEQ A;  3EHJ A;  3T0Z A;  2YE4 A;  4HY1 A;  1UY9 A;  5CTW A;  2VCJ A;  2YKB A;  3D36 A;  4ASG A;  2IWU A;  3IED A;  2BU8 A;  4R1F A;  3FT8 A;  4GEE A;  4YKU A;  5CF0 A;  2YE2 A;  4V26 A;  1GJV A;  2BRE A;  4O09 A;  1NHJ A;  3A0Z A;  4W7T A;  4EFU A;  4FCP A;  4HYP A;  4MPE A;  2CCT A;  3O2F A;  4O05 A;  2IOQ A;  4HZ5 A;  4PRX A;  2XJG A;  4HZ0 A;  4YKZ A;  3T0H A;  2YE5 A;  3U67 A;  4NH8 A;  4AWQ A;  4XKO A;  4ASB A;  3CGZ A;  2YEH A;  2CGF A;  4AWP A;  4BQG A;  4YKT A;  2YGF A;  1BXD A;  5FND A;  5CTU A;  2YEC A;  1B63 A;  5J6A A;  2XHT A;  1JM6 A;  2YI5 A;  4GQT A;  4GCZ A;  5CPH A;  2WEP A;  2XD6 A;  1B62 A;  1I5A A;  3HHU A;  4XCJ A;  5D7C A;  1YSR A;  4QPK A;  2YI6 A;  2YEI A;  4I5S A;  4L93 A;  4GGL A;  2YE3 A;  5IDM A;  3U2D A;  1Z5C A;  2ZBK B;  4BIU A;  3EHF A;  3GIE A;  1A4H A;  5FNF A;  4I3H A;  2WI3 A;  3Q5L A;  5M4E A;  3ZXQ A;  4CE3 A;  4QPJ A;  4MB9 A;  2BU5 A;  2E0A A;  5CTY A;  2BZ5 A;  3Q5J A;  3INX A;  4LWH A;  4CWS A;  4AS9 A;  2YEE A;  5D7R A;  2YEA A;  4CWR A;  4FCR A;  2WI1 A;  4L90 A;  1ZW9 A;  4MP7 A;  2YE6 A;  5FNC A;  3OPD A;  4KSH A;  3O0I A;  2BSM A;  2PNR A;  2XJX A;  4HYM A;  4PRV A;  2YKJ A;  3R91 A;  1I5C A;  4CWF A;  4XIQ A;  4KP4 A;  2XAB A;  4URN A;  4K4O A;  5M4K A;  4YKY A;  1YES A;  3TZ5 A;  4LPB A;  2Q8I A;  1TC6 A;  4XC0 A;  3K97 A;  4MPC A;  3QDD A;  2ZDX A;  4BAE A;  4CE1 A;  4NH7 A;  3RLQ A;  1H7U A;  4URL A;  4XDM A;  4MOT A;  1TH8 A;  3RLR A;  4WUD A;  2YI0 A;  4XCL A;  4XIP A;  5M4N A;  2UWD A;  1EI1 A;  1YET A;  4O0B A;  2YEG A;  1I5D A;  5BOC A;  2JJC A;  4U7N A;  3OWB A;  2XDS A;  1YER A;  1GKX A;  1Z59 A;  2Q8G A;  3T10 A;  2IOP A;  4KFG A;  2CG9 A;  4U93 A;  2BT0 A;  1GKZ A;  2VCI A;  4WUB A;  3FV5 A;  4MP2 A;  3R4P A;  2YEJ A;  2YE7 A;  1TID A;  1KIJ A;  4L91 A;  4H81 A;  4BIZ A;  4ASA A;  1H7S A;  2XK2 A;  4L94 A;  4MBC A;  2GQP A;  1MU5 A;  5C93 A;  1UYM A;  2AKP A;  1Y8N A;  3B24 A;  4O04 A;  4XIT A;  1BYQ A;  2HG1 A;  4KSG A;  3G7B A;  4E00 A;  4YKQ A;  1MX0 A;  2XDK A;  5D6Q A;  3OMU A;  2ESA A;  1Y4S A;  1UYL A;  3B28 A;  1UYD A;  1B3Q A;  1Z5B A;  2YE8 A;  2XDX A;  3R4O A;  4ZVI A;  1TC0 A;  5D6P A;  4AWO A;  2WI4 A;  3WQ9 A;  2YGE A;  3H80 A;  4CWQ A;  1S16 A;  5GGZ A;  3HYY A;  4GFN A;  4PL9 A;  1UYC A;  2XHX A;  4CE2 A;  1UYE A;  2C2A A;  3CRK A;  4XKA A;  5BOD A;  3B26 A;  4LWG A;  4WUC A;  1PVG A;  2YEB A;  2BYI A;  2VWC A;  4LP0 A;  4XKK A;  3INW A;  4DZY A;  1UYG A;  5L3J A;  3WHA A;  2WI6 A;  1QY8 A;  4YKX A;  3BM9 A;  1I59 A;  3PEH A;  1YC4 A;  3G7E A;  4JQL A;  3HZ5 A;  3U2K A;  2FXS A;  3K60 A;  1UYK A;  4URM A;  1UY8 A;  2BTZ A;  4X9L A;  2Q8H A;  3VHC A;  1KZN A;  2YE9 A;  4E01 A;  3D0B A;  1UYF A;  5D7D A;  4CWT A;  2XX2 A;  1ZXM A;  2O1V A;  2XX4 A;  4DUH A;  2VW5 A;  1I5B A;  4B6C A;  3A0R A;  4BQJ A;  4ZKI A;  2XX5 A;  1ZXN A;  5IDJ A;  5M4H A;  4XIR A;  4H85 A;  1Y4U A;  2Q2E B;  2YEF A;  4P8O A;  4L8Z A;  2YGA A;  2ZKJ A;  4YKR A;  2XJJ A;  4MPN A;  2YKI A;  4FCQ A;  3TZ2 A;  2QG0 A;  2WI2 A;  3A0W A;  5FWK A;  4EMV A;  1OSF A;  1L0O A;  3JZ3 A;  3R4M A;  1S14 A;  2BYH A;  3BMY A;  2O1W A;  1TBW A;  1BKN A;  1YT2 A;  2H8M A;  2ZDY A;  3VHA A;  3ZKD A;  2JKI A;  4EFT A;  3RKZ A;  1YC1 A;  3GIG A;  3C0E A;  1U0Z A;  2BU2 A;  2EXL A;  3HEK A;  5CTX A;  1Y8P A;  3B27 A;  3FT5 A;  3GIF A;  4KQV A;  3T2S A;  1AH6 A;  3LPS A;  4PU9 A;  5M4M A;  2BU7 A;  3KE6 A;  2IOR A;  3H4L A;  3CRL A;  2YK2 A;  1TIL A;  4NH9 A;  3ZXO A;  4R3A A;  3QTF A;  1Z5A A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...