1I59A

Structure of the histidine kinase chea atp-binding domain in complex with adpnp and magensium
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
188
structure length
180
Chain Sequence
b'SHMVPISFVFNRFPRMVRDLAKKMNKEVNFIMRGEDTELDRTFVEEIGEPLLHLLRNAIDHGIEPKEERIAKGKPPIGTLILSARHEGNNVVIEVEDDGRGIDKEKIIRKAIEKGLIDESKAATLSDQEILNFLFVPGFSTKRGVGMDVVKNVVESLNGSISIESEKDKGTKVTIRLPLT'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords CHEMOTAXIS PROTEIN CHEA
publication title Nucleotide binding by the histidine kinase CheA.
pubmed doi rcsb
source organism Thermotoga maritima
molecule tags Signaling protein, transferase
total genus 57
structure length 180
sequence length 188
chains with identical sequence B
ec nomenclature ec 2.7.13.3: Histidine kinase.
pdb deposition date 2001-02-26
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.565.10 Alpha Beta 2-Layer Sandwich Heat Shock Protein 90 Histidine kinase-like ATPase, C-terminal domain 1i59A00
4KSGA 4L90A 2XX4A 2YK2A 4GCZA 4YKUA 5GGZA 4YKWA 4HY6A 3T1KA 4P7AA 4AS9A 5M4HA 2Q8GA 1YS3A 4MPNA 1ZWHA 5M4PA 1MU5A 4LWHA 3BM9A 3HZ1A 4PU9A 3TUHA 4AWOA 2QF6A 3D0BA 2BZ5A 3OMUA 3R92A 4CWOA 1AM1A 4WUDA 3R91A 3HYZA 3WHAA 4MBCA 2YEJA 2WI3A 2YI5A 4CWPA 2YKEA 4NH7A 4R3MA 3TZ0A 1UYIA 4H85A 4LWGA 1UYEA 2O1WA 4HXZA 4MPCA 3Q5KA 2XCMA 4CWNA 2CCTA 1GKZA 3QTFA 3PEJA 3GIEA 2FWZA 1US7A 3DGEA 5CTUA 3T0ZA 3K98A 2O1UA 5CPHA 4O0BA 5C93A 3ZXQA 4HZ5A 1ID0A 3R4NA 2YE4A 5FWKA 1YC3A 4EFUA 3U2DA 4NH8A 4BQJA 3T10A 2JJCA 2CCSA 4GEEA 2YGEA 4YKQA 2YGFA 4CWRA 3H80A 4O07A 4CE3A 4ASAA 4FPPA 5CF0A 1I5DA 4EEHA 3LNUA 4YKYA 2IORA 4WUCA 3O6OA 4KP4A 1YT1A 1U0ZA 2YKCA 2BREA 2VW5A 4L91A 4JAVA 3C11A 1U2OA 5J71A 3INWA 2WI2A 2K5BA 1AH8A 2YK9A 1KIJA 2CCUA 3U67A 3VHAA 4UROA 1Y4SA 3Q5JA 3INXA 4XKOA 2JKIA 2XHXA 4BAEA 4I3HA 1QZRA 3JZ3A 5CTYA 2BTZA 4O04A 4PRVA 1UYFA 1UYMA 4L94A 2YE2A 5M4EA 1YC1A 2E0AA 2XDSA 3GIFA 3GIGB 3O0IA 1EA6A 4XIRA 3NMQA 2XX2A 1A4HA 3ZM7A 1Y8OA 1UYKA 3TZ4A 1THNA 2FXSA 4DUHA 1ZXMA 2XDKA 4XIPA 2YKIA 1I5BA 3HHUA 2WI6A 1BGQA 3RLPA 2YEIA 1I5CA 3K99A 4R3AA 4ASGA 3B28A 1NHHA 5BOCA 4L8ZA 4MP7A 3CWVA 4BIUA 1I58A 4XC0A 3FT8A 4CWQA 4PRXA 4XTJA 1Z5BA 4LPBA 3IEDA 2YGAA 4GT8A 2XX5A 4H7QA 4U7OA 5IN9A 3A0XA 4CE1A 3EHGA 1TIDA 2BRCA 3EHHA 3B27A 2HKJA 4AWQA 5FNFA 3TTZA 2WEPA 3R4PA 4I5SA 4YKTA 2YI7A 1NHIA 2XJXA 4HYPA 3K60A 4K4OA 4FMTA 1NHJA 5M4MA 2EXLA 3OWDA 3VHDA 3OW6A 2WEQA 5FNCA 3PEHA 3ZXOA 4CWSA 1YETA 4LWEA 2YEAA 3LPSA 1H7SA 3T0HA 5FNDA 4CE2A 1Z5CA 5D7DA 2XHTA 5D7RA 2YEDA 4HYMA 3MNRP 2XABA 3K97A 4DZYA 4JASA 1YC4A 2Q8FA 2BSMA 4FCPA 2ZDXA 3FT5A 4ZVIA 1UY7A 4V26A 3QDDA 4XKKA 3A0RA 3TZ2A 3G7BA 2FYPA 1BKNA 4EFTA 1Y8NA 1B62A 2IOPA 1S14A 1ZXNA 2XD6A 3Q5LA 2YJXA 4JAUA 2WI1A 1BYQA 4XCJA 1UYLA 4XIQA 2XJJA 4YKXA 4O05A 2WI7A 4X9LA 3B26A 4EM7A 5IDJA 4MB9A 2YE3A 1B63A 1UY6A 2H8MA 3KE6A 4BIZA 4LP0A 1TH8A 2Q8IA 3H4LA 4HXWA 1GJVA 4ZKIA 1BXDA 1UY8A 5D7CA 4LWIA 3EHJA 4EGHA 3GIGA 3A0WA 4ASFA 3VHCA 1PVGA 1KZNA 2QG0A 3HYYA 2YEBA 4HY1A 5M4NA 1I5AA 2YECA 4LWFA 4XCLA 4XD8A 5F3KA 4BQGA 5M4KA 4EGIA 2YE9A 3EHFA 2XK2A 4GFNA 4MPEA 2YEFA 2VWCA 1YSZA 5D6PA 2XHRA 1I59A 4YKZA 4YKRA 2IOQA 1MX0A 4KSHA 3EKOA 1R62A 1L0OA 3A0ZA 2Q2EB 3G75A 4MP2A 2YE8A 2XDXA 3RLQA 1YERA 1UYCA 3CGYA 3RLRA 1AH6A 3D2RA 1Y4UA 1H7UA 4L93A 3T2SA 4HZ0A 1JM6A 2GFDA 1AMWA 3C0EA 4E02A 4QPJA 2YKBA 2BU2A 4XDMA 3OWBA 1S16A 4E00A 5D6QA 2CH4A 1ZW9A 2IWUA 3U2KA 4WUBA 3TZ5A 4U7NA 2YKJA 2YEGA 5CTWA 4U93A 2YJWA 2IWSA 2XDUA 2VCJA 2WI5A 2BT0A 3O2FA 1YSRA 4V25A 4XKAA 2WERA 3A0TA 2YE6A 4PL9A 3HEKA 4NH9A 2HG1A 1UYHA 4URMA 2BU8A 3B24A 4URLA 4BXIA 4XITA 4P8OA 4JQLA 4O09A 2Q8HA 1UY9A 5F5RA 1Z59A 2BU5A 1YT2A 4H81A 3B25A 5L3JA 2BYHA 4KTNA 3VADA 2CG9A 2YI0A 4MOTA 5BODA 4GGLA 2ZBKB 2BU7A 2H55A 3G7EA 2YE5A 5CTXA 4E01A 3ZKBA 3EKRA 2AKPA 2BYIA 2HCHA 2YI6A 1QYEA 1B3QA 1TBWA 4FCRA 2O1VA 2WI4A 1TC6A 1Z5AA 4R1FA 1GKXA 4GQTA 2ESAA 3ZKDA 4AWPA 1YESA 3CRLA 3R4OA 4B7PA 1YT0A 2IWXA 2YE7A 3CGZA 2QFOA 4EGKA 4CWTA 1OSFA 1UYGA 4QPKA 3HZ5A 2ZDYA 2PNRA 4Q20A 1EI1A 2CGFA 2XDLA 2C2AA 5J6AA 3A0YA 4XE2A 1TILA 2VCIA 2FWYA 1AJ6A 2YEHA 2BU6A 1QY8A 1TC0A 4B6CA 3CRKA 4ASBA 2GQPA 2QG2A 1UYDA 2UWDA 4KQVA 2ZKJA 3SL2A 4URNA 4EMVA 3OPDA 4KFGA 4FCQA 1Y8PA 5IDMA 3RKZA 2YEEA 3D36A 4W7TA 3BMYA 3FV5A 4CWFA 2XJGA 3R4MA 3WQ9A
chains in the Genus database with same CATH superfamily
4KSGA 4L90A 2XX4A 2YK2A 4GCZA 4YKUA 5GGZA 4YKWA 4HY6A 3T1KA 4P7AA 4AS9A 5M4HA 2Q8GA 1YS3A 4MPNA 1ZWHA 5M4PA 1MU5A 4LWHA 3BM9A 3HZ1A 4PU9A 3TUHA 4AWOA 2QF6A 3D0BA 2BZ5A 3OMUA 3R92A 4CWOA 1AM1A 4WUDA 3R91A 3HYZA 3WHAA 4MBCA 2YEJA 2WI3A 2YI5A 4CWPA 2YKEA 4NH7A 4R3MA 3TZ0A 1UYIA 4H85A 4LWGA 1UYEA 2O1WA 4HXZA 4MPCA 3Q5KA 5JENA 2XCMA 3LMMA 4CWNA 2CCTA 1GKZA 3QTFA 3PEJA 3GIEA 2FWZA 1US7A 3DGEA 5CTUA 3T0ZA 3K98A 2O1UA 5CPHA 4O0BA 5C93A 3ZXQA 4HZ5A 1ID0A 3R4NA 2YE4A 5FWKA 1YC3A 4EFUA 3U2DA 4NH8A 4BQJA 3T10A 2JJCA 2CCSA 4GEEA 2HHIA 2YGEA 4YKQA 2YGFA 4CWRA 3H80A 4O07A 4E72A 4CE3A 4ASAA 4FPPA 5CF0A 1I5DA 4EEHA 3LNUA 4YKYA 2IORA 4WUCA 3O6OA 4KP4A 1YT1A 1U0ZA 2YKCA 2BREA 2VW5A 4L91A 4JAVA 3C11A 1U2OA 5J71A 3INWA 2WI2A 2K5BA 1AH8A 2YK9A 1KIJA 2CCUA 3U67A 3VHAA 4UROA 1Y4SA 3Q5JA 3INXA 4XKOA 2JKIA 2XHXA 4BAEA 4I3HA 1QZRA 2C1GA 3JZ3A 5CTYA 2BTZA 4O04A 4PRVA 1UYFA 1UYMA 4L94A 2YE2A 5M4EA 1YC1A 2E0AA 2XDSA 3GIFA 3GIGB 3O0IA 1EA6A 4XIRA 3NMQA 2XX2A 1A4HA 3ZM7A 1Y8OA 1UYKA 3TZ4A 1THNA 2FXSA 4DUHA 1IXMA 1ZXMA 2XDKA 4XIPA 2YKIA 1I5BA 3HHUA 2WI6A 1BGQA 3RLPA 2YEIA 1I5CA 3K99A 4R3AA 4ASGA 3B28A 1NHHA 5BOCA 4L8ZA 4MP7A 3CWVA 4BIUA 1I58A 4XC0A 3FT8A 4CWQA 4PRXA 4XTJA 1Z5BA 4LPBA 3IEDA 2YGAA 4GT8A 2XX5A 4H7QA 4U7OA 5IN9A 3A0XA 4CE1A 3EHGA 1TIDA 2BRCA 3EHHA 3B27A 2HKJA 4AWQA 5FNFA 3TTZA 2WEPA 3R4PA 4I5SA 4YKTA 2YI7A 1NHIA 2XJXA 4HYPA 3K60A 4K4OA 4FMTA 1NHJA 5M4MA 2EXLA 3OWDA 3VHDA 3OW6A 2WEQA 5FNCA 3PEHA 3ZXOA 4CWSA 1YETA 4LWEA 2YEAA 3LPSA 1H7SA 3T0HA 5FNDA 4CE2A 1Z5CA 5D7DA 2XHTA 5D7RA 2YEDA 4HYMA 3MNRP 2XABA 3K97A 4DZYA 4JASA 1YC4A 2Q8FA 2BSMA 4FCPA 2ZDXA 3FT5A 4ZVIA 1UY7A 4V26A 3QDDA 4XKKA 3A0RA 3TZ2A 3G7BA 2FYPA 1BKNA 4EFTA 1Y8NA 1B62A 2IOPA 1S14A 1ZXNA 2XD6A 3Q5LA 2YJXA 4JAUA 2WI1A 1BYQA 4XCJA 1UYLA 4XIQA 2XJJA 4YKXA 4O05A 2WI7A 4X9LA 3B26A 4EM7A 5IDJA 4MB9A 2YE3A 1B63A 1UY6A 2H8MA 3KE6A 4BIZA 4LP0A 1TH8A 2Q8IA 3H4LA 4HXWA 1GJVA 4ZKIA 1BXDA 1UY8A 5D7CA 4LWIA 3EHJA 4EGHA 3GIGA 3A0WA 4ASFA 3VHCA 1PVGA 1KZNA 2QG0A 3HYYA 2YEBA 4HY1A 5M4NA 1I5AA 2YECA 4LWFA 4XCLA 4XD8A 5F3KA 4BQGA 5M4KA 4EGIA 2YE9A 3EHFA 2XK2A 4GFNA 4MPEA 2YEFA 2VWCA 1YSZA 5D6PA 2XHRA 1I59A 4YKZA 4YKRA 2IOQA 1MX0A 4KSHA 3EKOA 1R62A 1L0OA 3A0ZA 2Q2EB 3G75A 4MP2A 2YE8A 2XDXA 3RLQA 1YERA 1UYCA 3CGYA 3RLRA 1AH6A 3D2RA 1Y4UA 1H7UA 4L93A 3T2SA 4HZ0A 1JM6A 2GFDA 1AMWA 3C0EA 4E02A 4QPJA 1F51A 2YKBA 2BU2A 4XDMA 3OWBA 1S16A 4E00A 5D6QA 2CH4A 1ZW9A 2IWUA 3U2KA 3S5TA 4WUBA 3TZ5A 4U7NA 2YKJA 2YEGA 5CTWA 4U93A 2YJWA 2IWSA 2XDUA 2VCJA 2WI5A 2BT0A 3O2FA 1YSRA 4V25A 4XKAA 2WERA 3A0TA 2YE6A 4PL9A 3HEKA 4NH9A 2HG1A 1UYHA 4URMA 2BU8A 3B24A 4URLA 4BXIA 4XITA 4P8OA 4JQLA 4O09A 2Q8HA 1UY9A 5F5RA 1Z59A 2C1IA 2BU5A 1YT2A 4H81A 3B25A 5L3JA 2BYHA 4KTNA 2FTKA 3VADA 2CG9A 2YI0A 4MOTA 5BODA 4GGLA 2ZBKB 2BU7A 2H55A 3G7EA 2YE5A 5CTXA 4E01A 3ZKBA 3EKRA 2AKPA 2BYIA 2HCHA 2YI6A 1QYEA 1B3QA 1TBWA 4FCRA 2O1VA 2WI4A 1TC6A 1Z5AA 4R1FA 1GKXA 4GQTA 2ESAA 3ZKDA 4AWPA 1YESA 3CRLA 3R4OA 4B7PA 1YT0A 2IWXA 2YE7A 3CGZA 2QFOA 4EGKA 4CWTA 1OSFA 1UYGA 4QPKA 3HZ5A 2ZDYA 2PNRA 4Q20A 1EI1A 2CGFA 2XDLA 2C2AA 5J6AA 3A0YA 4XE2A 1TILA 2VCIA 2FWYA 1AJ6A 2YEHA 2BU6A 1QY8A 1TC0A 4B6CA 3CRKA 4ASBA 2GQPA 2QG2A 1UYDA 2UWDA 4KQVA 2ZKJA 3SL2A 4URNA 4EMVA 3OPDA 4KFGA 4FCQA 1Y8PA 5IDMA 3RKZA 2YEEA 3D36A 4W7TA 3BMYA 3FV5A 4CWFA 2XJGA 3R4MA 3CYGA 3WQ9A
chains in the Genus database with same CATH topology
4KSGA 4L90A 2XX4A 2YK2A 4GCZA 4YKUA 5GGZA 4YKWA 4HY6A 3T1KA 4P7AA 4AS9A 5M4HA 2Q8GA 1YS3A 4MPNA 1ZWHA 5M4PA 1MU5A 4LWHA 3BM9A 3HZ1A 4PU9A 3TUHA 4AWOA 2QF6A 3D0BA 2BZ5A 3OMUA 3R92A 4CWOA 1AM1A 4WUDA 3R91A 3HYZA 3WHAA 4MBCA 2YEJA 2WI3A 2YI5A 4CWPA 2YKEA 4NH7A 4R3MA 3TZ0A 1UYIA 4H85A 4LWGA 1UYEA 2O1WA 4HXZA 4MPCA 3Q5KA 2XCMA 4CWNA 2CCTA 1GKZA 3QTFA 3PEJA 3GIEA 2FWZA 1US7A 3DGEA 5CTUA 3T0ZA 3K98A 2O1UA 5CPHA 4O0BA 5C93A 3ZXQA 4HZ5A 1ID0A 3R4NA 2YE4A 5FWKA 1YC3A 4EFUA 3U2DA 4NH8A 4BQJA 3T10A 2JJCA 2CCSA 4GEEA 2YGEA 4YKQA 2YGFA 4CWRA 3H80A 4O07A 4CE3A 4ASAA 4FPPA 5CF0A 1I5DA 4EEHA 3LNUA 4YKYA 2IORA 4WUCA 3O6OA 4KP4A 1YT1A 1U0ZA 2YKCA 2BREA 2VW5A 4L91A 4JAVA 3C11A 1U2OA 5J71A 3INWA 2WI2A 2K5BA 1AH8A 2YK9A 1KIJA 2CCUA 3U67A 3VHAA 4UROA 1Y4SA 3Q5JA 3INXA 4XKOA 2JKIA 2XHXA 4BAEA 4I3HA 1QZRA 3JZ3A 5CTYA 2BTZA 4O04A 4PRVA 1UYFA 1UYMA 4L94A 2YE2A 5M4EA 1YC1A 2E0AA 2XDSA 3GIFA 3GIGB 3O0IA 1EA6A 4XIRA 3NMQA 2XX2A 1A4HA 3ZM7A 1Y8OA 1UYKA 3TZ4A 1THNA 2FXSA 4DUHA 1ZXMA 2XDKA 4XIPA 2YKIA 1I5BA 3HHUA 2WI6A 1BGQA 3RLPA 2YEIA 1I5CA 3K99A 4R3AA 4ASGA 3B28A 1NHHA 5BOCA 4L8ZA 4MP7A 3CWVA 4BIUA 1I58A 4XC0A 3FT8A 4CWQA 4PRXA 4XTJA 1Z5BA 4LPBA 3IEDA 2YGAA 4GT8A 2XX5A 4H7QA 4U7OA 5IN9A 3A0XA 4CE1A 3EHGA 1TIDA 2BRCA 3EHHA 3B27A 2HKJA 4AWQA 5FNFA 3TTZA 2WEPA 3R4PA 4I5SA 4YKTA 2YI7A 1NHIA 2XJXA 4HYPA 3K60A 4K4OA 4FMTA 1NHJA 5M4MA 2EXLA 3OWDA 3VHDA 3OW6A 2WEQA 5FNCA 3PEHA 3ZXOA 4CWSA 1YETA 4LWEA 2YEAA 3LPSA 1H7SA 3T0HA 5FNDA 4CE2A 1Z5CA 5D7DA 2XHTA 5D7RA 2YEDA 4HYMA 3MNRP 2XABA 3K97A 4DZYA 4JASA 1YC4A 2Q8FA 2BSMA 4FCPA 2ZDXA 3FT5A 4ZVIA 1UY7A 4V26A 3QDDA 4XKKA 3A0RA 3TZ2A 3G7BA 2FYPA 1BKNA 4EFTA 1Y8NA 1B62A 2IOPA 1S14A 1ZXNA 2XD6A 3Q5LA 2YJXA 4JAUA 2WI1A 1BYQA 4XCJA 1UYLA 4XIQA 2XJJA 4YKXA 4O05A 2WI7A 4X9LA 3B26A 4EM7A 5IDJA 4MB9A 2YE3A 1B63A 1UY6A 2H8MA 3KE6A 4BIZA 4LP0A 1TH8A 2Q8IA 3H4LA 4HXWA 1GJVA 4ZKIA 1BXDA 1UY8A 5D7CA 4LWIA 3EHJA 4EGHA 3GIGA 3A0WA 4ASFA 3VHCA 1PVGA 1KZNA 2QG0A 3HYYA 2YEBA 4HY1A 5M4NA 1I5AA 2YECA 4LWFA 4XCLA 4XD8A 5F3KA 4BQGA 5M4KA 4EGIA 2YE9A 3EHFA 2XK2A 4GFNA 4MPEA 2YEFA 2VWCA 1YSZA 5D6PA 2XHRA 1I59A 4YKZA 4YKRA 2IOQA 1MX0A 4KSHA 3EKOA 1R62A 1L0OA 3A0ZA 2Q2EB 3G75A 4MP2A 2YE8A 2XDXA 3RLQA 1YERA 1UYCA 3CGYA 3RLRA 1AH6A 3D2RA 1Y4UA 1H7UA 4L93A 3T2SA 4HZ0A 1JM6A 2GFDA 1AMWA 3C0EA 4E02A 4QPJA 2YKBA 2BU2A 4XDMA 3OWBA 1S16A 4E00A 5D6QA 2CH4A 1ZW9A 2IWUA 3U2KA 4WUBA 3TZ5A 4U7NA 2YKJA 2YEGA 5CTWA 4U93A 2YJWA 2IWSA 2XDUA 2VCJA 2WI5A 2BT0A 3O2FA 1YSRA 4V25A 4XKAA 2WERA 3A0TA 2YE6A 4PL9A 3HEKA 4NH9A 2HG1A 1UYHA 4URMA 2BU8A 3B24A 4URLA 4BXIA 4XITA 4P8OA 4JQLA 4O09A 2Q8HA 1UY9A 5F5RA 1Z59A 2BU5A 1YT2A 4H81A 3B25A 5L3JA 2BYHA 4KTNA 3VADA 2CG9A 2YI0A 4MOTA 5BODA 4GGLA 2ZBKB 2BU7A 2H55A 3G7EA 2YE5A 5CTXA 4E01A 3ZKBA 3EKRA 2AKPA 2BYIA 2HCHA 2YI6A 1QYEA 1B3QA 1TBWA 4FCRA 2O1VA 2WI4A 1TC6A 1Z5AA 4R1FA 1GKXA 4GQTA 2ESAA 3ZKDA 4AWPA 1YESA 3CRLA 3R4OA 4B7PA 1YT0A 2IWXA 2YE7A 3CGZA 2QFOA 4EGKA 4CWTA 1OSFA 1UYGA 4QPKA 3HZ5A 2ZDYA 2PNRA 4Q20A 1EI1A 2CGFA 2XDLA 2C2AA 5J6AA 3A0YA 4XE2A 1TILA 2VCIA 2FWYA 1AJ6A 2YEHA 2BU6A 1QY8A 1TC0A 4B6CA 3CRKA 4ASBA 2GQPA 2QG2A 1UYDA 2UWDA 4KQVA 2ZKJA 3SL2A 4URNA 4EMVA 3OPDA 4KFGA 4FCQA 1Y8PA 5IDMA 3RKZA 2YEEA 3D36A 4W7TA 3BMYA 3FV5A 4CWFA 2XJGA 3R4MA 3WQ9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4KSG A;  4L90 A;  2XX4 A;  2YK2 A;  4GCZ A;  4YKU A;  5GGZ A;  4YKW A;  4HY6 A;  3T1K A;  4P7A A;  4AS9 A;  5M4H A;  2Q8G A;  1YS3 A;  4MPN A;  1ZWH A;  5M4P A;  1MU5 A;  4LWH A;  3BM9 A;  3HZ1 A;  4PU9 A;  3TUH A;  4AWO A;  2QF6 A;  3D0B A;  2BZ5 A;  3OMU A;  3R92 A;  4CWO A;  1AM1 A;  4WUD A;  3R91 A;  3HYZ A;  3WHA A;  4MBC A;  2YEJ A;  2WI3 A;  2YI5 A;  4CWP A;  2YKE A;  4NH7 A;  4R3M A;  3TZ0 A;  1UYI A;  4H85 A;  4LWG A;  1UYE A;  2O1W A;  4HXZ A;  4MPC A;  3Q5K A;  2XCM A;  4CWN A;  2CCT A;  1GKZ A;  3QTF A;  3PEJ A;  3GIE A;  2FWZ A;  1US7 A;  3DGE A;  5CTU A;  3T0Z A;  3K98 A;  2O1U A;  5CPH A;  4O0B A;  5C93 A;  3ZXQ A;  4HZ5 A;  1ID0 A;  3R4N A;  2YE4 A;  5FWK A;  1YC3 A;  4EFU A;  3U2D A;  4NH8 A;  4BQJ A;  3T10 A;  2JJC A;  2CCS A;  4GEE A;  2YGE A;  4YKQ A;  2YGF A;  4CWR A;  3H80 A;  4O07 A;  4CE3 A;  4ASA A;  4FPP A;  5CF0 A;  1I5D A;  4EEH A;  3LNU A;  4YKY A;  2IOR A;  4WUC A;  3O6O A;  4KP4 A;  1YT1 A;  1U0Z A;  2YKC A;  2BRE A;  2VW5 A;  4L91 A;  4JAV A;  3C11 A;  1U2O A;  5J71 A;  3INW A;  2WI2 A;  2K5B A;  1AH8 A;  2YK9 A;  1KIJ A;  2CCU A;  3U67 A;  3VHA A;  4URO A;  1Y4S A;  3Q5J A;  3INX A;  4XKO A;  2JKI A;  2XHX A;  4BAE A;  4I3H A;  1QZR A;  3JZ3 A;  5CTY A;  2BTZ A;  4O04 A;  4PRV A;  1UYF A;  1UYM A;  4L94 A;  2YE2 A;  5M4E A;  1YC1 A;  2E0A A;  2XDS A;  3GIF A;  3GIG B;  3O0I A;  1EA6 A;  4XIR A;  3NMQ A;  2XX2 A;  1A4H A;  3ZM7 A;  1Y8O A;  1UYK A;  3TZ4 A;  1THN A;  2FXS A;  4DUH A;  1ZXM A;  2XDK A;  4XIP A;  2YKI A;  1I5B A;  3HHU A;  2WI6 A;  1BGQ A;  3RLP A;  2YEI A;  1I5C A;  3K99 A;  4R3A A;  4ASG A;  3B28 A;  1NHH A;  5BOC A;  4L8Z A;  4MP7 A;  3CWV A;  4BIU A;  1I58 A;  4XC0 A;  3FT8 A;  4CWQ A;  4PRX A;  4XTJ A;  1Z5B A;  4LPB A;  3IED A;  2YGA A;  4GT8 A;  2XX5 A;  4H7Q A;  4U7O A;  5IN9 A;  3A0X A;  4CE1 A;  3EHG A;  1TID A;  2BRC A;  3EHH A;  3B27 A;  2HKJ A;  4AWQ A;  5FNF A;  3TTZ A;  2WEP A;  3R4P A;  4I5S A;  4YKT A;  2YI7 A;  1NHI A;  2XJX A;  4HYP A;  3K60 A;  4K4O A;  4FMT A;  1NHJ A;  5M4M A;  2EXL A;  3OWD A;  3VHD A;  3OW6 A;  2WEQ A;  5FNC A;  3PEH A;  3ZXO A;  4CWS A;  1YET A;  4LWE A;  2YEA A;  3LPS A;  1H7S A;  3T0H A;  5FND A;  4CE2 A;  1Z5C A;  5D7D A;  2XHT A;  5D7R A;  2YED A;  4HYM A;  3MNR P;  2XAB A;  3K97 A;  4DZY A;  4JAS A;  1YC4 A;  2Q8F A;  2BSM A;  4FCP A;  2ZDX A;  3FT5 A;  4ZVI A;  1UY7 A;  4V26 A;  3QDD A;  4XKK A;  3A0R A;  3TZ2 A;  3G7B A;  2FYP A;  1BKN A;  4EFT A;  1Y8N A;  1B62 A;  2IOP A;  1S14 A;  1ZXN A;  2XD6 A;  3Q5L A;  2YJX A;  4JAU A;  2WI1 A;  1BYQ A;  4XCJ A;  1UYL A;  4XIQ A;  2XJJ A;  4YKX A;  4O05 A;  2WI7 A;  4X9L A;  3B26 A;  4EM7 A;  5IDJ A;  4MB9 A;  2YE3 A;  1B63 A;  1UY6 A;  2H8M A;  3KE6 A;  4BIZ A;  4LP0 A;  1TH8 A;  2Q8I A;  3H4L A;  4HXW A;  1GJV A;  4ZKI A;  1BXD A;  1UY8 A;  5D7C A;  4LWI A;  3EHJ A;  4EGH A;  3GIG A;  3A0W A;  4ASF A;  3VHC A;  1PVG A;  1KZN A;  2QG0 A;  3HYY A;  2YEB A;  4HY1 A;  5M4N A;  1I5A A;  2YEC A;  4LWF A;  4XCL A;  4XD8 A;  5F3K A;  4BQG A;  5M4K A;  4EGI A;  2YE9 A;  3EHF A;  2XK2 A;  4GFN A;  4MPE A;  2YEF A;  2VWC A;  1YSZ A;  5D6P A;  2XHR A;  1I59 A;  4YKZ A;  4YKR A;  2IOQ A;  1MX0 A;  4KSH A;  3EKO A;  1R62 A;  1L0O A;  3A0Z A;  2Q2E B;  3G75 A;  4MP2 A;  2YE8 A;  2XDX A;  3RLQ A;  1YER A;  1UYC A;  3CGY A;  3RLR A;  1AH6 A;  3D2R A;  1Y4U A;  1H7U A;  4L93 A;  3T2S A;  4HZ0 A;  1JM6 A;  2GFD A;  1AMW A;  3C0E A;  4E02 A;  4QPJ A;  2YKB A;  2BU2 A;  4XDM A;  3OWB A;  1S16 A;  4E00 A;  5D6Q A;  2CH4 A;  1ZW9 A;  2IWU A;  3U2K A;  4WUB A;  3TZ5 A;  4U7N A;  2YKJ A;  2YEG A;  5CTW A;  4U93 A;  2YJW A;  2IWS A;  2XDU A;  2VCJ A;  2WI5 A;  2BT0 A;  3O2F A;  1YSR A;  4V25 A;  4XKA A;  2WER A;  3A0T A;  2YE6 A;  4PL9 A;  3HEK A;  4NH9 A;  2HG1 A;  1UYH A;  4URM A;  2BU8 A;  3B24 A;  4URL A;  4BXI A;  4XIT A;  4P8O A;  4JQL A;  4O09 A;  2Q8H A;  1UY9 A;  5F5R A;  1Z59 A;  2BU5 A;  1YT2 A;  4H81 A;  3B25 A;  5L3J A;  2BYH A;  4KTN A;  3VAD A;  2CG9 A;  2YI0 A;  4MOT A;  5BOD A;  4GGL A;  2ZBK B;  2BU7 A;  2H55 A;  3G7E A;  2YE5 A;  5CTX A;  4E01 A;  3ZKB A;  3EKR A;  2AKP A;  2BYI A;  2HCH A;  2YI6 A;  1QYE A;  1B3Q A;  1TBW A;  4FCR A;  2O1V A;  2WI4 A;  1TC6 A;  1Z5A A;  4R1F A;  1GKX A;  4GQT A;  2ESA A;  3ZKD A;  4AWP A;  1YES A;  3CRL A;  3R4O A;  4B7P A;  1YT0 A;  2IWX A;  2YE7 A;  3CGZ A;  2QFO A;  4EGK A;  4CWT A;  1OSF A;  1UYG A;  4QPK A;  3HZ5 A;  2ZDY A;  2PNR A;  4Q20 A;  1EI1 A;  2CGF A;  2XDL A;  2C2A A;  5J6A A;  3A0Y A;  4XE2 A;  1TIL A;  2VCI A;  2FWY A;  1AJ6 A;  2YEH A;  2BU6 A;  1QY8 A;  1TC0 A;  4B6C A;  3CRK A;  4ASB A;  2GQP A;  2QG2 A;  1UYD A;  2UWD A;  4KQV A;  2ZKJ A;  3SL2 A;  4URN A;  4EMV A;  3OPD A;  4KFG A;  4FCQ A;  1Y8P A;  5IDM A;  3RKZ A;  2YEE A;  3D36 A;  4W7T A;  3BMY A;  3FV5 A;  4CWF A;  2XJG A;  3R4M A;  3WQ9 A; 
#chains in the Genus database with same CATH topology
 4KSG A;  4L90 A;  2XX4 A;  2YK2 A;  4GCZ A;  4YKU A;  5GGZ A;  4YKW A;  4HY6 A;  3T1K A;  4P7A A;  4AS9 A;  5M4H A;  2Q8G A;  1YS3 A;  4MPN A;  1ZWH A;  5M4P A;  1MU5 A;  4LWH A;  3BM9 A;  3HZ1 A;  4PU9 A;  3TUH A;  4AWO A;  2QF6 A;  3D0B A;  2BZ5 A;  3OMU A;  3R92 A;  4CWO A;  1AM1 A;  4WUD A;  3R91 A;  3HYZ A;  3WHA A;  4MBC A;  2YEJ A;  2WI3 A;  2YI5 A;  4CWP A;  2YKE A;  4NH7 A;  4R3M A;  3TZ0 A;  1UYI A;  4H85 A;  4LWG A;  1UYE A;  2O1W A;  4HXZ A;  4MPC A;  3Q5K A;  5JEN A;  2XCM A;  3LMM A;  4CWN A;  2CCT A;  1GKZ A;  3QTF A;  3PEJ A;  3GIE A;  2FWZ A;  1US7 A;  3DGE A;  5CTU A;  3T0Z A;  3K98 A;  2O1U A;  5CPH A;  4O0B A;  5C93 A;  3ZXQ A;  4HZ5 A;  1ID0 A;  3R4N A;  2YE4 A;  5FWK A;  1YC3 A;  4EFU A;  3U2D A;  4NH8 A;  4BQJ A;  3T10 A;  2JJC A;  2CCS A;  4GEE A;  2HHI A;  2YGE A;  4YKQ A;  2YGF A;  4CWR A;  3H80 A;  4O07 A;  4E72 A;  4CE3 A;  4ASA A;  4FPP A;  5CF0 A;  1I5D A;  4EEH A;  3LNU A;  4YKY A;  2IOR A;  4WUC A;  3O6O A;  4KP4 A;  1YT1 A;  1U0Z A;  2YKC A;  2BRE A;  2VW5 A;  4L91 A;  4JAV A;  3C11 A;  1U2O A;  5J71 A;  3INW A;  2WI2 A;  2K5B A;  1AH8 A;  2YK9 A;  1KIJ A;  2CCU A;  3U67 A;  3VHA A;  4URO A;  1Y4S A;  3Q5J A;  3INX A;  4XKO A;  2JKI A;  2XHX A;  4BAE A;  4I3H A;  1QZR A;  2C1G A;  3JZ3 A;  5CTY A;  2BTZ A;  4O04 A;  4PRV A;  1UYF A;  1UYM A;  4L94 A;  2YE2 A;  5M4E A;  1YC1 A;  2E0A A;  2XDS A;  3GIF A;  3GIG B;  3O0I A;  1EA6 A;  4XIR A;  3NMQ A;  2XX2 A;  1A4H A;  3ZM7 A;  1Y8O A;  1UYK A;  3TZ4 A;  1THN A;  2FXS A;  4DUH A;  1IXM A;  1ZXM A;  2XDK A;  4XIP A;  2YKI A;  1I5B A;  3HHU A;  2WI6 A;  1BGQ A;  3RLP A;  2YEI A;  1I5C A;  3K99 A;  4R3A A;  4ASG A;  3B28 A;  1NHH A;  5BOC A;  4L8Z A;  4MP7 A;  3CWV A;  4BIU A;  1I58 A;  4XC0 A;  3FT8 A;  4CWQ A;  4PRX A;  4XTJ A;  1Z5B A;  4LPB A;  3IED A;  2YGA A;  4GT8 A;  2XX5 A;  4H7Q A;  4U7O A;  5IN9 A;  3A0X A;  4CE1 A;  3EHG A;  1TID A;  2BRC A;  3EHH A;  3B27 A;  2HKJ A;  4AWQ A;  5FNF A;  3TTZ A;  2WEP A;  3R4P A;  4I5S A;  4YKT A;  2YI7 A;  1NHI A;  2XJX A;  4HYP A;  3K60 A;  4K4O A;  4FMT A;  1NHJ A;  5M4M A;  2EXL A;  3OWD A;  3VHD A;  3OW6 A;  2WEQ A;  5FNC A;  3PEH A;  3ZXO A;  4CWS A;  1YET A;  4LWE A;  2YEA A;  3LPS A;  1H7S A;  3T0H A;  5FND A;  4CE2 A;  1Z5C A;  5D7D A;  2XHT A;  5D7R A;  2YED A;  4HYM A;  3MNR P;  2XAB A;  3K97 A;  4DZY A;  4JAS A;  1YC4 A;  2Q8F A;  2BSM A;  4FCP A;  2ZDX A;  3FT5 A;  4ZVI A;  1UY7 A;  4V26 A;  3QDD A;  4XKK A;  3A0R A;  3TZ2 A;  3G7B A;  2FYP A;  1BKN A;  4EFT A;  1Y8N A;  1B62 A;  2IOP A;  1S14 A;  1ZXN A;  2XD6 A;  3Q5L A;  2YJX A;  4JAU A;  2WI1 A;  1BYQ A;  4XCJ A;  1UYL A;  4XIQ A;  2XJJ A;  4YKX A;  4O05 A;  2WI7 A;  4X9L A;  3B26 A;  4EM7 A;  5IDJ A;  4MB9 A;  2YE3 A;  1B63 A;  1UY6 A;  2H8M A;  3KE6 A;  4BIZ A;  4LP0 A;  1TH8 A;  2Q8I A;  3H4L A;  4HXW A;  1GJV A;  4ZKI A;  1BXD A;  1UY8 A;  5D7C A;  4LWI A;  3EHJ A;  4EGH A;  3GIG A;  3A0W A;  4ASF A;  3VHC A;  1PVG A;  1KZN A;  2QG0 A;  3HYY A;  2YEB A;  4HY1 A;  5M4N A;  1I5A A;  2YEC A;  4LWF A;  4XCL A;  4XD8 A;  5F3K A;  4BQG A;  5M4K A;  4EGI A;  2YE9 A;  3EHF A;  2XK2 A;  4GFN A;  4MPE A;  2YEF A;  2VWC A;  1YSZ A;  5D6P A;  2XHR A;  1I59 A;  4YKZ A;  4YKR A;  2IOQ A;  1MX0 A;  4KSH A;  3EKO A;  1R62 A;  1L0O A;  3A0Z A;  2Q2E B;  3G75 A;  4MP2 A;  2YE8 A;  2XDX A;  3RLQ A;  1YER A;  1UYC A;  3CGY A;  3RLR A;  1AH6 A;  3D2R A;  1Y4U A;  1H7U A;  4L93 A;  3T2S A;  4HZ0 A;  1JM6 A;  2GFD A;  1AMW A;  3C0E A;  4E02 A;  4QPJ A;  1F51 A;  2YKB A;  2BU2 A;  4XDM A;  3OWB A;  1S16 A;  4E00 A;  5D6Q A;  2CH4 A;  1ZW9 A;  2IWU A;  3U2K A;  3S5T A;  4WUB A;  3TZ5 A;  4U7N A;  2YKJ A;  2YEG A;  5CTW A;  4U93 A;  2YJW A;  2IWS A;  2XDU A;  2VCJ A;  2WI5 A;  2BT0 A;  3O2F A;  1YSR A;  4V25 A;  4XKA A;  2WER A;  3A0T A;  2YE6 A;  4PL9 A;  3HEK A;  4NH9 A;  2HG1 A;  1UYH A;  4URM A;  2BU8 A;  3B24 A;  4URL A;  4BXI A;  4XIT A;  4P8O A;  4JQL A;  4O09 A;  2Q8H A;  1UY9 A;  5F5R A;  1Z59 A;  2C1I A;  2BU5 A;  1YT2 A;  4H81 A;  3B25 A;  5L3J A;  2BYH A;  4KTN A;  2FTK A;  3VAD A;  2CG9 A;  2YI0 A;  4MOT A;  5BOD A;  4GGL A;  2ZBK B;  2BU7 A;  2H55 A;  3G7E A;  2YE5 A;  5CTX A;  4E01 A;  3ZKB A;  3EKR A;  2AKP A;  2BYI A;  2HCH A;  2YI6 A;  1QYE A;  1B3Q A;  1TBW A;  4FCR A;  2O1V A;  2WI4 A;  1TC6 A;  1Z5A A;  4R1F A;  1GKX A;  4GQT A;  2ESA A;  3ZKD A;  4AWP A;  1YES A;  3CRL A;  3R4O A;  4B7P A;  1YT0 A;  2IWX A;  2YE7 A;  3CGZ A;  2QFO A;  4EGK A;  4CWT A;  1OSF A;  1UYG A;  4QPK A;  3HZ5 A;  2ZDY A;  2PNR A;  4Q20 A;  1EI1 A;  2CGF A;  2XDL A;  2C2A A;  5J6A A;  3A0Y A;  4XE2 A;  1TIL A;  2VCI A;  2FWY A;  1AJ6 A;  2YEH A;  2BU6 A;  1QY8 A;  1TC0 A;  4B6C A;  3CRK A;  4ASB A;  2GQP A;  2QG2 A;  1UYD A;  2UWD A;  4KQV A;  2ZKJ A;  3SL2 A;  4URN A;  4EMV A;  3OPD A;  4KFG A;  4FCQ A;  1Y8P A;  5IDM A;  3RKZ A;  2YEE A;  3D36 A;  4W7T A;  3BMY A;  3FV5 A;  4CWF A;  2XJG A;  3R4M A;  3CYG A;  3WQ9 A; 
#chains in the Genus database with same CATH homology
 4KSG A;  4L90 A;  2XX4 A;  2YK2 A;  4GCZ A;  4YKU A;  5GGZ A;  4YKW A;  4HY6 A;  3T1K A;  4P7A A;  4AS9 A;  5M4H A;  2Q8G A;  1YS3 A;  4MPN A;  1ZWH A;  5M4P A;  1MU5 A;  4LWH A;  3BM9 A;  3HZ1 A;  4PU9 A;  3TUH A;  4AWO A;  2QF6 A;  3D0B A;  2BZ5 A;  3OMU A;  3R92 A;  4CWO A;  1AM1 A;  4WUD A;  3R91 A;  3HYZ A;  3WHA A;  4MBC A;  2YEJ A;  2WI3 A;  2YI5 A;  4CWP A;  2YKE A;  4NH7 A;  4R3M A;  3TZ0 A;  1UYI A;  4H85 A;  4LWG A;  1UYE A;  2O1W A;  4HXZ A;  4MPC A;  3Q5K A;  2XCM A;  4CWN A;  2CCT A;  1GKZ A;  3QTF A;  3PEJ A;  3GIE A;  2FWZ A;  1US7 A;  3DGE A;  5CTU A;  3T0Z A;  3K98 A;  2O1U A;  5CPH A;  4O0B A;  5C93 A;  3ZXQ A;  4HZ5 A;  1ID0 A;  3R4N A;  2YE4 A;  5FWK A;  1YC3 A;  4EFU A;  3U2D A;  4NH8 A;  4BQJ A;  3T10 A;  2JJC A;  2CCS A;  4GEE A;  2YGE A;  4YKQ A;  2YGF A;  4CWR A;  3H80 A;  4O07 A;  4CE3 A;  4ASA A;  4FPP A;  5CF0 A;  1I5D A;  4EEH A;  3LNU A;  4YKY A;  2IOR A;  4WUC A;  3O6O A;  4KP4 A;  1YT1 A;  1U0Z A;  2YKC A;  2BRE A;  2VW5 A;  4L91 A;  4JAV A;  3C11 A;  1U2O A;  5J71 A;  3INW A;  2WI2 A;  2K5B A;  1AH8 A;  2YK9 A;  1KIJ A;  2CCU A;  3U67 A;  3VHA A;  4URO A;  1Y4S A;  3Q5J A;  3INX A;  4XKO A;  2JKI A;  2XHX A;  4BAE A;  4I3H A;  1QZR A;  3JZ3 A;  5CTY A;  2BTZ A;  4O04 A;  4PRV A;  1UYF A;  1UYM A;  4L94 A;  2YE2 A;  5M4E A;  1YC1 A;  2E0A A;  2XDS A;  3GIF A;  3GIG B;  3O0I A;  1EA6 A;  4XIR A;  3NMQ A;  2XX2 A;  1A4H A;  3ZM7 A;  1Y8O A;  1UYK A;  3TZ4 A;  1THN A;  2FXS A;  4DUH A;  1ZXM A;  2XDK A;  4XIP A;  2YKI A;  1I5B A;  3HHU A;  2WI6 A;  1BGQ A;  3RLP A;  2YEI A;  1I5C A;  3K99 A;  4R3A A;  4ASG A;  3B28 A;  1NHH A;  5BOC A;  4L8Z A;  4MP7 A;  3CWV A;  4BIU A;  1I58 A;  4XC0 A;  3FT8 A;  4CWQ A;  4PRX A;  4XTJ A;  1Z5B A;  4LPB A;  3IED A;  2YGA A;  4GT8 A;  2XX5 A;  4H7Q A;  4U7O A;  5IN9 A;  3A0X A;  4CE1 A;  3EHG A;  1TID A;  2BRC A;  3EHH A;  3B27 A;  2HKJ A;  4AWQ A;  5FNF A;  3TTZ A;  2WEP A;  3R4P A;  4I5S A;  4YKT A;  2YI7 A;  1NHI A;  2XJX A;  4HYP A;  3K60 A;  4K4O A;  4FMT A;  1NHJ A;  5M4M A;  2EXL A;  3OWD A;  3VHD A;  3OW6 A;  2WEQ A;  5FNC A;  3PEH A;  3ZXO A;  4CWS A;  1YET A;  4LWE A;  2YEA A;  3LPS A;  1H7S A;  3T0H A;  5FND A;  4CE2 A;  1Z5C A;  5D7D A;  2XHT A;  5D7R A;  2YED A;  4HYM A;  3MNR P;  2XAB A;  3K97 A;  4DZY A;  4JAS A;  1YC4 A;  2Q8F A;  2BSM A;  4FCP A;  2ZDX A;  3FT5 A;  4ZVI A;  1UY7 A;  4V26 A;  3QDD A;  4XKK A;  3A0R A;  3TZ2 A;  3G7B A;  2FYP A;  1BKN A;  4EFT A;  1Y8N A;  1B62 A;  2IOP A;  1S14 A;  1ZXN A;  2XD6 A;  3Q5L A;  2YJX A;  4JAU A;  2WI1 A;  1BYQ A;  4XCJ A;  1UYL A;  4XIQ A;  2XJJ A;  4YKX A;  4O05 A;  2WI7 A;  4X9L A;  3B26 A;  4EM7 A;  5IDJ A;  4MB9 A;  2YE3 A;  1B63 A;  1UY6 A;  2H8M A;  3KE6 A;  4BIZ A;  4LP0 A;  1TH8 A;  2Q8I A;  3H4L A;  4HXW A;  1GJV A;  4ZKI A;  1BXD A;  1UY8 A;  5D7C A;  4LWI A;  3EHJ A;  4EGH A;  3GIG A;  3A0W A;  4ASF A;  3VHC A;  1PVG A;  1KZN A;  2QG0 A;  3HYY A;  2YEB A;  4HY1 A;  5M4N A;  1I5A A;  2YEC A;  4LWF A;  4XCL A;  4XD8 A;  5F3K A;  4BQG A;  5M4K A;  4EGI A;  2YE9 A;  3EHF A;  2XK2 A;  4GFN A;  4MPE A;  2YEF A;  2VWC A;  1YSZ A;  5D6P A;  2XHR A;  1I59 A;  4YKZ A;  4YKR A;  2IOQ A;  1MX0 A;  4KSH A;  3EKO A;  1R62 A;  1L0O A;  3A0Z A;  2Q2E B;  3G75 A;  4MP2 A;  2YE8 A;  2XDX A;  3RLQ A;  1YER A;  1UYC A;  3CGY A;  3RLR A;  1AH6 A;  3D2R A;  1Y4U A;  1H7U A;  4L93 A;  3T2S A;  4HZ0 A;  1JM6 A;  2GFD A;  1AMW A;  3C0E A;  4E02 A;  4QPJ A;  2YKB A;  2BU2 A;  4XDM A;  3OWB A;  1S16 A;  4E00 A;  5D6Q A;  2CH4 A;  1ZW9 A;  2IWU A;  3U2K A;  4WUB A;  3TZ5 A;  4U7N A;  2YKJ A;  2YEG A;  5CTW A;  4U93 A;  2YJW A;  2IWS A;  2XDU A;  2VCJ A;  2WI5 A;  2BT0 A;  3O2F A;  1YSR A;  4V25 A;  4XKA A;  2WER A;  3A0T A;  2YE6 A;  4PL9 A;  3HEK A;  4NH9 A;  2HG1 A;  1UYH A;  4URM A;  2BU8 A;  3B24 A;  4URL A;  4BXI A;  4XIT A;  4P8O A;  4JQL A;  4O09 A;  2Q8H A;  1UY9 A;  5F5R A;  1Z59 A;  2BU5 A;  1YT2 A;  4H81 A;  3B25 A;  5L3J A;  2BYH A;  4KTN A;  3VAD A;  2CG9 A;  2YI0 A;  4MOT A;  5BOD A;  4GGL A;  2ZBK B;  2BU7 A;  2H55 A;  3G7E A;  2YE5 A;  5CTX A;  4E01 A;  3ZKB A;  3EKR A;  2AKP A;  2BYI A;  2HCH A;  2YI6 A;  1QYE A;  1B3Q A;  1TBW A;  4FCR A;  2O1V A;  2WI4 A;  1TC6 A;  1Z5A A;  4R1F A;  1GKX A;  4GQT A;  2ESA A;  3ZKD A;  4AWP A;  1YES A;  3CRL A;  3R4O A;  4B7P A;  1YT0 A;  2IWX A;  2YE7 A;  3CGZ A;  2QFO A;  4EGK A;  4CWT A;  1OSF A;  1UYG A;  4QPK A;  3HZ5 A;  2ZDY A;  2PNR A;  4Q20 A;  1EI1 A;  2CGF A;  2XDL A;  2C2A A;  5J6A A;  3A0Y A;  4XE2 A;  1TIL A;  2VCI A;  2FWY A;  1AJ6 A;  2YEH A;  2BU6 A;  1QY8 A;  1TC0 A;  4B6C A;  3CRK A;  4ASB A;  2GQP A;  2QG2 A;  1UYD A;  2UWD A;  4KQV A;  2ZKJ A;  3SL2 A;  4URN A;  4EMV A;  3OPD A;  4KFG A;  4FCQ A;  1Y8P A;  5IDM A;  3RKZ A;  2YEE A;  3D36 A;  4W7T A;  3BMY A;  3FV5 A;  4CWF A;  2XJG A;  3R4M A;  3WQ9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...