1I59A

Structure of the histidine kinase chea atp-binding domain in complex with adpnp and magensium
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
188
structure length
180
Chain Sequence
SHMVPISFVFNRFPRMVRDLAKKMNKEVNFIMRGEDTELDRTFVEEIGEPLLHLLRNAIDHGIEPKEERIAKGKPPIGTLILSARHEGNNVVIEVEDDGRGIDKEKIIRKAIEKGLIDESKAATLSDQEILNFLFVPGFSTKRGVGMDVVKNVVESLNGSISIESEKDKGTKVTIRLPLT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Nucleotide binding by the histidine kinase CheA.
pubmed doi rcsb
source organism Thermotoga maritima
molecule tags Signaling protein, transferase
molecule keywords CHEMOTAXIS PROTEIN CHEA
total genus 57
structure length 180
sequence length 188
chains with identical sequence B
ec nomenclature ec 2.7.13.3: Histidine kinase.
pdb deposition date 2001-02-26
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.565.10 Alpha Beta 2-Layer Sandwich Heat Shock Protein 90 Histidine kinase-like ATPase, C-terminal domain 1i59A00
1S16A 2CH4A 2IOPA 4PRXA 2XHTA 3BMYA 2XHRA 3Q5LA 4CWSA 5CTYA 1YT2A 4EMVA 4I3HA 1S14A 2GFDA 4P7AA 4XC0A 1YC4A 4HXWA 4MP7A 2IORA 2Q2EB 4JAUA 5IDMA 4LWIA 4JAVA 3EHJA 4XIPA 2HCHA 3B26A 2CGFA 4YKTA 1AH6A 1YS3A 1EA6A 2XHXA 5CTWA 5F5RA 3ZKDA 2AKPA 2ESAA 1GKXA 4CE1A 1TIDA 4KSGA 2XK2A 3H4LA 2WI4A 2WI6A 4H81A 4XE2A 4URNA 4L94A 4PU9A 4UROA 3TZ0A 3TZ5A 4XDMA 1H7UA 4E01A 2XJJA 2WI2A 4KTNA 4GT8A 2PNRA 4HXZA 4CWRA 4GGLA 4Q20A 2YEIA 3R91A 1TC0A 3TUHA 2VCJA 3T0HA 3CRKA 2BU5A 4LWFA 5D6PA 3T10A 2QFOA 4P8OA 3A0XA 4GCZA 4B6CA 2YI6A 3Q5JA 5M4HA 2XDUA 2YGAA 4JASA 4EGHA 4WUDA 2YKEA 3R4OA 1US7A 4XKOA 4XITA 1Z59A 4ASBA 2IOQA 2ZKJA 4CWNA 2ZDXA 3ZKBA 5D7CA 4HYPA 4NH9A 4I5SA 1OSFA 1ID0A 5GGZA 2O1WA 2XX4A 3B25A 2YE2A 3GIGB 4KSHA 2YE9A 1AM1A 1NHJA 2XDLA 1YC1A 4YKZA 2IWXA 4V26A 5M4NA 3PEHA 3HYYA 3HZ5A 3NMQA 4L91A 1Y4UA 4YKQA 1UYGA 2BU7A 5CTXA 1BXDA 5F3KA 2YEJA 4BIUA 4GEEA 1QYEA 2YEEA 4ZKIA 2YE6A 2YEAA 1THNA 3INXA 1TH8A 3LPSA 2EXLA 3ZXOA 4H85A 4MPCA 5BOCA 3R4PA 4LWEA 4O05A 3H80A 2BU6A 4L93A 4B7PA 2BT0A 2UWDA 3C11A 1UY8A 3FT8A 3R4MA 3G7EA 2YK9A 5C93A 2YKCA 4AWQA 4EM7A 2BTZA 4EFUA 4PRVA 4FCPA 4XKKA 3RLRA 4L8ZA 2YJWA 1Y8OA 1B3QA 4MOTA 3IEDA 1MX0A 3A0ZA 3RKZA 2BZ5A 2CCTA 2VW5A 2WI1A 3K98A 3SL2A 3HEKA 3TZ2A 2YGFA 5BODA 4X9LA 4EEHA 1UYMA 5FWKA 4MBCA 4YKWA 3TZ4A 4XTJA 1Y8PA 1PVGA 4LPBA 2XX2A 3A0TA 3MNRP 1TILA 4BXIA 2CCUA 4CWFA 2WEPA 4FPPA 3K97A 2IWUA 1I58A 4KQVA 4BQJA 3DGEA 1I5DA 2QG0A 1UY9A 3T1KA 2YGEA 1UYFA 2YECA 3CGZA 4XD8A 4ZVIA 3QDDA 3EHGA 1UYIA 2XX5A 1ZWHA 4BIZA 1U0ZA 3QTFA 3A0RA 3Q5KA 1ZXNA 2HG1A 4HZ0A 4XIRA 1YT1A 2BRCA 4XCJA 4NH7A 5CTUA 1YSZA 2WI3A 1B63A 2XCMA 2YEBA 3G7BA 3GIEA 4FMTA 2WI7A 4HYMA 4MB9A 1UYKA 2GQPA 3RLQA 4L90A 4MP2A 3EHFA 3U2KA 4AWPA 4CWPA 1UYHA 4EGIA 4FCQA 4E02A 3OWDA 2XDSA 4JQLA 4LWHA 1TBWA 1YETA 3GIGA 3T2SA 4CWQA 1BGQA 3KE6A 3OW6A 2FWYA 2YK2A 2O1UA 3EKRA 1UYDA 5CPHA 4ASAA 1EI1A 3B27A 1UYLA 2YE5A 2YI5A 2XDXA 3JZ3A 4AWOA 3LNUA 3A0YA 5IN9A 3HHUA 2FYPA 3K60A 3EKOA 1UYCA 3BM9A 4QPKA 4U7OA 1NHHA 3GIFA 2YEGA 3D0BA 1Z5AA 4YKYA 4GFNA 3FT5A 3O2FA 2BU8A 1ZXMA 4K4OA 4EGKA 3R92A 1UY7A 2FXSA 2XDKA 1AH8A 2BYIA 2CCSA 2Q8IA 2YKJA 4R3MA 4LWGA 5L3JA 2YE3A 3HZ1A 1KZNA 3CGYA 3WHAA 3OMUA 3OWBA 2XJXA 2YE4A 1NHIA 3B24A 4CWOA 2C2AA 4EFTA 1UYEA 2CG9A 4O07A 1JM6A 3O0IA 2BU2A 4O04A 1Y4SA 4W7TA 2YKIA 1Y8NA 1UY6A 2YI7A 4CE2A 1YERA 4HY1A 1GKZA 1I5BA 5FNDA 3TTZA 4DZYA 1QZRA 2K5BA 1KIJA 2ZBKB 2BSMA 4ASGA 3HYZA 4WUBA 5M4EA 2XD6A 2Q8GA 4U7NA 1ZW9A 2YEHA 3C0EA 3INWA 4URMA 1GJVA 5CF0A 3B28A 4R1FA 2Q8FA 2O1VA 2YE8A 1AJ6A 2BYHA 2YEFA 3VHAA 3R4NA 1QY8A 2FWZA 2YEDA 2QF6A 5FNCA 4HZ5A 4KP4A 3D36A 4QPJA 1Z5CA 3D2RA 4YKUA 1AMWA 1U2OA 4E00A 1I59A 2H55A 2ZDYA 4NH8A 3VADA 4KFGA 1YT0A 2E0AA 4U93A 4MPEA 3U67A 2YKBA 3O6OA 4O0BA 2Q8HA 4XCLA 4BQGA 1MU5A 5J71A 2IWSA 1YESA 2JJCA 3EHHA 3VHCA 2YI0A 4XKAA 1YC3A 4H7QA 5D6QA 1I5AA 4FCRA 2WERA 3PEJA 4CWTA 3T0ZA 1B62A 2WI5A 1BKNA 3OPDA 2VWCA 5FNFA 4DUHA 4XIQA 4YKRA 3FV5A 1R62A 1L0OA 4AS9A 1BYQA 3CWVA 3CRLA 3ZM7A 4YKXA 3WQ9A 2BREA 3ZXQA 4ASFA 2XABA 5D7RA 2XJGA 3RLPA 2HKJA 3G75A 3U2DA 4WUCA 5M4KA 3VHDA 1I5CA 1TC6A 2JKIA 2H8MA 1H7SA 4CE3A 3A0WA 4V25A 1YSRA 1Z5BA 1A4HA 2YJXA 5IDJA 4URLA 4R3AA 2YE7A 4BAEA 5M4MA 4GQTA 2VCIA 5J6AA 2QG2A 4PL9A 4LP0A 4MPNA 4O09A 3K99A 5D7DA 2WEQA 4HY6A 5M4PA
chains in the Genus database with same CATH superfamily
1S16A 2CH4A 2IOPA 4PRXA 2XHTA 3BMYA 2XHRA 3Q5LA 4CWSA 5CTYA 1YT2A 4EMVA 4I3HA 1S14A 2GFDA 4P7AA 4XC0A 1YC4A 4HXWA 4MP7A 2IORA 2Q2EB 4JAUA 5IDMA 4LWIA 4JAVA 3EHJA 4XIPA 2HCHA 3B26A 2CGFA 4YKTA 1AH6A 1YS3A 1EA6A 2XHXA 5CTWA 1F51A 5F5RA 3ZKDA 3S5TA 2AKPA 2ESAA 1GKXA 3LMMA 4CE1A 1TIDA 4KSGA 2XK2A 3H4LA 2WI4A 1IXMA 2WI6A 4H81A 4XE2A 4URNA 4L94A 4PU9A 4UROA 3TZ0A 3TZ5A 4XDMA 1H7UA 4E01A 2XJJA 2WI2A 4KTNA 4GT8A 2PNRA 4HXZA 4CWRA 4GGLA 4Q20A 2YEIA 3R91A 1TC0A 3TUHA 2VCJA 3T0HA 3CRKA 2BU5A 4LWFA 5D6PA 3T10A 2QFOA 4P8OA 3A0XA 4GCZA 4B6CA 2YI6A 3Q5JA 5M4HA 2XDUA 2YGAA 4JASA 4EGHA 4WUDA 2YKEA 3R4OA 1US7A 4XKOA 4XITA 1Z59A 4ASBA 2IOQA 2ZKJA 4CWNA 2ZDXA 3ZKBA 5D7CA 4HYPA 4NH9A 4I5SA 1OSFA 1ID0A 5GGZA 2O1WA 2XX4A 3B25A 2YE2A 3GIGB 4KSHA 2YE9A 1AM1A 1NHJA 2XDLA 1YC1A 4YKZA 2IWXA 4V26A 5M4NA 3PEHA 3HYYA 3HZ5A 3NMQA 4L91A 1Y4UA 4YKQA 1UYGA 2BU7A 5CTXA 1BXDA 5F3KA 2YEJA 4BIUA 4GEEA 1QYEA 2YEEA 4ZKIA 2YE6A 2YEAA 1THNA 3INXA 1TH8A 3LPSA 2EXLA 3ZXOA 4H85A 4MPCA 5BOCA 3R4PA 4LWEA 4O05A 3H80A 2BU6A 4L93A 4B7PA 2BT0A 2UWDA 3C11A 1UY8A 3FT8A 3R4MA 3G7EA 2YK9A 5C93A 2YKCA 4AWQA 4EM7A 2BTZA 4EFUA 4PRVA 4FCPA 4XKKA 3RLRA 4L8ZA 2YJWA 1Y8OA 1B3QA 4MOTA 3IEDA 1MX0A 3A0ZA 3RKZA 2BZ5A 2CCTA 2VW5A 2WI1A 3K98A 3SL2A 3HEKA 3TZ2A 2YGFA 5BODA 4X9LA 4EEHA 1UYMA 5FWKA 4MBCA 4YKWA 3TZ4A 4XTJA 1Y8PA 1PVGA 4LPBA 2XX2A 3A0TA 3MNRP 1TILA 5JENA 4BXIA 2CCUA 4CWFA 2WEPA 4FPPA 3K97A 2IWUA 1I58A 4KQVA 4BQJA 3DGEA 1I5DA 2QG0A 1UY9A 3T1KA 2YGEA 1UYFA 2YECA 3CGZA 4XD8A 4ZVIA 3QDDA 3EHGA 2C1IA 1UYIA 2XX5A 1ZWHA 4BIZA 1U0ZA 3QTFA 3A0RA 3Q5KA 1ZXNA 2HG1A 4HZ0A 4XIRA 4E72A 1YT1A 2BRCA 4XCJA 4NH7A 5CTUA 1YSZA 2WI3A 1B63A 2XCMA 2YEBA 3G7BA 3GIEA 4FMTA 2WI7A 4HYMA 4MB9A 1UYKA 2GQPA 3RLQA 4L90A 4MP2A 3EHFA 3U2KA 4AWPA 4CWPA 1UYHA 4EGIA 4FCQA 4E02A 3OWDA 2XDSA 4JQLA 4LWHA 1TBWA 1YETA 2HHIA 3GIGA 3T2SA 4CWQA 1BGQA 3KE6A 3OW6A 2FWYA 2YK2A 2O1UA 3EKRA 1UYDA 5CPHA 4ASAA 3CYGA 1EI1A 3B27A 1UYLA 2YE5A 2YI5A 2XDXA 3JZ3A 4AWOA 3LNUA 3A0YA 5IN9A 3HHUA 2FYPA 3K60A 3EKOA 1UYCA 3BM9A 4QPKA 4U7OA 1NHHA 3GIFA 2YEGA 3D0BA 1Z5AA 4YKYA 4GFNA 3FT5A 3O2FA 2BU8A 1ZXMA 4K4OA 4EGKA 3R92A 1UY7A 2FXSA 2XDKA 1AH8A 2BYIA 2CCSA 2Q8IA 2YKJA 4R3MA 4LWGA 5L3JA 2YE3A 3HZ1A 1KZNA 3CGYA 3WHAA 3OMUA 3OWBA 2XJXA 2YE4A 2C1GA 1NHIA 3B24A 4CWOA 2C2AA 4EFTA 1UYEA 2CG9A 4O07A 1JM6A 3O0IA 2BU2A 4O04A 1Y4SA 4W7TA 2YKIA 1Y8NA 1UY6A 2YI7A 4CE2A 1YERA 4HY1A 1GKZA 1I5BA 5FNDA 3TTZA 4DZYA 1QZRA 2K5BA 1KIJA 2ZBKB 2BSMA 4ASGA 3HYZA 4WUBA 5M4EA 2XD6A 2Q8GA 4U7NA 1ZW9A 2YEHA 3C0EA 3INWA 4URMA 1GJVA 5CF0A 3B28A 4R1FA 2Q8FA 2O1VA 2YE8A 1AJ6A 2BYHA 2YEFA 3VHAA 3R4NA 1QY8A 2FWZA 2YEDA 2QF6A 5FNCA 4HZ5A 4KP4A 3D36A 4QPJA 1Z5CA 3D2RA 4YKUA 1AMWA 1U2OA 4E00A 1I59A 2H55A 2ZDYA 4NH8A 3VADA 4KFGA 1YT0A 2E0AA 4U93A 4MPEA 3U67A 2YKBA 3O6OA 4O0BA 2Q8HA 4XCLA 4BQGA 1MU5A 5J71A 2IWSA 1YESA 2JJCA 3EHHA 3VHCA 2YI0A 4XKAA 1YC3A 4H7QA 5D6QA 1I5AA 4FCRA 2WERA 3PEJA 4CWTA 3T0ZA 1B62A 2WI5A 1BKNA 3OPDA 2VWCA 5FNFA 4DUHA 4XIQA 4YKRA 3FV5A 1R62A 1L0OA 4AS9A 1BYQA 3CWVA 3CRLA 3ZM7A 4YKXA 3WQ9A 2BREA 3ZXQA 4ASFA 2XABA 5D7RA 2XJGA 3RLPA 2HKJA 3G75A 3U2DA 4WUCA 5M4KA 3VHDA 1I5CA 1TC6A 2JKIA 2H8MA 1H7SA 4CE3A 3A0WA 4V25A 1YSRA 1Z5BA 1A4HA 2YJXA 5IDJA 2FTKA 4URLA 4R3AA 2YE7A 4BAEA 5M4MA 4GQTA 2VCIA 5J6AA 2QG2A 4PL9A 4LP0A 4MPNA 4O09A 3K99A 5D7DA 2WEQA 4HY6A 5M4PA
chains in the Genus database with same CATH topology
1S16A 2CH4A 2IOPA 4PRXA 2XHTA 3BMYA 2XHRA 3Q5LA 4CWSA 5CTYA 1YT2A 4EMVA 4I3HA 1S14A 2GFDA 4P7AA 4XC0A 1YC4A 4HXWA 4MP7A 2IORA 2Q2EB 4JAUA 5IDMA 4LWIA 4JAVA 3EHJA 4XIPA 2HCHA 3B26A 2CGFA 4YKTA 1AH6A 1YS3A 1EA6A 2XHXA 5CTWA 5F5RA 3ZKDA 2AKPA 2ESAA 1GKXA 4CE1A 1TIDA 4KSGA 2XK2A 3H4LA 2WI4A 2WI6A 4H81A 4XE2A 4URNA 4L94A 4PU9A 4UROA 3TZ0A 3TZ5A 4XDMA 1H7UA 4E01A 2XJJA 2WI2A 4KTNA 4GT8A 2PNRA 4HXZA 4CWRA 4GGLA 4Q20A 2YEIA 3R91A 1TC0A 3TUHA 2VCJA 3T0HA 3CRKA 2BU5A 4LWFA 5D6PA 3T10A 2QFOA 4P8OA 3A0XA 4GCZA 4B6CA 2YI6A 3Q5JA 5M4HA 2XDUA 2YGAA 4JASA 4EGHA 4WUDA 2YKEA 3R4OA 1US7A 4XKOA 4XITA 1Z59A 4ASBA 2IOQA 2ZKJA 4CWNA 2ZDXA 3ZKBA 5D7CA 4HYPA 4NH9A 4I5SA 1OSFA 1ID0A 5GGZA 2O1WA 2XX4A 3B25A 2YE2A 3GIGB 4KSHA 2YE9A 1AM1A 1NHJA 2XDLA 1YC1A 4YKZA 2IWXA 4V26A 5M4NA 3PEHA 3HYYA 3HZ5A 3NMQA 4L91A 1Y4UA 4YKQA 1UYGA 2BU7A 5CTXA 1BXDA 5F3KA 2YEJA 4BIUA 4GEEA 1QYEA 2YEEA 4ZKIA 2YE6A 2YEAA 1THNA 3INXA 1TH8A 3LPSA 2EXLA 3ZXOA 4H85A 4MPCA 5BOCA 3R4PA 4LWEA 4O05A 3H80A 2BU6A 4L93A 4B7PA 2BT0A 2UWDA 3C11A 1UY8A 3FT8A 3R4MA 3G7EA 2YK9A 5C93A 2YKCA 4AWQA 4EM7A 2BTZA 4EFUA 4PRVA 4FCPA 4XKKA 3RLRA 4L8ZA 2YJWA 1Y8OA 1B3QA 4MOTA 3IEDA 1MX0A 3A0ZA 3RKZA 2BZ5A 2CCTA 2VW5A 2WI1A 3K98A 3SL2A 3HEKA 3TZ2A 2YGFA 5BODA 4X9LA 4EEHA 1UYMA 5FWKA 4MBCA 4YKWA 3TZ4A 4XTJA 1Y8PA 1PVGA 4LPBA 2XX2A 3A0TA 3MNRP 1TILA 4BXIA 2CCUA 4CWFA 2WEPA 4FPPA 3K97A 2IWUA 1I58A 4KQVA 4BQJA 3DGEA 1I5DA 2QG0A 1UY9A 3T1KA 2YGEA 1UYFA 2YECA 3CGZA 4XD8A 4ZVIA 3QDDA 3EHGA 1UYIA 2XX5A 1ZWHA 4BIZA 1U0ZA 3QTFA 3A0RA 3Q5KA 1ZXNA 2HG1A 4HZ0A 4XIRA 1YT1A 2BRCA 4XCJA 4NH7A 5CTUA 1YSZA 2WI3A 1B63A 2XCMA 2YEBA 3G7BA 3GIEA 4FMTA 2WI7A 4HYMA 4MB9A 1UYKA 2GQPA 3RLQA 4L90A 4MP2A 3EHFA 3U2KA 4AWPA 4CWPA 1UYHA 4EGIA 4FCQA 4E02A 3OWDA 2XDSA 4JQLA 4LWHA 1TBWA 1YETA 3GIGA 3T2SA 4CWQA 1BGQA 3KE6A 3OW6A 2FWYA 2YK2A 2O1UA 3EKRA 1UYDA 5CPHA 4ASAA 1EI1A 3B27A 1UYLA 2YE5A 2YI5A 2XDXA 3JZ3A 4AWOA 3LNUA 3A0YA 5IN9A 3HHUA 2FYPA 3K60A 3EKOA 1UYCA 3BM9A 4QPKA 4U7OA 1NHHA 3GIFA 2YEGA 3D0BA 1Z5AA 4YKYA 4GFNA 3FT5A 3O2FA 2BU8A 1ZXMA 4K4OA 4EGKA 3R92A 1UY7A 2FXSA 2XDKA 1AH8A 2BYIA 2CCSA 2Q8IA 2YKJA 4R3MA 4LWGA 5L3JA 2YE3A 3HZ1A 1KZNA 3CGYA 3WHAA 3OMUA 3OWBA 2XJXA 2YE4A 1NHIA 3B24A 4CWOA 2C2AA 4EFTA 1UYEA 2CG9A 4O07A 1JM6A 3O0IA 2BU2A 4O04A 1Y4SA 4W7TA 2YKIA 1Y8NA 1UY6A 2YI7A 4CE2A 1YERA 4HY1A 1GKZA 1I5BA 5FNDA 3TTZA 4DZYA 1QZRA 2K5BA 1KIJA 2ZBKB 2BSMA 4ASGA 3HYZA 4WUBA 5M4EA 2XD6A 2Q8GA 4U7NA 1ZW9A 2YEHA 3C0EA 3INWA 4URMA 1GJVA 5CF0A 3B28A 4R1FA 2Q8FA 2O1VA 2YE8A 1AJ6A 2BYHA 2YEFA 3VHAA 3R4NA 1QY8A 2FWZA 2YEDA 2QF6A 5FNCA 4HZ5A 4KP4A 3D36A 4QPJA 1Z5CA 3D2RA 4YKUA 1AMWA 1U2OA 4E00A 1I59A 2H55A 2ZDYA 4NH8A 3VADA 4KFGA 1YT0A 2E0AA 4U93A 4MPEA 3U67A 2YKBA 3O6OA 4O0BA 2Q8HA 4XCLA 4BQGA 1MU5A 5J71A 2IWSA 1YESA 2JJCA 3EHHA 3VHCA 2YI0A 4XKAA 1YC3A 4H7QA 5D6QA 1I5AA 4FCRA 2WERA 3PEJA 4CWTA 3T0ZA 1B62A 2WI5A 1BKNA 3OPDA 2VWCA 5FNFA 4DUHA 4XIQA 4YKRA 3FV5A 1R62A 1L0OA 4AS9A 1BYQA 3CWVA 3CRLA 3ZM7A 4YKXA 3WQ9A 2BREA 3ZXQA 4ASFA 2XABA 5D7RA 2XJGA 3RLPA 2HKJA 3G75A 3U2DA 4WUCA 5M4KA 3VHDA 1I5CA 1TC6A 2JKIA 2H8MA 1H7SA 4CE3A 3A0WA 4V25A 1YSRA 1Z5BA 1A4HA 2YJXA 5IDJA 4URLA 4R3AA 2YE7A 4BAEA 5M4MA 4GQTA 2VCIA 5J6AA 2QG2A 4PL9A 4LP0A 4MPNA 4O09A 3K99A 5D7DA 2WEQA 4HY6A 5M4PA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1S16 A;  2CH4 A;  2IOP A;  4PRX A;  2XHT A;  3BMY A;  2XHR A;  3Q5L A;  4CWS A;  5CTY A;  1YT2 A;  4EMV A;  4I3H A;  1S14 A;  2GFD A;  4P7A A;  4XC0 A;  1YC4 A;  4HXW A;  4MP7 A;  2IOR A;  2Q2E B;  4JAU A;  5IDM A;  4LWI A;  4JAV A;  3EHJ A;  4XIP A;  2HCH A;  3B26 A;  2CGF A;  4YKT A;  1AH6 A;  1YS3 A;  1EA6 A;  2XHX A;  5CTW A;  5F5R A;  3ZKD A;  2AKP A;  2ESA A;  1GKX A;  4CE1 A;  1TID A;  4KSG A;  2XK2 A;  3H4L A;  2WI4 A;  2WI6 A;  4H81 A;  4XE2 A;  4URN A;  4L94 A;  4PU9 A;  4URO A;  3TZ0 A;  3TZ5 A;  4XDM A;  1H7U A;  4E01 A;  2XJJ A;  2WI2 A;  4KTN A;  4GT8 A;  2PNR A;  4HXZ A;  4CWR A;  4GGL A;  4Q20 A;  2YEI A;  3R91 A;  1TC0 A;  3TUH A;  2VCJ A;  3T0H A;  3CRK A;  2BU5 A;  4LWF A;  5D6P A;  3T10 A;  2QFO A;  4P8O A;  3A0X A;  4GCZ A;  4B6C A;  2YI6 A;  3Q5J A;  5M4H A;  2XDU A;  2YGA A;  4JAS A;  4EGH A;  4WUD A;  2YKE A;  3R4O A;  1US7 A;  4XKO A;  4XIT A;  1Z59 A;  4ASB A;  2IOQ A;  2ZKJ A;  4CWN A;  2ZDX A;  3ZKB A;  5D7C A;  4HYP A;  4NH9 A;  4I5S A;  1OSF A;  1ID0 A;  5GGZ A;  2O1W A;  2XX4 A;  3B25 A;  2YE2 A;  3GIG B;  4KSH A;  2YE9 A;  1AM1 A;  1NHJ A;  2XDL A;  1YC1 A;  4YKZ A;  2IWX A;  4V26 A;  5M4N A;  3PEH A;  3HYY A;  3HZ5 A;  3NMQ A;  4L91 A;  1Y4U A;  4YKQ A;  1UYG A;  2BU7 A;  5CTX A;  1BXD A;  5F3K A;  2YEJ A;  4BIU A;  4GEE A;  1QYE A;  2YEE A;  4ZKI A;  2YE6 A;  2YEA A;  1THN A;  3INX A;  1TH8 A;  3LPS A;  2EXL A;  3ZXO A;  4H85 A;  4MPC A;  5BOC A;  3R4P A;  4LWE A;  4O05 A;  3H80 A;  2BU6 A;  4L93 A;  4B7P A;  2BT0 A;  2UWD A;  3C11 A;  1UY8 A;  3FT8 A;  3R4M A;  3G7E A;  2YK9 A;  5C93 A;  2YKC A;  4AWQ A;  4EM7 A;  2BTZ A;  4EFU A;  4PRV A;  4FCP A;  4XKK A;  3RLR A;  4L8Z A;  2YJW A;  1Y8O A;  1B3Q A;  4MOT A;  3IED A;  1MX0 A;  3A0Z A;  3RKZ A;  2BZ5 A;  2CCT A;  2VW5 A;  2WI1 A;  3K98 A;  3SL2 A;  3HEK A;  3TZ2 A;  2YGF A;  5BOD A;  4X9L A;  4EEH A;  1UYM A;  5FWK A;  4MBC A;  4YKW A;  3TZ4 A;  4XTJ A;  1Y8P A;  1PVG A;  4LPB A;  2XX2 A;  3A0T A;  3MNR P;  1TIL A;  4BXI A;  2CCU A;  4CWF A;  2WEP A;  4FPP A;  3K97 A;  2IWU A;  1I58 A;  4KQV A;  4BQJ A;  3DGE A;  1I5D A;  2QG0 A;  1UY9 A;  3T1K A;  2YGE A;  1UYF A;  2YEC A;  3CGZ A;  4XD8 A;  4ZVI A;  3QDD A;  3EHG A;  1UYI A;  2XX5 A;  1ZWH A;  4BIZ A;  1U0Z A;  3QTF A;  3A0R A;  3Q5K A;  1ZXN A;  2HG1 A;  4HZ0 A;  4XIR A;  1YT1 A;  2BRC A;  4XCJ A;  4NH7 A;  5CTU A;  1YSZ A;  2WI3 A;  1B63 A;  2XCM A;  2YEB A;  3G7B A;  3GIE A;  4FMT A;  2WI7 A;  4HYM A;  4MB9 A;  1UYK A;  2GQP A;  3RLQ A;  4L90 A;  4MP2 A;  3EHF A;  3U2K A;  4AWP A;  4CWP A;  1UYH A;  4EGI A;  4FCQ A;  4E02 A;  3OWD A;  2XDS A;  4JQL A;  4LWH A;  1TBW A;  1YET A;  3GIG A;  3T2S A;  4CWQ A;  1BGQ A;  3KE6 A;  3OW6 A;  2FWY A;  2YK2 A;  2O1U A;  3EKR A;  1UYD A;  5CPH A;  4ASA A;  1EI1 A;  3B27 A;  1UYL A;  2YE5 A;  2YI5 A;  2XDX A;  3JZ3 A;  4AWO A;  3LNU A;  3A0Y A;  5IN9 A;  3HHU A;  2FYP A;  3K60 A;  3EKO A;  1UYC A;  3BM9 A;  4QPK A;  4U7O A;  1NHH A;  3GIF A;  2YEG A;  3D0B A;  1Z5A A;  4YKY A;  4GFN A;  3FT5 A;  3O2F A;  2BU8 A;  1ZXM A;  4K4O A;  4EGK A;  3R92 A;  1UY7 A;  2FXS A;  2XDK A;  1AH8 A;  2BYI A;  2CCS A;  2Q8I A;  2YKJ A;  4R3M A;  4LWG A;  5L3J A;  2YE3 A;  3HZ1 A;  1KZN A;  3CGY A;  3WHA A;  3OMU A;  3OWB A;  2XJX A;  2YE4 A;  1NHI A;  3B24 A;  4CWO A;  2C2A A;  4EFT A;  1UYE A;  2CG9 A;  4O07 A;  1JM6 A;  3O0I A;  2BU2 A;  4O04 A;  1Y4S A;  4W7T A;  2YKI A;  1Y8N A;  1UY6 A;  2YI7 A;  4CE2 A;  1YER A;  4HY1 A;  1GKZ A;  1I5B A;  5FND A;  3TTZ A;  4DZY A;  1QZR A;  2K5B A;  1KIJ A;  2ZBK B;  2BSM A;  4ASG A;  3HYZ A;  4WUB A;  5M4E A;  2XD6 A;  2Q8G A;  4U7N A;  1ZW9 A;  2YEH A;  3C0E A;  3INW A;  4URM A;  1GJV A;  5CF0 A;  3B28 A;  4R1F A;  2Q8F A;  2O1V A;  2YE8 A;  1AJ6 A;  2BYH A;  2YEF A;  3VHA A;  3R4N A;  1QY8 A;  2FWZ A;  2YED A;  2QF6 A;  5FNC A;  4HZ5 A;  4KP4 A;  3D36 A;  4QPJ A;  1Z5C A;  3D2R A;  4YKU A;  1AMW A;  1U2O A;  4E00 A;  1I59 A;  2H55 A;  2ZDY A;  4NH8 A;  3VAD A;  4KFG A;  1YT0 A;  2E0A A;  4U93 A;  4MPE A;  3U67 A;  2YKB A;  3O6O A;  4O0B A;  2Q8H A;  4XCL A;  4BQG A;  1MU5 A;  5J71 A;  2IWS A;  1YES A;  2JJC A;  3EHH A;  3VHC A;  2YI0 A;  4XKA A;  1YC3 A;  4H7Q A;  5D6Q A;  1I5A A;  4FCR A;  2WER A;  3PEJ A;  4CWT A;  3T0Z A;  1B62 A;  2WI5 A;  1BKN A;  3OPD A;  2VWC A;  5FNF A;  4DUH A;  4XIQ A;  4YKR A;  3FV5 A;  1R62 A;  1L0O A;  4AS9 A;  1BYQ A;  3CWV A;  3CRL A;  3ZM7 A;  4YKX A;  3WQ9 A;  2BRE A;  3ZXQ A;  4ASF A;  2XAB A;  5D7R A;  2XJG A;  3RLP A;  2HKJ A;  3G75 A;  3U2D A;  4WUC A;  5M4K A;  3VHD A;  1I5C A;  1TC6 A;  2JKI A;  2H8M A;  1H7S A;  4CE3 A;  3A0W A;  4V25 A;  1YSR A;  1Z5B A;  1A4H A;  2YJX A;  5IDJ A;  4URL A;  4R3A A;  2YE7 A;  4BAE A;  5M4M A;  4GQT A;  2VCI A;  5J6A A;  2QG2 A;  4PL9 A;  4LP0 A;  4MPN A;  4O09 A;  3K99 A;  5D7D A;  2WEQ A;  4HY6 A;  5M4P A; 
#chains in the Genus database with same CATH topology
 1S16 A;  2CH4 A;  2IOP A;  4PRX A;  2XHT A;  3BMY A;  2XHR A;  3Q5L A;  4CWS A;  5CTY A;  1YT2 A;  4EMV A;  4I3H A;  1S14 A;  2GFD A;  4P7A A;  4XC0 A;  1YC4 A;  4HXW A;  4MP7 A;  2IOR A;  2Q2E B;  4JAU A;  5IDM A;  4LWI A;  4JAV A;  3EHJ A;  4XIP A;  2HCH A;  3B26 A;  2CGF A;  4YKT A;  1AH6 A;  1YS3 A;  1EA6 A;  2XHX A;  5CTW A;  1F51 A;  5F5R A;  3ZKD A;  3S5T A;  2AKP A;  2ESA A;  1GKX A;  3LMM A;  4CE1 A;  1TID A;  4KSG A;  2XK2 A;  3H4L A;  2WI4 A;  1IXM A;  2WI6 A;  4H81 A;  4XE2 A;  4URN A;  4L94 A;  4PU9 A;  4URO A;  3TZ0 A;  3TZ5 A;  4XDM A;  1H7U A;  4E01 A;  2XJJ A;  2WI2 A;  4KTN A;  4GT8 A;  2PNR A;  4HXZ A;  4CWR A;  4GGL A;  4Q20 A;  2YEI A;  3R91 A;  1TC0 A;  3TUH A;  2VCJ A;  3T0H A;  3CRK A;  2BU5 A;  4LWF A;  5D6P A;  3T10 A;  2QFO A;  4P8O A;  3A0X A;  4GCZ A;  4B6C A;  2YI6 A;  3Q5J A;  5M4H A;  2XDU A;  2YGA A;  4JAS A;  4EGH A;  4WUD A;  2YKE A;  3R4O A;  1US7 A;  4XKO A;  4XIT A;  1Z59 A;  4ASB A;  2IOQ A;  2ZKJ A;  4CWN A;  2ZDX A;  3ZKB A;  5D7C A;  4HYP A;  4NH9 A;  4I5S A;  1OSF A;  1ID0 A;  5GGZ A;  2O1W A;  2XX4 A;  3B25 A;  2YE2 A;  3GIG B;  4KSH A;  2YE9 A;  1AM1 A;  1NHJ A;  2XDL A;  1YC1 A;  4YKZ A;  2IWX A;  4V26 A;  5M4N A;  3PEH A;  3HYY A;  3HZ5 A;  3NMQ A;  4L91 A;  1Y4U A;  4YKQ A;  1UYG A;  2BU7 A;  5CTX A;  1BXD A;  5F3K A;  2YEJ A;  4BIU A;  4GEE A;  1QYE A;  2YEE A;  4ZKI A;  2YE6 A;  2YEA A;  1THN A;  3INX A;  1TH8 A;  3LPS A;  2EXL A;  3ZXO A;  4H85 A;  4MPC A;  5BOC A;  3R4P A;  4LWE A;  4O05 A;  3H80 A;  2BU6 A;  4L93 A;  4B7P A;  2BT0 A;  2UWD A;  3C11 A;  1UY8 A;  3FT8 A;  3R4M A;  3G7E A;  2YK9 A;  5C93 A;  2YKC A;  4AWQ A;  4EM7 A;  2BTZ A;  4EFU A;  4PRV A;  4FCP A;  4XKK A;  3RLR A;  4L8Z A;  2YJW A;  1Y8O A;  1B3Q A;  4MOT A;  3IED A;  1MX0 A;  3A0Z A;  3RKZ A;  2BZ5 A;  2CCT A;  2VW5 A;  2WI1 A;  3K98 A;  3SL2 A;  3HEK A;  3TZ2 A;  2YGF A;  5BOD A;  4X9L A;  4EEH A;  1UYM A;  5FWK A;  4MBC A;  4YKW A;  3TZ4 A;  4XTJ A;  1Y8P A;  1PVG A;  4LPB A;  2XX2 A;  3A0T A;  3MNR P;  1TIL A;  5JEN A;  4BXI A;  2CCU A;  4CWF A;  2WEP A;  4FPP A;  3K97 A;  2IWU A;  1I58 A;  4KQV A;  4BQJ A;  3DGE A;  1I5D A;  2QG0 A;  1UY9 A;  3T1K A;  2YGE A;  1UYF A;  2YEC A;  3CGZ A;  4XD8 A;  4ZVI A;  3QDD A;  3EHG A;  2C1I A;  1UYI A;  2XX5 A;  1ZWH A;  4BIZ A;  1U0Z A;  3QTF A;  3A0R A;  3Q5K A;  1ZXN A;  2HG1 A;  4HZ0 A;  4XIR A;  4E72 A;  1YT1 A;  2BRC A;  4XCJ A;  4NH7 A;  5CTU A;  1YSZ A;  2WI3 A;  1B63 A;  2XCM A;  2YEB A;  3G7B A;  3GIE A;  4FMT A;  2WI7 A;  4HYM A;  4MB9 A;  1UYK A;  2GQP A;  3RLQ A;  4L90 A;  4MP2 A;  3EHF A;  3U2K A;  4AWP A;  4CWP A;  1UYH A;  4EGI A;  4FCQ A;  4E02 A;  3OWD A;  2XDS A;  4JQL A;  4LWH A;  1TBW A;  1YET A;  2HHI A;  3GIG A;  3T2S A;  4CWQ A;  1BGQ A;  3KE6 A;  3OW6 A;  2FWY A;  2YK2 A;  2O1U A;  3EKR A;  1UYD A;  5CPH A;  4ASA A;  3CYG A;  1EI1 A;  3B27 A;  1UYL A;  2YE5 A;  2YI5 A;  2XDX A;  3JZ3 A;  4AWO A;  3LNU A;  3A0Y A;  5IN9 A;  3HHU A;  2FYP A;  3K60 A;  3EKO A;  1UYC A;  3BM9 A;  4QPK A;  4U7O A;  1NHH A;  3GIF A;  2YEG A;  3D0B A;  1Z5A A;  4YKY A;  4GFN A;  3FT5 A;  3O2F A;  2BU8 A;  1ZXM A;  4K4O A;  4EGK A;  3R92 A;  1UY7 A;  2FXS A;  2XDK A;  1AH8 A;  2BYI A;  2CCS A;  2Q8I A;  2YKJ A;  4R3M A;  4LWG A;  5L3J A;  2YE3 A;  3HZ1 A;  1KZN A;  3CGY A;  3WHA A;  3OMU A;  3OWB A;  2XJX A;  2YE4 A;  2C1G A;  1NHI A;  3B24 A;  4CWO A;  2C2A A;  4EFT A;  1UYE A;  2CG9 A;  4O07 A;  1JM6 A;  3O0I A;  2BU2 A;  4O04 A;  1Y4S A;  4W7T A;  2YKI A;  1Y8N A;  1UY6 A;  2YI7 A;  4CE2 A;  1YER A;  4HY1 A;  1GKZ A;  1I5B A;  5FND A;  3TTZ A;  4DZY A;  1QZR A;  2K5B A;  1KIJ A;  2ZBK B;  2BSM A;  4ASG A;  3HYZ A;  4WUB A;  5M4E A;  2XD6 A;  2Q8G A;  4U7N A;  1ZW9 A;  2YEH A;  3C0E A;  3INW A;  4URM A;  1GJV A;  5CF0 A;  3B28 A;  4R1F A;  2Q8F A;  2O1V A;  2YE8 A;  1AJ6 A;  2BYH A;  2YEF A;  3VHA A;  3R4N A;  1QY8 A;  2FWZ A;  2YED A;  2QF6 A;  5FNC A;  4HZ5 A;  4KP4 A;  3D36 A;  4QPJ A;  1Z5C A;  3D2R A;  4YKU A;  1AMW A;  1U2O A;  4E00 A;  1I59 A;  2H55 A;  2ZDY A;  4NH8 A;  3VAD A;  4KFG A;  1YT0 A;  2E0A A;  4U93 A;  4MPE A;  3U67 A;  2YKB A;  3O6O A;  4O0B A;  2Q8H A;  4XCL A;  4BQG A;  1MU5 A;  5J71 A;  2IWS A;  1YES A;  2JJC A;  3EHH A;  3VHC A;  2YI0 A;  4XKA A;  1YC3 A;  4H7Q A;  5D6Q A;  1I5A A;  4FCR A;  2WER A;  3PEJ A;  4CWT A;  3T0Z A;  1B62 A;  2WI5 A;  1BKN A;  3OPD A;  2VWC A;  5FNF A;  4DUH A;  4XIQ A;  4YKR A;  3FV5 A;  1R62 A;  1L0O A;  4AS9 A;  1BYQ A;  3CWV A;  3CRL A;  3ZM7 A;  4YKX A;  3WQ9 A;  2BRE A;  3ZXQ A;  4ASF A;  2XAB A;  5D7R A;  2XJG A;  3RLP A;  2HKJ A;  3G75 A;  3U2D A;  4WUC A;  5M4K A;  3VHD A;  1I5C A;  1TC6 A;  2JKI A;  2H8M A;  1H7S A;  4CE3 A;  3A0W A;  4V25 A;  1YSR A;  1Z5B A;  1A4H A;  2YJX A;  5IDJ A;  2FTK A;  4URL A;  4R3A A;  2YE7 A;  4BAE A;  5M4M A;  4GQT A;  2VCI A;  5J6A A;  2QG2 A;  4PL9 A;  4LP0 A;  4MPN A;  4O09 A;  3K99 A;  5D7D A;  2WEQ A;  4HY6 A;  5M4P A; 
#chains in the Genus database with same CATH homology
 1S16 A;  2CH4 A;  2IOP A;  4PRX A;  2XHT A;  3BMY A;  2XHR A;  3Q5L A;  4CWS A;  5CTY A;  1YT2 A;  4EMV A;  4I3H A;  1S14 A;  2GFD A;  4P7A A;  4XC0 A;  1YC4 A;  4HXW A;  4MP7 A;  2IOR A;  2Q2E B;  4JAU A;  5IDM A;  4LWI A;  4JAV A;  3EHJ A;  4XIP A;  2HCH A;  3B26 A;  2CGF A;  4YKT A;  1AH6 A;  1YS3 A;  1EA6 A;  2XHX A;  5CTW A;  5F5R A;  3ZKD A;  2AKP A;  2ESA A;  1GKX A;  4CE1 A;  1TID A;  4KSG A;  2XK2 A;  3H4L A;  2WI4 A;  2WI6 A;  4H81 A;  4XE2 A;  4URN A;  4L94 A;  4PU9 A;  4URO A;  3TZ0 A;  3TZ5 A;  4XDM A;  1H7U A;  4E01 A;  2XJJ A;  2WI2 A;  4KTN A;  4GT8 A;  2PNR A;  4HXZ A;  4CWR A;  4GGL A;  4Q20 A;  2YEI A;  3R91 A;  1TC0 A;  3TUH A;  2VCJ A;  3T0H A;  3CRK A;  2BU5 A;  4LWF A;  5D6P A;  3T10 A;  2QFO A;  4P8O A;  3A0X A;  4GCZ A;  4B6C A;  2YI6 A;  3Q5J A;  5M4H A;  2XDU A;  2YGA A;  4JAS A;  4EGH A;  4WUD A;  2YKE A;  3R4O A;  1US7 A;  4XKO A;  4XIT A;  1Z59 A;  4ASB A;  2IOQ A;  2ZKJ A;  4CWN A;  2ZDX A;  3ZKB A;  5D7C A;  4HYP A;  4NH9 A;  4I5S A;  1OSF A;  1ID0 A;  5GGZ A;  2O1W A;  2XX4 A;  3B25 A;  2YE2 A;  3GIG B;  4KSH A;  2YE9 A;  1AM1 A;  1NHJ A;  2XDL A;  1YC1 A;  4YKZ A;  2IWX A;  4V26 A;  5M4N A;  3PEH A;  3HYY A;  3HZ5 A;  3NMQ A;  4L91 A;  1Y4U A;  4YKQ A;  1UYG A;  2BU7 A;  5CTX A;  1BXD A;  5F3K A;  2YEJ A;  4BIU A;  4GEE A;  1QYE A;  2YEE A;  4ZKI A;  2YE6 A;  2YEA A;  1THN A;  3INX A;  1TH8 A;  3LPS A;  2EXL A;  3ZXO A;  4H85 A;  4MPC A;  5BOC A;  3R4P A;  4LWE A;  4O05 A;  3H80 A;  2BU6 A;  4L93 A;  4B7P A;  2BT0 A;  2UWD A;  3C11 A;  1UY8 A;  3FT8 A;  3R4M A;  3G7E A;  2YK9 A;  5C93 A;  2YKC A;  4AWQ A;  4EM7 A;  2BTZ A;  4EFU A;  4PRV A;  4FCP A;  4XKK A;  3RLR A;  4L8Z A;  2YJW A;  1Y8O A;  1B3Q A;  4MOT A;  3IED A;  1MX0 A;  3A0Z A;  3RKZ A;  2BZ5 A;  2CCT A;  2VW5 A;  2WI1 A;  3K98 A;  3SL2 A;  3HEK A;  3TZ2 A;  2YGF A;  5BOD A;  4X9L A;  4EEH A;  1UYM A;  5FWK A;  4MBC A;  4YKW A;  3TZ4 A;  4XTJ A;  1Y8P A;  1PVG A;  4LPB A;  2XX2 A;  3A0T A;  3MNR P;  1TIL A;  4BXI A;  2CCU A;  4CWF A;  2WEP A;  4FPP A;  3K97 A;  2IWU A;  1I58 A;  4KQV A;  4BQJ A;  3DGE A;  1I5D A;  2QG0 A;  1UY9 A;  3T1K A;  2YGE A;  1UYF A;  2YEC A;  3CGZ A;  4XD8 A;  4ZVI A;  3QDD A;  3EHG A;  1UYI A;  2XX5 A;  1ZWH A;  4BIZ A;  1U0Z A;  3QTF A;  3A0R A;  3Q5K A;  1ZXN A;  2HG1 A;  4HZ0 A;  4XIR A;  1YT1 A;  2BRC A;  4XCJ A;  4NH7 A;  5CTU A;  1YSZ A;  2WI3 A;  1B63 A;  2XCM A;  2YEB A;  3G7B A;  3GIE A;  4FMT A;  2WI7 A;  4HYM A;  4MB9 A;  1UYK A;  2GQP A;  3RLQ A;  4L90 A;  4MP2 A;  3EHF A;  3U2K A;  4AWP A;  4CWP A;  1UYH A;  4EGI A;  4FCQ A;  4E02 A;  3OWD A;  2XDS A;  4JQL A;  4LWH A;  1TBW A;  1YET A;  3GIG A;  3T2S A;  4CWQ A;  1BGQ A;  3KE6 A;  3OW6 A;  2FWY A;  2YK2 A;  2O1U A;  3EKR A;  1UYD A;  5CPH A;  4ASA A;  1EI1 A;  3B27 A;  1UYL A;  2YE5 A;  2YI5 A;  2XDX A;  3JZ3 A;  4AWO A;  3LNU A;  3A0Y A;  5IN9 A;  3HHU A;  2FYP A;  3K60 A;  3EKO A;  1UYC A;  3BM9 A;  4QPK A;  4U7O A;  1NHH A;  3GIF A;  2YEG A;  3D0B A;  1Z5A A;  4YKY A;  4GFN A;  3FT5 A;  3O2F A;  2BU8 A;  1ZXM A;  4K4O A;  4EGK A;  3R92 A;  1UY7 A;  2FXS A;  2XDK A;  1AH8 A;  2BYI A;  2CCS A;  2Q8I A;  2YKJ A;  4R3M A;  4LWG A;  5L3J A;  2YE3 A;  3HZ1 A;  1KZN A;  3CGY A;  3WHA A;  3OMU A;  3OWB A;  2XJX A;  2YE4 A;  1NHI A;  3B24 A;  4CWO A;  2C2A A;  4EFT A;  1UYE A;  2CG9 A;  4O07 A;  1JM6 A;  3O0I A;  2BU2 A;  4O04 A;  1Y4S A;  4W7T A;  2YKI A;  1Y8N A;  1UY6 A;  2YI7 A;  4CE2 A;  1YER A;  4HY1 A;  1GKZ A;  1I5B A;  5FND A;  3TTZ A;  4DZY A;  1QZR A;  2K5B A;  1KIJ A;  2ZBK B;  2BSM A;  4ASG A;  3HYZ A;  4WUB A;  5M4E A;  2XD6 A;  2Q8G A;  4U7N A;  1ZW9 A;  2YEH A;  3C0E A;  3INW A;  4URM A;  1GJV A;  5CF0 A;  3B28 A;  4R1F A;  2Q8F A;  2O1V A;  2YE8 A;  1AJ6 A;  2BYH A;  2YEF A;  3VHA A;  3R4N A;  1QY8 A;  2FWZ A;  2YED A;  2QF6 A;  5FNC A;  4HZ5 A;  4KP4 A;  3D36 A;  4QPJ A;  1Z5C A;  3D2R A;  4YKU A;  1AMW A;  1U2O A;  4E00 A;  1I59 A;  2H55 A;  2ZDY A;  4NH8 A;  3VAD A;  4KFG A;  1YT0 A;  2E0A A;  4U93 A;  4MPE A;  3U67 A;  2YKB A;  3O6O A;  4O0B A;  2Q8H A;  4XCL A;  4BQG A;  1MU5 A;  5J71 A;  2IWS A;  1YES A;  2JJC A;  3EHH A;  3VHC A;  2YI0 A;  4XKA A;  1YC3 A;  4H7Q A;  5D6Q A;  1I5A A;  4FCR A;  2WER A;  3PEJ A;  4CWT A;  3T0Z A;  1B62 A;  2WI5 A;  1BKN A;  3OPD A;  2VWC A;  5FNF A;  4DUH A;  4XIQ A;  4YKR A;  3FV5 A;  1R62 A;  1L0O A;  4AS9 A;  1BYQ A;  3CWV A;  3CRL A;  3ZM7 A;  4YKX A;  3WQ9 A;  2BRE A;  3ZXQ A;  4ASF A;  2XAB A;  5D7R A;  2XJG A;  3RLP A;  2HKJ A;  3G75 A;  3U2D A;  4WUC A;  5M4K A;  3VHD A;  1I5C A;  1TC6 A;  2JKI A;  2H8M A;  1H7S A;  4CE3 A;  3A0W A;  4V25 A;  1YSR A;  1Z5B A;  1A4H A;  2YJX A;  5IDJ A;  4URL A;  4R3A A;  2YE7 A;  4BAE A;  5M4M A;  4GQT A;  2VCI A;  5J6A A;  2QG2 A;  4PL9 A;  4LP0 A;  4MPN A;  4O09 A;  3K99 A;  5D7D A;  2WEQ A;  4HY6 A;  5M4P A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...