1I59A

Structure of the histidine kinase chea atp-binding domain in complex with adpnp and magensium
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
188
structure length
180
Chain Sequence
b'SHMVPISFVFNRFPRMVRDLAKKMNKEVNFIMRGEDTELDRTFVEEIGEPLLHLLRNAIDHGIEPKEERIAKGKPPIGTLILSARHEGNNVVIEVEDDGRGIDKEKIIRKAIEKGLIDESKAATLSDQEILNFLFVPGFSTKRGVGMDVVKNVVESLNGSISIESEKDKGTKVTIRLPLT'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords CHEMOTAXIS PROTEIN CHEA
molecule tags Signaling protein, transferase
source organism Thermotoga maritima
publication title Nucleotide binding by the histidine kinase CheA.
pubmed doi rcsb
total genus 57
structure length 180
sequence length 188
chains with identical sequence B
ec nomenclature ec 2.7.13.3: Histidine kinase.
pdb deposition date 2001-02-26
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.565.10 Alpha Beta 2-Layer Sandwich Heat Shock Protein 90 Histidine kinase-like ATPase, C-terminal domain 1i59A00
3ZXQA 3GIFA 4HXWA 2XJJA 3H80A 5IDMA 3HZ5A 2XD6A 5IDJA 4MPCA 2O1WA 3BMYA 4U7OA 4CWRA 4GCZA 2YI0A 3ZKDA 1UYFA 2JJCA 1MX0A 3PEJA 4Q20A 4YKRA 4BIUA 2WEQA 4JQLA 1AH8A 1GJVA 4XKKA 3Q5JA 1AMWA 4R1FA 4WUCA 2YE6A 1I5CA 4FPPA 1YC3A 3NMQA 4LWIA 3BM9A 3TZ4A 4XCJA 4BXIA 5FNDA 2IORA 2YJXA 3TUHA 1YETA 4YKUA 4AWQA 2CH4A 3O2FA 1ZXMA 4LWEA 4MOTA 5M4EA 5GGZA 4CE3A 2QG0A 3B27A 1UYHA 2ZKJA 4X9LA 5M4MA 1GKZA 2WI5A 2QF6A 4U93A 5CF0A 1A4HA 2O1UA 5CTYA 2XDXA 3DGEA 3T10A 3EHGA 1NHJA 1Y8OA 4NH7A 2XHXA 4MP2A 4FMTA 5CTXA 2YE7A 4EFTA 1ZWHA 2QFOA 4DUHA 3JZ3A 4URNA 1TC0A 3GIGB 1R62A 1UY9A 4LP0A 4XD8A 2YJWA 1ZW9A 3G75A 1H7UA 2ZBKB 4MBCA 1I58A 1BGQA 3HYZA 3KE6A 2BU7A 2XCMA 3GIEA 5D7DA 4XE2A 4WUBA 2UWDA 1TH8A 4V25A 2YEAA 3CRKA 4HYMA 3CGYA 4CE2A 4GQTA 4YKTA 3OMUA 5BODA 1ID0A 4H81A 4P8OA 4MPEA 3K60A 3R4MA 3HYYA 4H7QA 1TIDA 4BQJA 2YK2A 2YEEA 4XKOA 1KZNA 2XJGA 3LPSA 4L94A 5L3JA 4V26A 4EFUA 5M4NA 2BREA 5C93A 2WI3A 4EGIA 4FCPA 3VHAA 1UYKA 4YKQA 2XX5A 3TZ5A 2XDKA 2XDUA 4CE1A 2CCSA 2YEIA 2CG9A 4BQGA 4PRXA 4EM7A 3B26A 1I5BA 2YE4A 1S14A 4BIZA 1Y4UA 4W7TA 4I5SA 4E01A 2H8MA 4CWSA 2BU5A 4YKYA 4XITA 3OPDA 2XHRA 1Z5AA 2ZDXA 4PL9A 2YKBA 2YGAA 2YGFA 3HZ1A 4LPBA 2BU8A 2YE9A 3TTZA 4ZVIA 2Q8IA 4NH8A 4K4OA 3RKZA 1AM1A 3LNUA 3CWVA 2HCHA 1B63A 2VCIA 3WHAA 1YC4A 2AKPA 2FWZA 1UYEA 1YT1A 4JASA 4B7PA 2BU6A 3A0YA 1Y8NA 2XJXA 2XDLA 4GT8A 3ZKBA 1TC6A 3T1KA 4ASAA 3Q5LA 4R3AA 4B6CA 2BU2A 1U2OA 3HEKA 4EGKA 5F5RA 2PNRA 3ZM7A 1Y4SA 4E00A 4HZ5A 4AS9A 3U2DA 4CWFA 1Z59A 2GQPA 2XHTA 4KTNA 4P7AA 1ZXNA 3RLPA 2YE3A 2YEJA 4XCLA 4AWPA 4O09A 3A0RA 4FCQA 4KSHA 4HY1A 3B25A 3EHFA 1I5DA 3R4PA 2Q8FA 4JAVA 2O1VA 2YK9A 4R3MA 3D0BA 2IWUA 4CWPA 3SL2A 4PU9A 3EHHA 3IEDA 5CTUA 4URMA 2YEGA 1EA6A 3R4NA 4LWHA 4HXZA 4L90A 5M4HA 3TZ2A 4WUDA 2BYHA 4CWTA 2WI4A 4XC0A 2WERA 4XIQA 3RLQA 1EI1A 1BKNA 2WI6A 3EKRA 4L8ZA 1YESA 2XX4A 2YKEA 4ASBA 3A0WA 4JAUA 4CWQA 3C11A 4YKWA 4LWGA 2FYPA 4CWNA 4MPNA 3OWDA 4GGLA 2YI5A 5D7CA 5FNCA 4MP7A 3A0XA 4ZKIA 4E02A 3PEHA 2YKJA 3QDDA 2WI1A 1AJ6A 3HHUA 2YEHA 4XTJA 4GFNA 5IN9A 1YERA 3R92A 2XK2A 3B28A 4MB9A 2WI7A 1Z5CA 4YKXA 1B62A 3D36A 3FV5A 2E0AA 3TZ0A 2FXSA 5FWKA 4EGHA 3D2RA 3A0ZA 4L93A 4PRVA 4KP4A 1YT0A 1QZRA 2QG2A 3EKOA 2CCTA 5CPHA 3B24A 3QTFA 5J6AA 2K5BA 1B3QA 3O6OA 3GIGA 4QPKA 4L91A 2GFDA 1Z5BA 5D6PA 1YS3A 4H85A 2Q8GA 4NH9A 1H7SA 1TBWA 2YI7A 1UYGA 4BAEA 3R4OA 3C0EA 2ESAA 1MU5A 2BRCA 1BXDA 1PVGA 1JM6A 1NHHA 2VW5A 3U67A 2VWCA 3FT5A 4QPJA 2VCJA 4LWFA 1US7A 2IWSA 1GKXA 1QYEA 3K98A 2WI2A 2Q2EB 2WEPA 2BYIA 1I5AA 3VHDA 2BT0A 2JKIA 3INXA 1UYIA 5D7RA 4O0BA 1TILA 4O07A 2Q8HA 3U2KA 2H55A 2CCUA 5J71A 3MNRP 4GEEA 1YSRA 3Q5KA 1OSFA 2YECA 5M4KA 2YGEA 4UROA 5F3KA 4O04A 3FT8A 3RLRA 2BSMA 2C2AA 4EEHA 3R91A 1YSZA 4U7NA 3ZXOA 1UYCA 4XIRA 1YC1A 1YT2A 1UY6A 1Y8PA 2ZDYA 5M4PA 2YE5A 4YKZA 2FWYA 3G7BA 3O0IA 4KQVA 3T2SA 3EHJA 3G7EA 4KFGA 3CRLA 4AWOA 4O05A 4KSGA 3T0ZA 3A0TA 4ASGA 2IOQA 4EMVA 3OWBA 2YEDA 3K97A 2BZ5A 2CGFA 4ASFA 5CTWA 2HG1A 3VHCA 2EXLA 1AH6A 5D6QA 1KIJA 2YE8A 1NHIA 4CWOA 2HKJA 3INWA 4HY6A 1UY7A 1QY8A 1S16A 2IOPA 3WQ9A 2YKCA 4URLA 4FCRA 4HYPA 1I59A 2IWXA 3VADA 1UY8A 3OW6A 3T0HA 4XIPA 4DZYA 2YEBA 4HZ0A 2YKIA 5FNFA 3H4LA 2BTZA 2YI6A 3CGZA 2XX2A 5BOCA 3K99A 2XDSA 1BYQA 4XKAA 4I3HA 1U0ZA 1UYMA 1UYDA 2YEFA 1THNA 2XABA 4XDMA 2YE2A 1UYLA 1L0OA
chains in the Genus database with same CATH superfamily
3ZXQA 3GIFA 4HXWA 2XJJA 3H80A 5IDMA 3HZ5A 2XD6A 5IDJA 4MPCA 2O1WA 3BMYA 4U7OA 4CWRA 4GCZA 2YI0A 3ZKDA 1UYFA 2JJCA 1MX0A 3PEJA 4Q20A 4YKRA 4BIUA 2WEQA 4JQLA 1AH8A 1GJVA 4XKKA 3Q5JA 1AMWA 3S5TA 4R1FA 4WUCA 2YE6A 1I5CA 4FPPA 1YC3A 3NMQA 4LWIA 3BM9A 3TZ4A 4XCJA 4BXIA 5FNDA 2IORA 2YJXA 2HHIA 3TUHA 1YETA 4YKUA 4AWQA 2CH4A 3O2FA 1ZXMA 4LWEA 4MOTA 5M4EA 5GGZA 4CE3A 2QG0A 3B27A 1UYHA 2ZKJA 4X9LA 5M4MA 1GKZA 2WI5A 2QF6A 4U93A 5CF0A 1A4HA 2O1UA 3LMMA 5CTYA 2XDXA 3DGEA 3T10A 3EHGA 1NHJA 1Y8OA 4NH7A 2XHXA 4MP2A 4FMTA 5CTXA 2YE7A 4EFTA 1ZWHA 2QFOA 4DUHA 3JZ3A 2C1IA 4URNA 1TC0A 3GIGB 1R62A 1UY9A 4LP0A 4XD8A 2YJWA 1ZW9A 3G75A 1H7UA 2ZBKB 4MBCA 1I58A 1BGQA 3HYZA 3KE6A 2BU7A 2XCMA 3GIEA 5D7DA 4XE2A 4WUBA 2UWDA 1TH8A 4V25A 2YEAA 3CRKA 4HYMA 3CGYA 4CE2A 4GQTA 4YKTA 3OMUA 5BODA 1ID0A 4H81A 4P8OA 4MPEA 3K60A 3R4MA 3HYYA 4H7QA 1TIDA 4BQJA 2YK2A 2YEEA 4XKOA 1IXMA 1KZNA 2XJGA 1F51A 3LPSA 4L94A 5L3JA 4V26A 4EFUA 5M4NA 2BREA 5C93A 2WI3A 4EGIA 4FCPA 3VHAA 1UYKA 4YKQA 2XX5A 3TZ5A 2XDKA 2XDUA 4CE1A 2CCSA 2YEIA 2CG9A 4BQGA 4PRXA 4EM7A 3B26A 1I5BA 2YE4A 1S14A 4BIZA 1Y4UA 4W7TA 4I5SA 4E01A 2H8MA 4CWSA 2BU5A 4YKYA 4XITA 3OPDA 2XHRA 1Z5AA 2ZDXA 4PL9A 2YKBA 2YGAA 2YGFA 3HZ1A 4LPBA 2BU8A 2YE9A 3TTZA 4ZVIA 2Q8IA 4NH8A 4K4OA 3RKZA 1AM1A 3LNUA 3CWVA 2HCHA 1B63A 2VCIA 3WHAA 1YC4A 2AKPA 2FWZA 1UYEA 1YT1A 4JASA 4B7PA 2BU6A 3A0YA 1Y8NA 2XJXA 2XDLA 4GT8A 3ZKBA 1TC6A 3T1KA 4ASAA 3Q5LA 4R3AA 4B6CA 2BU2A 1U2OA 3HEKA 4EGKA 5F5RA 2PNRA 3ZM7A 1Y4SA 4E00A 4HZ5A 4AS9A 3U2DA 4CWFA 1Z59A 2GQPA 2XHTA 4KTNA 4P7AA 1ZXNA 3RLPA 2YE3A 2YEJA 4XCLA 4AWPA 4O09A 3A0RA 4FCQA 4KSHA 4HY1A 3B25A 3EHFA 1I5DA 3R4PA 2Q8FA 4JAVA 2O1VA 2YK9A 4R3MA 3D0BA 2IWUA 4CWPA 3SL2A 4PU9A 3EHHA 3IEDA 5CTUA 4URMA 2YEGA 1EA6A 3R4NA 4LWHA 4HXZA 4L90A 5M4HA 3TZ2A 4WUDA 2BYHA 4CWTA 2WI4A 4XC0A 2WERA 4XIQA 3RLQA 1EI1A 1BKNA 2WI6A 3EKRA 4L8ZA 1YESA 2XX4A 2YKEA 4ASBA 4E72A 3A0WA 4JAUA 4CWQA 3C11A 4YKWA 4LWGA 2FYPA 4CWNA 4MPNA 3OWDA 4GGLA 2YI5A 5D7CA 5FNCA 4MP7A 3A0XA 4ZKIA 4E02A 3PEHA 2YKJA 3QDDA 2WI1A 1AJ6A 3HHUA 2YEHA 4XTJA 4GFNA 5IN9A 1YERA 3R92A 2XK2A 3B28A 4MB9A 2WI7A 1Z5CA 4YKXA 1B62A 3D36A 3FV5A 2E0AA 3TZ0A 2FXSA 5FWKA 4EGHA 3D2RA 3A0ZA 4L93A 4PRVA 4KP4A 1YT0A 1QZRA 2QG2A 3EKOA 2CCTA 5CPHA 3B24A 3QTFA 5J6AA 2K5BA 1B3QA 3O6OA 3GIGA 4QPKA 4L91A 2GFDA 1Z5BA 5D6PA 1YS3A 4H85A 2Q8GA 4NH9A 1H7SA 1TBWA 2YI7A 1UYGA 4BAEA 3R4OA 3C0EA 2ESAA 1MU5A 2BRCA 1BXDA 1PVGA 1JM6A 1NHHA 2VW5A 3U67A 2VWCA 3FT5A 4QPJA 2VCJA 4LWFA 1US7A 2IWSA 1GKXA 1QYEA 3K98A 5JENA 2WI2A 2Q2EB 2WEPA 2BYIA 1I5AA 3VHDA 2BT0A 2JKIA 3INXA 1UYIA 5D7RA 4O0BA 1TILA 4O07A 2Q8HA 3U2KA 2H55A 2CCUA 5J71A 3MNRP 4GEEA 1YSRA 3Q5KA 1OSFA 2YECA 5M4KA 2YGEA 4UROA 5F3KA 4O04A 3FT8A 3RLRA 2BSMA 2C2AA 4EEHA 3R91A 1YSZA 4U7NA 3ZXOA 1UYCA 3CYGA 4XIRA 1YC1A 1YT2A 1UY6A 1Y8PA 2ZDYA 5M4PA 2YE5A 4YKZA 2FWYA 3G7BA 3O0IA 4KQVA 3T2SA 3EHJA 3G7EA 4KFGA 3CRLA 4AWOA 4O05A 4KSGA 3T0ZA 3A0TA 4ASGA 2IOQA 4EMVA 3OWBA 2YEDA 3K97A 2BZ5A 2CGFA 4ASFA 5CTWA 2HG1A 3VHCA 2EXLA 1AH6A 5D6QA 1KIJA 2YE8A 1NHIA 4CWOA 2HKJA 3INWA 4HY6A 1UY7A 1QY8A 1S16A 2IOPA 3WQ9A 2YKCA 2C1GA 4URLA 4FCRA 4HYPA 1I59A 2IWXA 3VADA 1UY8A 3OW6A 3T0HA 4XIPA 4DZYA 2YEBA 4HZ0A 2YKIA 5FNFA 3H4LA 2BTZA 2YI6A 3CGZA 2XX2A 5BOCA 2FTKA 3K99A 2XDSA 1BYQA 4XKAA 4I3HA 1U0ZA 1UYMA 1UYDA 2YEFA 1THNA 2XABA 4XDMA 2YE2A 1UYLA 1L0OA
chains in the Genus database with same CATH topology
3ZXQA 3GIFA 4HXWA 2XJJA 3H80A 5IDMA 3HZ5A 2XD6A 5IDJA 4MPCA 2O1WA 3BMYA 4U7OA 4CWRA 4GCZA 2YI0A 3ZKDA 1UYFA 2JJCA 1MX0A 3PEJA 4Q20A 4YKRA 4BIUA 2WEQA 4JQLA 1AH8A 1GJVA 4XKKA 3Q5JA 1AMWA 4R1FA 4WUCA 2YE6A 1I5CA 4FPPA 1YC3A 3NMQA 4LWIA 3BM9A 3TZ4A 4XCJA 4BXIA 5FNDA 2IORA 2YJXA 3TUHA 1YETA 4YKUA 4AWQA 2CH4A 3O2FA 1ZXMA 4LWEA 4MOTA 5M4EA 5GGZA 4CE3A 2QG0A 3B27A 1UYHA 2ZKJA 4X9LA 5M4MA 1GKZA 2WI5A 2QF6A 4U93A 5CF0A 1A4HA 2O1UA 5CTYA 2XDXA 3DGEA 3T10A 3EHGA 1NHJA 1Y8OA 4NH7A 2XHXA 4MP2A 4FMTA 5CTXA 2YE7A 4EFTA 1ZWHA 2QFOA 4DUHA 3JZ3A 4URNA 1TC0A 3GIGB 1R62A 1UY9A 4LP0A 4XD8A 2YJWA 1ZW9A 3G75A 1H7UA 2ZBKB 4MBCA 1I58A 1BGQA 3HYZA 3KE6A 2BU7A 2XCMA 3GIEA 5D7DA 4XE2A 4WUBA 2UWDA 1TH8A 4V25A 2YEAA 3CRKA 4HYMA 3CGYA 4CE2A 4GQTA 4YKTA 3OMUA 5BODA 1ID0A 4H81A 4P8OA 4MPEA 3K60A 3R4MA 3HYYA 4H7QA 1TIDA 4BQJA 2YK2A 2YEEA 4XKOA 1KZNA 2XJGA 3LPSA 4L94A 5L3JA 4V26A 4EFUA 5M4NA 2BREA 5C93A 2WI3A 4EGIA 4FCPA 3VHAA 1UYKA 4YKQA 2XX5A 3TZ5A 2XDKA 2XDUA 4CE1A 2CCSA 2YEIA 2CG9A 4BQGA 4PRXA 4EM7A 3B26A 1I5BA 2YE4A 1S14A 4BIZA 1Y4UA 4W7TA 4I5SA 4E01A 2H8MA 4CWSA 2BU5A 4YKYA 4XITA 3OPDA 2XHRA 1Z5AA 2ZDXA 4PL9A 2YKBA 2YGAA 2YGFA 3HZ1A 4LPBA 2BU8A 2YE9A 3TTZA 4ZVIA 2Q8IA 4NH8A 4K4OA 3RKZA 1AM1A 3LNUA 3CWVA 2HCHA 1B63A 2VCIA 3WHAA 1YC4A 2AKPA 2FWZA 1UYEA 1YT1A 4JASA 4B7PA 2BU6A 3A0YA 1Y8NA 2XJXA 2XDLA 4GT8A 3ZKBA 1TC6A 3T1KA 4ASAA 3Q5LA 4R3AA 4B6CA 2BU2A 1U2OA 3HEKA 4EGKA 5F5RA 2PNRA 3ZM7A 1Y4SA 4E00A 4HZ5A 4AS9A 3U2DA 4CWFA 1Z59A 2GQPA 2XHTA 4KTNA 4P7AA 1ZXNA 3RLPA 2YE3A 2YEJA 4XCLA 4AWPA 4O09A 3A0RA 4FCQA 4KSHA 4HY1A 3B25A 3EHFA 1I5DA 3R4PA 2Q8FA 4JAVA 2O1VA 2YK9A 4R3MA 3D0BA 2IWUA 4CWPA 3SL2A 4PU9A 3EHHA 3IEDA 5CTUA 4URMA 2YEGA 1EA6A 3R4NA 4LWHA 4HXZA 4L90A 5M4HA 3TZ2A 4WUDA 2BYHA 4CWTA 2WI4A 4XC0A 2WERA 4XIQA 3RLQA 1EI1A 1BKNA 2WI6A 3EKRA 4L8ZA 1YESA 2XX4A 2YKEA 4ASBA 3A0WA 4JAUA 4CWQA 3C11A 4YKWA 4LWGA 2FYPA 4CWNA 4MPNA 3OWDA 4GGLA 2YI5A 5D7CA 5FNCA 4MP7A 3A0XA 4ZKIA 4E02A 3PEHA 2YKJA 3QDDA 2WI1A 1AJ6A 3HHUA 2YEHA 4XTJA 4GFNA 5IN9A 1YERA 3R92A 2XK2A 3B28A 4MB9A 2WI7A 1Z5CA 4YKXA 1B62A 3D36A 3FV5A 2E0AA 3TZ0A 2FXSA 5FWKA 4EGHA 3D2RA 3A0ZA 4L93A 4PRVA 4KP4A 1YT0A 1QZRA 2QG2A 3EKOA 2CCTA 5CPHA 3B24A 3QTFA 5J6AA 2K5BA 1B3QA 3O6OA 3GIGA 4QPKA 4L91A 2GFDA 1Z5BA 5D6PA 1YS3A 4H85A 2Q8GA 4NH9A 1H7SA 1TBWA 2YI7A 1UYGA 4BAEA 3R4OA 3C0EA 2ESAA 1MU5A 2BRCA 1BXDA 1PVGA 1JM6A 1NHHA 2VW5A 3U67A 2VWCA 3FT5A 4QPJA 2VCJA 4LWFA 1US7A 2IWSA 1GKXA 1QYEA 3K98A 2WI2A 2Q2EB 2WEPA 2BYIA 1I5AA 3VHDA 2BT0A 2JKIA 3INXA 1UYIA 5D7RA 4O0BA 1TILA 4O07A 2Q8HA 3U2KA 2H55A 2CCUA 5J71A 3MNRP 4GEEA 1YSRA 3Q5KA 1OSFA 2YECA 5M4KA 2YGEA 4UROA 5F3KA 4O04A 3FT8A 3RLRA 2BSMA 2C2AA 4EEHA 3R91A 1YSZA 4U7NA 3ZXOA 1UYCA 4XIRA 1YC1A 1YT2A 1UY6A 1Y8PA 2ZDYA 5M4PA 2YE5A 4YKZA 2FWYA 3G7BA 3O0IA 4KQVA 3T2SA 3EHJA 3G7EA 4KFGA 3CRLA 4AWOA 4O05A 4KSGA 3T0ZA 3A0TA 4ASGA 2IOQA 4EMVA 3OWBA 2YEDA 3K97A 2BZ5A 2CGFA 4ASFA 5CTWA 2HG1A 3VHCA 2EXLA 1AH6A 5D6QA 1KIJA 2YE8A 1NHIA 4CWOA 2HKJA 3INWA 4HY6A 1UY7A 1QY8A 1S16A 2IOPA 3WQ9A 2YKCA 4URLA 4FCRA 4HYPA 1I59A 2IWXA 3VADA 1UY8A 3OW6A 3T0HA 4XIPA 4DZYA 2YEBA 4HZ0A 2YKIA 5FNFA 3H4LA 2BTZA 2YI6A 3CGZA 2XX2A 5BOCA 3K99A 2XDSA 1BYQA 4XKAA 4I3HA 1U0ZA 1UYMA 1UYDA 2YEFA 1THNA 2XABA 4XDMA 2YE2A 1UYLA 1L0OA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3ZXQ A;  3GIF A;  4HXW A;  2XJJ A;  3H80 A;  5IDM A;  3HZ5 A;  2XD6 A;  5IDJ A;  4MPC A;  2O1W A;  3BMY A;  4U7O A;  4CWR A;  4GCZ A;  2YI0 A;  3ZKD A;  1UYF A;  2JJC A;  1MX0 A;  3PEJ A;  4Q20 A;  4YKR A;  4BIU A;  2WEQ A;  4JQL A;  1AH8 A;  1GJV A;  4XKK A;  3Q5J A;  1AMW A;  4R1F A;  4WUC A;  2YE6 A;  1I5C A;  4FPP A;  1YC3 A;  3NMQ A;  4LWI A;  3BM9 A;  3TZ4 A;  4XCJ A;  4BXI A;  5FND A;  2IOR A;  2YJX A;  3TUH A;  1YET A;  4YKU A;  4AWQ A;  2CH4 A;  3O2F A;  1ZXM A;  4LWE A;  4MOT A;  5M4E A;  5GGZ A;  4CE3 A;  2QG0 A;  3B27 A;  1UYH A;  2ZKJ A;  4X9L A;  5M4M A;  1GKZ A;  2WI5 A;  2QF6 A;  4U93 A;  5CF0 A;  1A4H A;  2O1U A;  5CTY A;  2XDX A;  3DGE A;  3T10 A;  3EHG A;  1NHJ A;  1Y8O A;  4NH7 A;  2XHX A;  4MP2 A;  4FMT A;  5CTX A;  2YE7 A;  4EFT A;  1ZWH A;  2QFO A;  4DUH A;  3JZ3 A;  4URN A;  1TC0 A;  3GIG B;  1R62 A;  1UY9 A;  4LP0 A;  4XD8 A;  2YJW A;  1ZW9 A;  3G75 A;  1H7U A;  2ZBK B;  4MBC A;  1I58 A;  1BGQ A;  3HYZ A;  3KE6 A;  2BU7 A;  2XCM A;  3GIE A;  5D7D A;  4XE2 A;  4WUB A;  2UWD A;  1TH8 A;  4V25 A;  2YEA A;  3CRK A;  4HYM A;  3CGY A;  4CE2 A;  4GQT A;  4YKT A;  3OMU A;  5BOD A;  1ID0 A;  4H81 A;  4P8O A;  4MPE A;  3K60 A;  3R4M A;  3HYY A;  4H7Q A;  1TID A;  4BQJ A;  2YK2 A;  2YEE A;  4XKO A;  1KZN A;  2XJG A;  3LPS A;  4L94 A;  5L3J A;  4V26 A;  4EFU A;  5M4N A;  2BRE A;  5C93 A;  2WI3 A;  4EGI A;  4FCP A;  3VHA A;  1UYK A;  4YKQ A;  2XX5 A;  3TZ5 A;  2XDK A;  2XDU A;  4CE1 A;  2CCS A;  2YEI A;  2CG9 A;  4BQG A;  4PRX A;  4EM7 A;  3B26 A;  1I5B A;  2YE4 A;  1S14 A;  4BIZ A;  1Y4U A;  4W7T A;  4I5S A;  4E01 A;  2H8M A;  4CWS A;  2BU5 A;  4YKY A;  4XIT A;  3OPD A;  2XHR A;  1Z5A A;  2ZDX A;  4PL9 A;  2YKB A;  2YGA A;  2YGF A;  3HZ1 A;  4LPB A;  2BU8 A;  2YE9 A;  3TTZ A;  4ZVI A;  2Q8I A;  4NH8 A;  4K4O A;  3RKZ A;  1AM1 A;  3LNU A;  3CWV A;  2HCH A;  1B63 A;  2VCI A;  3WHA A;  1YC4 A;  2AKP A;  2FWZ A;  1UYE A;  1YT1 A;  4JAS A;  4B7P A;  2BU6 A;  3A0Y A;  1Y8N A;  2XJX A;  2XDL A;  4GT8 A;  3ZKB A;  1TC6 A;  3T1K A;  4ASA A;  3Q5L A;  4R3A A;  4B6C A;  2BU2 A;  1U2O A;  3HEK A;  4EGK A;  5F5R A;  2PNR A;  3ZM7 A;  1Y4S A;  4E00 A;  4HZ5 A;  4AS9 A;  3U2D A;  4CWF A;  1Z59 A;  2GQP A;  2XHT A;  4KTN A;  4P7A A;  1ZXN A;  3RLP A;  2YE3 A;  2YEJ A;  4XCL A;  4AWP A;  4O09 A;  3A0R A;  4FCQ A;  4KSH A;  4HY1 A;  3B25 A;  3EHF A;  1I5D A;  3R4P A;  2Q8F A;  4JAV A;  2O1V A;  2YK9 A;  4R3M A;  3D0B A;  2IWU A;  4CWP A;  3SL2 A;  4PU9 A;  3EHH A;  3IED A;  5CTU A;  4URM A;  2YEG A;  1EA6 A;  3R4N A;  4LWH A;  4HXZ A;  4L90 A;  5M4H A;  3TZ2 A;  4WUD A;  2BYH A;  4CWT A;  2WI4 A;  4XC0 A;  2WER A;  4XIQ A;  3RLQ A;  1EI1 A;  1BKN A;  2WI6 A;  3EKR A;  4L8Z A;  1YES A;  2XX4 A;  2YKE A;  4ASB A;  3A0W A;  4JAU A;  4CWQ A;  3C11 A;  4YKW A;  4LWG A;  2FYP A;  4CWN A;  4MPN A;  3OWD A;  4GGL A;  2YI5 A;  5D7C A;  5FNC A;  4MP7 A;  3A0X A;  4ZKI A;  4E02 A;  3PEH A;  2YKJ A;  3QDD A;  2WI1 A;  1AJ6 A;  3HHU A;  2YEH A;  4XTJ A;  4GFN A;  5IN9 A;  1YER A;  3R92 A;  2XK2 A;  3B28 A;  4MB9 A;  2WI7 A;  1Z5C A;  4YKX A;  1B62 A;  3D36 A;  3FV5 A;  2E0A A;  3TZ0 A;  2FXS A;  5FWK A;  4EGH A;  3D2R A;  3A0Z A;  4L93 A;  4PRV A;  4KP4 A;  1YT0 A;  1QZR A;  2QG2 A;  3EKO A;  2CCT A;  5CPH A;  3B24 A;  3QTF A;  5J6A A;  2K5B A;  1B3Q A;  3O6O A;  3GIG A;  4QPK A;  4L91 A;  2GFD A;  1Z5B A;  5D6P A;  1YS3 A;  4H85 A;  2Q8G A;  4NH9 A;  1H7S A;  1TBW A;  2YI7 A;  1UYG A;  4BAE A;  3R4O A;  3C0E A;  2ESA A;  1MU5 A;  2BRC A;  1BXD A;  1PVG A;  1JM6 A;  1NHH A;  2VW5 A;  3U67 A;  2VWC A;  3FT5 A;  4QPJ A;  2VCJ A;  4LWF A;  1US7 A;  2IWS A;  1GKX A;  1QYE A;  3K98 A;  2WI2 A;  2Q2E B;  2WEP A;  2BYI A;  1I5A A;  3VHD A;  2BT0 A;  2JKI A;  3INX A;  1UYI A;  5D7R A;  4O0B A;  1TIL A;  4O07 A;  2Q8H A;  3U2K A;  2H55 A;  2CCU A;  5J71 A;  3MNR P;  4GEE A;  1YSR A;  3Q5K A;  1OSF A;  2YEC A;  5M4K A;  2YGE A;  4URO A;  5F3K A;  4O04 A;  3FT8 A;  3RLR A;  2BSM A;  2C2A A;  4EEH A;  3R91 A;  1YSZ A;  4U7N A;  3ZXO A;  1UYC A;  4XIR A;  1YC1 A;  1YT2 A;  1UY6 A;  1Y8P A;  2ZDY A;  5M4P A;  2YE5 A;  4YKZ A;  2FWY A;  3G7B A;  3O0I A;  4KQV A;  3T2S A;  3EHJ A;  3G7E A;  4KFG A;  3CRL A;  4AWO A;  4O05 A;  4KSG A;  3T0Z A;  3A0T A;  4ASG A;  2IOQ A;  4EMV A;  3OWB A;  2YED A;  3K97 A;  2BZ5 A;  2CGF A;  4ASF A;  5CTW A;  2HG1 A;  3VHC A;  2EXL A;  1AH6 A;  5D6Q A;  1KIJ A;  2YE8 A;  1NHI A;  4CWO A;  2HKJ A;  3INW A;  4HY6 A;  1UY7 A;  1QY8 A;  1S16 A;  2IOP A;  3WQ9 A;  2YKC A;  4URL A;  4FCR A;  4HYP A;  1I59 A;  2IWX A;  3VAD A;  1UY8 A;  3OW6 A;  3T0H A;  4XIP A;  4DZY A;  2YEB A;  4HZ0 A;  2YKI A;  5FNF A;  3H4L A;  2BTZ A;  2YI6 A;  3CGZ A;  2XX2 A;  5BOC A;  3K99 A;  2XDS A;  1BYQ A;  4XKA A;  4I3H A;  1U0Z A;  1UYM A;  1UYD A;  2YEF A;  1THN A;  2XAB A;  4XDM A;  2YE2 A;  1UYL A;  1L0O A; 
#chains in the Genus database with same CATH topology
 3ZXQ A;  3GIF A;  4HXW A;  2XJJ A;  3H80 A;  5IDM A;  3HZ5 A;  2XD6 A;  5IDJ A;  4MPC A;  2O1W A;  3BMY A;  4U7O A;  4CWR A;  4GCZ A;  2YI0 A;  3ZKD A;  1UYF A;  2JJC A;  1MX0 A;  3PEJ A;  4Q20 A;  4YKR A;  4BIU A;  2WEQ A;  4JQL A;  1AH8 A;  1GJV A;  4XKK A;  3Q5J A;  1AMW A;  3S5T A;  4R1F A;  4WUC A;  2YE6 A;  1I5C A;  4FPP A;  1YC3 A;  3NMQ A;  4LWI A;  3BM9 A;  3TZ4 A;  4XCJ A;  4BXI A;  5FND A;  2IOR A;  2YJX A;  2HHI A;  3TUH A;  1YET A;  4YKU A;  4AWQ A;  2CH4 A;  3O2F A;  1ZXM A;  4LWE A;  4MOT A;  5M4E A;  5GGZ A;  4CE3 A;  2QG0 A;  3B27 A;  1UYH A;  2ZKJ A;  4X9L A;  5M4M A;  1GKZ A;  2WI5 A;  2QF6 A;  4U93 A;  5CF0 A;  1A4H A;  2O1U A;  3LMM A;  5CTY A;  2XDX A;  3DGE A;  3T10 A;  3EHG A;  1NHJ A;  1Y8O A;  4NH7 A;  2XHX A;  4MP2 A;  4FMT A;  5CTX A;  2YE7 A;  4EFT A;  1ZWH A;  2QFO A;  4DUH A;  3JZ3 A;  2C1I A;  4URN A;  1TC0 A;  3GIG B;  1R62 A;  1UY9 A;  4LP0 A;  4XD8 A;  2YJW A;  1ZW9 A;  3G75 A;  1H7U A;  2ZBK B;  4MBC A;  1I58 A;  1BGQ A;  3HYZ A;  3KE6 A;  2BU7 A;  2XCM A;  3GIE A;  5D7D A;  4XE2 A;  4WUB A;  2UWD A;  1TH8 A;  4V25 A;  2YEA A;  3CRK A;  4HYM A;  3CGY A;  4CE2 A;  4GQT A;  4YKT A;  3OMU A;  5BOD A;  1ID0 A;  4H81 A;  4P8O A;  4MPE A;  3K60 A;  3R4M A;  3HYY A;  4H7Q A;  1TID A;  4BQJ A;  2YK2 A;  2YEE A;  4XKO A;  1IXM A;  1KZN A;  2XJG A;  1F51 A;  3LPS A;  4L94 A;  5L3J A;  4V26 A;  4EFU A;  5M4N A;  2BRE A;  5C93 A;  2WI3 A;  4EGI A;  4FCP A;  3VHA A;  1UYK A;  4YKQ A;  2XX5 A;  3TZ5 A;  2XDK A;  2XDU A;  4CE1 A;  2CCS A;  2YEI A;  2CG9 A;  4BQG A;  4PRX A;  4EM7 A;  3B26 A;  1I5B A;  2YE4 A;  1S14 A;  4BIZ A;  1Y4U A;  4W7T A;  4I5S A;  4E01 A;  2H8M A;  4CWS A;  2BU5 A;  4YKY A;  4XIT A;  3OPD A;  2XHR A;  1Z5A A;  2ZDX A;  4PL9 A;  2YKB A;  2YGA A;  2YGF A;  3HZ1 A;  4LPB A;  2BU8 A;  2YE9 A;  3TTZ A;  4ZVI A;  2Q8I A;  4NH8 A;  4K4O A;  3RKZ A;  1AM1 A;  3LNU A;  3CWV A;  2HCH A;  1B63 A;  2VCI A;  3WHA A;  1YC4 A;  2AKP A;  2FWZ A;  1UYE A;  1YT1 A;  4JAS A;  4B7P A;  2BU6 A;  3A0Y A;  1Y8N A;  2XJX A;  2XDL A;  4GT8 A;  3ZKB A;  1TC6 A;  3T1K A;  4ASA A;  3Q5L A;  4R3A A;  4B6C A;  2BU2 A;  1U2O A;  3HEK A;  4EGK A;  5F5R A;  2PNR A;  3ZM7 A;  1Y4S A;  4E00 A;  4HZ5 A;  4AS9 A;  3U2D A;  4CWF A;  1Z59 A;  2GQP A;  2XHT A;  4KTN A;  4P7A A;  1ZXN A;  3RLP A;  2YE3 A;  2YEJ A;  4XCL A;  4AWP A;  4O09 A;  3A0R A;  4FCQ A;  4KSH A;  4HY1 A;  3B25 A;  3EHF A;  1I5D A;  3R4P A;  2Q8F A;  4JAV A;  2O1V A;  2YK9 A;  4R3M A;  3D0B A;  2IWU A;  4CWP A;  3SL2 A;  4PU9 A;  3EHH A;  3IED A;  5CTU A;  4URM A;  2YEG A;  1EA6 A;  3R4N A;  4LWH A;  4HXZ A;  4L90 A;  5M4H A;  3TZ2 A;  4WUD A;  2BYH A;  4CWT A;  2WI4 A;  4XC0 A;  2WER A;  4XIQ A;  3RLQ A;  1EI1 A;  1BKN A;  2WI6 A;  3EKR A;  4L8Z A;  1YES A;  2XX4 A;  2YKE A;  4ASB A;  4E72 A;  3A0W A;  4JAU A;  4CWQ A;  3C11 A;  4YKW A;  4LWG A;  2FYP A;  4CWN A;  4MPN A;  3OWD A;  4GGL A;  2YI5 A;  5D7C A;  5FNC A;  4MP7 A;  3A0X A;  4ZKI A;  4E02 A;  3PEH A;  2YKJ A;  3QDD A;  2WI1 A;  1AJ6 A;  3HHU A;  2YEH A;  4XTJ A;  4GFN A;  5IN9 A;  1YER A;  3R92 A;  2XK2 A;  3B28 A;  4MB9 A;  2WI7 A;  1Z5C A;  4YKX A;  1B62 A;  3D36 A;  3FV5 A;  2E0A A;  3TZ0 A;  2FXS A;  5FWK A;  4EGH A;  3D2R A;  3A0Z A;  4L93 A;  4PRV A;  4KP4 A;  1YT0 A;  1QZR A;  2QG2 A;  3EKO A;  2CCT A;  5CPH A;  3B24 A;  3QTF A;  5J6A A;  2K5B A;  1B3Q A;  3O6O A;  3GIG A;  4QPK A;  4L91 A;  2GFD A;  1Z5B A;  5D6P A;  1YS3 A;  4H85 A;  2Q8G A;  4NH9 A;  1H7S A;  1TBW A;  2YI7 A;  1UYG A;  4BAE A;  3R4O A;  3C0E A;  2ESA A;  1MU5 A;  2BRC A;  1BXD A;  1PVG A;  1JM6 A;  1NHH A;  2VW5 A;  3U67 A;  2VWC A;  3FT5 A;  4QPJ A;  2VCJ A;  4LWF A;  1US7 A;  2IWS A;  1GKX A;  1QYE A;  3K98 A;  5JEN A;  2WI2 A;  2Q2E B;  2WEP A;  2BYI A;  1I5A A;  3VHD A;  2BT0 A;  2JKI A;  3INX A;  1UYI A;  5D7R A;  4O0B A;  1TIL A;  4O07 A;  2Q8H A;  3U2K A;  2H55 A;  2CCU A;  5J71 A;  3MNR P;  4GEE A;  1YSR A;  3Q5K A;  1OSF A;  2YEC A;  5M4K A;  2YGE A;  4URO A;  5F3K A;  4O04 A;  3FT8 A;  3RLR A;  2BSM A;  2C2A A;  4EEH A;  3R91 A;  1YSZ A;  4U7N A;  3ZXO A;  1UYC A;  3CYG A;  4XIR A;  1YC1 A;  1YT2 A;  1UY6 A;  1Y8P A;  2ZDY A;  5M4P A;  2YE5 A;  4YKZ A;  2FWY A;  3G7B A;  3O0I A;  4KQV A;  3T2S A;  3EHJ A;  3G7E A;  4KFG A;  3CRL A;  4AWO A;  4O05 A;  4KSG A;  3T0Z A;  3A0T A;  4ASG A;  2IOQ A;  4EMV A;  3OWB A;  2YED A;  3K97 A;  2BZ5 A;  2CGF A;  4ASF A;  5CTW A;  2HG1 A;  3VHC A;  2EXL A;  1AH6 A;  5D6Q A;  1KIJ A;  2YE8 A;  1NHI A;  4CWO A;  2HKJ A;  3INW A;  4HY6 A;  1UY7 A;  1QY8 A;  1S16 A;  2IOP A;  3WQ9 A;  2YKC A;  2C1G A;  4URL A;  4FCR A;  4HYP A;  1I59 A;  2IWX A;  3VAD A;  1UY8 A;  3OW6 A;  3T0H A;  4XIP A;  4DZY A;  2YEB A;  4HZ0 A;  2YKI A;  5FNF A;  3H4L A;  2BTZ A;  2YI6 A;  3CGZ A;  2XX2 A;  5BOC A;  2FTK A;  3K99 A;  2XDS A;  1BYQ A;  4XKA A;  4I3H A;  1U0Z A;  1UYM A;  1UYD A;  2YEF A;  1THN A;  2XAB A;  4XDM A;  2YE2 A;  1UYL A;  1L0O A; 
#chains in the Genus database with same CATH homology
 3ZXQ A;  3GIF A;  4HXW A;  2XJJ A;  3H80 A;  5IDM A;  3HZ5 A;  2XD6 A;  5IDJ A;  4MPC A;  2O1W A;  3BMY A;  4U7O A;  4CWR A;  4GCZ A;  2YI0 A;  3ZKD A;  1UYF A;  2JJC A;  1MX0 A;  3PEJ A;  4Q20 A;  4YKR A;  4BIU A;  2WEQ A;  4JQL A;  1AH8 A;  1GJV A;  4XKK A;  3Q5J A;  1AMW A;  4R1F A;  4WUC A;  2YE6 A;  1I5C A;  4FPP A;  1YC3 A;  3NMQ A;  4LWI A;  3BM9 A;  3TZ4 A;  4XCJ A;  4BXI A;  5FND A;  2IOR A;  2YJX A;  3TUH A;  1YET A;  4YKU A;  4AWQ A;  2CH4 A;  3O2F A;  1ZXM A;  4LWE A;  4MOT A;  5M4E A;  5GGZ A;  4CE3 A;  2QG0 A;  3B27 A;  1UYH A;  2ZKJ A;  4X9L A;  5M4M A;  1GKZ A;  2WI5 A;  2QF6 A;  4U93 A;  5CF0 A;  1A4H A;  2O1U A;  5CTY A;  2XDX A;  3DGE A;  3T10 A;  3EHG A;  1NHJ A;  1Y8O A;  4NH7 A;  2XHX A;  4MP2 A;  4FMT A;  5CTX A;  2YE7 A;  4EFT A;  1ZWH A;  2QFO A;  4DUH A;  3JZ3 A;  4URN A;  1TC0 A;  3GIG B;  1R62 A;  1UY9 A;  4LP0 A;  4XD8 A;  2YJW A;  1ZW9 A;  3G75 A;  1H7U A;  2ZBK B;  4MBC A;  1I58 A;  1BGQ A;  3HYZ A;  3KE6 A;  2BU7 A;  2XCM A;  3GIE A;  5D7D A;  4XE2 A;  4WUB A;  2UWD A;  1TH8 A;  4V25 A;  2YEA A;  3CRK A;  4HYM A;  3CGY A;  4CE2 A;  4GQT A;  4YKT A;  3OMU A;  5BOD A;  1ID0 A;  4H81 A;  4P8O A;  4MPE A;  3K60 A;  3R4M A;  3HYY A;  4H7Q A;  1TID A;  4BQJ A;  2YK2 A;  2YEE A;  4XKO A;  1KZN A;  2XJG A;  3LPS A;  4L94 A;  5L3J A;  4V26 A;  4EFU A;  5M4N A;  2BRE A;  5C93 A;  2WI3 A;  4EGI A;  4FCP A;  3VHA A;  1UYK A;  4YKQ A;  2XX5 A;  3TZ5 A;  2XDK A;  2XDU A;  4CE1 A;  2CCS A;  2YEI A;  2CG9 A;  4BQG A;  4PRX A;  4EM7 A;  3B26 A;  1I5B A;  2YE4 A;  1S14 A;  4BIZ A;  1Y4U A;  4W7T A;  4I5S A;  4E01 A;  2H8M A;  4CWS A;  2BU5 A;  4YKY A;  4XIT A;  3OPD A;  2XHR A;  1Z5A A;  2ZDX A;  4PL9 A;  2YKB A;  2YGA A;  2YGF A;  3HZ1 A;  4LPB A;  2BU8 A;  2YE9 A;  3TTZ A;  4ZVI A;  2Q8I A;  4NH8 A;  4K4O A;  3RKZ A;  1AM1 A;  3LNU A;  3CWV A;  2HCH A;  1B63 A;  2VCI A;  3WHA A;  1YC4 A;  2AKP A;  2FWZ A;  1UYE A;  1YT1 A;  4JAS A;  4B7P A;  2BU6 A;  3A0Y A;  1Y8N A;  2XJX A;  2XDL A;  4GT8 A;  3ZKB A;  1TC6 A;  3T1K A;  4ASA A;  3Q5L A;  4R3A A;  4B6C A;  2BU2 A;  1U2O A;  3HEK A;  4EGK A;  5F5R A;  2PNR A;  3ZM7 A;  1Y4S A;  4E00 A;  4HZ5 A;  4AS9 A;  3U2D A;  4CWF A;  1Z59 A;  2GQP A;  2XHT A;  4KTN A;  4P7A A;  1ZXN A;  3RLP A;  2YE3 A;  2YEJ A;  4XCL A;  4AWP A;  4O09 A;  3A0R A;  4FCQ A;  4KSH A;  4HY1 A;  3B25 A;  3EHF A;  1I5D A;  3R4P A;  2Q8F A;  4JAV A;  2O1V A;  2YK9 A;  4R3M A;  3D0B A;  2IWU A;  4CWP A;  3SL2 A;  4PU9 A;  3EHH A;  3IED A;  5CTU A;  4URM A;  2YEG A;  1EA6 A;  3R4N A;  4LWH A;  4HXZ A;  4L90 A;  5M4H A;  3TZ2 A;  4WUD A;  2BYH A;  4CWT A;  2WI4 A;  4XC0 A;  2WER A;  4XIQ A;  3RLQ A;  1EI1 A;  1BKN A;  2WI6 A;  3EKR A;  4L8Z A;  1YES A;  2XX4 A;  2YKE A;  4ASB A;  3A0W A;  4JAU A;  4CWQ A;  3C11 A;  4YKW A;  4LWG A;  2FYP A;  4CWN A;  4MPN A;  3OWD A;  4GGL A;  2YI5 A;  5D7C A;  5FNC A;  4MP7 A;  3A0X A;  4ZKI A;  4E02 A;  3PEH A;  2YKJ A;  3QDD A;  2WI1 A;  1AJ6 A;  3HHU A;  2YEH A;  4XTJ A;  4GFN A;  5IN9 A;  1YER A;  3R92 A;  2XK2 A;  3B28 A;  4MB9 A;  2WI7 A;  1Z5C A;  4YKX A;  1B62 A;  3D36 A;  3FV5 A;  2E0A A;  3TZ0 A;  2FXS A;  5FWK A;  4EGH A;  3D2R A;  3A0Z A;  4L93 A;  4PRV A;  4KP4 A;  1YT0 A;  1QZR A;  2QG2 A;  3EKO A;  2CCT A;  5CPH A;  3B24 A;  3QTF A;  5J6A A;  2K5B A;  1B3Q A;  3O6O A;  3GIG A;  4QPK A;  4L91 A;  2GFD A;  1Z5B A;  5D6P A;  1YS3 A;  4H85 A;  2Q8G A;  4NH9 A;  1H7S A;  1TBW A;  2YI7 A;  1UYG A;  4BAE A;  3R4O A;  3C0E A;  2ESA A;  1MU5 A;  2BRC A;  1BXD A;  1PVG A;  1JM6 A;  1NHH A;  2VW5 A;  3U67 A;  2VWC A;  3FT5 A;  4QPJ A;  2VCJ A;  4LWF A;  1US7 A;  2IWS A;  1GKX A;  1QYE A;  3K98 A;  2WI2 A;  2Q2E B;  2WEP A;  2BYI A;  1I5A A;  3VHD A;  2BT0 A;  2JKI A;  3INX A;  1UYI A;  5D7R A;  4O0B A;  1TIL A;  4O07 A;  2Q8H A;  3U2K A;  2H55 A;  2CCU A;  5J71 A;  3MNR P;  4GEE A;  1YSR A;  3Q5K A;  1OSF A;  2YEC A;  5M4K A;  2YGE A;  4URO A;  5F3K A;  4O04 A;  3FT8 A;  3RLR A;  2BSM A;  2C2A A;  4EEH A;  3R91 A;  1YSZ A;  4U7N A;  3ZXO A;  1UYC A;  4XIR A;  1YC1 A;  1YT2 A;  1UY6 A;  1Y8P A;  2ZDY A;  5M4P A;  2YE5 A;  4YKZ A;  2FWY A;  3G7B A;  3O0I A;  4KQV A;  3T2S A;  3EHJ A;  3G7E A;  4KFG A;  3CRL A;  4AWO A;  4O05 A;  4KSG A;  3T0Z A;  3A0T A;  4ASG A;  2IOQ A;  4EMV A;  3OWB A;  2YED A;  3K97 A;  2BZ5 A;  2CGF A;  4ASF A;  5CTW A;  2HG1 A;  3VHC A;  2EXL A;  1AH6 A;  5D6Q A;  1KIJ A;  2YE8 A;  1NHI A;  4CWO A;  2HKJ A;  3INW A;  4HY6 A;  1UY7 A;  1QY8 A;  1S16 A;  2IOP A;  3WQ9 A;  2YKC A;  4URL A;  4FCR A;  4HYP A;  1I59 A;  2IWX A;  3VAD A;  1UY8 A;  3OW6 A;  3T0H A;  4XIP A;  4DZY A;  2YEB A;  4HZ0 A;  2YKI A;  5FNF A;  3H4L A;  2BTZ A;  2YI6 A;  3CGZ A;  2XX2 A;  5BOC A;  3K99 A;  2XDS A;  1BYQ A;  4XKA A;  4I3H A;  1U0Z A;  1UYM A;  1UYD A;  2YEF A;  1THN A;  2XAB A;  4XDM A;  2YE2 A;  1UYL A;  1L0O A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...