1I5CA

Structure of chea domain p4 in complex with adp
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
188
structure length
181
Chain Sequence
b'SHMVPISFVFNRFPRMVRDLAKKMNKEVNFIMRGEDTELDRTFVEEIGEPLLHLLRNAIDHGIEPKEERIAKGKPPIGTLILSARHEGNNVVIEVEDDGRGIDKEKIIRKAIEKGLIDESKAATLSDQEILNFLFVPGFSTKERGVGMDVVKNVVESLNGSISIESEKDKGTKVTIRLPLT'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords CHEMOTAXIS PROTEIN CHEA
publication title Nucleotide binding by the histidine kinase CheA.
pubmed doi rcsb
source organism Thermotoga maritima
molecule tags Signaling protein, transferase
total genus 58
structure length 181
sequence length 188
chains with identical sequence B
ec nomenclature ec 2.7.13.3: Histidine kinase.
pdb deposition date 2001-02-26
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.565.10 Alpha Beta 2-Layer Sandwich Heat Shock Protein 90 Histidine kinase-like ATPase, C-terminal domain 1i5cA00
3EKRA 1UY9A 1MX0A 3INWA 3TTZA 1B62A 2BU8A 4MPNA 3SL2A 4P8OA 2WI7A 3ZXQA 2XDSA 2ZDYA 3Q5KA 1EA6A 1TC6A 3U67A 4DZYA 4ZKIA 2YKIA 5FNFA 4KP4A 4Q20A 2FXSA 2YEAA 2XX5A 1YC3A 4HZ5A 1BYQA 4YKWA 4EMVA 1A4HA 4L90A 2VCIA 1UYMA 2BU6A 2YKBA 3RLPA 2XJGA 3CRLA 2XHRA 3EHFA 4QPJA 2Q2EB 2BYIA 4XD8A 5FNCA 1UYKA 4E02A 1UYGA 2YE2A 3WQ9A 2YEIA 4HZ0A 3FT8A 3O6OA 3A0TA 1H7SA 4GFNA 2BREA 4LWHA 5D7CA 3T0ZA 2XK2A 1Y8PA 2FWYA 4YKYA 5CTUA 3GIGB 3OPDA 2Q8FA 2QF6A 1ZXNA 2XDUA 3Q5LA 2YECA 4MP7A 2YK9A 1I5AA 4CWNA 4R3MA 3DGEA 4URMA 3PEHA 2XDXA 1PVGA 4R1FA 1YETA 4NH8A 1YSRA 2IWXA 3D2RA 2BRCA 2YE6A 4HYPA 2Q8HA 4CWTA 4EGIA 1KIJA 2C2AA 3T2SA 4CWPA 3B27A 2YEFA 2YEBA 3A0WA 4LWEA 4L93A 4FMTA 3OWBA 3C11A 5BODA 4EEHA 3VHDA 2H55A 4ASAA 3OWDA 4MB9A 2WEPA 4AS9A 4BIUA 5M4HA 3B26A 4H7QA 2YEDA 2H8MA 5FWKA 5M4KA 1BXDA 3TUHA 3PEJA 4FCRA 2YGFA 4FCQA 4U7NA 4LP0A 4GEEA 1Y8OA 1I5BA 3H80A 3EKOA 1QY8A 4U7OA 4XIPA 4E01A 1ID0A 2WERA 4EFUA 2WI4A 1UY8A 1AH8A 2WI1A 5F3KA 1L0OA 1U0ZA 4O05A 3R92A 4MP2A 3R4MA 2BU7A 5D6QA 2YJXA 2FYPA 1US7A 2VW5A 2K5BA 2YI0A 4L8ZA 3MNRP 1AM1A 1UYIA 3IEDA 3K60A 4GGLA 3C0EA 1BKNA 5J71A 1ZW9A 4BIZA 4WUBA 5D6PA 2Q8IA 3B28A 1H7UA 2CCUA 4KTNA 1UYLA 1UY7A 4JAUA 4H81A 4X9LA 2JJCA 4HY6A 4DUHA 3K99A 2YI6A 2VWCA 2CH4A 3HYZA 4XKAA 3RLRA 3EHJA 2WI5A 4LWGA 2YK2A 3BMYA 3T0HA 3VHAA 2YE7A 4YKRA 3R4PA 4KSHA 3VADA 3TZ5A 1EI1A 1S14A 4O07A 1Z5CA 4ASGA 3G7BA 2AKPA 3HHUA 4LWFA 1AMWA 2GQPA 4XDMA 3R4OA 5C93A 3CWVA 2YE5A 4XTJA 4HYMA 4LWIA 2EXLA 2YEGA 4CWFA 2CCSA 5L3JA 2PNRA 4ZVIA 1UYEA 1YT1A 2UWDA 4GQTA 2XJXA 1Y4SA 4MPEA 4JASA 5J6AA 3HEKA 5D7DA 4CWQA 5IN9A 4CWRA 3HZ5A 1UYCA 4GCZA 1YC4A 4JAVA 1QZRA 5CPHA 4WUDA 5F5RA 4XE2A 1TC0A 3A0XA 5CF0A 3G7EA 4WUCA 1KZNA 4FPPA 4KSGA 1NHJA 5CTXA 1TBWA 3H4LA 1MU5A 2BT0A 2ZBKB 4URLA 3OW6A 3TZ0A 2YGEA 3A0ZA 2XJJA 2QG2A 2XX4A 4YKUA 4KFGA 4P7AA 2XDKA 2QFOA 1GJVA 3T10A 2IWUA 2XDLA 2WI3A 3EHGA 2BTZA 2O1UA 1YT2A 2XD6A 4EGKA 1YSZA 4XCJA 2CCTA 2YKCA 3HZ1A 2QG0A 3U2DA 1UY6A 5IDMA 1Z59A 4AWQA 4I5SA 3K97A 5IDJA 1TIDA 2BZ5A 1THNA 4HY1A 3LNUA 4H85A 3TZ2A 2BSMA 1B3QA 3ZM7A 3A0YA 4PRXA 3B24A 2BYHA 3GIEA 4L94A 1GKZA 4CWOA 4V26A 3G75A 3ZXOA 3QDDA 4ASBA 3B25A 5CTYA 4BXIA 5BOCA 1S16A 4EGHA 3O2FA 1GKXA 4EM7A 2CGFA 4MOTA 4YKXA 4YKTA 1I5CA 4R3AA 3NMQA 3T1KA 1UYDA 5D7RA 4CE3A 2XABA 2CG9A 4CWSA 1Y4UA 2ZKJA 1NHHA 1YC1A 2YI7A 2HKJA 4XITA 3FT5A 2IORA 2YJWA 4EFTA 4V25A 3RLQA 2WI6A 3ZKDA 4L91A 1AJ6A 4XKOA 2YKJA 2E0AA 4FCPA 2XHXA 1I58A 1TILA 2ZDXA 4XCLA 3TZ4A 4KQVA 2WI2A 2HCHA 4PRVA 4O09A 1Z5AA 3VHCA 3EHHA 4HXWA 4NH7A 3R4NA 2XX2A 3BM9A 2O1VA 2YE8A 4MBCA 1JM6A 2XHTA 4AWOA 4GT8A 4JQLA 3RKZA 4YKQA 3ZKBA 5M4MA 2XCMA 2YGAA 3O0IA 1AH6A 4W7TA 1QYEA 4UROA 4XKKA 5FNDA 1ZXMA 2Q8GA 4PU9A 4YKZA 5GGZA 3A0RA 1Z5BA 2O1WA 5CTWA 3CGZA 4CE1A 3KE6A 2HG1A 4O04A 3D36A 4E00A 1YERA 2ESAA 4I3HA 4LPBA 4HXZA 4K4OA 3OMUA 1I5DA 3CRKA 5M4EA 2JKIA 4B7PA 3K98A 3WHAA 1R62A 3FV5A 4BAEA 4BQJA 3Q5JA 2IOPA 2GFDA 3GIFA 4MPCA 2YKEA 2VCJA 2YEJA 2YE4A 4XC0A 4BQGA 2YEHA 4CE2A 4PL9A 2YEEA 1BGQA 4NH9A 3CGYA 3R91A 4QPKA 3D0BA 1ZWHA 1TH8A 2WEQA 1YESA 4O0BA 3JZ3A 2YI5A 3HYYA 1OSFA 3INXA 4URNA 5M4PA 2BU2A 1U2OA 1YT0A 4XIQA 1NHIA 3GIGA 2YE3A 1UYHA 5M4NA 1B63A 2BU5A 2FWZA 3QTFA 1Y8NA 1I59A 4XIRA 4ASFA 2YE9A 1UYFA 4U93A 2IOQA 2IWSA 1YS3A 3U2KA 4B6CA 4AWPA 3LPSA
chains in the Genus database with same CATH superfamily
3EKRA 1UY9A 1MX0A 3INWA 3TTZA 1B62A 2BU8A 4MPNA 3SL2A 4P8OA 2WI7A 3ZXQA 2XDSA 2ZDYA 3Q5KA 1EA6A 1TC6A 3U67A 4DZYA 4ZKIA 2YKIA 5FNFA 4KP4A 4Q20A 2FXSA 2YEAA 2XX5A 1YC3A 4HZ5A 1BYQA 4YKWA 4EMVA 1A4HA 4L90A 2VCIA 1UYMA 2BU6A 2YKBA 3RLPA 2XJGA 3CRLA 2XHRA 3EHFA 4QPJA 2Q2EB 2BYIA 4XD8A 5FNCA 1UYKA 4E02A 1UYGA 2YE2A 3WQ9A 2YEIA 4HZ0A 3FT8A 3O6OA 3A0TA 1H7SA 4GFNA 2BREA 4LWHA 5D7CA 3T0ZA 2XK2A 1Y8PA 2FWYA 4YKYA 5CTUA 3GIGB 3OPDA 2Q8FA 2QF6A 1ZXNA 2XDUA 3Q5LA 2YECA 4MP7A 2YK9A 1I5AA 4CWNA 4R3MA 3DGEA 4URMA 3PEHA 2XDXA 1PVGA 4R1FA 1YETA 4NH8A 1YSRA 2IWXA 3D2RA 2BRCA 2YE6A 3LMMA 4HYPA 2Q8HA 4CWTA 4EGIA 1KIJA 2C2AA 3T2SA 4CWPA 3B27A 2YEFA 2YEBA 3A0WA 4LWEA 4L93A 4FMTA 3OWBA 3C11A 5BODA 4EEHA 3VHDA 2H55A 4ASAA 3OWDA 4MB9A 2WEPA 4AS9A 4BIUA 5M4HA 3B26A 4H7QA 2YEDA 2H8MA 5FWKA 5M4KA 1BXDA 3TUHA 3PEJA 4FCRA 2YGFA 4FCQA 4U7NA 4LP0A 4GEEA 1Y8OA 1I5BA 5JENA 3H80A 3EKOA 1QY8A 4U7OA 4XIPA 4E01A 1ID0A 2WERA 4EFUA 2WI4A 1UY8A 1AH8A 2WI1A 5F3KA 1L0OA 1U0ZA 4O05A 1F51A 3CYGA 3R92A 4MP2A 3R4MA 2BU7A 5D6QA 2YJXA 2FYPA 1US7A 2VW5A 2K5BA 4E72A 2YI0A 4L8ZA 3MNRP 1AM1A 1UYIA 3IEDA 3K60A 4GGLA 3C0EA 1BKNA 5J71A 1ZW9A 4BIZA 4WUBA 5D6PA 2Q8IA 3B28A 1H7UA 2CCUA 4KTNA 1UYLA 1UY7A 4JAUA 4H81A 4X9LA 2JJCA 4HY6A 4DUHA 3K99A 2YI6A 2VWCA 2CH4A 3HYZA 4XKAA 3RLRA 3EHJA 2WI5A 4LWGA 2YK2A 3BMYA 3T0HA 3VHAA 2YE7A 4YKRA 3R4PA 4KSHA 3VADA 3TZ5A 1EI1A 1S14A 4O07A 1Z5CA 4ASGA 3G7BA 2AKPA 3HHUA 4LWFA 1AMWA 2GQPA 4XDMA 3R4OA 5C93A 3CWVA 2YE5A 4XTJA 4HYMA 4LWIA 2EXLA 2YEGA 4CWFA 2CCSA 5L3JA 2PNRA 4ZVIA 1UYEA 1YT1A 2UWDA 4GQTA 2XJXA 1Y4SA 2HHIA 4MPEA 4JASA 5J6AA 3HEKA 5D7DA 4CWQA 5IN9A 4CWRA 3HZ5A 1UYCA 4GCZA 1YC4A 4JAVA 1QZRA 5CPHA 4WUDA 5F5RA 4XE2A 1TC0A 3A0XA 1IXMA 3G7EA 5CF0A 4WUCA 1KZNA 4FPPA 4KSGA 1NHJA 5CTXA 1TBWA 3H4LA 1MU5A 2BT0A 2ZBKB 4URLA 3OW6A 3TZ0A 2YGEA 3A0ZA 2XJJA 2QG2A 2XX4A 4YKUA 4KFGA 4P7AA 2XDKA 2QFOA 1GJVA 3T10A 2IWUA 2XDLA 2WI3A 3EHGA 2BTZA 2O1UA 1YT2A 2XD6A 4EGKA 1YSZA 4XCJA 2CCTA 2YKCA 3HZ1A 2QG0A 3U2DA 1UY6A 5IDMA 1Z59A 4AWQA 4I5SA 3K97A 5IDJA 1TIDA 2BZ5A 1THNA 4HY1A 3LNUA 4H85A 3TZ2A 2BSMA 1B3QA 3ZM7A 3A0YA 4PRXA 3B24A 2BYHA 3GIEA 4L94A 1GKZA 4CWOA 4V26A 3G75A 3ZXOA 3QDDA 4ASBA 3B25A 5CTYA 4BXIA 5BOCA 1S16A 4EGHA 3O2FA 1GKXA 4EM7A 2CGFA 4MOTA 4YKXA 4YKTA 1I5CA 4R3AA 3NMQA 3T1KA 1UYDA 5D7RA 4CE3A 2XABA 2CG9A 4CWSA 1Y4UA 2ZKJA 1NHHA 1YC1A 2YI7A 2HKJA 4XITA 3FT5A 2IORA 2YJWA 4EFTA 4V25A 3RLQA 2WI6A 3ZKDA 4L91A 1AJ6A 4XKOA 2YKJA 2E0AA 4FCPA 2XHXA 1I58A 1TILA 2ZDXA 4XCLA 3TZ4A 4KQVA 2WI2A 2HCHA 4PRVA 4O09A 1Z5AA 3VHCA 3EHHA 4HXWA 4NH7A 3R4NA 2XX2A 3BM9A 2O1VA 2YE8A 4MBCA 1JM6A 2XHTA 4AWOA 4GT8A 4JQLA 3RKZA 4YKQA 3ZKBA 5M4MA 2C1IA 2XCMA 2YGAA 3O0IA 1AH6A 4W7TA 1QYEA 4UROA 4XKKA 5FNDA 1ZXMA 2Q8GA 4PU9A 2C1GA 4YKZA 5GGZA 3A0RA 1Z5BA 2O1WA 5CTWA 3CGZA 4CE1A 3KE6A 2HG1A 4O04A 3D36A 4E00A 1YERA 2ESAA 4I3HA 3S5TA 4LPBA 4HXZA 4K4OA 3OMUA 1I5DA 3CRKA 5M4EA 2JKIA 4B7PA 3K98A 3WHAA 1R62A 3FV5A 4BAEA 4BQJA 3Q5JA 2IOPA 2GFDA 3GIFA 4MPCA 2YKEA 2VCJA 2YEJA 2YE4A 4XC0A 4BQGA 2YEHA 4CE2A 4PL9A 2YEEA 1BGQA 4NH9A 3CGYA 3R91A 4QPKA 3D0BA 1ZWHA 1TH8A 2WEQA 1YESA 4O0BA 3JZ3A 2YI5A 3HYYA 1OSFA 3INXA 4URNA 5M4PA 2BU2A 1U2OA 1YT0A 4XIQA 1NHIA 3GIGA 2YE3A 1UYHA 5M4NA 1B63A 2BU5A 2FWZA 3QTFA 1Y8NA 1I59A 4XIRA 4ASFA 2YE9A 1UYFA 2FTKA 4U93A 2IOQA 2IWSA 1YS3A 3U2KA 4B6CA 4AWPA 3LPSA
chains in the Genus database with same CATH topology
3EKRA 1UY9A 1MX0A 3INWA 3TTZA 1B62A 2BU8A 4MPNA 3SL2A 4P8OA 2WI7A 3ZXQA 2XDSA 2ZDYA 3Q5KA 1EA6A 1TC6A 3U67A 4DZYA 4ZKIA 2YKIA 5FNFA 4KP4A 4Q20A 2FXSA 2YEAA 2XX5A 1YC3A 4HZ5A 1BYQA 4YKWA 4EMVA 1A4HA 4L90A 2VCIA 1UYMA 2BU6A 2YKBA 3RLPA 2XJGA 3CRLA 2XHRA 3EHFA 4QPJA 2Q2EB 2BYIA 4XD8A 5FNCA 1UYKA 4E02A 1UYGA 2YE2A 3WQ9A 2YEIA 4HZ0A 3FT8A 3O6OA 3A0TA 1H7SA 4GFNA 2BREA 4LWHA 5D7CA 3T0ZA 2XK2A 1Y8PA 2FWYA 4YKYA 5CTUA 3GIGB 3OPDA 2Q8FA 2QF6A 1ZXNA 2XDUA 3Q5LA 2YECA 4MP7A 2YK9A 1I5AA 4CWNA 4R3MA 3DGEA 4URMA 3PEHA 2XDXA 1PVGA 4R1FA 1YETA 4NH8A 1YSRA 2IWXA 3D2RA 2BRCA 2YE6A 4HYPA 2Q8HA 4CWTA 4EGIA 1KIJA 2C2AA 3T2SA 4CWPA 3B27A 2YEFA 2YEBA 3A0WA 4LWEA 4L93A 4FMTA 3OWBA 3C11A 5BODA 4EEHA 3VHDA 2H55A 4ASAA 3OWDA 4MB9A 2WEPA 4AS9A 4BIUA 5M4HA 3B26A 4H7QA 2YEDA 2H8MA 5FWKA 5M4KA 1BXDA 3TUHA 3PEJA 4FCRA 2YGFA 4FCQA 4U7NA 4LP0A 4GEEA 1Y8OA 1I5BA 3H80A 3EKOA 1QY8A 4U7OA 4XIPA 4E01A 1ID0A 2WERA 4EFUA 2WI4A 1UY8A 1AH8A 2WI1A 5F3KA 1L0OA 1U0ZA 4O05A 3R92A 4MP2A 3R4MA 2BU7A 5D6QA 2YJXA 2FYPA 1US7A 2VW5A 2K5BA 2YI0A 4L8ZA 3MNRP 1AM1A 1UYIA 3IEDA 3K60A 4GGLA 3C0EA 1BKNA 5J71A 1ZW9A 4BIZA 4WUBA 5D6PA 2Q8IA 3B28A 1H7UA 2CCUA 4KTNA 1UYLA 1UY7A 4JAUA 4H81A 4X9LA 2JJCA 4HY6A 4DUHA 3K99A 2YI6A 2VWCA 2CH4A 3HYZA 4XKAA 3RLRA 3EHJA 2WI5A 4LWGA 2YK2A 3BMYA 3T0HA 3VHAA 2YE7A 4YKRA 3R4PA 4KSHA 3VADA 3TZ5A 1EI1A 1S14A 4O07A 1Z5CA 4ASGA 3G7BA 2AKPA 3HHUA 4LWFA 1AMWA 2GQPA 4XDMA 3R4OA 5C93A 3CWVA 2YE5A 4XTJA 4HYMA 4LWIA 2EXLA 2YEGA 4CWFA 2CCSA 5L3JA 2PNRA 4ZVIA 1UYEA 1YT1A 2UWDA 4GQTA 2XJXA 1Y4SA 4MPEA 4JASA 5J6AA 3HEKA 5D7DA 4CWQA 5IN9A 4CWRA 3HZ5A 1UYCA 4GCZA 1YC4A 4JAVA 1QZRA 5CPHA 4WUDA 5F5RA 4XE2A 1TC0A 3A0XA 5CF0A 3G7EA 4WUCA 1KZNA 4FPPA 4KSGA 1NHJA 5CTXA 1TBWA 3H4LA 1MU5A 2BT0A 2ZBKB 4URLA 3OW6A 3TZ0A 2YGEA 3A0ZA 2XJJA 2QG2A 2XX4A 4YKUA 4KFGA 4P7AA 2XDKA 2QFOA 1GJVA 3T10A 2IWUA 2XDLA 2WI3A 3EHGA 2BTZA 2O1UA 1YT2A 2XD6A 4EGKA 1YSZA 4XCJA 2CCTA 2YKCA 3HZ1A 2QG0A 3U2DA 1UY6A 5IDMA 1Z59A 4AWQA 4I5SA 3K97A 5IDJA 1TIDA 2BZ5A 1THNA 4HY1A 3LNUA 4H85A 3TZ2A 2BSMA 1B3QA 3ZM7A 3A0YA 4PRXA 3B24A 2BYHA 3GIEA 4L94A 1GKZA 4CWOA 4V26A 3G75A 3ZXOA 3QDDA 4ASBA 3B25A 5CTYA 4BXIA 5BOCA 1S16A 4EGHA 3O2FA 1GKXA 4EM7A 2CGFA 4MOTA 4YKXA 4YKTA 1I5CA 4R3AA 3NMQA 3T1KA 1UYDA 5D7RA 4CE3A 2XABA 2CG9A 4CWSA 1Y4UA 2ZKJA 1NHHA 1YC1A 2YI7A 2HKJA 4XITA 3FT5A 2IORA 2YJWA 4EFTA 4V25A 3RLQA 2WI6A 3ZKDA 4L91A 1AJ6A 4XKOA 2YKJA 2E0AA 4FCPA 2XHXA 1I58A 1TILA 2ZDXA 4XCLA 3TZ4A 4KQVA 2WI2A 2HCHA 4PRVA 4O09A 1Z5AA 3VHCA 3EHHA 4HXWA 4NH7A 3R4NA 2XX2A 3BM9A 2O1VA 2YE8A 4MBCA 1JM6A 2XHTA 4AWOA 4GT8A 4JQLA 3RKZA 4YKQA 3ZKBA 5M4MA 2XCMA 2YGAA 3O0IA 1AH6A 4W7TA 1QYEA 4UROA 4XKKA 5FNDA 1ZXMA 2Q8GA 4PU9A 4YKZA 5GGZA 3A0RA 1Z5BA 2O1WA 5CTWA 3CGZA 4CE1A 3KE6A 2HG1A 4O04A 3D36A 4E00A 1YERA 2ESAA 4I3HA 4LPBA 4HXZA 4K4OA 3OMUA 1I5DA 3CRKA 5M4EA 2JKIA 4B7PA 3K98A 3WHAA 1R62A 3FV5A 4BAEA 4BQJA 3Q5JA 2IOPA 2GFDA 3GIFA 4MPCA 2YKEA 2VCJA 2YEJA 2YE4A 4XC0A 4BQGA 2YEHA 4CE2A 4PL9A 2YEEA 1BGQA 4NH9A 3CGYA 3R91A 4QPKA 3D0BA 1ZWHA 1TH8A 2WEQA 1YESA 4O0BA 3JZ3A 2YI5A 3HYYA 1OSFA 3INXA 4URNA 5M4PA 2BU2A 1U2OA 1YT0A 4XIQA 1NHIA 3GIGA 2YE3A 1UYHA 5M4NA 1B63A 2BU5A 2FWZA 3QTFA 1Y8NA 1I59A 4XIRA 4ASFA 2YE9A 1UYFA 4U93A 2IOQA 2IWSA 1YS3A 3U2KA 4B6CA 4AWPA 3LPSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3EKR A;  1UY9 A;  1MX0 A;  3INW A;  3TTZ A;  1B62 A;  2BU8 A;  4MPN A;  3SL2 A;  4P8O A;  2WI7 A;  3ZXQ A;  2XDS A;  2ZDY A;  3Q5K A;  1EA6 A;  1TC6 A;  3U67 A;  4DZY A;  4ZKI A;  2YKI A;  5FNF A;  4KP4 A;  4Q20 A;  2FXS A;  2YEA A;  2XX5 A;  1YC3 A;  4HZ5 A;  1BYQ A;  4YKW A;  4EMV A;  1A4H A;  4L90 A;  2VCI A;  1UYM A;  2BU6 A;  2YKB A;  3RLP A;  2XJG A;  3CRL A;  2XHR A;  3EHF A;  4QPJ A;  2Q2E B;  2BYI A;  4XD8 A;  5FNC A;  1UYK A;  4E02 A;  1UYG A;  2YE2 A;  3WQ9 A;  2YEI A;  4HZ0 A;  3FT8 A;  3O6O A;  3A0T A;  1H7S A;  4GFN A;  2BRE A;  4LWH A;  5D7C A;  3T0Z A;  2XK2 A;  1Y8P A;  2FWY A;  4YKY A;  5CTU A;  3GIG B;  3OPD A;  2Q8F A;  2QF6 A;  1ZXN A;  2XDU A;  3Q5L A;  2YEC A;  4MP7 A;  2YK9 A;  1I5A A;  4CWN A;  4R3M A;  3DGE A;  4URM A;  3PEH A;  2XDX A;  1PVG A;  4R1F A;  1YET A;  4NH8 A;  1YSR A;  2IWX A;  3D2R A;  2BRC A;  2YE6 A;  4HYP A;  2Q8H A;  4CWT A;  4EGI A;  1KIJ A;  2C2A A;  3T2S A;  4CWP A;  3B27 A;  2YEF A;  2YEB A;  3A0W A;  4LWE A;  4L93 A;  4FMT A;  3OWB A;  3C11 A;  5BOD A;  4EEH A;  3VHD A;  2H55 A;  4ASA A;  3OWD A;  4MB9 A;  2WEP A;  4AS9 A;  4BIU A;  5M4H A;  3B26 A;  4H7Q A;  2YED A;  2H8M A;  5FWK A;  5M4K A;  1BXD A;  3TUH A;  3PEJ A;  4FCR A;  2YGF A;  4FCQ A;  4U7N A;  4LP0 A;  4GEE A;  1Y8O A;  1I5B A;  3H80 A;  3EKO A;  1QY8 A;  4U7O A;  4XIP A;  4E01 A;  1ID0 A;  2WER A;  4EFU A;  2WI4 A;  1UY8 A;  1AH8 A;  2WI1 A;  5F3K A;  1L0O A;  1U0Z A;  4O05 A;  3R92 A;  4MP2 A;  3R4M A;  2BU7 A;  5D6Q A;  2YJX A;  2FYP A;  1US7 A;  2VW5 A;  2K5B A;  2YI0 A;  4L8Z A;  3MNR P;  1AM1 A;  1UYI A;  3IED A;  3K60 A;  4GGL A;  3C0E A;  1BKN A;  5J71 A;  1ZW9 A;  4BIZ A;  4WUB A;  5D6P A;  2Q8I A;  3B28 A;  1H7U A;  2CCU A;  4KTN A;  1UYL A;  1UY7 A;  4JAU A;  4H81 A;  4X9L A;  2JJC A;  4HY6 A;  4DUH A;  3K99 A;  2YI6 A;  2VWC A;  2CH4 A;  3HYZ A;  4XKA A;  3RLR A;  3EHJ A;  2WI5 A;  4LWG A;  2YK2 A;  3BMY A;  3T0H A;  3VHA A;  2YE7 A;  4YKR A;  3R4P A;  4KSH A;  3VAD A;  3TZ5 A;  1EI1 A;  1S14 A;  4O07 A;  1Z5C A;  4ASG A;  3G7B A;  2AKP A;  3HHU A;  4LWF A;  1AMW A;  2GQP A;  4XDM A;  3R4O A;  5C93 A;  3CWV A;  2YE5 A;  4XTJ A;  4HYM A;  4LWI A;  2EXL A;  2YEG A;  4CWF A;  2CCS A;  5L3J A;  2PNR A;  4ZVI A;  1UYE A;  1YT1 A;  2UWD A;  4GQT A;  2XJX A;  1Y4S A;  4MPE A;  4JAS A;  5J6A A;  3HEK A;  5D7D A;  4CWQ A;  5IN9 A;  4CWR A;  3HZ5 A;  1UYC A;  4GCZ A;  1YC4 A;  4JAV A;  1QZR A;  5CPH A;  4WUD A;  5F5R A;  4XE2 A;  1TC0 A;  3A0X A;  5CF0 A;  3G7E A;  4WUC A;  1KZN A;  4FPP A;  4KSG A;  1NHJ A;  5CTX A;  1TBW A;  3H4L A;  1MU5 A;  2BT0 A;  2ZBK B;  4URL A;  3OW6 A;  3TZ0 A;  2YGE A;  3A0Z A;  2XJJ A;  2QG2 A;  2XX4 A;  4YKU A;  4KFG A;  4P7A A;  2XDK A;  2QFO A;  1GJV A;  3T10 A;  2IWU A;  2XDL A;  2WI3 A;  3EHG A;  2BTZ A;  2O1U A;  1YT2 A;  2XD6 A;  4EGK A;  1YSZ A;  4XCJ A;  2CCT A;  2YKC A;  3HZ1 A;  2QG0 A;  3U2D A;  1UY6 A;  5IDM A;  1Z59 A;  4AWQ A;  4I5S A;  3K97 A;  5IDJ A;  1TID A;  2BZ5 A;  1THN A;  4HY1 A;  3LNU A;  4H85 A;  3TZ2 A;  2BSM A;  1B3Q A;  3ZM7 A;  3A0Y A;  4PRX A;  3B24 A;  2BYH A;  3GIE A;  4L94 A;  1GKZ A;  4CWO A;  4V26 A;  3G75 A;  3ZXO A;  3QDD A;  4ASB A;  3B25 A;  5CTY A;  4BXI A;  5BOC A;  1S16 A;  4EGH A;  3O2F A;  1GKX A;  4EM7 A;  2CGF A;  4MOT A;  4YKX A;  4YKT A;  1I5C A;  4R3A A;  3NMQ A;  3T1K A;  1UYD A;  5D7R A;  4CE3 A;  2XAB A;  2CG9 A;  4CWS A;  1Y4U A;  2ZKJ A;  1NHH A;  1YC1 A;  2YI7 A;  2HKJ A;  4XIT A;  3FT5 A;  2IOR A;  2YJW A;  4EFT A;  4V25 A;  3RLQ A;  2WI6 A;  3ZKD A;  4L91 A;  1AJ6 A;  4XKO A;  2YKJ A;  2E0A A;  4FCP A;  2XHX A;  1I58 A;  1TIL A;  2ZDX A;  4XCL A;  3TZ4 A;  4KQV A;  2WI2 A;  2HCH A;  4PRV A;  4O09 A;  1Z5A A;  3VHC A;  3EHH A;  4HXW A;  4NH7 A;  3R4N A;  2XX2 A;  3BM9 A;  2O1V A;  2YE8 A;  4MBC A;  1JM6 A;  2XHT A;  4AWO A;  4GT8 A;  4JQL A;  3RKZ A;  4YKQ A;  3ZKB A;  5M4M A;  2XCM A;  2YGA A;  3O0I A;  1AH6 A;  4W7T A;  1QYE A;  4URO A;  4XKK A;  5FND A;  1ZXM A;  2Q8G A;  4PU9 A;  4YKZ A;  5GGZ A;  3A0R A;  1Z5B A;  2O1W A;  5CTW A;  3CGZ A;  4CE1 A;  3KE6 A;  2HG1 A;  4O04 A;  3D36 A;  4E00 A;  1YER A;  2ESA A;  4I3H A;  4LPB A;  4HXZ A;  4K4O A;  3OMU A;  1I5D A;  3CRK A;  5M4E A;  2JKI A;  4B7P A;  3K98 A;  3WHA A;  1R62 A;  3FV5 A;  4BAE A;  4BQJ A;  3Q5J A;  2IOP A;  2GFD A;  3GIF A;  4MPC A;  2YKE A;  2VCJ A;  2YEJ A;  2YE4 A;  4XC0 A;  4BQG A;  2YEH A;  4CE2 A;  4PL9 A;  2YEE A;  1BGQ A;  4NH9 A;  3CGY A;  3R91 A;  4QPK A;  3D0B A;  1ZWH A;  1TH8 A;  2WEQ A;  1YES A;  4O0B A;  3JZ3 A;  2YI5 A;  3HYY A;  1OSF A;  3INX A;  4URN A;  5M4P A;  2BU2 A;  1U2O A;  1YT0 A;  4XIQ A;  1NHI A;  3GIG A;  2YE3 A;  1UYH A;  5M4N A;  1B63 A;  2BU5 A;  2FWZ A;  3QTF A;  1Y8N A;  1I59 A;  4XIR A;  4ASF A;  2YE9 A;  1UYF A;  4U93 A;  2IOQ A;  2IWS A;  1YS3 A;  3U2K A;  4B6C A;  4AWP A;  3LPS A; 
#chains in the Genus database with same CATH topology
 3EKR A;  1UY9 A;  1MX0 A;  3INW A;  3TTZ A;  1B62 A;  2BU8 A;  4MPN A;  3SL2 A;  4P8O A;  2WI7 A;  3ZXQ A;  2XDS A;  2ZDY A;  3Q5K A;  1EA6 A;  1TC6 A;  3U67 A;  4DZY A;  4ZKI A;  2YKI A;  5FNF A;  4KP4 A;  4Q20 A;  2FXS A;  2YEA A;  2XX5 A;  1YC3 A;  4HZ5 A;  1BYQ A;  4YKW A;  4EMV A;  1A4H A;  4L90 A;  2VCI A;  1UYM A;  2BU6 A;  2YKB A;  3RLP A;  2XJG A;  3CRL A;  2XHR A;  3EHF A;  4QPJ A;  2Q2E B;  2BYI A;  4XD8 A;  5FNC A;  1UYK A;  4E02 A;  1UYG A;  2YE2 A;  3WQ9 A;  2YEI A;  4HZ0 A;  3FT8 A;  3O6O A;  3A0T A;  1H7S A;  4GFN A;  2BRE A;  4LWH A;  5D7C A;  3T0Z A;  2XK2 A;  1Y8P A;  2FWY A;  4YKY A;  5CTU A;  3GIG B;  3OPD A;  2Q8F A;  2QF6 A;  1ZXN A;  2XDU A;  3Q5L A;  2YEC A;  4MP7 A;  2YK9 A;  1I5A A;  4CWN A;  4R3M A;  3DGE A;  4URM A;  3PEH A;  2XDX A;  1PVG A;  4R1F A;  1YET A;  4NH8 A;  1YSR A;  2IWX A;  3D2R A;  2BRC A;  2YE6 A;  3LMM A;  4HYP A;  2Q8H A;  4CWT A;  4EGI A;  1KIJ A;  2C2A A;  3T2S A;  4CWP A;  3B27 A;  2YEF A;  2YEB A;  3A0W A;  4LWE A;  4L93 A;  4FMT A;  3OWB A;  3C11 A;  5BOD A;  4EEH A;  3VHD A;  2H55 A;  4ASA A;  3OWD A;  4MB9 A;  2WEP A;  4AS9 A;  4BIU A;  5M4H A;  3B26 A;  4H7Q A;  2YED A;  2H8M A;  5FWK A;  5M4K A;  1BXD A;  3TUH A;  3PEJ A;  4FCR A;  2YGF A;  4FCQ A;  4U7N A;  4LP0 A;  4GEE A;  1Y8O A;  1I5B A;  5JEN A;  3H80 A;  3EKO A;  1QY8 A;  4U7O A;  4XIP A;  4E01 A;  1ID0 A;  2WER A;  4EFU A;  2WI4 A;  1UY8 A;  1AH8 A;  2WI1 A;  5F3K A;  1L0O A;  1U0Z A;  4O05 A;  1F51 A;  3CYG A;  3R92 A;  4MP2 A;  3R4M A;  2BU7 A;  5D6Q A;  2YJX A;  2FYP A;  1US7 A;  2VW5 A;  2K5B A;  4E72 A;  2YI0 A;  4L8Z A;  3MNR P;  1AM1 A;  1UYI A;  3IED A;  3K60 A;  4GGL A;  3C0E A;  1BKN A;  5J71 A;  1ZW9 A;  4BIZ A;  4WUB A;  5D6P A;  2Q8I A;  3B28 A;  1H7U A;  2CCU A;  4KTN A;  1UYL A;  1UY7 A;  4JAU A;  4H81 A;  4X9L A;  2JJC A;  4HY6 A;  4DUH A;  3K99 A;  2YI6 A;  2VWC A;  2CH4 A;  3HYZ A;  4XKA A;  3RLR A;  3EHJ A;  2WI5 A;  4LWG A;  2YK2 A;  3BMY A;  3T0H A;  3VHA A;  2YE7 A;  4YKR A;  3R4P A;  4KSH A;  3VAD A;  3TZ5 A;  1EI1 A;  1S14 A;  4O07 A;  1Z5C A;  4ASG A;  3G7B A;  2AKP A;  3HHU A;  4LWF A;  1AMW A;  2GQP A;  4XDM A;  3R4O A;  5C93 A;  3CWV A;  2YE5 A;  4XTJ A;  4HYM A;  4LWI A;  2EXL A;  2YEG A;  4CWF A;  2CCS A;  5L3J A;  2PNR A;  4ZVI A;  1UYE A;  1YT1 A;  2UWD A;  4GQT A;  2XJX A;  1Y4S A;  2HHI A;  4MPE A;  4JAS A;  5J6A A;  3HEK A;  5D7D A;  4CWQ A;  5IN9 A;  4CWR A;  3HZ5 A;  1UYC A;  4GCZ A;  1YC4 A;  4JAV A;  1QZR A;  5CPH A;  4WUD A;  5F5R A;  4XE2 A;  1TC0 A;  3A0X A;  1IXM A;  3G7E A;  5CF0 A;  4WUC A;  1KZN A;  4FPP A;  4KSG A;  1NHJ A;  5CTX A;  1TBW A;  3H4L A;  1MU5 A;  2BT0 A;  2ZBK B;  4URL A;  3OW6 A;  3TZ0 A;  2YGE A;  3A0Z A;  2XJJ A;  2QG2 A;  2XX4 A;  4YKU A;  4KFG A;  4P7A A;  2XDK A;  2QFO A;  1GJV A;  3T10 A;  2IWU A;  2XDL A;  2WI3 A;  3EHG A;  2BTZ A;  2O1U A;  1YT2 A;  2XD6 A;  4EGK A;  1YSZ A;  4XCJ A;  2CCT A;  2YKC A;  3HZ1 A;  2QG0 A;  3U2D A;  1UY6 A;  5IDM A;  1Z59 A;  4AWQ A;  4I5S A;  3K97 A;  5IDJ A;  1TID A;  2BZ5 A;  1THN A;  4HY1 A;  3LNU A;  4H85 A;  3TZ2 A;  2BSM A;  1B3Q A;  3ZM7 A;  3A0Y A;  4PRX A;  3B24 A;  2BYH A;  3GIE A;  4L94 A;  1GKZ A;  4CWO A;  4V26 A;  3G75 A;  3ZXO A;  3QDD A;  4ASB A;  3B25 A;  5CTY A;  4BXI A;  5BOC A;  1S16 A;  4EGH A;  3O2F A;  1GKX A;  4EM7 A;  2CGF A;  4MOT A;  4YKX A;  4YKT A;  1I5C A;  4R3A A;  3NMQ A;  3T1K A;  1UYD A;  5D7R A;  4CE3 A;  2XAB A;  2CG9 A;  4CWS A;  1Y4U A;  2ZKJ A;  1NHH A;  1YC1 A;  2YI7 A;  2HKJ A;  4XIT A;  3FT5 A;  2IOR A;  2YJW A;  4EFT A;  4V25 A;  3RLQ A;  2WI6 A;  3ZKD A;  4L91 A;  1AJ6 A;  4XKO A;  2YKJ A;  2E0A A;  4FCP A;  2XHX A;  1I58 A;  1TIL A;  2ZDX A;  4XCL A;  3TZ4 A;  4KQV A;  2WI2 A;  2HCH A;  4PRV A;  4O09 A;  1Z5A A;  3VHC A;  3EHH A;  4HXW A;  4NH7 A;  3R4N A;  2XX2 A;  3BM9 A;  2O1V A;  2YE8 A;  4MBC A;  1JM6 A;  2XHT A;  4AWO A;  4GT8 A;  4JQL A;  3RKZ A;  4YKQ A;  3ZKB A;  5M4M A;  2C1I A;  2XCM A;  2YGA A;  3O0I A;  1AH6 A;  4W7T A;  1QYE A;  4URO A;  4XKK A;  5FND A;  1ZXM A;  2Q8G A;  4PU9 A;  2C1G A;  4YKZ A;  5GGZ A;  3A0R A;  1Z5B A;  2O1W A;  5CTW A;  3CGZ A;  4CE1 A;  3KE6 A;  2HG1 A;  4O04 A;  3D36 A;  4E00 A;  1YER A;  2ESA A;  4I3H A;  3S5T A;  4LPB A;  4HXZ A;  4K4O A;  3OMU A;  1I5D A;  3CRK A;  5M4E A;  2JKI A;  4B7P A;  3K98 A;  3WHA A;  1R62 A;  3FV5 A;  4BAE A;  4BQJ A;  3Q5J A;  2IOP A;  2GFD A;  3GIF A;  4MPC A;  2YKE A;  2VCJ A;  2YEJ A;  2YE4 A;  4XC0 A;  4BQG A;  2YEH A;  4CE2 A;  4PL9 A;  2YEE A;  1BGQ A;  4NH9 A;  3CGY A;  3R91 A;  4QPK A;  3D0B A;  1ZWH A;  1TH8 A;  2WEQ A;  1YES A;  4O0B A;  3JZ3 A;  2YI5 A;  3HYY A;  1OSF A;  3INX A;  4URN A;  5M4P A;  2BU2 A;  1U2O A;  1YT0 A;  4XIQ A;  1NHI A;  3GIG A;  2YE3 A;  1UYH A;  5M4N A;  1B63 A;  2BU5 A;  2FWZ A;  3QTF A;  1Y8N A;  1I59 A;  4XIR A;  4ASF A;  2YE9 A;  1UYF A;  2FTK A;  4U93 A;  2IOQ A;  2IWS A;  1YS3 A;  3U2K A;  4B6C A;  4AWP A;  3LPS A; 
#chains in the Genus database with same CATH homology
 3EKR A;  1UY9 A;  1MX0 A;  3INW A;  3TTZ A;  1B62 A;  2BU8 A;  4MPN A;  3SL2 A;  4P8O A;  2WI7 A;  3ZXQ A;  2XDS A;  2ZDY A;  3Q5K A;  1EA6 A;  1TC6 A;  3U67 A;  4DZY A;  4ZKI A;  2YKI A;  5FNF A;  4KP4 A;  4Q20 A;  2FXS A;  2YEA A;  2XX5 A;  1YC3 A;  4HZ5 A;  1BYQ A;  4YKW A;  4EMV A;  1A4H A;  4L90 A;  2VCI A;  1UYM A;  2BU6 A;  2YKB A;  3RLP A;  2XJG A;  3CRL A;  2XHR A;  3EHF A;  4QPJ A;  2Q2E B;  2BYI A;  4XD8 A;  5FNC A;  1UYK A;  4E02 A;  1UYG A;  2YE2 A;  3WQ9 A;  2YEI A;  4HZ0 A;  3FT8 A;  3O6O A;  3A0T A;  1H7S A;  4GFN A;  2BRE A;  4LWH A;  5D7C A;  3T0Z A;  2XK2 A;  1Y8P A;  2FWY A;  4YKY A;  5CTU A;  3GIG B;  3OPD A;  2Q8F A;  2QF6 A;  1ZXN A;  2XDU A;  3Q5L A;  2YEC A;  4MP7 A;  2YK9 A;  1I5A A;  4CWN A;  4R3M A;  3DGE A;  4URM A;  3PEH A;  2XDX A;  1PVG A;  4R1F A;  1YET A;  4NH8 A;  1YSR A;  2IWX A;  3D2R A;  2BRC A;  2YE6 A;  4HYP A;  2Q8H A;  4CWT A;  4EGI A;  1KIJ A;  2C2A A;  3T2S A;  4CWP A;  3B27 A;  2YEF A;  2YEB A;  3A0W A;  4LWE A;  4L93 A;  4FMT A;  3OWB A;  3C11 A;  5BOD A;  4EEH A;  3VHD A;  2H55 A;  4ASA A;  3OWD A;  4MB9 A;  2WEP A;  4AS9 A;  4BIU A;  5M4H A;  3B26 A;  4H7Q A;  2YED A;  2H8M A;  5FWK A;  5M4K A;  1BXD A;  3TUH A;  3PEJ A;  4FCR A;  2YGF A;  4FCQ A;  4U7N A;  4LP0 A;  4GEE A;  1Y8O A;  1I5B A;  3H80 A;  3EKO A;  1QY8 A;  4U7O A;  4XIP A;  4E01 A;  1ID0 A;  2WER A;  4EFU A;  2WI4 A;  1UY8 A;  1AH8 A;  2WI1 A;  5F3K A;  1L0O A;  1U0Z A;  4O05 A;  3R92 A;  4MP2 A;  3R4M A;  2BU7 A;  5D6Q A;  2YJX A;  2FYP A;  1US7 A;  2VW5 A;  2K5B A;  2YI0 A;  4L8Z A;  3MNR P;  1AM1 A;  1UYI A;  3IED A;  3K60 A;  4GGL A;  3C0E A;  1BKN A;  5J71 A;  1ZW9 A;  4BIZ A;  4WUB A;  5D6P A;  2Q8I A;  3B28 A;  1H7U A;  2CCU A;  4KTN A;  1UYL A;  1UY7 A;  4JAU A;  4H81 A;  4X9L A;  2JJC A;  4HY6 A;  4DUH A;  3K99 A;  2YI6 A;  2VWC A;  2CH4 A;  3HYZ A;  4XKA A;  3RLR A;  3EHJ A;  2WI5 A;  4LWG A;  2YK2 A;  3BMY A;  3T0H A;  3VHA A;  2YE7 A;  4YKR A;  3R4P A;  4KSH A;  3VAD A;  3TZ5 A;  1EI1 A;  1S14 A;  4O07 A;  1Z5C A;  4ASG A;  3G7B A;  2AKP A;  3HHU A;  4LWF A;  1AMW A;  2GQP A;  4XDM A;  3R4O A;  5C93 A;  3CWV A;  2YE5 A;  4XTJ A;  4HYM A;  4LWI A;  2EXL A;  2YEG A;  4CWF A;  2CCS A;  5L3J A;  2PNR A;  4ZVI A;  1UYE A;  1YT1 A;  2UWD A;  4GQT A;  2XJX A;  1Y4S A;  4MPE A;  4JAS A;  5J6A A;  3HEK A;  5D7D A;  4CWQ A;  5IN9 A;  4CWR A;  3HZ5 A;  1UYC A;  4GCZ A;  1YC4 A;  4JAV A;  1QZR A;  5CPH A;  4WUD A;  5F5R A;  4XE2 A;  1TC0 A;  3A0X A;  5CF0 A;  3G7E A;  4WUC A;  1KZN A;  4FPP A;  4KSG A;  1NHJ A;  5CTX A;  1TBW A;  3H4L A;  1MU5 A;  2BT0 A;  2ZBK B;  4URL A;  3OW6 A;  3TZ0 A;  2YGE A;  3A0Z A;  2XJJ A;  2QG2 A;  2XX4 A;  4YKU A;  4KFG A;  4P7A A;  2XDK A;  2QFO A;  1GJV A;  3T10 A;  2IWU A;  2XDL A;  2WI3 A;  3EHG A;  2BTZ A;  2O1U A;  1YT2 A;  2XD6 A;  4EGK A;  1YSZ A;  4XCJ A;  2CCT A;  2YKC A;  3HZ1 A;  2QG0 A;  3U2D A;  1UY6 A;  5IDM A;  1Z59 A;  4AWQ A;  4I5S A;  3K97 A;  5IDJ A;  1TID A;  2BZ5 A;  1THN A;  4HY1 A;  3LNU A;  4H85 A;  3TZ2 A;  2BSM A;  1B3Q A;  3ZM7 A;  3A0Y A;  4PRX A;  3B24 A;  2BYH A;  3GIE A;  4L94 A;  1GKZ A;  4CWO A;  4V26 A;  3G75 A;  3ZXO A;  3QDD A;  4ASB A;  3B25 A;  5CTY A;  4BXI A;  5BOC A;  1S16 A;  4EGH A;  3O2F A;  1GKX A;  4EM7 A;  2CGF A;  4MOT A;  4YKX A;  4YKT A;  1I5C A;  4R3A A;  3NMQ A;  3T1K A;  1UYD A;  5D7R A;  4CE3 A;  2XAB A;  2CG9 A;  4CWS A;  1Y4U A;  2ZKJ A;  1NHH A;  1YC1 A;  2YI7 A;  2HKJ A;  4XIT A;  3FT5 A;  2IOR A;  2YJW A;  4EFT A;  4V25 A;  3RLQ A;  2WI6 A;  3ZKD A;  4L91 A;  1AJ6 A;  4XKO A;  2YKJ A;  2E0A A;  4FCP A;  2XHX A;  1I58 A;  1TIL A;  2ZDX A;  4XCL A;  3TZ4 A;  4KQV A;  2WI2 A;  2HCH A;  4PRV A;  4O09 A;  1Z5A A;  3VHC A;  3EHH A;  4HXW A;  4NH7 A;  3R4N A;  2XX2 A;  3BM9 A;  2O1V A;  2YE8 A;  4MBC A;  1JM6 A;  2XHT A;  4AWO A;  4GT8 A;  4JQL A;  3RKZ A;  4YKQ A;  3ZKB A;  5M4M A;  2XCM A;  2YGA A;  3O0I A;  1AH6 A;  4W7T A;  1QYE A;  4URO A;  4XKK A;  5FND A;  1ZXM A;  2Q8G A;  4PU9 A;  4YKZ A;  5GGZ A;  3A0R A;  1Z5B A;  2O1W A;  5CTW A;  3CGZ A;  4CE1 A;  3KE6 A;  2HG1 A;  4O04 A;  3D36 A;  4E00 A;  1YER A;  2ESA A;  4I3H A;  4LPB A;  4HXZ A;  4K4O A;  3OMU A;  1I5D A;  3CRK A;  5M4E A;  2JKI A;  4B7P A;  3K98 A;  3WHA A;  1R62 A;  3FV5 A;  4BAE A;  4BQJ A;  3Q5J A;  2IOP A;  2GFD A;  3GIF A;  4MPC A;  2YKE A;  2VCJ A;  2YEJ A;  2YE4 A;  4XC0 A;  4BQG A;  2YEH A;  4CE2 A;  4PL9 A;  2YEE A;  1BGQ A;  4NH9 A;  3CGY A;  3R91 A;  4QPK A;  3D0B A;  1ZWH A;  1TH8 A;  2WEQ A;  1YES A;  4O0B A;  3JZ3 A;  2YI5 A;  3HYY A;  1OSF A;  3INX A;  4URN A;  5M4P A;  2BU2 A;  1U2O A;  1YT0 A;  4XIQ A;  1NHI A;  3GIG A;  2YE3 A;  1UYH A;  5M4N A;  1B63 A;  2BU5 A;  2FWZ A;  3QTF A;  1Y8N A;  1I59 A;  4XIR A;  4ASF A;  2YE9 A;  1UYF A;  4U93 A;  2IOQ A;  2IWS A;  1YS3 A;  3U2K A;  4B6C A;  4AWP A;  3LPS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...