1I5CA

Structure of chea domain p4 in complex with adp
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
188
structure length
181
Chain Sequence
SHMVPISFVFNRFPRMVRDLAKKMNKEVNFIMRGEDTELDRTFVEEIGEPLLHLLRNAIDHGIEPKEERIAKGKPPIGTLILSARHEGNNVVIEVEDDGRGIDKEKIIRKAIEKGLIDESKAATLSDQEILNFLFVPGFSTKERGVGMDVVKNVVESLNGSISIESEKDKGTKVTIRLPLT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Nucleotide binding by the histidine kinase CheA.
pubmed doi rcsb
source organism Thermotoga maritima
molecule tags Signaling protein, transferase
molecule keywords CHEMOTAXIS PROTEIN CHEA
total genus 58
structure length 181
sequence length 188
chains with identical sequence B
ec nomenclature ec 2.7.13.3: Histidine kinase.
pdb deposition date 2001-02-26
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.565.10 Alpha Beta 2-Layer Sandwich Heat Shock Protein 90 Histidine kinase-like ATPase, C-terminal domain 1i5cA00
4LPBA 1H7UA 3RLPA 5M4PA 1GJVA 1ZXMA 2YE9A 5CTWA 1UYGA 1Y8NA 2YEFA 1U0ZA 2YKJA 3TZ5A 2CGFA 3A0XA 4DZYA 2BTZA 2HCHA 1US7A 5M4EA 2QG0A 3LPSA 2CCUA 4EEHA 1UY8A 2YKEA 2JJCA 5GGZA 3HZ1A 4XKOA 1I58A 4QPKA 2XX5A 3R4OA 4MP7A 2WI3A 1UYHA 1YT1A 1ZXNA 2YJXA 3GIGB 4GGLA 2YE4A 3A0YA 3QTFA 2QG2A 4KTNA 1UYEA 1R62A 3H4LA 4YKWA 2YE7A 3B24A 2H8MA 4B6CA 2YKIA 1Z59A 3TZ2A 1B63A 5M4HA 3INWA 2Q8GA 3HEKA 1I5BA 4AWPA 2IWSA 4JASA 1EA6A 2YE5A 4MPEA 2XK2A 2BT0A 2VCIA 1Z5AA 4WUCA 4CWPA 4XKAA 5CPHA 4BQGA 3C11A 1B3QA 2O1VA 3BM9A 3FT8A 1L0OA 3FT5A 2XDUA 4BQJA 2FXSA 3R4NA 1BXDA 1QYEA 3Q5LA 2FWYA 3ZXOA 1Y4SA 2XHXA 2YI5A 4EGIA 5F5RA 1AMWA 4ASAA 3OWBA 1ZW9A 4PL9A 3WHAA 4EGKA 1EI1A 4CE2A 2BYIA 4BIUA 4YKQA 2XJJA 4R3MA 3KE6A 3BMYA 2FWZA 4R1FA 4XIRA 2CG9A 4LP0A 3ZXQA 2XDLA 4HYMA 3T0ZA 1JM6A 5IDMA 2XDXA 4CWNA 1Z5CA 2YEDA 4YKXA 4KFGA 4CWQA 1YC4A 1AH8A 1I5CA 4XKKA 3Q5KA 2IWUA 1UY7A 1PVGA 2UWDA 3C0EA 3OPDA 3H80A 2XX2A 3TUHA 3Q5JA 4U93A 1UY9A 2YI7A 4ASFA 2XHRA 1UYKA 4Q20A 4XD8A 3VHDA 4MPCA 2GFDA 3VHCA 3WQ9A 4YKZA 2YGAA 5FNDA 4XCLA 2YEEA 1YETA 3ZKDA 4KSHA 1AM1A 3ZKBA 1TILA 2XJXA 3DGEA 5CTXA 2QF6A 4KP4A 3T10A 3K97A 5D7CA 1B62A 1QY8A 1U2OA 2XCMA 3RLQA 2O1WA 2BU2A 4O05A 5L3JA 4LWFA 4EM7A 3TZ0A 4FCRA 2AKPA 4XE2A 2YE2A 1UYFA 5D6QA 2YEAA 3RLRA 2CCSA 4KSGA 3G7EA 4LWEA 1NHJA 3K98A 4PRVA 2BYHA 3GIFA 4LWIA 4E01A 4CWSA 3U2DA 1Y8PA 3B26A 2ZBKB 2BSMA 4NH7A 4L8ZA 3RKZA 4NH8A 1OSFA 2XDKA 2YEHA 3T0HA 4L93A 4GEEA 1NHIA 2YK2A 5BODA 5M4KA 1TC6A 3HYZA 4O09A 1UYLA 1UYIA 2QFOA 4I3HA 3GIGA 1BYQA 1S14A 2Q8FA 2YE8A 1ID0A 4GCZA 4MPNA 3EKOA 3PEJA 2XX4A 3INXA 4XDMA 3R92A 3B25A 4LWGA 2BU7A 3OMUA 1AJ6A 4W7TA 4AS9A 4MB9A 2HKJA 1I5DA 3T1KA 2CCTA 4AWOA 3O0IA 1TIDA 4WUBA 3FV5A 4P7AA 4CWTA 4MP2A 1I59A 2K5BA 2YEJA 4ZVIA 4L90A 4XCJA 1TH8A 4JQLA 4CE3A 3HZ5A 1BGQA 2Q8IA 4FMTA 4YKUA 4ZKIA 5FNCA 5IDJA 2YECA 2C2AA 2IOPA 1A4HA 2JKIA 2YI0A 4HZ0A 2XABA 3R91A 4EMVA 5J6AA 1MU5A 3IEDA 1KIJA 2XDSA 2ZDXA 2PNRA 3JZ3A 4CWOA 3EHFA 4BAEA 3CGYA 4EFUA 4MOTA 2WERA 1AH6A 3TZ4A 1YT0A 2BREA 4JAVA 4UROA 3OW6A 4GT8A 1ZWHA 5M4NA 4QPJA 3B28A 4GFNA 1YT2A 3CGZA 2BU8A 4CE1A 4K4OA 3EKRA 2WI4A 2YEIA 1TC0A 2WI2A 3O2FA 3D36A 4EFTA 1YSRA 3D2RA 2XD6A 2BU5A 2YEBA 4JAUA 2YGEA 2CH4A 4U7OA 1UYCA 1YERA 2XHTA 3EHGA 4HYPA 4NH9A 3A0RA 4HZ5A 5CTUA 3K99A 4YKRA 1GKXA 2YKBA 4CWFA 4B7PA 1THNA 1UYMA 2VCJA 3CRKA 3U67A 5J71A 1S16A 4PRXA 4PU9A 4R3AA 5FNFA 5C93A 4HXWA 1KZNA 5F3KA 1UY6A 2YKCA 4L91A 4YKYA 2H55A 1Z5BA 3OWDA 4FCQA 4U7NA 4P8OA 1MX0A 1Y8OA 2IOQA 2GQPA 2IWXA 3B27A 3D0BA 3O6OA 3LNUA 4LWHA 4HY1A 3NMQA 1YSZA 4ASBA 3QDDA 5CF0A 2IORA 2YEGA 3R4MA 3T2SA 1BKNA 1YESA 1QZRA 4YKTA 2YI6A 4WUDA 4V25A 3A0TA 2O1UA 4MBCA 4BXIA 5D6PA 2ESAA 4CWRA 4I5SA 4FCPA 2WI7A 4GQTA 3G7BA 4EGHA 4URNA 4XTJA 2HG1A 5FWKA 1H7SA 2WEQA 5IN9A 2VWCA 3PEHA 4XIQA 5CTYA 4O07A 4BIZA 3CWVA 3VADA 4H85A 1YC3A 2WI5A 4E00A 3ZM7A 3MNRP 4X9LA 4HY6A 4KQVA 4L94A 2EXLA 3HYYA 3A0WA 1Y4UA 3HHUA 4XITA 4V26A 3A0ZA 3TTZA 4FPPA 5D7DA 5BOCA 2YGFA 4DUHA 1YC1A 3R4PA 4XIPA 5M4MA 2Q8HA 2ZDYA 4AWQA 3G75A 2BZ5A 2WEPA 2E0AA 3GIEA 3CRLA 5D7RA 4ASGA 2Q2EB 4E02A 1YS3A 2VW5A 3EHJA 3U2KA 2WI1A 2YK9A 2WI6A 1UYDA 1GKZA 2YE6A 4H7QA 4HXZA 3K60A 3EHHA 2XJGA 2YE3A 4URMA 2ZKJA 1NHHA 2FYPA 4H81A 2YJWA 3VHAA 2BRCA 4O04A 4XC0A 1TBWA 2BU6A 4URLA 3SL2A 1I5AA 4O0BA
chains in the Genus database with same CATH superfamily
4LPBA 1H7UA 3RLPA 5M4PA 1GJVA 1ZXMA 2YE9A 5CTWA 1UYGA 1Y8NA 2YEFA 1U0ZA 2YKJA 3TZ5A 2CGFA 3A0XA 4DZYA 2BTZA 2HCHA 1US7A 5M4EA 2QG0A 3LPSA 2CCUA 4EEHA 1UY8A 2YKEA 2JJCA 5GGZA 3HZ1A 4XKOA 1I58A 4QPKA 2XX5A 3R4OA 4MP7A 2WI3A 1UYHA 1YT1A 1ZXNA 2YJXA 1IXMA 3GIGB 4GGLA 2YE4A 3A0YA 3QTFA 2QG2A 4KTNA 1UYEA 1R62A 3H4LA 4YKWA 2YE7A 3B24A 5JENA 2H8MA 4B6CA 2YKIA 1Z59A 3TZ2A 1B63A 5M4HA 3INWA 2Q8GA 4E72A 3HEKA 1I5BA 4AWPA 2IWSA 4JASA 1EA6A 2YE5A 4MPEA 2XK2A 2BT0A 2VCIA 1Z5AA 4WUCA 4CWPA 4XKAA 5CPHA 4BQGA 3C11A 1B3QA 2O1VA 3BM9A 3FT8A 1L0OA 3FT5A 2XDUA 4BQJA 2FXSA 3R4NA 1BXDA 1QYEA 3Q5LA 2FWYA 3ZXOA 1Y4SA 2XHXA 2YI5A 4EGIA 5F5RA 1AMWA 4ASAA 3OWBA 1ZW9A 4PL9A 3WHAA 4EGKA 1EI1A 4CE2A 2BYIA 4BIUA 4YKQA 2XJJA 4R3MA 3KE6A 3BMYA 2FWZA 4R1FA 4XIRA 2CG9A 4LP0A 3ZXQA 2XDLA 4HYMA 3T0ZA 1JM6A 5IDMA 2XDXA 2FTKA 4CWNA 1Z5CA 2YEDA 4YKXA 4KFGA 4CWQA 1YC4A 1AH8A 1I5CA 4XKKA 3Q5KA 2IWUA 1UY7A 1PVGA 2UWDA 3C0EA 3OPDA 3H80A 2XX2A 3TUHA 3S5TA 3Q5JA 4U93A 1UY9A 2YI7A 4ASFA 2XHRA 1UYKA 4Q20A 4XD8A 3VHDA 4MPCA 2GFDA 3VHCA 3WQ9A 4YKZA 2YGAA 5FNDA 4XCLA 2YEEA 1YETA 3ZKDA 4KSHA 1AM1A 3ZKBA 1TILA 2XJXA 3DGEA 5CTXA 2QF6A 4KP4A 3T10A 3K97A 5D7CA 1B62A 1QY8A 1U2OA 2XCMA 3RLQA 2O1WA 2BU2A 4O05A 5L3JA 4LWFA 2C1GA 4EM7A 3LMMA 3TZ0A 4FCRA 2AKPA 4XE2A 2YE2A 1UYFA 5D6QA 2YEAA 1F51A 3RLRA 2CCSA 4KSGA 3G7EA 4LWEA 1NHJA 3K98A 4PRVA 2BYHA 3GIFA 4LWIA 4E01A 4CWSA 3U2DA 1Y8PA 3B26A 2ZBKB 2BSMA 4NH7A 4L8ZA 3RKZA 4NH8A 1OSFA 2XDKA 2YEHA 3T0HA 4L93A 4GEEA 1NHIA 2YK2A 3CYGA 5BODA 5M4KA 1TC6A 3HYZA 4O09A 1UYLA 1UYIA 2QFOA 4I3HA 3GIGA 1BYQA 1S14A 2Q8FA 2YE8A 1ID0A 4GCZA 4MPNA 3EKOA 3PEJA 2XX4A 3INXA 4XDMA 3R92A 3B25A 4LWGA 2BU7A 3OMUA 1AJ6A 4W7TA 4AS9A 4MB9A 2HKJA 1I5DA 3T1KA 2CCTA 4AWOA 3O0IA 1TIDA 4WUBA 3FV5A 4P7AA 4CWTA 4MP2A 1I59A 2K5BA 2YEJA 4ZVIA 4L90A 4XCJA 1TH8A 4JQLA 4CE3A 3HZ5A 1BGQA 2Q8IA 4FMTA 4YKUA 4ZKIA 5FNCA 5IDJA 2YECA 2C2AA 2IOPA 1A4HA 2JKIA 2YI0A 4HZ0A 2XABA 3R91A 4EMVA 5J6AA 1MU5A 3IEDA 1KIJA 2XDSA 2ZDXA 2PNRA 3JZ3A 4CWOA 3EHFA 4BAEA 3CGYA 4EFUA 4MOTA 2WERA 1AH6A 3TZ4A 1YT0A 2BREA 4JAVA 4UROA 3OW6A 4GT8A 1ZWHA 5M4NA 4QPJA 3B28A 4GFNA 1YT2A 3CGZA 2BU8A 4CE1A 4K4OA 3EKRA 2WI4A 2YEIA 1TC0A 2WI2A 3O2FA 3D36A 4EFTA 1YSRA 3D2RA 2XD6A 2BU5A 2YEBA 4JAUA 2YGEA 2CH4A 4U7OA 1UYCA 1YERA 2XHTA 3EHGA 4HYPA 4NH9A 3A0RA 4HZ5A 5CTUA 3K99A 4YKRA 1GKXA 2YKBA 4CWFA 4B7PA 1THNA 1UYMA 2VCJA 3CRKA 3U67A 5J71A 1S16A 4PRXA 4PU9A 4R3AA 5FNFA 5C93A 4HXWA 1KZNA 5F3KA 1UY6A 2YKCA 4L91A 4YKYA 2H55A 1Z5BA 3OWDA 4FCQA 4U7NA 4P8OA 1MX0A 1Y8OA 2IOQA 2GQPA 2IWXA 3B27A 3D0BA 3O6OA 3LNUA 4LWHA 4HY1A 3NMQA 1YSZA 4ASBA 3QDDA 5CF0A 2IORA 2YEGA 3R4MA 3T2SA 1BKNA 1YESA 1QZRA 4YKTA 2YI6A 4WUDA 4V25A 3A0TA 2O1UA 4MBCA 4BXIA 5D6PA 2ESAA 4CWRA 4I5SA 4FCPA 2WI7A 4GQTA 3G7BA 4EGHA 4URNA 4XTJA 2HG1A 5FWKA 1H7SA 2WEQA 5IN9A 2VWCA 3PEHA 4XIQA 5CTYA 4O07A 4BIZA 3CWVA 3VADA 4H85A 1YC3A 2WI5A 4E00A 3ZM7A 3MNRP 4X9LA 4HY6A 4KQVA 4L94A 2EXLA 3HYYA 3A0WA 1Y4UA 3HHUA 4XITA 4V26A 3A0ZA 3TTZA 4FPPA 5D7DA 5BOCA 2YGFA 4DUHA 1YC1A 3R4PA 4XIPA 5M4MA 2Q8HA 2ZDYA 4AWQA 3G75A 2BZ5A 2WEPA 2E0AA 3GIEA 3CRLA 5D7RA 4ASGA 2Q2EB 4E02A 1YS3A 2HHIA 2VW5A 3EHJA 3U2KA 2WI1A 2YK9A 2WI6A 1UYDA 1GKZA 2YE6A 4H7QA 4HXZA 3K60A 3EHHA 2XJGA 2YE3A 4URMA 2ZKJA 1NHHA 2FYPA 4H81A 2YJWA 3VHAA 2BRCA 4O04A 4XC0A 1TBWA 2BU6A 4URLA 2C1IA 3SL2A 1I5AA 4O0BA
chains in the Genus database with same CATH topology
4LPBA 1H7UA 3RLPA 5M4PA 1GJVA 1ZXMA 2YE9A 5CTWA 1UYGA 1Y8NA 2YEFA 1U0ZA 2YKJA 3TZ5A 2CGFA 3A0XA 4DZYA 2BTZA 2HCHA 1US7A 5M4EA 2QG0A 3LPSA 2CCUA 4EEHA 1UY8A 2YKEA 2JJCA 5GGZA 3HZ1A 4XKOA 1I58A 4QPKA 2XX5A 3R4OA 4MP7A 2WI3A 1UYHA 1YT1A 1ZXNA 2YJXA 3GIGB 4GGLA 2YE4A 3A0YA 3QTFA 2QG2A 4KTNA 1UYEA 1R62A 3H4LA 4YKWA 2YE7A 3B24A 2H8MA 4B6CA 2YKIA 1Z59A 3TZ2A 1B63A 5M4HA 3INWA 2Q8GA 3HEKA 1I5BA 4AWPA 2IWSA 4JASA 1EA6A 2YE5A 4MPEA 2XK2A 2BT0A 2VCIA 1Z5AA 4WUCA 4CWPA 4XKAA 5CPHA 4BQGA 3C11A 1B3QA 2O1VA 3BM9A 3FT8A 1L0OA 3FT5A 2XDUA 4BQJA 2FXSA 3R4NA 1BXDA 1QYEA 3Q5LA 2FWYA 3ZXOA 1Y4SA 2XHXA 2YI5A 4EGIA 5F5RA 1AMWA 4ASAA 3OWBA 1ZW9A 4PL9A 3WHAA 4EGKA 1EI1A 4CE2A 2BYIA 4BIUA 4YKQA 2XJJA 4R3MA 3KE6A 3BMYA 2FWZA 4R1FA 4XIRA 2CG9A 4LP0A 3ZXQA 2XDLA 4HYMA 3T0ZA 1JM6A 5IDMA 2XDXA 4CWNA 1Z5CA 2YEDA 4YKXA 4KFGA 4CWQA 1YC4A 1AH8A 1I5CA 4XKKA 3Q5KA 2IWUA 1UY7A 1PVGA 2UWDA 3C0EA 3OPDA 3H80A 2XX2A 3TUHA 3Q5JA 4U93A 1UY9A 2YI7A 4ASFA 2XHRA 1UYKA 4Q20A 4XD8A 3VHDA 4MPCA 2GFDA 3VHCA 3WQ9A 4YKZA 2YGAA 5FNDA 4XCLA 2YEEA 1YETA 3ZKDA 4KSHA 1AM1A 3ZKBA 1TILA 2XJXA 3DGEA 5CTXA 2QF6A 4KP4A 3T10A 3K97A 5D7CA 1B62A 1QY8A 1U2OA 2XCMA 3RLQA 2O1WA 2BU2A 4O05A 5L3JA 4LWFA 4EM7A 3TZ0A 4FCRA 2AKPA 4XE2A 2YE2A 1UYFA 5D6QA 2YEAA 3RLRA 2CCSA 4KSGA 3G7EA 4LWEA 1NHJA 3K98A 4PRVA 2BYHA 3GIFA 4LWIA 4E01A 4CWSA 3U2DA 1Y8PA 3B26A 2ZBKB 2BSMA 4NH7A 4L8ZA 3RKZA 4NH8A 1OSFA 2XDKA 2YEHA 3T0HA 4L93A 4GEEA 1NHIA 2YK2A 5BODA 5M4KA 1TC6A 3HYZA 4O09A 1UYLA 1UYIA 2QFOA 4I3HA 3GIGA 1BYQA 1S14A 2Q8FA 2YE8A 1ID0A 4GCZA 4MPNA 3EKOA 3PEJA 2XX4A 3INXA 4XDMA 3R92A 3B25A 4LWGA 2BU7A 3OMUA 1AJ6A 4W7TA 4AS9A 4MB9A 2HKJA 1I5DA 3T1KA 2CCTA 4AWOA 3O0IA 1TIDA 4WUBA 3FV5A 4P7AA 4CWTA 4MP2A 1I59A 2K5BA 2YEJA 4ZVIA 4L90A 4XCJA 1TH8A 4JQLA 4CE3A 3HZ5A 1BGQA 2Q8IA 4FMTA 4YKUA 4ZKIA 5FNCA 5IDJA 2YECA 2C2AA 2IOPA 1A4HA 2JKIA 2YI0A 4HZ0A 2XABA 3R91A 4EMVA 5J6AA 1MU5A 3IEDA 1KIJA 2XDSA 2ZDXA 2PNRA 3JZ3A 4CWOA 3EHFA 4BAEA 3CGYA 4EFUA 4MOTA 2WERA 1AH6A 3TZ4A 1YT0A 2BREA 4JAVA 4UROA 3OW6A 4GT8A 1ZWHA 5M4NA 4QPJA 3B28A 4GFNA 1YT2A 3CGZA 2BU8A 4CE1A 4K4OA 3EKRA 2WI4A 2YEIA 1TC0A 2WI2A 3O2FA 3D36A 4EFTA 1YSRA 3D2RA 2XD6A 2BU5A 2YEBA 4JAUA 2YGEA 2CH4A 4U7OA 1UYCA 1YERA 2XHTA 3EHGA 4HYPA 4NH9A 3A0RA 4HZ5A 5CTUA 3K99A 4YKRA 1GKXA 2YKBA 4CWFA 4B7PA 1THNA 1UYMA 2VCJA 3CRKA 3U67A 5J71A 1S16A 4PRXA 4PU9A 4R3AA 5FNFA 5C93A 4HXWA 1KZNA 5F3KA 1UY6A 2YKCA 4L91A 4YKYA 2H55A 1Z5BA 3OWDA 4FCQA 4U7NA 4P8OA 1MX0A 1Y8OA 2IOQA 2GQPA 2IWXA 3B27A 3D0BA 3O6OA 3LNUA 4LWHA 4HY1A 3NMQA 1YSZA 4ASBA 3QDDA 5CF0A 2IORA 2YEGA 3R4MA 3T2SA 1BKNA 1YESA 1QZRA 4YKTA 2YI6A 4WUDA 4V25A 3A0TA 2O1UA 4MBCA 4BXIA 5D6PA 2ESAA 4CWRA 4I5SA 4FCPA 2WI7A 4GQTA 3G7BA 4EGHA 4URNA 4XTJA 2HG1A 5FWKA 1H7SA 2WEQA 5IN9A 2VWCA 3PEHA 4XIQA 5CTYA 4O07A 4BIZA 3CWVA 3VADA 4H85A 1YC3A 2WI5A 4E00A 3ZM7A 3MNRP 4X9LA 4HY6A 4KQVA 4L94A 2EXLA 3HYYA 3A0WA 1Y4UA 3HHUA 4XITA 4V26A 3A0ZA 3TTZA 4FPPA 5D7DA 5BOCA 2YGFA 4DUHA 1YC1A 3R4PA 4XIPA 5M4MA 2Q8HA 2ZDYA 4AWQA 3G75A 2BZ5A 2WEPA 2E0AA 3GIEA 3CRLA 5D7RA 4ASGA 2Q2EB 4E02A 1YS3A 2VW5A 3EHJA 3U2KA 2WI1A 2YK9A 2WI6A 1UYDA 1GKZA 2YE6A 4H7QA 4HXZA 3K60A 3EHHA 2XJGA 2YE3A 4URMA 2ZKJA 1NHHA 2FYPA 4H81A 2YJWA 3VHAA 2BRCA 4O04A 4XC0A 1TBWA 2BU6A 4URLA 3SL2A 1I5AA 4O0BA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4LPB A;  1H7U A;  3RLP A;  5M4P A;  1GJV A;  1ZXM A;  2YE9 A;  5CTW A;  1UYG A;  1Y8N A;  2YEF A;  1U0Z A;  2YKJ A;  3TZ5 A;  2CGF A;  3A0X A;  4DZY A;  2BTZ A;  2HCH A;  1US7 A;  5M4E A;  2QG0 A;  3LPS A;  2CCU A;  4EEH A;  1UY8 A;  2YKE A;  2JJC A;  5GGZ A;  3HZ1 A;  4XKO A;  1I58 A;  4QPK A;  2XX5 A;  3R4O A;  4MP7 A;  2WI3 A;  1UYH A;  1YT1 A;  1ZXN A;  2YJX A;  3GIG B;  4GGL A;  2YE4 A;  3A0Y A;  3QTF A;  2QG2 A;  4KTN A;  1UYE A;  1R62 A;  3H4L A;  4YKW A;  2YE7 A;  3B24 A;  2H8M A;  4B6C A;  2YKI A;  1Z59 A;  3TZ2 A;  1B63 A;  5M4H A;  3INW A;  2Q8G A;  3HEK A;  1I5B A;  4AWP A;  2IWS A;  4JAS A;  1EA6 A;  2YE5 A;  4MPE A;  2XK2 A;  2BT0 A;  2VCI A;  1Z5A A;  4WUC A;  4CWP A;  4XKA A;  5CPH A;  4BQG A;  3C11 A;  1B3Q A;  2O1V A;  3BM9 A;  3FT8 A;  1L0O A;  3FT5 A;  2XDU A;  4BQJ A;  2FXS A;  3R4N A;  1BXD A;  1QYE A;  3Q5L A;  2FWY A;  3ZXO A;  1Y4S A;  2XHX A;  2YI5 A;  4EGI A;  5F5R A;  1AMW A;  4ASA A;  3OWB A;  1ZW9 A;  4PL9 A;  3WHA A;  4EGK A;  1EI1 A;  4CE2 A;  2BYI A;  4BIU A;  4YKQ A;  2XJJ A;  4R3M A;  3KE6 A;  3BMY A;  2FWZ A;  4R1F A;  4XIR A;  2CG9 A;  4LP0 A;  3ZXQ A;  2XDL A;  4HYM A;  3T0Z A;  1JM6 A;  5IDM A;  2XDX A;  4CWN A;  1Z5C A;  2YED A;  4YKX A;  4KFG A;  4CWQ A;  1YC4 A;  1AH8 A;  1I5C A;  4XKK A;  3Q5K A;  2IWU A;  1UY7 A;  1PVG A;  2UWD A;  3C0E A;  3OPD A;  3H80 A;  2XX2 A;  3TUH A;  3Q5J A;  4U93 A;  1UY9 A;  2YI7 A;  4ASF A;  2XHR A;  1UYK A;  4Q20 A;  4XD8 A;  3VHD A;  4MPC A;  2GFD A;  3VHC A;  3WQ9 A;  4YKZ A;  2YGA A;  5FND A;  4XCL A;  2YEE A;  1YET A;  3ZKD A;  4KSH A;  1AM1 A;  3ZKB A;  1TIL A;  2XJX A;  3DGE A;  5CTX A;  2QF6 A;  4KP4 A;  3T10 A;  3K97 A;  5D7C A;  1B62 A;  1QY8 A;  1U2O A;  2XCM A;  3RLQ A;  2O1W A;  2BU2 A;  4O05 A;  5L3J A;  4LWF A;  4EM7 A;  3TZ0 A;  4FCR A;  2AKP A;  4XE2 A;  2YE2 A;  1UYF A;  5D6Q A;  2YEA A;  3RLR A;  2CCS A;  4KSG A;  3G7E A;  4LWE A;  1NHJ A;  3K98 A;  4PRV A;  2BYH A;  3GIF A;  4LWI A;  4E01 A;  4CWS A;  3U2D A;  1Y8P A;  3B26 A;  2ZBK B;  2BSM A;  4NH7 A;  4L8Z A;  3RKZ A;  4NH8 A;  1OSF A;  2XDK A;  2YEH A;  3T0H A;  4L93 A;  4GEE A;  1NHI A;  2YK2 A;  5BOD A;  5M4K A;  1TC6 A;  3HYZ A;  4O09 A;  1UYL A;  1UYI A;  2QFO A;  4I3H A;  3GIG A;  1BYQ A;  1S14 A;  2Q8F A;  2YE8 A;  1ID0 A;  4GCZ A;  4MPN A;  3EKO A;  3PEJ A;  2XX4 A;  3INX A;  4XDM A;  3R92 A;  3B25 A;  4LWG A;  2BU7 A;  3OMU A;  1AJ6 A;  4W7T A;  4AS9 A;  4MB9 A;  2HKJ A;  1I5D A;  3T1K A;  2CCT A;  4AWO A;  3O0I A;  1TID A;  4WUB A;  3FV5 A;  4P7A A;  4CWT A;  4MP2 A;  1I59 A;  2K5B A;  2YEJ A;  4ZVI A;  4L90 A;  4XCJ A;  1TH8 A;  4JQL A;  4CE3 A;  3HZ5 A;  1BGQ A;  2Q8I A;  4FMT A;  4YKU A;  4ZKI A;  5FNC A;  5IDJ A;  2YEC A;  2C2A A;  2IOP A;  1A4H A;  2JKI A;  2YI0 A;  4HZ0 A;  2XAB A;  3R91 A;  4EMV A;  5J6A A;  1MU5 A;  3IED A;  1KIJ A;  2XDS A;  2ZDX A;  2PNR A;  3JZ3 A;  4CWO A;  3EHF A;  4BAE A;  3CGY A;  4EFU A;  4MOT A;  2WER A;  1AH6 A;  3TZ4 A;  1YT0 A;  2BRE A;  4JAV A;  4URO A;  3OW6 A;  4GT8 A;  1ZWH A;  5M4N A;  4QPJ A;  3B28 A;  4GFN A;  1YT2 A;  3CGZ A;  2BU8 A;  4CE1 A;  4K4O A;  3EKR A;  2WI4 A;  2YEI A;  1TC0 A;  2WI2 A;  3O2F A;  3D36 A;  4EFT A;  1YSR A;  3D2R A;  2XD6 A;  2BU5 A;  2YEB A;  4JAU A;  2YGE A;  2CH4 A;  4U7O A;  1UYC A;  1YER A;  2XHT A;  3EHG A;  4HYP A;  4NH9 A;  3A0R A;  4HZ5 A;  5CTU A;  3K99 A;  4YKR A;  1GKX A;  2YKB A;  4CWF A;  4B7P A;  1THN A;  1UYM A;  2VCJ A;  3CRK A;  3U67 A;  5J71 A;  1S16 A;  4PRX A;  4PU9 A;  4R3A A;  5FNF A;  5C93 A;  4HXW A;  1KZN A;  5F3K A;  1UY6 A;  2YKC A;  4L91 A;  4YKY A;  2H55 A;  1Z5B A;  3OWD A;  4FCQ A;  4U7N A;  4P8O A;  1MX0 A;  1Y8O A;  2IOQ A;  2GQP A;  2IWX A;  3B27 A;  3D0B A;  3O6O A;  3LNU A;  4LWH A;  4HY1 A;  3NMQ A;  1YSZ A;  4ASB A;  3QDD A;  5CF0 A;  2IOR A;  2YEG A;  3R4M A;  3T2S A;  1BKN A;  1YES A;  1QZR A;  4YKT A;  2YI6 A;  4WUD A;  4V25 A;  3A0T A;  2O1U A;  4MBC A;  4BXI A;  5D6P A;  2ESA A;  4CWR A;  4I5S A;  4FCP A;  2WI7 A;  4GQT A;  3G7B A;  4EGH A;  4URN A;  4XTJ A;  2HG1 A;  5FWK A;  1H7S A;  2WEQ A;  5IN9 A;  2VWC A;  3PEH A;  4XIQ A;  5CTY A;  4O07 A;  4BIZ A;  3CWV A;  3VAD A;  4H85 A;  1YC3 A;  2WI5 A;  4E00 A;  3ZM7 A;  3MNR P;  4X9L A;  4HY6 A;  4KQV A;  4L94 A;  2EXL A;  3HYY A;  3A0W A;  1Y4U A;  3HHU A;  4XIT A;  4V26 A;  3A0Z A;  3TTZ A;  4FPP A;  5D7D A;  5BOC A;  2YGF A;  4DUH A;  1YC1 A;  3R4P A;  4XIP A;  5M4M A;  2Q8H A;  2ZDY A;  4AWQ A;  3G75 A;  2BZ5 A;  2WEP A;  2E0A A;  3GIE A;  3CRL A;  5D7R A;  4ASG A;  2Q2E B;  4E02 A;  1YS3 A;  2VW5 A;  3EHJ A;  3U2K A;  2WI1 A;  2YK9 A;  2WI6 A;  1UYD A;  1GKZ A;  2YE6 A;  4H7Q A;  4HXZ A;  3K60 A;  3EHH A;  2XJG A;  2YE3 A;  4URM A;  2ZKJ A;  1NHH A;  2FYP A;  4H81 A;  2YJW A;  3VHA A;  2BRC A;  4O04 A;  4XC0 A;  1TBW A;  2BU6 A;  4URL A;  3SL2 A;  1I5A A;  4O0B A; 
#chains in the Genus database with same CATH topology
 4LPB A;  1H7U A;  3RLP A;  5M4P A;  1GJV A;  1ZXM A;  2YE9 A;  5CTW A;  1UYG A;  1Y8N A;  2YEF A;  1U0Z A;  2YKJ A;  3TZ5 A;  2CGF A;  3A0X A;  4DZY A;  2BTZ A;  2HCH A;  1US7 A;  5M4E A;  2QG0 A;  3LPS A;  2CCU A;  4EEH A;  1UY8 A;  2YKE A;  2JJC A;  5GGZ A;  3HZ1 A;  4XKO A;  1I58 A;  4QPK A;  2XX5 A;  3R4O A;  4MP7 A;  2WI3 A;  1UYH A;  1YT1 A;  1ZXN A;  2YJX A;  1IXM A;  3GIG B;  4GGL A;  2YE4 A;  3A0Y A;  3QTF A;  2QG2 A;  4KTN A;  1UYE A;  1R62 A;  3H4L A;  4YKW A;  2YE7 A;  3B24 A;  5JEN A;  2H8M A;  4B6C A;  2YKI A;  1Z59 A;  3TZ2 A;  1B63 A;  5M4H A;  3INW A;  2Q8G A;  4E72 A;  3HEK A;  1I5B A;  4AWP A;  2IWS A;  4JAS A;  1EA6 A;  2YE5 A;  4MPE A;  2XK2 A;  2BT0 A;  2VCI A;  1Z5A A;  4WUC A;  4CWP A;  4XKA A;  5CPH A;  4BQG A;  3C11 A;  1B3Q A;  2O1V A;  3BM9 A;  3FT8 A;  1L0O A;  3FT5 A;  2XDU A;  4BQJ A;  2FXS A;  3R4N A;  1BXD A;  1QYE A;  3Q5L A;  2FWY A;  3ZXO A;  1Y4S A;  2XHX A;  2YI5 A;  4EGI A;  5F5R A;  1AMW A;  4ASA A;  3OWB A;  1ZW9 A;  4PL9 A;  3WHA A;  4EGK A;  1EI1 A;  4CE2 A;  2BYI A;  4BIU A;  4YKQ A;  2XJJ A;  4R3M A;  3KE6 A;  3BMY A;  2FWZ A;  4R1F A;  4XIR A;  2CG9 A;  4LP0 A;  3ZXQ A;  2XDL A;  4HYM A;  3T0Z A;  1JM6 A;  5IDM A;  2XDX A;  2FTK A;  4CWN A;  1Z5C A;  2YED A;  4YKX A;  4KFG A;  4CWQ A;  1YC4 A;  1AH8 A;  1I5C A;  4XKK A;  3Q5K A;  2IWU A;  1UY7 A;  1PVG A;  2UWD A;  3C0E A;  3OPD A;  3H80 A;  2XX2 A;  3TUH A;  3S5T A;  3Q5J A;  4U93 A;  1UY9 A;  2YI7 A;  4ASF A;  2XHR A;  1UYK A;  4Q20 A;  4XD8 A;  3VHD A;  4MPC A;  2GFD A;  3VHC A;  3WQ9 A;  4YKZ A;  2YGA A;  5FND A;  4XCL A;  2YEE A;  1YET A;  3ZKD A;  4KSH A;  1AM1 A;  3ZKB A;  1TIL A;  2XJX A;  3DGE A;  5CTX A;  2QF6 A;  4KP4 A;  3T10 A;  3K97 A;  5D7C A;  1B62 A;  1QY8 A;  1U2O A;  2XCM A;  3RLQ A;  2O1W A;  2BU2 A;  4O05 A;  5L3J A;  4LWF A;  2C1G A;  4EM7 A;  3LMM A;  3TZ0 A;  4FCR A;  2AKP A;  4XE2 A;  2YE2 A;  1UYF A;  5D6Q A;  2YEA A;  1F51 A;  3RLR A;  2CCS A;  4KSG A;  3G7E A;  4LWE A;  1NHJ A;  3K98 A;  4PRV A;  2BYH A;  3GIF A;  4LWI A;  4E01 A;  4CWS A;  3U2D A;  1Y8P A;  3B26 A;  2ZBK B;  2BSM A;  4NH7 A;  4L8Z A;  3RKZ A;  4NH8 A;  1OSF A;  2XDK A;  2YEH A;  3T0H A;  4L93 A;  4GEE A;  1NHI A;  2YK2 A;  3CYG A;  5BOD A;  5M4K A;  1TC6 A;  3HYZ A;  4O09 A;  1UYL A;  1UYI A;  2QFO A;  4I3H A;  3GIG A;  1BYQ A;  1S14 A;  2Q8F A;  2YE8 A;  1ID0 A;  4GCZ A;  4MPN A;  3EKO A;  3PEJ A;  2XX4 A;  3INX A;  4XDM A;  3R92 A;  3B25 A;  4LWG A;  2BU7 A;  3OMU A;  1AJ6 A;  4W7T A;  4AS9 A;  4MB9 A;  2HKJ A;  1I5D A;  3T1K A;  2CCT A;  4AWO A;  3O0I A;  1TID A;  4WUB A;  3FV5 A;  4P7A A;  4CWT A;  4MP2 A;  1I59 A;  2K5B A;  2YEJ A;  4ZVI A;  4L90 A;  4XCJ A;  1TH8 A;  4JQL A;  4CE3 A;  3HZ5 A;  1BGQ A;  2Q8I A;  4FMT A;  4YKU A;  4ZKI A;  5FNC A;  5IDJ A;  2YEC A;  2C2A A;  2IOP A;  1A4H A;  2JKI A;  2YI0 A;  4HZ0 A;  2XAB A;  3R91 A;  4EMV A;  5J6A A;  1MU5 A;  3IED A;  1KIJ A;  2XDS A;  2ZDX A;  2PNR A;  3JZ3 A;  4CWO A;  3EHF A;  4BAE A;  3CGY A;  4EFU A;  4MOT A;  2WER A;  1AH6 A;  3TZ4 A;  1YT0 A;  2BRE A;  4JAV A;  4URO A;  3OW6 A;  4GT8 A;  1ZWH A;  5M4N A;  4QPJ A;  3B28 A;  4GFN A;  1YT2 A;  3CGZ A;  2BU8 A;  4CE1 A;  4K4O A;  3EKR A;  2WI4 A;  2YEI A;  1TC0 A;  2WI2 A;  3O2F A;  3D36 A;  4EFT A;  1YSR A;  3D2R A;  2XD6 A;  2BU5 A;  2YEB A;  4JAU A;  2YGE A;  2CH4 A;  4U7O A;  1UYC A;  1YER A;  2XHT A;  3EHG A;  4HYP A;  4NH9 A;  3A0R A;  4HZ5 A;  5CTU A;  3K99 A;  4YKR A;  1GKX A;  2YKB A;  4CWF A;  4B7P A;  1THN A;  1UYM A;  2VCJ A;  3CRK A;  3U67 A;  5J71 A;  1S16 A;  4PRX A;  4PU9 A;  4R3A A;  5FNF A;  5C93 A;  4HXW A;  1KZN A;  5F3K A;  1UY6 A;  2YKC A;  4L91 A;  4YKY A;  2H55 A;  1Z5B A;  3OWD A;  4FCQ A;  4U7N A;  4P8O A;  1MX0 A;  1Y8O A;  2IOQ A;  2GQP A;  2IWX A;  3B27 A;  3D0B A;  3O6O A;  3LNU A;  4LWH A;  4HY1 A;  3NMQ A;  1YSZ A;  4ASB A;  3QDD A;  5CF0 A;  2IOR A;  2YEG A;  3R4M A;  3T2S A;  1BKN A;  1YES A;  1QZR A;  4YKT A;  2YI6 A;  4WUD A;  4V25 A;  3A0T A;  2O1U A;  4MBC A;  4BXI A;  5D6P A;  2ESA A;  4CWR A;  4I5S A;  4FCP A;  2WI7 A;  4GQT A;  3G7B A;  4EGH A;  4URN A;  4XTJ A;  2HG1 A;  5FWK A;  1H7S A;  2WEQ A;  5IN9 A;  2VWC A;  3PEH A;  4XIQ A;  5CTY A;  4O07 A;  4BIZ A;  3CWV A;  3VAD A;  4H85 A;  1YC3 A;  2WI5 A;  4E00 A;  3ZM7 A;  3MNR P;  4X9L A;  4HY6 A;  4KQV A;  4L94 A;  2EXL A;  3HYY A;  3A0W A;  1Y4U A;  3HHU A;  4XIT A;  4V26 A;  3A0Z A;  3TTZ A;  4FPP A;  5D7D A;  5BOC A;  2YGF A;  4DUH A;  1YC1 A;  3R4P A;  4XIP A;  5M4M A;  2Q8H A;  2ZDY A;  4AWQ A;  3G75 A;  2BZ5 A;  2WEP A;  2E0A A;  3GIE A;  3CRL A;  5D7R A;  4ASG A;  2Q2E B;  4E02 A;  1YS3 A;  2HHI A;  2VW5 A;  3EHJ A;  3U2K A;  2WI1 A;  2YK9 A;  2WI6 A;  1UYD A;  1GKZ A;  2YE6 A;  4H7Q A;  4HXZ A;  3K60 A;  3EHH A;  2XJG A;  2YE3 A;  4URM A;  2ZKJ A;  1NHH A;  2FYP A;  4H81 A;  2YJW A;  3VHA A;  2BRC A;  4O04 A;  4XC0 A;  1TBW A;  2BU6 A;  4URL A;  2C1I A;  3SL2 A;  1I5A A;  4O0B A; 
#chains in the Genus database with same CATH homology
 4LPB A;  1H7U A;  3RLP A;  5M4P A;  1GJV A;  1ZXM A;  2YE9 A;  5CTW A;  1UYG A;  1Y8N A;  2YEF A;  1U0Z A;  2YKJ A;  3TZ5 A;  2CGF A;  3A0X A;  4DZY A;  2BTZ A;  2HCH A;  1US7 A;  5M4E A;  2QG0 A;  3LPS A;  2CCU A;  4EEH A;  1UY8 A;  2YKE A;  2JJC A;  5GGZ A;  3HZ1 A;  4XKO A;  1I58 A;  4QPK A;  2XX5 A;  3R4O A;  4MP7 A;  2WI3 A;  1UYH A;  1YT1 A;  1ZXN A;  2YJX A;  3GIG B;  4GGL A;  2YE4 A;  3A0Y A;  3QTF A;  2QG2 A;  4KTN A;  1UYE A;  1R62 A;  3H4L A;  4YKW A;  2YE7 A;  3B24 A;  2H8M A;  4B6C A;  2YKI A;  1Z59 A;  3TZ2 A;  1B63 A;  5M4H A;  3INW A;  2Q8G A;  3HEK A;  1I5B A;  4AWP A;  2IWS A;  4JAS A;  1EA6 A;  2YE5 A;  4MPE A;  2XK2 A;  2BT0 A;  2VCI A;  1Z5A A;  4WUC A;  4CWP A;  4XKA A;  5CPH A;  4BQG A;  3C11 A;  1B3Q A;  2O1V A;  3BM9 A;  3FT8 A;  1L0O A;  3FT5 A;  2XDU A;  4BQJ A;  2FXS A;  3R4N A;  1BXD A;  1QYE A;  3Q5L A;  2FWY A;  3ZXO A;  1Y4S A;  2XHX A;  2YI5 A;  4EGI A;  5F5R A;  1AMW A;  4ASA A;  3OWB A;  1ZW9 A;  4PL9 A;  3WHA A;  4EGK A;  1EI1 A;  4CE2 A;  2BYI A;  4BIU A;  4YKQ A;  2XJJ A;  4R3M A;  3KE6 A;  3BMY A;  2FWZ A;  4R1F A;  4XIR A;  2CG9 A;  4LP0 A;  3ZXQ A;  2XDL A;  4HYM A;  3T0Z A;  1JM6 A;  5IDM A;  2XDX A;  4CWN A;  1Z5C A;  2YED A;  4YKX A;  4KFG A;  4CWQ A;  1YC4 A;  1AH8 A;  1I5C A;  4XKK A;  3Q5K A;  2IWU A;  1UY7 A;  1PVG A;  2UWD A;  3C0E A;  3OPD A;  3H80 A;  2XX2 A;  3TUH A;  3Q5J A;  4U93 A;  1UY9 A;  2YI7 A;  4ASF A;  2XHR A;  1UYK A;  4Q20 A;  4XD8 A;  3VHD A;  4MPC A;  2GFD A;  3VHC A;  3WQ9 A;  4YKZ A;  2YGA A;  5FND A;  4XCL A;  2YEE A;  1YET A;  3ZKD A;  4KSH A;  1AM1 A;  3ZKB A;  1TIL A;  2XJX A;  3DGE A;  5CTX A;  2QF6 A;  4KP4 A;  3T10 A;  3K97 A;  5D7C A;  1B62 A;  1QY8 A;  1U2O A;  2XCM A;  3RLQ A;  2O1W A;  2BU2 A;  4O05 A;  5L3J A;  4LWF A;  4EM7 A;  3TZ0 A;  4FCR A;  2AKP A;  4XE2 A;  2YE2 A;  1UYF A;  5D6Q A;  2YEA A;  3RLR A;  2CCS A;  4KSG A;  3G7E A;  4LWE A;  1NHJ A;  3K98 A;  4PRV A;  2BYH A;  3GIF A;  4LWI A;  4E01 A;  4CWS A;  3U2D A;  1Y8P A;  3B26 A;  2ZBK B;  2BSM A;  4NH7 A;  4L8Z A;  3RKZ A;  4NH8 A;  1OSF A;  2XDK A;  2YEH A;  3T0H A;  4L93 A;  4GEE A;  1NHI A;  2YK2 A;  5BOD A;  5M4K A;  1TC6 A;  3HYZ A;  4O09 A;  1UYL A;  1UYI A;  2QFO A;  4I3H A;  3GIG A;  1BYQ A;  1S14 A;  2Q8F A;  2YE8 A;  1ID0 A;  4GCZ A;  4MPN A;  3EKO A;  3PEJ A;  2XX4 A;  3INX A;  4XDM A;  3R92 A;  3B25 A;  4LWG A;  2BU7 A;  3OMU A;  1AJ6 A;  4W7T A;  4AS9 A;  4MB9 A;  2HKJ A;  1I5D A;  3T1K A;  2CCT A;  4AWO A;  3O0I A;  1TID A;  4WUB A;  3FV5 A;  4P7A A;  4CWT A;  4MP2 A;  1I59 A;  2K5B A;  2YEJ A;  4ZVI A;  4L90 A;  4XCJ A;  1TH8 A;  4JQL A;  4CE3 A;  3HZ5 A;  1BGQ A;  2Q8I A;  4FMT A;  4YKU A;  4ZKI A;  5FNC A;  5IDJ A;  2YEC A;  2C2A A;  2IOP A;  1A4H A;  2JKI A;  2YI0 A;  4HZ0 A;  2XAB A;  3R91 A;  4EMV A;  5J6A A;  1MU5 A;  3IED A;  1KIJ A;  2XDS A;  2ZDX A;  2PNR A;  3JZ3 A;  4CWO A;  3EHF A;  4BAE A;  3CGY A;  4EFU A;  4MOT A;  2WER A;  1AH6 A;  3TZ4 A;  1YT0 A;  2BRE A;  4JAV A;  4URO A;  3OW6 A;  4GT8 A;  1ZWH A;  5M4N A;  4QPJ A;  3B28 A;  4GFN A;  1YT2 A;  3CGZ A;  2BU8 A;  4CE1 A;  4K4O A;  3EKR A;  2WI4 A;  2YEI A;  1TC0 A;  2WI2 A;  3O2F A;  3D36 A;  4EFT A;  1YSR A;  3D2R A;  2XD6 A;  2BU5 A;  2YEB A;  4JAU A;  2YGE A;  2CH4 A;  4U7O A;  1UYC A;  1YER A;  2XHT A;  3EHG A;  4HYP A;  4NH9 A;  3A0R A;  4HZ5 A;  5CTU A;  3K99 A;  4YKR A;  1GKX A;  2YKB A;  4CWF A;  4B7P A;  1THN A;  1UYM A;  2VCJ A;  3CRK A;  3U67 A;  5J71 A;  1S16 A;  4PRX A;  4PU9 A;  4R3A A;  5FNF A;  5C93 A;  4HXW A;  1KZN A;  5F3K A;  1UY6 A;  2YKC A;  4L91 A;  4YKY A;  2H55 A;  1Z5B A;  3OWD A;  4FCQ A;  4U7N A;  4P8O A;  1MX0 A;  1Y8O A;  2IOQ A;  2GQP A;  2IWX A;  3B27 A;  3D0B A;  3O6O A;  3LNU A;  4LWH A;  4HY1 A;  3NMQ A;  1YSZ A;  4ASB A;  3QDD A;  5CF0 A;  2IOR A;  2YEG A;  3R4M A;  3T2S A;  1BKN A;  1YES A;  1QZR A;  4YKT A;  2YI6 A;  4WUD A;  4V25 A;  3A0T A;  2O1U A;  4MBC A;  4BXI A;  5D6P A;  2ESA A;  4CWR A;  4I5S A;  4FCP A;  2WI7 A;  4GQT A;  3G7B A;  4EGH A;  4URN A;  4XTJ A;  2HG1 A;  5FWK A;  1H7S A;  2WEQ A;  5IN9 A;  2VWC A;  3PEH A;  4XIQ A;  5CTY A;  4O07 A;  4BIZ A;  3CWV A;  3VAD A;  4H85 A;  1YC3 A;  2WI5 A;  4E00 A;  3ZM7 A;  3MNR P;  4X9L A;  4HY6 A;  4KQV A;  4L94 A;  2EXL A;  3HYY A;  3A0W A;  1Y4U A;  3HHU A;  4XIT A;  4V26 A;  3A0Z A;  3TTZ A;  4FPP A;  5D7D A;  5BOC A;  2YGF A;  4DUH A;  1YC1 A;  3R4P A;  4XIP A;  5M4M A;  2Q8H A;  2ZDY A;  4AWQ A;  3G75 A;  2BZ5 A;  2WEP A;  2E0A A;  3GIE A;  3CRL A;  5D7R A;  4ASG A;  2Q2E B;  4E02 A;  1YS3 A;  2VW5 A;  3EHJ A;  3U2K A;  2WI1 A;  2YK9 A;  2WI6 A;  1UYD A;  1GKZ A;  2YE6 A;  4H7Q A;  4HXZ A;  3K60 A;  3EHH A;  2XJG A;  2YE3 A;  4URM A;  2ZKJ A;  1NHH A;  2FYP A;  4H81 A;  2YJW A;  3VHA A;  2BRC A;  4O04 A;  4XC0 A;  1TBW A;  2BU6 A;  4URL A;  3SL2 A;  1I5A A;  4O0B A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...