1I5EA

Crystal structure of bacillus caldolyticus uracil phosphoribosyltransferase with bound ump
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
208
structure length
208
Chain Sequence
b'GKVYVFDHPLIQHKLTYIRDKNTGTKEFRELVDEVATLMAFEITRDLPLEEVEIETPVSKARAKVIAGKKLGVIPILRAGIGMVDGILKLIPAAKVGHIGLYRDPQTLKPVEYYVKLPSDVEERDFIIVDPMLATGGSAVAAIDALKKRGAKSIKFMCLIAAPEGVKAVETAHPDVDIYIAALDERLNDHGYIVPGLGDAGDRLFGTK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords URACIL PHOSPHORIBOSYLTRANSFERASE
publication title Structure of product-bound Bacillus caldolyticus uracil phosphoribosyltransferase confirms ordered sequential substrate binding.
pubmed doi rcsb
source organism Bacillus caldolyticus
molecule tags Transferase
total genus 51
structure length 208
sequence length 208
chains with identical sequence B
ec nomenclature ec 2.4.2.9: Uracil phosphoribosyltransferase.
pdb deposition date 2001-02-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF14681 UPRTase Uracil phosphoribosyltransferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2020 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1i5eA00
4RHXA 1BD4A 1DKRA 1OPRA 3DEZA 1XZNA 2WNSA 1G2PA 1ECCA 1I13A 5KAPA 5HIAA 4RABA 1JLSA 4RHUA 1P4AA 1HMPA 4P83A 2GEBA 1A3CA 1UPFA 5E38A 1U9ZA 4LZOA 1LH0A 1G9TA 1I5EA 4IJQA 1TC1A 2EHJA 2H08A 3DAHA 3ACBA 3MJDA 3N2LA 4RAQA 1MZVA 1QK5A 2C4KA 1A97A 4MB6A 1XZ8A 4LZNA 1QB8A 2PS1A 1NONA 1ECJA 1O5OA 1A98A 4WMLA 1G2QA 5K51A 4RAOA 1ZN7A 1A95A 2IGBA 4RACA 1G9SA 1I14A 3O7MA 4LYYA 2H07A 3M3HA 4QYIA 2YZKA 3MBIA 3EFHA 4ZFNA 4JITA 4FYMA 4OHCA 2HCRA 3OHPA 1VDMA 4M0KA 1A96A 2JKYA 1VSTA 3HVUA 3QW4B 4RQBA 1GPH1 4P3KA 1STOA 1FSGA 3NAGA 1I0LA 4WN3A 4M0UA 1HGXA 1XTUA 2JBHA 4P84A 1VCHA 1PZMA 1QK3A 1Y0BA 4RHTA 1ZN9A 1ECBA 1R3UA 1GRVA 4P80A 1U9YA 4RANA 2JI4A 5BRNA 1XTTA 1ECGA 1P18A 4S2UA 4X45A 1L1QA 1ZN8A 4Z1OA 2FXVA 3G6WA 1QCCA 4P82A 3OZFA 4QYIB 5ESXA 5IPFA 2AEEA 1IBSA 1TC2A 2XBUA 1Z7GA 2DY0A 1YFZA 1DBRA 1O57A 4P81A 4TWBA 1I0IA 3H83A 3GEPA 2JKZA 5BQPA 5BSKA 1BD3A 1D6NA 2H06A 3LRTA 1W30A 4RADA 4QRIA 2PRYA 4RV4A 1DKUA 4RHYA 1ECFA 1DQNA 4X44A 5HKLA 1P17A 1J7JA 1OREA 4LZAA 1QK4A 1A4XA 5KAMA 1AO0A 2VFAA 5BQOA 1QCDA 1L1RA 2P1ZA 1QB7A 4PFQA 1UFRA 3DMPA 1NULA 4PAWA 3S5JA 1JLRA 5ESWA 1V9SA 2PRZA 4JLSA 4P86A 3ACCA 5EUCA 4F8EA 3KB8A 1OROA 4LYGA 3LPNA 1XTVA 1CJBA 4KN6A 4RQAA 3GGJA 5IAOA 3ACDA 1BZYA 1WD5A 2E55A 4M0PA 5JSQA 1DQPA 3OZGA 3GGCA 5JV5A 1P19A 1UPUA
chains in the Genus database with same CATH superfamily
1E5TA 5EJ5A 3GGGA 1QP7A 5TQJA 821PA 4CIAA 1YJCA 3S2YA 3DYVA 1YACA 4EPTA 1QH1B 1GPAA 3W8RA 1J4AA 4Z0NA 5I47A 4J94A 2BR4A 3A9UA 5AO9A 3UHPA 1Y9EA 5NLLA 3VC1A 4GLOA 1V1JA 3Q72A 1T2FA 3QV1A 4G09A 2LRHA 4UHKA 3DB1A 1AC5A 4JR1A 1M3SA 1QE5A 1EJ2A 2VH1A 4OJQA 4O63O 2ZROA 3AJ8A 1OBVA 2AJLI 3RT9A 5JYDA 2HL6A 4Q47A 1AK1A 3PSAA 4PF1A 5M5BA 3WE7A 3DZJA 2WLSA 1D2HA 2RE8A 2QQ5A 2BFBA 4WZ6A 1PD1A 4NYJQ 2XE6A 1ECJA 3OPXA 2CL5A 2OO3A 3GCZA 5F9HA 1PZHA 3OCYA 4C2BA 4DLVA 4QQ8A 5FQNA 5KVQA 1AHIA 2AJDA 1QHFA 1HF3A 1GT91 1T9GR 1AZWA 2RGNC 4R8KA 5JISA 4TWZA 1OBFO 4FZ3A 2VDOB 3N2EA 2AEJA 2I2CA 3HA5A 4MW0A 3PF8A 1KO5A 3HYNA 3L8MA 1JL3A 3RBZA 3RRNA 4B40A 1IUKA 1UK6A 2I8LA 3AF6A 4YRBA 4MPPA 1CULC 2O20A 2PUCA 4FMDB 2I1WA 1W5AA 2B99A 1ZI8A 1CUJA 3NT5A 3PGKA 4P0TA 3EOAI 2J3HA 3VTAA 2ZI3A 2AZTA 2OGTA 3CMCO 1RJWA 3EDYA 4Q9DA 3C8MA 1CEYA 2X9GA 3I32A 3WSWA 4KYVA 2B0CA 3TB6A 5L3VA 4GR9A 1CUBA 1JZTA 5AUOB 1I2DA 4LJ4A 1E3LA 2LBPA 4REQB 2J08A 3FUXA 3M2TA 4I8XA 3RIHA 3A9TA 1YMQA 4FFWA 1E6CA 1GU0A 1ZUIA 2PUVA 3H8VA 4W6ZA 5J59A 4AECA 3BCUA 3RU3A 4CG0A 2Q6OA 1M0SA 2Y1XA 5DISB 4C4OA 4EPXA 3HPQA 3ETEA 1YGPA 5GJVC 3ESBA 1BIFA 2C3UA 3RT7A 1XRMA 2EBWA 3CX7A 3MD0A 5K2MA 4YQZA 3DE5X 3ZJVA 3FBTA 4JQCA 3VKGA 1FXSA 4B0OA 5IAJA 1KSJA 3R7LA 5EE1A 4AQDA 4PO8A 2IBTA 1EJ0A 2P2ZA 1U3GA 2DULA 3F4KA 2BEWB 2GAAA 2VO1A 5AK5A 3VNBA 4W5OA 3RSLA 1XQXA 2IE8A 4MQ5A 1CHDA 1VMAA 1T0UA 4DV2B 3WY9A 1U7XA 4LDZA 1TCCA 4M22A 3KUXA 4R84A 4OYRA 5COQA 1JE0A 1NJ6A 1NGSA 1QIIA 2GEJA 2Q9BA 3EGCA 4JP2A 4OQNA 2VDVE 4AS2A 2W11A 4JUIA 5REQA 1RMYA 5F7JA 3QK7A 4NIMA 4XH9B 5AWFC 1Y89A 3PE3A 5DKFA 3S5JA 5I4IA 3NHJA 1XZDA 4MTLA 2HMTA 1DXQA 4G8DA 2BE7A 1XZFA 2R66A 3H87A 3PHIA 1H4TA 4ND6A 1K7EB 2PRZA 5EEHA 5FHQA 1GM5A 5ARDA 2D06A 3A1VA 1W1WA 4ZVNA 4PWZA 1SA0A 2EWMA 2OHXA 5A1JA 1YKGA 4XOUA 4JJ6A 2W2LA 2C9YA 1SRQA 3ANTA 4A8JC 1V16B 2D5CA 3T3GA 2QPTA 1T5DX 3BA6A 4C01A 3PK0A 1YI1A 5E4TA 5JEDA 3ICEA 4LWOA 2G6TA 4DCNA 1EG2A 1GUZA 2EGUA 2ZYSA 3Q6NA 3VPFA 2W8BA 3IKJA 1OPRA 1O54A 3A37A 5K3AA 3TKLA 3SR3A 4HJXA 3C0KA 3IRUA 3HHPA 1A2KC 2V65A 1G7SA 1TQ6A 2B8JA 4FNMA 4C7VA 1QYRA 3T1HB 3B9RA 2EZUA 2QQ0A 4ZU6X 3ZDAA 2A57A 3DG9A 4HUQB 1Z5NA 3PUKA 1KETA 2CXXA 4CLOA 1C4OA 1EXNA 3KP1A 2WJYA 1FDVA 2QZ4A 4OK5A 4JN6B 4YPOA 4X8OA 1VMKA 3QTTA 1VP3A 1XBTA 3CG0A 3DKVA 1C3LA 4W9RA 3OM8A 5LMCA 2DERA 1P31A 2FLWA 2R9VA 2P5TB 3GI1A 1B8NA 1AX9A 1LBHA 3IIEA 3M4JA 1U3UA 3A58B 4OGKA 5IASA 1QGED 1MV8A 2EDCA 4RF5A 4W5JA 2VNJA 1CQIB 3M6FA 5SYMA 4RPKA 2W43A 1PKXA 1BU5A 1VPEA 3BM5A 3IJEB 4TM7A 2G17A 4JJGA 1SB9A 3MINB 3ORSA 3PPVA 4X1IA 5DMHA 3VI4B 1A5SB 3ZPXA 5CFNA 1JMYA 3FTNA 2YZKA 3MT9A 5GAJA 3W5HA 5B3LA 4L02A 1C7IA 1WP4A 1XTSA 1Z0DA 2YC4C 4HGYA 1Z0AA 2IEAA 1R5JA 4DZTA 1LSOA 2Y3IA 4BNUA 5EIWA 3ST7A 5BPFA 4HNAB 3T1OA 1I2BA 2QRZA 3NT2A 4IR7A 2VZEA 2P27A 3HXKA 1QAOA 4ZICA 1XRQA 3EK2A 2K5UA 4ETNA 4HTFB 4RTPA 4YRCA 3OQNA 3EGVA 2VYVD 2O1EA 3TIFA 1SOMA 2NLOA 3BRQA 2CSXA 3CX8A 2JBWA 3HJFA 1G8KA 1YVDA 3QXSA 3W1WA 5BOSB 4MEAA 1L1QA 5I3CA 3PYMA 1Z6PA 3M1IA 2WU8A 2PWZA 3IUNA 5E0KB 3IIMA 4KRXA 1QKKA 1XMXA 2TMDA 4PAGA 3H2SA 3OE1A 4NI5A 2G0NA 1COZA 1EZZA 5E9AA 5FYQA 5JJBA 4NABA 3QFTA 3DUFA 1Z6GA 5A0VA 4C6TA 3MFQA 3HCBA 2BGKA 3RUEA 3BGVA 5L45A 3PTZA 3LZCA 1Y6JA 3LRTA 4GSLA 5FLKA 2FPMA 1GTRA 4DLXA 1QLHA 3EAQA 3V00A 1LPPA 3MS4A 3PDIA 2WU3A 1M0WA 3H2JA 1M72A 1CY8A 2YQ4A 2ZRFA 2HWUA 4RMGA 5EP2A 5DSZA 3SQOA 1XU7A 3VSCA 5FWNA 2J0VA 1VKRA 3QVGA 1QVAA 5TEVA 2PGNA 2Q5IA 1MF7A 2OP0A 5D84A 1UIRA 1F2DA 3HBMA 4XLLA 4LMBA 3ZE2B 3L04A 4MPDA 4E30A 4RS4A 2BFDA 2XQGA 3D6TB 3E84A 4MRMB 3X44A 3AOEC 2CLOB 1ZD5A 2YRXA 3OE4A 4KIGA 5FPPA 4FXOA 5CXQA 1OZAA 3PX3A 4MUFA 2P90A 5CFRA 3E27A 3ZGVA 9ATCA 2AMFA 4JLSA 4FGLA 4YHBA 3F6YA 1FDRA 1I24A 1UQTA 3JATB 4COKA 1CJBA 1KVQA 4BMPB 3TIXB 1YS9A 5FP0A 1MJHA 3P9NA 5FKJA 3MWGA 1DAHA 4L74A 4HN2A 4DJTA 2W37A 2NTNA 3SDSA 1TZJA 1N0WA 4AIIA 2C98A 3IUQA 1E61A 1TNDA 1KK1A 1I3OA 1DC6A 2AMYA 3DJYA 4M99A 1WBJB 4NHEA 5ILGA 5PGMA 4RD0A 1IL0A 1P9LA 1GTJ1 1ZH4A 1JH8A 4ZA2A 3EWSA 4UNSA 1W5SA 3E9CA 1D6MA 3IBCA 1XTQA 4UCFA 1CY6A 1NHGA 2NT4A 2WYWA 4OFZA 4DXHA 5TMPA 1VJ0A 3D54D 3QRWA 4ENSA 1FA9A 3DVSX 2VCYA 4K0RA 4ARUA 3DWEX 2I66A 2J31A 2REOA 2VJYA 2E2WA 2R86A 4GC9A 1CJSA 3GA5A 3TMKA 4C14A 1LLFA 2HB6A 1X3LA 2BJHA 3VSBA 3EH1A 2D54A 4L16A 3BKXA 3DFKA 1XTJA 3LG2A 5I8WA 1EIZA 1N4AA 1DMSA 2QZZA 3F3KA 3KUKA 3WL7A 3E7PA 4MS1B 4BQRA 4X8HA 1AGNA 3A4IA 3KZOA 4FS3A 4L6IA 4UXJA 1PBTA 1P0PA 3I5MA 4U7GA 5FD8A 3O75A 4G0WA 3BE5A 1Z0JA 2GBGA 2WFLA 3UAGA 3O8CA 2JGEA 1XCLA 2B5OA 1JXMA 3AFHA 3MJVA 4CETA 5GZ3A 4HWSA 2WMNB 3QNUA 1SD5A 2VWPA 2A9QA 3IVCA 3ZJ5A 3LI2A 5FCDA 3VR6H 5J47A 3ND7A 3K6KA 4E4TA 4NOJA 2JKYA 1SVUA 3CNLA 1ULSA 1ZPDA 3PDWA 5ISMA 4L5JA 2V7WA 1BTOA 1N7IA 1KR5A 5DXJA 2J4CA 3PRJA 3T35A 4F2PA 3WJAA 4DR4B 1Y81A 4DDUA 3TSZA 3ZDQA 3ASVA 4MUXA 3W4KA 1ORDA 3GJSA 1GYRA 3NBYC 3E9RA 1YJXA 3LNTA 4HZGA 2UUBB 1GKYA 3JQAA 4BN4A 4IINA 3R76A 1JDUA 3G9QA 3ZK8A 1XIVA 3VR4D 4B4UA 7AT1A 1L4GA 2ZYRA 1LBSA 1PX2A 3IJRA 1PUJA 4MRNA 3PEUA 3KQOA 2C7GA 3CRMA 3H5AA 4D26A 3O0DA 2WHYA 3QIVA 1H22A 4FHDA 2XWJI 4MVJP 4A4DA 1JT2A 3DOIA 4EABA 1HQCA 3M6LA 2WI8A 2YOHA 3QXXA 3WIUA 4KO2S 4FBLA 1CZRA 5BWLA 2ODEA 1R4MA 4N4AA 2XH8A 3K0HA 3TZ6A 4FVTA 4IS2A 4LOKA 1DIHA 4M9ZA 1NVGA 3HC7A 4Y2QA 5NULA 4EHAA 3BFVA 4HK4A 2I6UA 5CK4A 1GLGA 5C5DA 1EVEA 1VGRA 2ZWAA 2QTZA 1NC1A 1JDSA 3EZGA 2C7VA 2R4QA 3NATA 3EARA 1Z82A 5EXDA 4Z4CA 1CRPA 1T25A 5EJIA 3L7MA 4H9GA 4PZPA 3G23A 1INLA 5ILQA 1R18A 1D0IA 3SZGA 2GEKA 1F17A 1VLZA 2X9NA 3MRTA 1EK2A 2O0JA 2QVZX 4LYEA 1DQSA 2H92A 1PAUA 3LWZA 3PQ3A 1L3BA 4RD6A 4RVUA 2CJWB 1NQVA 1ONBA 3AKDA 2IUTA 3BK2A 3QA3E 2HIGA 1NG1A 4HDRB 4US1R 1B1AA 5AXBA 1BHJA 1FSZA 3BGWA 1G55A 2G70A 3ZXUB 1Q0SA 1P5RA 4ZI2A 4QJ5A 1LBTA 3OZCA 4R2KA 2C4WA 4TRRA 2AG0A 2I4RA 2XMCA 3GBSA 3V4FA 3QPCA 3NBXX 1WD5A 1COWD 5FUMA 3PQFA 1POXA 1SU6A 4R81A 1QHYA 5DOZA 4D4GA 3GRUA 4R54A 3RUAA 4BZZA 3H4IA 2Z8ZA 2OZPA 5BV2P 4O4JF 4GWGA 5IKMA 1LWNA 3DZKA 5FTWA 3WZ2A 1RHKA 1NRIA 1YB6A 2LIPA 3O4VA 4GOND 1AE1A 3DAOA 3WWCA 1RQLA 2IA5A 3DXFA 4U7JA 1A69A 4E7PA 4X7MA 3U4GA 2GO7A 1M6WA 2Y66A 3AFMA 4TWJA 4URFA 5DH9A 5A9SA 3AGPA 4S24A 4G07A 1I5OA 3AV3A 4RIGA 4MVJE 5K0FA 2YY5A 1N7GA 3GEBA 2H4FA 4TLDA 5AP9A 2A58A 1PFWA 4EAAA 4TL9A 1LNZA 1VSUA 3S8YA 1WUTA 3I2IA 3QLUC 2NIPA 2G09A 4FFSA 4BNFA 2GEVA 5BN3A 1C30B 1K8YB 3RT1A 2I54A 4BO7A 2ZZMA 3VOAA 1RM5A 1JAZA 4II2A 1CLEA 2O2IA 4LHEA 1BXKA 1QANA 1WPXA 2DX7A 3EBLA 5LLSA 4Q39A 4V1CI 1OD6A 1DCKA 2DVMA 1WDLA 1YQUA 2H57A 1FDIA 1KMMA 2Y27A 4FIDA 4LIPD 4M0FA 1DRUA 1H66A 4ZO8A 5ALMA 3Q88A 1RR6A 5IZCC 1AJEA 4R71A 3TBKA 1Z12A 2KBEA 2C59A 3EEFA 3RF6A 1NF8A 2AHRA 2H9AA 3L49A 1ZMRA 4NHOA 1Y1QA 2I7VA 2Z58A 3G5LA 4LRTB 4EF6A 1U2DA 3X2SA 2RGRA 4D74A 1C9DB 1I1OA 4M88A 4PCUA 4JJ8A 1FRQA 5AKYA 5LNK1 4PG4A 4F71A 4DB4A 4J6EA 5B3AA 3TUIC 1YOBA 1D1SA 1R0XA 2EG5A 3IAHA 3LPLA 4PX2A 5FBHA 4ZVSA 3VPHA 4EVQA 2RHMA 1RBYA 4OSEA 1V2GA 3FYTA 4AZ0B 2DBRA 2EQBA 4GQAA 5KNCD 4B6OA 2OY0A 4D5EA 1QORA 3K2BA 3TQQA 3ORQA 5COAA 3FHCB 2JGRA 1GTMA 1P77A 3D3NA 3L6RA 4P9NA 5ALRA 1NMQA 1VP9A 2YJZA 2QGNA 2H0AA 1GPJA 1USIA 3EXFA 1YFZA 4MWOA 1DJLA 3FETA 4A6PA 2NX2A 4BFWA 2ZTMA 4H0NA 4GP9A 5FO1A 3UPTA 4C7MA 3PXEA 1M74A 1VYHA 1X7YA 2VTBB 2GK7A 4QFBA 2ZIWB 1JIKA 1YFLA 1RQ2A 1K66A 2Z30A 3G2NA 4RL4A 4Q4CA 3OESA 1J70A 2OO5C 2R11A 1OKKD 1QK4A 3HP4A 5KC9A 3EF0A 2JATA 4B8WA 1S2IA 2VK4A 3LGAA 3GD5A 3I8SA 3B13B 4AO7A 3DS8A 1XP5A 4GIBA 5EFZA 4ILEA 5LXTB 3SY8A 3LXMA 2D13A 4Y0NA 4PRLA 4GICA 4QG7A 2AFIE 2HU8A 1KIFA 4RDIA 3QUAA 4CCSA 1GG8A 1G5FA 2DXIA 1KPIA 3ECSA 4RUKA 3OFNA 1EX1A 1MB3A 4R68A 3FOCA 3PQ4A 5HF9A 3ACCA 4PC7A 3QVKA 4O4JA 1K97A 4IDCA 4MGHA 6REQA 4E03A 1FMCA 4RPLA 2N0SA 1T8YA 5T6MA 5DNWA 4BXOB 4GX0A 1YS1X 4HG2A 3W0LB 2B25A 3IKMB 3RHFA 5H4GA 5IAOA 5IG2A 1AHNA 3EGOA 4H4EA 2ZI9A 3C3WA 3KWLA 3N2KA 1Z4OA 4R7TA 2DQ4A 3BTVA 3Q41A 3RVJA 2JI6A 3B9QA 2Y2UA 3CH4B 4LJSA 3TCNA 3V1MA 3BORA 1TRHA 4NONA 4C3UA 3ZQKA 4AY2A 1RADA 2V9ZA 3ES9A 2XSZA 4YB8A 3FOWA 1AN9A 3NKVA 3K15A 3UTDA 3DZBA 2FSPA 3UWDA 3MMZA 2GLXA 4TLMB 3SHTA 2AFVA 3LQYA 2JFBA 3H17A 4YALA 2VOJA 5AW8A 1FDOA 2KJQA 1S8OA 4TSKA 4FUQA 4M0CA 1SXHA 2VUIB 2M6SA 1K8XB 3NBAA 3NI2A 4WZAA 4GKVA 4KUEA 2PV0A 5AICA 4UAVA 4BJ3A 2JD1A 1SBIA 3KHUA 4XCXA 5JFOA 3SYRA 2X42A 2HCFA 4L1KA 2C4KA 2GPSA 4RK1A 2Z2KA 5KSPA 2HHLA 1E9FA 3WLIA 2BKXA 2ZS9A 4LVCA 1VLLA 2ETXA 1KI1A 1EUDA 2Q5JA 2QS9A 2A9PA 4HCJA 4K6CA 1WJGA 5DTRA 5MN5A 4OL9A 1ONSA 1OGYA 4JUDX 2V9CA 2XHZA 1NQWA 2XRMA 2G3YA 4ALJA 5EG5A 3MEQA 3JWPA 1ZGBA 4WXHA 3PIDA 4LK3A 3WQQA 2M2IA 1QU2A 3FX2A 3N0XA 4HUJA 2G9ZA 1KMNA 3UAXA 1SIUA 4HADA 5DPMA 4ZPXA 3MPUA 1YUMA 4FCTA 2POQX 2YXLA 4QHTA 2QJRA 4QAJA 3C43A 1H3NA 2J85A 2P3OA 1ULTA 3F2IA 5J5VA 3CRZA 3Q0EA 2O2CA 5BV8A 1L5HB 4QFMA 1CCWA 5TVGA 4LZLA 2UVDA 1TK3A 4ZT6A 3A27A 3MMXA 1A4RA 3DTYA 4EI2A 1Z0FA 3T4EA 1AA9A 1V1MA 2BM9A 4A73A 5F23A 1GG2A 1V48A 1WSDA 1C3XA 1ZJ5A 3IAM6 2OCDA 3Q6IA 4H7KA 3WLAA 5I4KA 1SB8A 5IH7A 2QLBA 5BSHA 2ZR8A 2NXWA 4HAZA 3BZWA 4Q1EA 1M34E 4J1TC 1TK9A 5KVSA 4BE9A 1AKEA 1MNQA 4D0LB 2ZSAA 2NZUG 5CR9A 3L7NA 1U3VA 3V4ZA 4F5DA 3PFHA 2BFOA 5ADUS 2DR2A 4BLOA 5PNTA 4E08A 1W6RA 1RKQA 3K1YA 2ZU6A 4WEOA 2CGEA 2QJTA 1WVMA 4JC4A 4Q3OA 1U0FA 2I9KA 1HRKA 3D3QA 2I78A 2QM3A 3NGXA 3WQSB 4PG8A 4CXMA 4S1NA 4CKWB 4E5VA 5JAUA 3K6SB 2IPNA 4UCWA 4WASA 3S1LA 1XELA 1E92A 3L84A 4L2IB 1UDAA 2HRRA 3I5UA 3WGKA 1J1IA 3W34A 4QU5A 4Q66C 1JLKA 2DCUA 4MKZA 3QELB 4C4PA 2QAGB 4JX8A 5JAMA 4Y6OA 1S89A 2G71A 3UK0A 3N3AC 5F1OA 1IHDA 2I99A 3QEJA 2C9BA 3UAZA 2WWXA 4R3NA 3GC6A 3WAGA 4KR9A 4BX2A 1FE8A 3A2LA 1X80A 3BH6A 4QTZA 2WPNA 1U0NA 4TQAA 7MDHA 4IG4A 4UMDA 4W8HA 5EE3A 3G02A 2WWGA 1ZK0A 4EQ6A 1KEPA 1QX3A 1U7PA 2A9VA 5YASA 1RD4A 3KWJA 1KEUA 4MVXA 1NN0A 1QZZA 1WXQA 4L5IA 5AMXA 4LGYA 4DLPA 3PEYA 2VF2A 1E4EB 4HAUA 4JJIA 4A2WA 5BNFA 4RY9A 2EBFX 5BR4A 3UENA 1YAHA 4YLYA 2H48A 2DETA 2JG3A 5IM4F 2WJPA 2A92A 3I3SR 2W6QA 4PANA 3QVUA 2ZT6A 3K92A 1BE6A 1S2OA 1UBFA 2BFNA 1XE3A 2PCJA 1QYXA 2RGAA 1YBVA 3EAFA 3O84A 3OZVA 1R16A 2FPPB 3M4YA 1B0AA 4NPHA 4RD1A 3E7XA 4P31A 2GHQA 2ZR7A 2V6GA 4QUHA 5H7XA 4PG6A 4R6WA 3R5FA 3RIEA 4FGUA 4MMZB 1GJRA 1XXHE 1Z33A 2RARA 3KVRA 4DMGA 4HDMA 1OU0A 4KE8A 4GOOD 1KDTA 4QDJA 1ZY2A 4NTZA 3L6DA 1REQA 3NTOA 4DXDA 3DZHA 4IIEA 2WHRA 4IKOA 3ZWWA 2ZE6A 4L28A 3OEHD 1BH6A 4QUJA 1OWNA 1SFRA 1XTZA 4KJXA 4URVR 4CTKA 5I9LA 4RAOA 3TR6A 1ZN7A 2IYRA 3PC2A 4FMDF 2AN5A 4G0XA 5HZHA 1Y4SA 3LT4A 3LV8A 4KFTA 4BO2A 1NW4A 2P9GA 1ZSNA 4KWTA 4ZAZA 3ZGZA 2B3DA 5KJCA 1UDRA 2JAQA 1DRJA 3SWWA 2PX6A 1II8B 3ZYZA 3E7WA 1AKUA 4A8PA 5IBQA 3E4DA 3T9AA 1AKNA 1GUFA 3BIJA 3ANMA 1YZFA 3JPWA 1Z0KA 3WMEA 5CLGA 2OGZA 2J1LA 3EC7A 4LGMA 3ZVRA 2ONCA 4ON9A 4KP7A 1EM8A 4B3HA 4F06A 1XRSB 2Y77A 4P3YA 2CLFB 3L7LA 3ETCA 3A11A 3K8QA 3O2SB 2DM6A 2LDXA 2WTMA 4EATA 3WAJA 3NTQA 3PPIA 1X42A 4W9MC 4Q3EA 4RJLA 3HB5X 4MUMA 3UTCA 1KJZA 3COYA 3WGJA 1V26A 3WISA 3ZDBA 1CWUA 5ALQA 3JQ9C 2DC1A 3G2PA 2QVBA 4D44A 3CNOA 4FPXA 3WDMA 5I7FA 3VHQA 1G6Q1 2G0TA 2NU9A 4UM5A 3GJ8A 1EFHA 4XZ3A 3TLKA 1B2LA 1UMDA 2FPUA 2GXUA 2J87A 2H59A 3ZVLA 4KITB 1E79A 1SCKA 2ODTX 4O0LA 1JBEA 1K68A 2J9YB 5DT2A 1XD8A 3AC0A 3T5TA 3FGNA 2ORWA 2QUAA 4GXNA 3ZEAA 3SR4A 1SOAA 4FQ7A 1PR6A 2IOYA 4AJNA 2HA3A 5H8WA 1Y8QA 2ZE7A 3ICVA 1NIJA 1PWHA 3W5JA 3ZIUA 2CLKB 4F4HA 2J6CA 2WTAA 2EERA 1JS1X 4RD2A 4YMIA 3D43A 3QFFA 3AJDA 3N9IA 2SCUA 4IVPA 1ZL2A 2Z04A 3U7IA 4L8GA 4QUGA 4XD7D 1O0SA 1Z8NA 3R0QA 4MI6A 3V55A 3A3OA 2TS1A 1R7RA 2C4MA 2E5FA 5IVIA 4CM5A 1N3YA 3WRXC 3ICCA 2OQVA 3SBXA 1E2UA 1A8UA 5EJFA 4LN1A 1QH1A 1NY6A 1LS6A 2YJ3A 1GFZA 3CRQA 5KSOA 1YQDA 2FRDA 4GL4A 2G1PA 3STTA 3DFUA 5IM4A 1OX6A 4P38A 2GPNA 3WNDA 1C14A 3BWYA 4DG9A 2XNHA 3FF1A 2HK7A 4KE6A 5DB4A 4UW9A 3DCJA 2A0UA 2GETA 1IEXA 5LFAA 3T34A 1V4BA 3PSHA 5KKAA 4Z3DA 2C5LA 4DIEA 1IY9A 1MCZA 3LXXA 4NARA 3HACA 2F43B 1GV1A 1IATA 3IAEA 4LOIA 3KKMA 3LX6A 3OQOA 2YXPX 3AZQA 4QGGA 1FFEA 4MEBA 3T5BA 1WA5A 2B94A 2CDCA 3UJBA 4MWBA 4ES6A 4F7WA 3AO0B 3Q5DA 5H5JA 4WLFA 2Q46A 1PVOA 4HL6A 3IV9A 1KSGA 1JZQA 3VPBA 3PWSA 4FT2A 4A26A 3EZ7A 2ICAA 4C0LA 1W36D 1QONA 1N7HA 4E2XA 4HNTA 3RSHA 1YA8A 4M9CA 1M6YA 4XLTA 4A0FA 2AX3A 1N3LA 2ZUFA 4MQ4A 3B6EA 1MOQA 3GZNB 1QVVA 2F4NA 2XGSA 2ZJ8A 2WF8A 4H35A 1ZUNB 4K9KA 3Q9LA 2W2VA 4MUGA 4Q02A 2E18A 5BR1A 4MI1A 3H86A 1QDUA 4K8RB 1WEKA 3DAHA 3VUEA 1JTEA 2VXOA 2HMVA 3KKKA 3RTGA 4TKMA 4KPUB 1NA5A 3QY0A 4OYLA 3RWOA 3FDFA 4EDFA 2R97A 2B4QA 5KTSA 1FNNA 1OZ0A 1ELOA 1PT6A 3P96A 4FZRA 5G3ZA 3ZI7A 5MGNA 3BMXA 2V8BA 3W6UA 1UPXA 4KX5A 4YC7A 4BLTA 1TLLA 2JFOA 3AUSA 4REQA 2F00A 1Y3FE 1U1IA 4ZMBA 5TY0A 3VZPA 4S1VA 4IDOA 3ZJTA 4OCZA 3D4LA 1CSEE 3JD1A 1LDBA 3PEFA 1GY8A 3JVIA 4O08A 5FR2A 4M49A 3UMGA 2IH2A 1UWCA 2JI8A 2VTEA 4REMA 3MYRA 3QOWA 1FSGA 3R77A 2PUJA 3BVPA 3CLKA 5GONB 1JEDA 1U4NA 3QNWA 3ROPA 4ZAGA 2DP4E 4NPAA 4EG3A 2GCNA 3TDMA 3BWEA 1BW9B 1IEQA 2BEWA 1GNLA 2P11A 4IOJA 1ECGA 2JRCA 4PLCA 3S1SA 3K35A 1EXWA 1QCCA 2G1KA 1Q1EA 2F8MA 3DFIA 3MPOA 4FZJA 1GAWA 1IVNA 1J8FA 1PR3A 4AS3A 4IF4A 1RYNA 2FMXA 2H7CA 3JRNA 1OJLA 5C3MA 1YTUA 4DLSA 1KU0A 2XJ9A 2R0QC 5IT9A 2OV4A 4OI1A 5HUHA 3QU9A 4LMPA 5DM0A 2BKLA 2A86A 5HE9A 4P33A 1AKMA 3NYRA 1JLHA 1LEHA 3AOGA 2ZCUA 1JXAA 4PN3A 3GAMA 5DWQA 4CU5A 3U26A 2AL7A 3VDNB 4BX0A 4US0R 5AVYA 2HFKA 2IHUA 2Y92A 1V16A 3I5AA 4UTXA 3UAOA 5JZMA 4Q00A 1FPQA 1LBEA 2VHWA 5E95A 3QBVA 2FX2A 1KFCB 1QBGA 1ULZA 2VFAA 2RHLA 3HB1A 2WFMA 5G1NA 3VOSA 1M8FA 4LQCA 4DDKA 1EMDA 3RASA 5L3SA 1W88B 1FFHA 2W2PA 2I3DA 3WKBA 1W94A 5LQCA 3DOJA 3FYCA 1JLRA 4Z2AA 1QH8A 3GUCA 4XXHA 3RGWS 5KOIA 3U7QB 4DIBA 1JWAB 1X7WB 1Y9DA 5BQ5A 3BXEA 4KTVE 1ZC4A 2FKAA 3ORHA 2IUUA 2RH5A 4CQLB 2OWDA 2DWQA 2YC2C 2M98A 1VLHA 4INAA 3PGA1 4M53A 5DX8A 5TVKA 3R7BA 1ONNA 2HD4A 4G5QA 4J16A 3LYUA 4RHEA 3OOHA 4U9HS 4ARVA 2VSFA 3GBPA 4XFDA 1KTVA 3RC8A 2WILA 3TD9A 1WKVA 2DJIA 3PRHA 3V9PA 1VJCA 1P8AA 2HV9A 3FPSA 1MFPA 5F5NA 3OZXA 4JP1A 2FSHA 5LJLA 3W6PA 1CQIA 1UODA 1CZLA 5DDIP 1XXLA 3NTRA 3EQ2A 3ETHA 1YVRA 1PV2A 3MINA 1I51A 4XE5A 4QHSA 3IP8A 2VYVA 3BSWA 3LY9A 3T3OA 2PK3A 4BN5A 2WP0A 3O93A 3TFOA 2OCYC 1VE7A 3HXTA 4E5DA 1NOJA 2BGNA 3DBHB 4G26A 3RFTA 5K6AA 4N0QA 2WABA 2QUIA 1ZC3A 3K6RA 3GR6A 3P52A 4WCFC 4WOJA 3N2LA 4Z8YA 2R8EA 3RHSA 3W9SA 3CVWA 5JDIA 4I1UA 1IZYA 1RHMA 4HTFA 4I3HA 1CF4A 2Z1DA 3QOXA 3VC2A 5BYKA 1R0YA 2VAXA 3N2NA 1JQKA 4BRZA 3AEUB 1EI9A 5BOSA 4KSBA 1NRWA 1HY3A 2IYYA 4U7TB 4WXRA 2JNWA 3GJ4A 2YJGA 3PHJA 5EZYB 3RC7A 3CRVA 4D43A 1VGQA 3KOOA 4KNVA 1IE3A 1O4WA 4TLLB 4MYTA 5HKBA 2EVWX 4TXMA 1XQ6A 4QPCA 2Z3WA 1RLJA 1QAQA 1NDHA 3RK0A 1EUCB 1H1TA 1Z5WA 3KYCB 2ZB8A 4TQUS 3QVJA 3SM3A 3UEOA 3W3AH 3QLVC 3T7EA 2NPFA 1F12A 3VJKA 1DKPA 3W1VA 1N7JA 2I2BA 1TLFA 2ZJ5A 1M2EA 4UTVA 5IN4A 4ZMSA 3GYGA 4BDTA 2PH3A 3PTLA 1TRKA 4J7UA 3UH1A 1D4OA 3DW1X 5K7SA 1ZGCA 1OTHA 3ENQA 4Q48A 1RI2A 1SQGA 2DQSA 1SUPA 2W9XA 3CRW1 3K9CA 4FJ1A 4DY4A 4D0SA 4BVBA 5GJCA 3WGQA 3EG5A 1JKFA 3PUIA 4QBIA 1NUSA 2GEFA 3D8NA 3ML1A 4U1RA 2UAGA 2YV1A 5I45A 4M60A 2ABWA 1XZQA 2P9JA 5K2OA 4MRMA 3AVWA 2DHRA 1SXIA 1SXJB 2XT9A 3I39X 1WOMA 4P7GA 3WKDA 1BX1A 3WFJA 3MWLA 2O6LA 1YO6A 3WYBA 3OOEA 3R7DA 3ZHUA 1ST2A 1FUEA 4PZ0A 4NMHA 5DGCA 3T9BA 4JVNA 1QP0A 1FW6A 2JVJA 1JQAA 3Q98A 5CLLA 3D3EA 1M6VB 1MC4A 1PKEA 3RR2A 3T95A 2WK1A 3JATA 5JG7A 4MW7A 2FMHA 3E03A 2XCUA 3WNQA 3MAJA 1U65A 2ZSEA 2IELA 1Q7EA 3D2BA 3GUVA 4WLEA 1IIRA 2IRWA 3MGGA 4ZOBA 2WW8A 3SEFA 1SXJD 3LVQE 5A5DA 4JVSB 2JZOA 5E8RA 4WQMA 5B2ZA 3GQBB 2CDBA 1N2GA 1X19A 1SXPA 5HZGA 1BMDA 3MMSA 4TYMA 1JLLB 2LGJA 2XOXA 2WAAA 3O21A 4H1HA 4R2IA 2P1ZA 4UNNA 3L7JA 3VJMA 4RH1A 3E2PA 1ZM7A 4QBHA 4RFLA 5KQSA 3T9CA 1JYFA 4MICA 5A4AA 1Y4ZA 4Q7MB 2O8VA 3VTZA 1BFDA 5B1EA 4X0EA 1YZGA 3RIMA 4AY5A 4Q6WA 3LIIA 3SSNA 1HTTA 1P9WA 4PHFA 1OROA 4UUAA 1CF9A 4GLFA 4DJJA 3OZSA 1YXMA 4OM8A 4HMOA 1XEAA 1A9QA 1ZONA 3SMVA 1E2IA 4BLPA 2ZRNA 3T4XA 3GRZA 3P0RA 2B2XA 1JVBA 3A8TA 1M6EX 2OGWA 4ZAYA 2ZB7A 1YRYE 2WZDA 3C1OA 1NP6A 3DHEA 1FMJA 4HB2A 4MS1A 5EQDA 4CM3A 1UJ4A 3V7FA 4G5SA 4R0VA 2ZRAA 2J3LA 4QTTB 1GUYA 2AZMA 2IHBA 2VTVA 5CXSA 4EO4A 1GUBA 2PE5A 1QRUA 4CKYA 3EH2A 1UOEA 2VBGA 3AM4A 2VHTA 4N12A 3AL2A 5A0FA 421PA 4E11A 4GBED 1Z6TA 2E49A 4OXKA 4ZT5A 3WJ2A 3B9PA 1TVKB 4PC3A 5EZQA 5AI8A 1EVKA 3Q0TA 1DHTA 2EX4A 3OEED 2GGSA 2AOXA 3VR4A 3CX6A 2Q8NA 2A9FA 4KN8A 4YMVA 3NGLA 5F1PA 2R48A 4QOGA 4Q1DA 1X13A 1KFKB 1JTFA 3VZBA 1F7UA 1FSSA 3TUJC 5ADVA 3T7KA 2D8AA 4G0NA 4KQGA 4YI5A 2PS1A 3A6EA 5F51A 3U4AA 2C2OA 3F49S 3UJAA 1RHQA 3IOYA 3KO8A 4YNBA 1NYRA 4OHXA 1QZ3A 3HP1A 4FE3A 5KYKA 4WK0B 1L5SA 4C2TA 2NV6A 1XX6A 2ZKIA 2XZDA 1JAXA 4M21A 3OZBA 4UFOA 2O07A 4EYOA 4EZEA 4MAMA 4DPLA 1B2RA 2Z56A 2O8FA 2QOEA 2VBIA 3QPUA 1KEWA 3BJZA 3CG4A 4NEGA 3H6HA 5JNVA 4WUVA 1RTKA 5JS1A 3HU3A 3RIXA 4NG4A 5TE9A 2JFXA 1E6UA 1J22A 1RBQA 5CLFA 1QFYA 1DFHA 1AHHA 2OV8A 3RWBA 3KR2A 4AURA 1NJSA 1FBNA 2PH5A 1W0JA 4J9UE 4JP8A 5DNAA 5JBNA 4TXJA 2AS0A 2Q41A 3OP1A 3UHJA 1WSWA 2YJ5A 1X1SA 3TUZC 3ZE9A 1NMEA 4DLWA 3RKUA 3A9WA 2AEEA 3OT4A 1RWOA 2FZLA 3CZMA 3M3PA 1COWA 2PH7A 2CEKA 3Q3HA 4H31A 4MVJD 2QRKA 3HBNA 1FFYA 4BO0A 1FU7A 1L7MA 1XD9A 1OT5A 2CJWA 2PR7A 3G0IA 3QSGA 1LTHR 1QRDA 2DTDA 2W2OA 2QX6A 4HDRA 4LNHA 1EDDA 2YV3A 3A28A 4UE2A 5CH8A 5CVVA 4EM6A 5MDHA 5G3YA 4IXNA 2DLNA 5CLJA 1UP7A 1MQ9A 4YO7A 2QYOA 3JPYA 4LISA 4FDTA 3LCUA 4YAUA 1B14A 3NV7A 5KYTA 2R65A 1C0EA 1ZOOA 4G8BA 4L3VA 2H1RA 2F1HA 2HQOA 2ZDHA 3RSCA 4TL7A 3ZHSA 4RA6B 5D85A 4BGVA 5LQAA 3VNQA 1ODJA 4RW0A 1Q50A 2IPLA 1DFGA 4KOEC 3U40A 3REGA 3NDRA 3OZDA 1E2KA 2OSBA 1G5HA 4ZCIA 1MHPA 1XA3A 2QW8A 4BLWA 2WY2D 5IDYA 1SC9A 2R1TB 2R47A 1TW2A 3WWEA 1NWHA 2NYVA 3I45A 4X54A 3DCYA 3BZUA 3GXOA 2I6SA 3O8DA 4D6PA 2YFKA 1F14A 4EY8A 5JD6A 3O73A 5IJAA 3BK7A 3KB8A 3C7AA 3NFYA 2Q3EA 5T4FA 3D6NB 1NTOA 4KN6A 1PDVA 1T36B 2V03A 2PEZA 3OFVA 1GPNA 3D6AA 1P1RA 1V8ZA 5JSQA 4D0GA 1U6JA 4HYTA 3EPPA 3WGNA 5ITWA 1YDMA 3CUEF 2IW3A 1C30A 2DPGA 1KP2A 2JA2A 4JMLA 1C3OB 3A6FA 3UH0A 4DCTA 5JD5A 5CM9C 1HQKA 4IDNA 1E9BA 2Z0MA 3VQTA 4RHUA 1BWRA 2ZJOA 2ZUDA 4ER3A 3LT5A 3LQRA 1SEVA 4I1RA 2VDUE 3ZX4A 4LUCA 2A7XA 3L7OA 5SYAA 4N76A 1EQ2A 1RM4A 1T8PA 3JTMA 3CXUA 2ZAIA 2AFIB 5KNCA 4QJ3A 1TAQA 4BBZA 3X1MA 2GUGA 2JAUA 5D2CA 1NX9A 2WWVD 3NHYA 3YASA 3UYKA 1EA7A 2R62A 2EWVA 4D02A 3RODA 2YY6A 2HBQA 2F1RA 1G17A 4B76A 3U1BA 3D5QA 2MU1A 3PPXA 1AHPA 2AN1A 1EX7A 2YY7A 4AY4A 3OLCX 4D8WA 1DOAA 3IIIA 3DE7X 1FFDA 2P6OA 2WJIA 2HHCA 3EZXA 3M5DA 1UXJA 1OQAA 4AZ0A 2AYYA 4XWTA 5K8UA 1RWWA 3CZPA 1OLXB 2BE9A 3SX4A 1S3GA 4CM9D 5IDXA 1YUBA 2J0EA 3AXSA 4JBXA 1OKKA 2C8KA 1PFVA 4P2BA 4BGDA 3FUCA 4MJ3A 5BQFA 2XHEA 1E4VA 3B1FA 3GLVA 2X8AA 5DRYA 3SXJA 4HFNA 1T1JA 2X7XA 4H08A 2BIFA 4CEHB 1S9DA 2QD1A 2VPZA 1XI2A 3QENA 2I9PA 3RNLA 4EY6A 4L5CA 3RS9A 1HGXA 1EJ6A 3BCHA 4MQEB 2FWRA 4LTDA 1OLSB 3C3AA 3FLBA 4QGBA 1CZOA 4QHYA 2FHPA 4B2IA 2JI4A 4LQLA 1PVVA 1W52X 3AK4A 1E7RA 2ZR9A 3DCNA 4DJ5X 3F5QA 4RKYA 2NZWA 3BWDD 3G6WA 3M83A 3DKRA 4ZVVA 2BI7A 4MDHA 4KYTA 4W5WA 3D8TA 5SICE 2XUPA 2XB6A 1PNRA 2P9TA 5ERGB 1V7PC 1UZLA 1UIMA 4B09A 5ALHA 2L82A 5IUNC 2X40A 1SKYE 4RTRA 3A1SA 2WM3A 3K8YA 3FWHA 2VKTA 4BRUA 3EDOA 4C6HA 3O2QB 3IIKA 1DUVG 2GD0A 3LF1A 1F1BA 2DFNA 2HYDA 2QJOA 5IWAB 3COJA 2W98A 5EPOA 2F48A 3FI0A 4C4SA 4BXOA 3G2QA 4JH0A 1LPNA 2OV3A 4UTOA 2I2FA 1OREA 1G7RA 4BVEA 3OP4A 1NNSA 5EC8A 3G8DA 1RXEA 1G8HA 1SK8A 2YRFA 3BEDA 4PNHA 3T7DA 5DEOA 1MO5A 2FDXA 4BNXA 3A31A 1B76A 2ADFA 3FPFA 4NJMB 3A4NA 2JCVA 1XDDA 4FLFA 4ACAA 2W2TA 1T9ZA 1PIWA 4NY1A 3G0CA 4PYRA 1YK0A 4YMGA 4MW6A 4ZVUA 4O33A 3VTFA 1QRAA 4H6XA 3CUVA 3GCDA 4ZZ1A 4QEZA 1HYEA 2B78A 4NBKA 3HV2A 1TM2A 1ZGGA 5JYCA 4HDQB 4RD4A 1H1LB 3H1FA 1TEXA 3Q7QA 1T34A 1P2VA 1M34B 3Q8WA 3WNZA 2K7ZA 4OB7A 4A8JB 1MX1A 4TRMA 3M9LA 1TU3A 1HE8B 3EWIA 3OFSA 4M1OA 4XJTA 2BKUA 3RRZA 3LZ6A 3RFVA 4HUTA 3L06A 4OLFA 2INGX 3H8WA 1G21E 1OE0A 1PG0A 2EU8A 4NNOA 4TXLA 5F35A 3T54A 3CEAA 4BJ5A 1GAXA 2R7NA 1I13A 3FNQA 3M6WA 1KRHA 5KAPA 1HQDA 4AXXA 5HIAA 3HI4A 1WXFA 1E2GA 3KQYA 4MQFA 2DGDA 2H52A 1NMXA 3U19A 4CMAA 1Z06A 3TTWA 4HYEA 4M89A 3K05A 4YAFA 2YZNA 4EA7A 2EEZA 2R79A 3K09A 3U9TA 5C8ZA 5K0TA 5LUAA 2ZBDA 2QN8A 3LQ1A 2FK7A 1LX6A 2A9RA 2KPOA 4JDUA 4KFUA 4ZO9A 3R7NA 3SBEA 4B3MB 3FPGA 4AMGA 1UM9B 5JZBA 3DA8A 5K0BA 4MIEA 4DQLA 5FLXA 4E31A 1KF0A 1FP2A 5KJFA 4GS5A 3QE4A 1WV1A 4IV5A 3WWPA 5DHAA 5DBOA 5AW4A 3RQSA 2Y1LA 3MTEA 2ZRJA 1L5HA 4YTEA 3VX3A 1N2XA 2HJSA 3LW7A 4M76B 4J1QA 2N42A 2JLRA 4K9QA 2Y68A 4TGLA 5IAKA 4BCBA 3K9FC 3QVTA 5A2QA 1RXSA 3DDCA 1KRXA 1G8FA 3FPKA 2Z9DA 4QU0A 4RZXA 5LSAA 3HA2A 4WN9B 4PYKA 3GRYA 3GDFA 1BG6A 2W4MA 3PNQA 1MDBA 2JAOA 2XUKA 3HVKA 3DVRX 4UJ5A 1I94B 4EFKA 2GOYA 2IV3A 3V7NA 3ROQA 3VBCA 3RGGA 3L6EA 4CR7A 1RHJA 4N8DA 4DMLA 5KYUB 2PL9A 3RU7A 3RF7A 2H18A 4PZEA 2WT9A 2FR0A 5ER9A 1ZOIA 3R24A 5EMMA 5EVJA 1OGIA 3JAMA 2PLRA 2FW8A 2SHKA 3B1ZA 4RZUA 1APBA 1X1TA 1VRWA 2EP7A 4M98A 2Q6VA 3GZTB 2EBHX 2LIVA 4EG4A 5JXWA 1V9LA 2JFWA 2BGMA 4CKWA 3K6SA 1H3EA 1Q0HA 4L2IA 2EZ4A 4XB1A 1R5NA 5BT8A 3WDKA 3PEWA 3QELA 5CFZA 5JS7A 2QAGA 2W70A 3V4RA 2HMSA 2DY0A 2R6FA 3U7JA 4BMCA 1EFKA 2BBTA 4OGFA 1RI1A 4P81A 2VTDA 2JKZA 3D02A 1Z6XA 5LWQA 1PLKA 4BVJA 5HRUA 3IXQA 1SUCA 4MYHA 3RFCA 2P4UA 4YY3B 1MJ5A 4NK4A 3EQ9A 5FEUA 4ID3A 2KLHA 5TPZA 5ADWA 4XM2A 3I12A 5J4KA 1E4EA 1VKNA 2FEXA 3GV0A 1OH7A 4I1OA 4TL8A 4QG3A 4QQFA 1UT8A 1A4XA 2H9YA 2NWQA 2RIPA 2VL7A 3A6ZA 3CEHA 4M8IA 4RGYA 3TM5A 2GVNA 3ZNOA 4DYDA 5K0SA 5LZ9A 4UM7A 1JAYA 1M2VB 3IXMA 4HTAA 4N47A 4LVOA 2ZI6A 4B0PA 3UBMA 1G0NA 2NG1A 2FPPA 4L9WA 3CO5A 4PAWA 3SHFA 4CW7A 3GZJA 3UFBA 4CFZA 3RFFA 2X8LA 3IHWA 5HFNA 4B3XA 1TTTA 2UXCB 3OEHA 1I7PA 3FCEA 3ZU2A 3GNQA 3GLHA 4MH0R 2OV1A 1T8SA 4HWPA 5FBLB 1HORA 5LMUB 5FJJA 3HJHA 5HCUA 3QEAZ 3BL8A 2ZRGA 4BX3A 3EBOA 1UZUA 1P72A 4NS4A 2FPOA 4TROA 1Y5LA 2H4HA 1WXEA 1X8KA 3G79A 5CCBA 3GVPA 4IDPA 4G56A 4M1TA 5KYYB 2E4VA 2Q2NA 3C3KA 4W7IA 3S7TA 5E4YA 3OD5A 2X4DA 3MYYA 3N0VA 4FMBB 3SQDA 3AESB 5AVQA 1VOTA 4GYYA 3TVDA 5M7EA 2CV2A 2JIRA 2P9ZA 3ZGYA 1SG0A 1PJRA 2QD4A 4PS0A 1II8A 1ZJJA 2BLLA 1JWBB 2FJPA 2XADA 4JY7A 1RNLA 2HW8A 3MLBA 1VIYA 1T3GA 1U0TA 2G82A 4BBPA 2XUFA 3FYUC 4ROSA 5TLSA 2IY8A 3H13A 4RIHA 2BGJA 1NX6A 3HDYA 2PZGA 4MB6A 2O8NA 2IXGA 3OG9A 4DNFA 4F2HA 4S1OA 5EYPB 2E82A 2WHQA 1NXXA 3L7BA 1WMDA 1EGAA 2GXSA 3TZBA 4DSNA 5B57C 3W2TA 4JLKA 2W0MA 4TUYB 4UDOA 1OAOC 2K4MA 2ZBGA 3OPMA 2J33A 4IGIA 5IARA 3ZX5A 2QV0A 1DJOA 1PG5A 1W8IA 3P19A 4L7VA 5GWXA 2H5EA 1XCPA 2PZKA 4UBMA 5THKA 5TPZD 1HT0A 1O58A 4HYYA 4AB1A 1MOPA 2IFTA 2R1VB 3TLZA 3WRVA 1KK3A 1Y7IA 1GQQA 1KWKA 3PNYA 2BFEB 2NTYC 4AO6A 4F5YA 1ZBDA 4XD7A 4XKJA 5CJ2A 5ALPA 2QBYB 1EEHA 1JFFB 2CNLA 4Q15A 4QRHA 3O91A 4CTOA 4YJFB 5DI3B 2Q99A 4YRMA 5IT0A 5JI3E 1DADA 1KYVA 3LXUX 1VPLA 4GVPA 4ZAFA 2JZCA 4OXYA 3I0NA 1UL1X 3QXGA 4C5CA 3MGCA 2UZAA 2QR3A 2O7RA 4G0YA 2QYSA 3OPQA 3L0OA 5HZMA 2C9DA 4E5SA 3W2GA 1S2NA 4E33A 1TAUA 1TD9A 4IXDA 4H1TA 4YP5A 1CJVC 3T3HA 3ZC3A 4OTZA 2D59A 3UV3A 3DZDA 2PLNA 3TTTA 1HOTA 1U0RA 3KEQA 1MJGM 4XDZA 1XAGA 1ZIOA 1JPNA 1ZITA 3LM8A 1BE1A 3H04A 3QFHA 3FWNA 3SX0A 3U09A 1O57A 2B7LA 2NO9A 3NH6A 2FMKA 4JJFA 4A0SA 4D3DA 4AQYB 3R44A 4RVFA 4V3CA 3HBJA 4FFNA 3P4UA 1SBHA 1BKSB 2P2GA 3AH8A 5JROA 3ZD8A 1KO4A 3V3KA 4Z8XA 5ECWA 5HYVA 2V3WA 2X7JA 2Y0PA 4M0EA 4U7HA 4DF3A 1MW8X 2F43A 3H9BA 3DZ8A 1O6BA 4XYMA 2EC5A 3A4MA 3O03A 2CNDA 1MB2A 4YAOA 1GNQA 1D04A 1BGVA 2WKSA 3I4FA 5MF6A 4YS6A 3AW9A 3UJ3X 4ADSG 3OIYA 5AJTA 1VE9A 3BYZA 1TYZA 3O6VA 2WIGA 1R6VA 2QPLA 1JDTA 1DRVA 5KWVA 2XCOA 1V3UA 3EVTA 4E2FA 2JW5A 2G9NA 3FOEC 1GQFA 3ELYA 3CWZA 1E3JA 3GZNA 5H1YA 4YFVA 3T4PA 1WNFA 4DDMA 1ZUNA 3D9QX 4N82A 3A9RA 3VNSA 3ZI0A 1HKHA 1YQGA 1Q1BA 4DA0A 3JALB 4LHWA 1YZVA 5C7YA 5FHRA 4MZXA 3HP7A 3VDMA 3PQ8A 4KPUA 1OZHA 3UGQA 3MOGA 2RMKA 3H5RA 4PLWA 2F7SA 5FWAA 1C0LA 1ODIA 3PFWO 2MOKA 1LWOA 2I5PO 4DMCA 2OAQ1 5HF8A 1Q19A 3DPUA 4IMIB 2AHOA 3ZDCA 4O29A 2AKEA 1OI7A 2YJ6A 3AI3A 2JH9A 2X6RA 1ZK4A 2VHUA 2C4VA 1R74A 1VL2A 5WRFA 3MTJA 2CBGA 1QQBA 1PL7A 4DWJA 1L8QA 3GDGA 1UXOA 3LGSA 4Q12A 1BMQA 4XWYA 5ALLA 1E0JA 3PPWA 2HCBA 1NVTA 3RS7A 2XA9A 4IBOA 5EZYF 1UMBB 4DA4A 2IEGA 4I9NA 1QU3A 1QG2A 3Q3JB 4TSFD 4L15A 4B4WA 1Y6QA 5GONA 1FNMA 3U3DA 2OUIA 4KREA 1PLLA 2Y9MB 4UVGA 1LI5A 3O95A 1BW9A 3A25A 4IOMA 3NDJA 2PRKA 4A5OA 4KV9A 2DBZA 4F72A 4C0SA 2L42A 1F48A 4C0JA 2Q5HA 1AVTA 1V47A 5FI5A 1KDYA 2O2YA 3X43A 3ME5A 4C4AA 4DR7B 4OLAA 1V35A 2PZMA 1H94A 4DPMA 1G5RA 2O3JA 2EX1A 5D1HA 1VSTA 2W5UA 3GA0A 5DM1A 5ITVA 3GJ0A 3HFSA 1MRZA 4DOMA 4P3NA 5KSYA 1M76A 4G0UA 4OI0A 5EZ6B 2FW7A 4OIFA 4PQYA 2JCBA 4KGZA 2ZSDA 1M6HA 1N2HA 3DE6X 4TT8A 3UA4A 3ZQ6A 3O8QB 1EDOA 1IHYA 2AG8A 2ZPTX 4MW5A 4PGHA 4W5HA 1YI0A 2L0XA 1EHCA 4JASB 3W8DA 4J6FA 1LLQA 1ZD1A 2OCBA 4IUCS 3V3TA 1O0CA 1MAWA 1JMVA 5LP6B 1D3AA 4F45A 3CTPA 5A3VA 1DDIA 2X86A 4OHRA 5CFQA 1CYDA 2BSQA 2PVCA 1CQWA 3NDPA 1W88A 4L7QA 2LE0A 4OMUA 3VZDA 2HPAA 3GG9A 5JCOC 3TZEA 2YDXA 2NTEA 5FH9A 2IUYA 3WWZA 2AFHE 1U2TA 2IYUA 3U80A 3U7QA 4DNQA 1X7WA 1MX9A 1K08A 3P0HA 3QG5A 5FF9A 5TRTA 1QNLA 2NSLA 2ZYGA 3IBFA 4IEIA 3KEOA 1F4LA 1YZTA 1KY3A 4CQLA 3A04A 3KV3O 4X44A 1DWOA 4RVSA 2P7IA 5DYYA 5AW5A 1R37A 4YMLA 2ZYTX 2PX3A 4IIXA 5HNKA 3ON5A 3WQHA 1GPMA 1WXDA 1ZHFA 3DMRA 1EAYA 3TW4A 4DEYA 2AXEA 3SXPA 1ZIDA 3JQFA 1RT9A 5G2OA 5C8YA 2LV8A 1E1NA 5D5HA 3WKEA 3DQPA 3R6GA 3QX3A 2WEKA 4W5TA 3G2HA 3LX4A 2GB4A 2WR8A 4JQYA 2COUA 3DT9A 1XV5A 1G3RA 2CD7A 4N3GA 1SC4A 2F55A 2IS4A 4R9UC 4KR2A 1JGTA 2DFDA 2OE2A 2HDHA 3LF2A 3D4OA 1SD1A 3QHPA 4QSHA 4YASA 4BU1A 2I7CA 1PW7A 3SHOA 3PHHA 5HEKA 4LJKA 1P7CA 2BC9A 3EC1A 4PBTA 1P33A 3DBHA 5G41A 2CZQA 5AOAA 1K75A 3CEPB 1QYDA 1F9AA 1PR5A 3K0BA 1QHIA 2A0FA 2FXIA 4ZOCA 4NOLA 4JI5B 3SP1A 5AW9A 1LKZA 1K3TA 4PHCA 4CL3A 1KFEB 4M37A 3U37A 3QW2A 1X0XA 3L3BA 2L17A 5LZ2A 1L3CA 1WW8A 3AEUA 3AG6A 2G4LA 1QIMA 1XTPA 4IYJA 1DQYA 3E9MA 4RDXA 1OZGA 1M7GA 2WVGA 5EZYA 4FILA 5LWHA 4YCJA 4AF7A 1NW7A 1YCGA 1YULA 2JC3A 2WICA 5E6SB 5B6JA 4EUSA 2A5JA 2F1KA 1UPTA 3P1JA 4LDAA 3TEJA 4UBOA 1EUCA 3KYCA 1KHHA 3BWBA 2B92A 1UEXC 4LRQA 1WB5A 2OHIA 2TMKA 5I7OA 4QPNA 1WPRA 2QB5A 4DMMA 3NVKI 1SVKA 1A8QA 4UHHA 3FOZA 1QHGA 1JBQA 1WP9A 3NHWA 3O82A 3WMFA 2RBKA 4YUYA 4N48A 1H93A 1EINA 2WJAA 3HM2A 5HMMA 1PL8A 4H6VA 3OU2A 4LSGA 3D6HA 5JMOA 5G0UA 3N2ZB 3KZMA 1NLZA 3QMVA 4MVJF 1P2SA 4EPRA 3M1YA 2EFDB 4GGOA 4ZFNA 5J2TB 3PZRA 1DS6A 3OURA 4LJYA 1OW3B 1V8DA 1YSCA 1SXJA 2AOTA 1YJQA 4ZJYA 5B3JC 1C3VA 1E8MA 1G3IA 2PUGA 1NFRA 2BHLA 4O6VA 4NESA 2C58A 1CD5A 3AP1A 3C5VA 4FGWA 2WIBA 1C4KA 1U2GC 2AC7A 3FTFA 1GEEA 4UU1A 4TYQA 3HU1A 3ZV5A 4J4HA 1M6VA 4MYRA 3C24A 1Z26A 3RS5A 2J0QA 2Y99A 3K20A 1AU9A 1U11A 3HBAA 4I5IA 4DCMA 2HF7A 2O8DB 1SKUA 1I2MA 2VP5A 1Z7YA 2XMBA 1EESA 3EWNA 4V24A 1NR7A 5JCXA 2H1IA 4UMEA 3GQBA 1Q1QA 1I30A 3GW8A 3MSCA 1JLLA 1GXSB 3AKEA 2B35A 4H3KB 2PV7A 5DBEX 3D8RA 5ALGA 1KZ9A 4F9GA 1JHMA 4CIWA 5JAPA 1JUDA 1GARA 2FSUA 2NZJA 3ZHOA 2H65A 3E6AA 3K8OE 3RS4A 4X3OA 1Y1PA 3GLFB 3W7VA 3HVRA 1DBRA 3B8EA 3IX7A 1MGPA 1PP4A 3H2HA 4NECA 4OK3A 2FB9A 5H3HA 1VI2A 1E62A 1QIEA 4AG3A 3CZ4A 4FOLA 4UREA 4GYWA 1V96A 1VXRA 3MUFA 2JAWA 4URXR 3INTA 5EWJB 2HMYB 1SZDA 5AI5A 1FTGA 2DHCA 3FOAA 4YT2A 4FDUA 1ZKDA 2H11A 2ZIUB 1O9BA 2ZDQA 1EXMA 3L6UA 2B34A 2IITA 2WU4A 1NDUA 3OQ1A 4G5GA 5ECGC 1AH2A 4HGQA 3HRIA 5EMNA 1OGJA 1J49A 3OEEA 4U2KA 3VC7A 3I83A 3ABRB 3ONDA 1GGVA 1ESMA 4TKVB 3WTBA 2W6MA 4XQ9A 3DFMA 4D3ZA 3LXRA 1U9CA 2OXIA 4Y2TA 1G4AE 1YRQA 5KQRA 1G41A 3HXLA 3BDVA 2HPZA 2ES4A 2O4UX 1EE9A 1GOTA 1X7XB 5F3DA 1R2QA 2PUWA 1Y3BE 5AVXA 1YDFA 1ZINA 4ND2A 3ONVA 3PCTA 4G8CA 4Q82A 1HSOA 4U6SA 3V2GA 1P5ZB 1J06A 3ZXYA 4E46A 2DR0A 1CS4C 3ZVNA 3QWBA 4JA2A 3IQDB 4NZOA 1GR0A 1XB2A 4HLUA 3N28A 2UXDB 4XX0B 1C41A 3DV2A 5U4QA 3HUFA 3SJCA 3I9JA 3IULA 4HRXA 1GV0A 2C95A 3HUUA 4QICA 2FQWA 2VHQA 4AJ1A 4RTLA 3ICWA 4GG1A 1MAAA 5KTTA 5FBRB 3EASA 4MUBA 2ZBRA 3GFRA 2BR3A 3OPVA 3GLSA 4JUAA 4UBIA 1UPFA 1AF4A 3IQZA 5DEIA 4US2R 1XMSA 2YVKA 3PJRA 1WPQA 1ZAKA 4OVKA 3IMCA 1MB9A 4MVJA 3R3UA 4R98A 1CX9B 1XZ8A 4ZYZA 1PEYA 3QI2A 4GKAA 4DMUB 5C18A 2FFQA 2RI1A 5AK6A 2I34A 2VBFA 3IIJA 1UK7A 3JZIA 1GSOA 3GEEA 3U48A 1IZ8A 1S1MA 2JIBA 1JDPA 4NYMQ 3FUUA 2A8YA 4QVIA 1OFHA 1F8FA 4H17A 3LDHA 4OLJA 4JBNA 3BXPA 2RGBA 1XQWA 2IZ1A 1RRMA 5JBIA 2HCRA 4HS4A 2QT1A 3I4LA 4LXQA 2WUFA 2WTXA 1DMRA 2GN6A 3WGGA 1KI7A 4GEGA 4NLLA 1KZHA 3LSTA 1LRLA 1QV9A 4DLRA 4I66A 3NVAA 3CGGA 1O89A 3D2AA 3MQ4A 4AUNA 3WIDA 1RM0A 3F97A 1Y1LA 1RACA 4GMHA 1NVFA 5CM8B 3R3SA 2N3ZA 5LKAA 4Y9DA 4D25A 2BSAA 5K4GA 4Q9NA 3P0EA 2GH1A 1SEPA 1IONA 4RA6A 1USKA 3PVCA 3QWHA 1FP7A 3KELA 4GX2A 5HIMA 2X2PA 5JQWA 1NQTA 1BGWA 1OT3A 1DLJA 2BZSA 3HGMA 4G85A 4JFAA 2R1TA 4TRNA 5EA2A 5EJ6A 1PTJA 3K0EA 5FOQA 3LTEA 2XRYA 1L5VA 3UGJA 3DEJA 2JLYA 2RK3A 3U9LA 2YUIA 5FB3A 3A2NA 3KOZA 4F8JA 1U7DA 1I36A 4LXIA 1W0KD 3UJDA 2ZLBA 4XIYA 5J1SB 2JASA 2PUTA 4DCPA 1WU7A 2GWRA 5FWXB 1T36A 1W5BA 5JPCA 1JF8A 2HZ7A 4HVTA 3ZKAA 1NW9B 1YE3A 4B33A 2G8NA 1T8RA 1RZRD 3UJ9A 5LR6A 3EZLA 2IS6A 4G5XA 1R0KA 2XTNA 1KI8A 4WECA 4F0JA 1NU8A 3T12A 4YP7A 3RKRA 3L9WA 4M0MA 1O5TA 3WP0A 4AJEA 3AUYA 3OJCA 3N8DA 4KVFA 3SQNA 521PA 2V58A 2HREA 2QTHA 1CY4A 5HQTA 1DCMA 2VT6A 2JCSA 3ZVMA 1Q0QA 3B89A 4MYDA 4XGIA 3W90A 5DNVA 1T9GS 1MAHA 2VK8A 1HEYA 4F8EA 5G4LA 5KINB 5EJ8A 1WKBA 2QLNA 1YU9A 2AFIA 3QEMB 1MTZA 2GBPA 4HVAA 2KB0A 1SKYB 2AFRA 2WG1A 4LCBA 1DE0A 4KL8S 4RVCA 1TA9A 5DGXA 3IBGA 2IPOA 3VKVA 4C3OB 3Q1LA 4C76A 1I3CA 4CM9A 1EBBA 4HEA1 2DECA 3MWJA 2CXHA 3WDSA 4P5EA 1E9RA 2AI3A 2HLHA 3DEZA 1H2RS 3ET5A 5L4LA 3CUUA 1JAHA 4LX8A 4DW8A 2W22A 2DEUA 1AS3A 1KY4A 3EG9B 2Q7OE 3TRDA 4WY8A 3E9ZA 3CU5A 4B3TB 3O47A 2RGNA 4KWHA 2APJA 3COPA 1UUFA 1OLXA 4BNKA 5ADHA 1KNXA 3DV0B 5ALTA 1VYUA 1IN8A 2B8EA 1GNTA 4L8WB 4BJ1A 1V8PA 2DPLA 2NMVA 2ZBEA 3IT3A 2P5YA 2V7TA 4BB9A 3HO1A 1I4LD 3CB4A 4IJVA 4R7ZA 1Z5ZA 3QKWA 5CIYA 3S4YA 4L95C 2OHOA 1VGVA 3DOEA 4CEHA 1P1CA 2E7ZA 3FF4A 5L51A 1B0UA 2HXYA 2WRZA 2G1AA 3VV2A 1M6NA 1NJ1A 2HHJA 2OFOA 4MQEA 2HWKA 3GEDA 3OQPA 1WMEA 1OLSA 4NNJA 4ZQFA 1U81A 3NHRA 3I04A 1F9EA 2AQHA 3IP9A 5ALIA 3VUFA 5JXHA 4RM2A 1TM4E 4KXNA 4EX7A 2OBFA 2K6GA 2FJUA 3VPSA 1G21B 2J41A 4B3BA 4FKMA 4OB8A 5J43A 1C9KA 3BUSA 3IKVA 3KIPA 4LJ5A 4MRAA 3MUOA 5DSXA 5IULC 1H2YA 5A0TA 3TN7A 2XOKD 4ITUA 2HNBA 4H4CA 4WCDA 2X13A 1U2QA 3TKYA 4XI9A 2XGGA 2H1FA 3UATA 4WK6A 2FZCA 2IUEA 3QBJA 1Z3CA 1RXCA 2X5KO 3SJAA 3F5FA 5EIAA 5EXPA 1QK3A 3J7TA 3RHZA 2QL9A 3ADKA 1FYFA 1JQJC 2ONKA 2WZCA 2ENWA 3H2GA 5DHRA 3R5TA 1WIWA 2FN8A 4CNBA 1GTL1 1BMFD 1T6NA 2Z57A 4JB2A 4S2UA 1E32A 1MD9A 2VZ9A 3C7DB 4P82A 2H1WA 5E7JA 3THRA 3CNBA 4D0RA 4I4TB 1Z9BA 2O57A 3FZNA 4NJMA 1MT0A 3I5XA 1V8OA 4QARA 4KAJA 3O83A 5AOCA 3DOHA 1PZNA 4PHGA 3KE8A 3N3BC 5DCLA 5BSKA 2ATIA 1S01A 2HEIA 3D2LA 1K2VN 3PC7A 4HAYA 4PYIA 4G2TA 4X8LA 5C34B 4YT4A 1T1GA 3OLZA 2R84A 4FI3C 5A1TA 1Z7BA 1H1LA 2YZ7A 4L4ZA 2VATA 2JLQA 3P9CA 3PUZA 4EP1A 3M89A 1M34A 4AFNA 3THWB 5C3UA 2P5SA 4A8JA 1JJAA 2BY4A 1TEHA 2YYYA 4OHPA 4TMKA 5AKLA 1KEZA 3K32A 2AG6A 2EAUA 2F8TA 3A10A 3MERA 3TG8A 4CBVA 1YASA 3HR4A 4YAGA 1JEOA 1ZW1A 2KHZA 1ODTC 2GFQA 3GT4A 4ZTZB 2XYHA 2ZYAA 4W1PA 1ZK1A 5F64A 4UHJA 4WA7A 4LMAA 4MKXA 4CLEA 4TS9A 5AD1A 5H82A 1BS1A 2Y0DA 5EMKA 2HMWA 2MYUA 3FVRA 3DXZA 3CRNA 4GGMX 4EJ2A 1NT2A 4P54A 1Z0UA 3CIFA 1C0PA 3GDWA 1E58A 5C8VA 4POAA 1FP1D 1UM9A 1Y4DE 3KDAA 1MPTA 4OQXA 1DL5A 3QOFA 3FDIA 1IXKA 3IUYA 3BD6A 4QBKA 3OA2A 1A2BA 1J20A 2JGLA 1XCOA 1X87A 3C48A 4E5YA 1M2HA 4JGBA 5JJCA 1JMKC 1LRKA 1RWMA 2GERA 2Q49A 1V5FA 5EJMA 1EH5A 4ZKDA 2WIJA 4OX9B 1MG5A 4N8SA 3KB2A 3BS4A 1TZ2A 1DBIA 4XEUA 2DAPA 4X94A 5FUXA 5DLQC 2WUGA 2RHDA 3IILA 4KDCA 4WN9A 4WD3A 4ND1A 2I65A 4DQ0A 3D4PA 3GBVA 3USZA 3WYAA 5TF0A 4HDCA 1T1IA 3BBPA 2C0CA 3PD7A 4TUYF 3TEMA 3C98A 4GGPA 2GUWA 2HQRA 2LUOA 2NACA 5KYUA 1Z74A 3NWJA 2WB2A 2DKNA 4PIPA 4IMJB 4EF5A 2FN9A 3G9TA 2LKDA 3IB3A 1E8NA 2BKVA 3RS2A 2ATCA 3OUTA 5K01A 1QB8A 3DXYA 3WQRA 6NULA 3BFKA 5BW5A 1O5OA 3HJRA 5CA0B 4YJKA 5I4CA 3FNEA 1M73E 1YL5A 3JAWB 3NHZA 4C07A 3P2MA 4DIUA 4BNTA 1W0CA 2PFKA 1RPNA 1XEXB 3AUAA 4LC9A 4MQUA 3ZTTA 3VVLA 1LTKA 1QFJA 1XZLA 4KXLA 3MGAA 3QE2A 4IAOA 1EWTA 1GEGA 2PUHA 4EHDA 3RDPA 5KU1A 3TFWA 4WJLA 4FDVA 4HD8A 3LUCA 3S2GA 1C1HA 2CLLB 2UZ3A 4FC7A 5E1OA 3OD1A 3JVEA 2HSGA 4U9UA 1NFQA 5AJWA 2IZ7A 1BN6A 1G4HA 3TW6A 3WLSA 3EWAA 2DQZA 3KSDO 5M04A 1SBTA 1HL7A 4GPEA 4ALLA 5B30A 1P1IA 1Z73A 1UKYA 4DVGA 1U7WA 5FWYB 3DZGA 4MCJA 3OQBA 2HX1A 3B5IA 1U2EA 4CMCA 1NVMB 1LY1A 4DL9A 4XQCA 5K09A 2VHCA 4CM8A 1WCYA 1M2VA 1JHZA 1P1JA 3N8NA 3BWCA 5J40A 1QIJA 2QPOA 3WO1A 3ZTWA 4L57A 2QTAA 3I2YX 2F59A 2B83A 2VP3A 2Z95A 3DQZA 4D3FA 1VHWA 1BHQ1 4FYIA 2YYZA 4UM8B 5L4SA 3QITA 4LG1A 4S1PA 1BSVA 3ANXA 1GZHB 3RYFB 4D96A 1L7XA 4QC2A 3CCBA 3FUTA 4QGFA 1QDLB 4CMGA 2H1VA 2QTCA 4YRNA 3EA5A 4DZRA 1XR3A 2Y05A 3TJMA 1L5YA 1O94D 4JI3B 3C7TA 3GMSA 4CF4A 3L5KA 2GBLA 4OLBA 1MIHA 1THGA 3DMDA 1U4SA 3P71T 1ORHA 2XE7A 1LDMA 2YHAA 4N9WA 5C7IO 5KYYA 1L1RA 4ABYA 3BJEA 4F3NA 2ZSBA 1YT5A 2VJCA 3E2IA 4IWNA 4Q16A 3U0VA 3WLPA 1Y82A 3AESA 1LF0A 1OXMA 1Q91A 2XWQA 2ZAGA 1YB1A 2NV2B 3LRXA 1YB2A 1VCOA 5EKSA 3EZYA 5SZHB 1VJRA 1OCEA 4MVCA 5FOXA 1XALA 2HJWA 3NC1C 3PUJA 4FYJA 4BMYA 5HKAA 5IHXA 1H0HA 1R88A 1WB6A 5JJ5A 2R6GA 5BVHB 3TLBA 4YAJA 4WA8A 3ANSA 2CCKA 3AV0B 5CITA 3VHLB 2W2XA 2Z08A 2PX5A 3EFEA 3K9BA 4S05A 5EZ5A 2DG2A 5FNVB 3K4PA 5I48A 1J9ZA 1HYQA 5JV5A 1LLDA 5IFLA 1LSJA 1PJAA 3UVEA 1EVYA 4Q21A 2FW1A 5EYPA 4XR9A 3S68A 1TXGA 3FPEA 1YDEA 4TUYA 4QD3A 3IQGX 4NCJA 4YJGB 5KMGB 2JCXA 5EIBC 2AXQA 3O3CA 1RKVA 1BVHA 1JA0A 4EMBA 3SM9A 3V6LA 3FHLA 1Y3AA 2R751 3CR3C 4W8OA 5AJVB 4YR9A 2O3SA 1K4YA 1NKTA 2VF5X 2BEVB 4AYWA 5DN6D 1YQXA 4RXMA 5JQGB 1JG7A 3PI7A 3BT7A 1DB3A 1PSZA 2JHCA 2PQ0A 3GGOA 3K4HA 2BFEA 2P4SA 3M2PA 3MA0A 3WXMA 2QL5A 1EP2B 1TC1A 2LCIA 2NVUB 3T3NA 2QBYA 1JFFA 1G6HA 3HCCA 4S2EA 1CR2A 4BVLA 4D97A 3V2IA 4XAQA 5JRZA 4K46A 2NVOA 4H7PA 2QQGA 4KN5A 4WX2B 4YJFA 5DI3A 1ZSVA 5JSYA 5M2QA 4CKEA 3AF0A 2W6JD 3E1KA 2Q4RA 3EDQA 4HKTA 5AYVA 3UWMA 5CDYA 2IY7A 2YWJA 5JY6A 3WGZA 1XEWY 2G1JA 3BTOA 2Q5LA 5UKDA 1GZ6A 1NW3A 3L43A 4TMZA 3TGLA 4PFJA 4W6QA 4QXRA 4FYXA 5BNWA 5CYFA 3AEZA 2ZM6B 5T4HA 4PR3A 4LF7B 3C45A 2XXAA 4HXFB 1FBTA 3OHPA 5AW3A 3BH7A 4J0DA 1UKCA 1GTG1 2VJOA 2BFMA 1CNEA 4FSHA 2PA0A 2GMWA 4DKXA 4MIYA 5HVNA 4LV6A 5LP6F 2CMKA 3DLIA 4GZLA 3AEYA 3ESCA 3TTSA 3QPBA 4MHSA 1MOZA 4G1UC 2OZLB 3FVWA 3STVA 4XIIA 1XTRA 3T7RA 3IE0A 2JCGA 4FHZA 3IDZA 5T67A 3QJYA 3X1JA 2G7MC 3I6QA 1DAGA 2ET6A 3D7RA 3FB4A 4OA5A 4KPYA 3L5OA 2OCPA 3NHMA 1S5PA 1VSBA 3TBHA 4EYEA 1PQWA 4X95A 4OHMA 3RB8A 3SNHA 4WOBA 2BTEA 2JDID 5H02A 1SU8A 2ECKA 3KUDA 4IVQA 3ZLTA 4RTJA 1P4GA 5AHOA 2MHCA 3IEPA 2AR0A 2YXNA 2ST1A 1UMKA 3OU6A 4GE3A 3RVSA 1GQYA 3JQGB 5KTRA 1YBFA 4BFZA 4C4XA 2PJRA 4EUKA 1GADO 1SMKA 1L7VC 5K6RA 3HV0A 1KI9A 5EIXA 2HV8A 1CUCA 1Q1AA 3JALA 1A50B 1K7YA 3LD9A 1YD7A 2XUJA 3WSTA 4PC1A 5H4HA 5FPSA 5BVGB 1IG3A 2C9OA 1X38A 1LU9A 5BQXA 3W5AA 3U4IA 3KX2A 2NUAB 3ZE0B 1A71A 1IDN1 1U1GA 2HSDA 5C2JB 2E89A 5ALXA 2G7ZA 1OVGA 2O3UA 1E1RD 3D2CA 3PD0A 2BT4A 1FRVA 4KFSA 4J49A 3EQ6A 1YZHA 2B1IA 2GZMA 1N2SA 2BDUA 4TSFA 4IWYA 1NT4A 1VE1A 4KUHA 3GPLA 2AA3A 2WQ7A 3R9XB 2A88A 2B61A 2IOFA 3I61A 3ROXA 2EYUA 3CCCA 2H4WA 1DT3A 2D6FA 3DO5A 4BUCA 1LDYA 2Q5FA 3BCRA 4QLAA 2YKGA 5GY7A 2AFHB 3TSAA 4NNPA 2ZUBA 4X71A 2BYTA 4CEIA 3JXEA 4MLDA 4I36A 4AWXA 1UMBA 4UCQA 3T1QA 3FUWA 1VBFA 3KQWA 3QLUA 4ZQHA 2VQ3A 3CLUD 1ODFA 4ENQA 1MKYA 5IC4A 1IHUA 3ZVKA 2RONA 2KX7A 1ZI6A 3K0FB 3KRTA 4HRVA 3TRJA 3OCJA 3VDXA 1KZGB 3EVZA 3PWKA 1JB9A 1OR8A 4A1OA 1JLSA 2F90A 2P35A 2VSOA 5JW6A 1GD1O 1V1RB 5L7YA 5EJGA 1U2ZA 2OPBA 3RJMA 1ZH8A 3BHMA 5E2AA 3CR7A 1JIUA 3V46A 5TT0A 1IQUA 1RHUA 3Q7EA 1IM5A 5D3ZA 5BUCA 1M8PA 4RHCA 2GX6A 3BMCB 2ZWVA 4GUAA 4MP8A 1A76A 5KWIA 3U16A 3QU5A 5ESDA 1QO0D 5JFTA 2HMUA 4MV8A 3WRYC 2W2KB 4D3SA 2X77A 3B48A 1K6EA 5J2TF 2V74B 4UHFA 1Y9AA 3O8QA 3O26A 3WIEA 5LLTA 3IHLA 1FQJA 4NDNE 4WMLA 4BFXA 1WTCA 4HX9A 4GWKA 3INRA 4EARA 4Y9UA 1MQAA 3VZCA 1ZVKA 3UMRA 3CH5A 1NVVR 2CC2A 1RSZA 2HDOA 3D6MA 4F4FA 5LP6A 5L6LB 3WR5A 1JA1A 2IWHA 1R6UA 4W82A 4KDFA 2JLVA 4NBTA 2YHBA 2NQTA 3IE2A 2ZRDA 2GF2A 2BH9A 3QHQA 3MOSA 4M0KA 4MKHA 4HDOB 5CP8A 4BCDA 5EP3A 3PFGA 4FOPA 1FCJA 3SU8A 4KWIA 4DA7A 5FWDA 4YCMA 5KUTA 1NJ5A 3LHSA 2GTPA 1SIWA 4IHAA 1AQLA 2YCBA 1DARA 3R74A 4PLFA 2XVMA 2QW0X 2PM8A 4CEIB 1R0LA 2ID4A 2ZBQA 1D8AA 3I0MA 4NX2A 2G40A 1Z28A 2D5BA 3P9YA 2FRVA 1T5BA 2DBVO 4J4BA 1DI0A 2PWBA 1HH4A 2B1JA 4D9JA 1F5SA 3U3RA 4CV3A 4Z1OA 3EIQA 2D00A 4M8NE 1S8NA 4N5HX 2BGWA 1L5WA 4KO4S 2HSEA 2XOEA 2YS6A 4C5AA 1AV6A 4QVKA 2XF8A 2JK0A 1KKLA 4AMZA 1Z0SA 5IUJC 2ZBUA 4UXIA 3NANA 5IVDA 4DV5B 1AY0A 3CVYA 3HUDA 3SG0A 3OLWA 3EW7A 3MD9A 4R5HA 3KJGA 2WSYB 4U2BA 4UASA 4RADA 3RRYA 3I73A 3SN6A 2IIQA 3MUEA 3O8NA 4QRIA 4L5YA 2IQIA 3O2NA 4P34A 5H9VA 3F5DA 3OKPA 1X8LA 1GSHA 3EQZA 2Q2VA 3JZDA 1RYYA 2YZ2A 4INJA 4QVGA 1XZJA 5LB4A 4P4NA 4B79A 1U0BB 4LXXA 1BE8A 2ZWMA 3UMBA 2XD4A 1D03A 1SZJG 3V2HA 4MV9A 4EFNA 2FFRA 2VJNA 2ZVPX 3E15A 1PHRA 4ZC1A 3DTVB 4RMNA 1K2WA 1VE5A 3G13A 3CE9A 3H2ZA 1QB7A 5E2IA 3HMKA 2B9VA 1D07A 3OHSX 4B4OA 4CCYB 4DCCA 4DRXB 1VECA 3D1VA 4D8UA 1KR2A 2ODAA 3IOBA 4QPZA 4JP5A 3T0GA 1JPVA 4M7PA 1QH9A 1IQPA 1IBKB 5E3IA 3RCBA 1E9AA 4R9SA 5E6SA 4PONA 5HTKA 4RFSB 3KJFA 2OC9A 3PUWA 1A7AA 1J2RA 3DTVD 3DMHA 5ESRA 3JVDA 3HJCA 3AT1A 3L93A 3WYGA 3ZLUA 5HUQA 2FPWA 4YPFA 1W59A 3B51X 2AN9A 4E4YA 5BMOA 4K9RA 5FAKA 2C94A 1T5OA 1IBMB 3FVVA 1J07A 3GGCA 4G1BA 3NRJA 1Y1KE 1Z5OA 2BGLA 5H59A 2EJWA 2WTUA 2MSLA 5I01A 2B4KA 3DLAA 3OOSA 1Z2AA 3OZTA 2PT7A 4IJKA 3ZH2A 2QDXA 3QV2A 2X0DA 1ML4A 1ZCZA 2AD1A 5JC1A 1USUA 1NXPA 2GJ9A 1NUAA 3DWGA 2WG0A 3QEKA 4DE5A 3VH2A 5J2TA 1YJ5A 2I4LA 4RCZA 3WV4A 3TFQA 1RAFA 3WGIA 3TLMA 2YTZA 2RKWA 3QKTA 1TCUA 4J0JA 3RVBA 5EJAA 1NBAA 6ADHA 5I7VA 2AD5A 4Z4QA 2CXPA 3EQ7A 1DZ3A 2HA7A 2NZ2A 3VKUA 3I5YA 1N2ZA 1N5RA 2FETA 3LL4A 5JSFA 2O8DA 2CJPA 4BLVA 5BN4B 1U9IA 1RRCA 3QM1A 2IV2X 3GRRA 2CLSA 3AHJA 3GARA 3M6AA 3NTXA 3PJGA 4EG1A 4CL2A 4JXZA 1HEUA 2ZVQX 4N7BA 2OORC 5GJWC 4LCJA 4OREX 3PGMA 1GXSA 4K7JA 5K5EA 1XMQB 2IZOA 4D0NA 4YIHA 1CU1A 2JHPA 1U0SY 3TRIA 3GLFA 2ZQYA 2O7SA 3T0FA 4JCOA 5IAAA 2CL7X 1KS9A 3GFFA 1K88A 4W1RA 1Z2OX 3HZRA 3FAZA 2C84A 3NR2A 5CDUA 5AVTA 2BFPA 1BS9A 3L4BC 1MEJA 2GAJA 3HDGA 4XFKA 4DY6A 4LYHA 5EWJA 4YJ3B 1IK4A 1CUUA 6GPBA 1JKJB 3LZDA 1B43A 5AXAA 1ZN9A 1GRVA 1A5ZA 4YBZA 5D51S 4EHNA 3LCMA 3EW9A 5BRNA 5ICEA 2ORIA 3U3XA 3RBXA 1CNFA 3DDWA 2HJGA 2ODWA 4ITVA 3IRVA 4F04A 1LS1A 2I33A 1B16A 3OTWA 4TKVA 2YINC 2V97A 1Z7GA 3RW9A 2NXEA 2VF4X 4CMBA 3NASA 4BB6A 4OXRA 4OU5A 1IU9A 3C15C 3O3OB 1X9GA 4IIHA 3DVQX 1X7XA 3SOPA 3HKCB 5BMVB 2CFSA 2I0FA 2VUUA 3N6XA 3MZ0A 1I4WA 4O8ZA 1OXUA 1SUSA 3ANLA 3ZWBA 4Q7JB 4H7HA 2NO1A 1PCXA 4GKBA 4TN1A 4KMRA 4LXUA 3PT5A 1QCZA 1Z4KA 1R9MA 3DWIA 2OM2A 4RV9A 1Z2NX 3EZ6A 4JSRA 3KS9A 4XX0A 5AKHA 4ZKEA 1II0A 2FNAA 4IICA 2PKRA 2OBXA 4AXBA 2J9FB 1GFWA 4WZAE 5FA8A 1OYYA 1UP6A 1YV9A 4GD3Q 1J0CA 2GQ0A 5B53A 4BMVA 5ERYA 4DLNA 4RENA 1W2HA 1WUHS 4U6NA 3IDFA 2KMLA 5GQSA 1TEZA 3Q3EA 4Y6SA 2VHEA 3KEMA 4I6GA 1D4ZA 1FVXA 4U2GA 4LDJA 4TS4A 3HB4X 2V6IA 5BSGA 1B00A 2IYLD 3IJPA 5T4BA 1N6HA 1IH8A 4ZT3A 2F9MA 4NAUA 1KY2A 1JN0A 2QMUA 3I64A 3ZY2A 5HRAA 1TQHA 1DTEA 4MGKR 3PT9A 5E3HA 2P6MA 2OPHA 4OP2A 4DLAA 5KNCH 1T4GA 1J56A