1I5EA

Crystal structure of bacillus caldolyticus uracil phosphoribosyltransferase with bound ump
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
208
structure length
208
Chain Sequence
GKVYVFDHPLIQHKLTYIRDKNTGTKEFRELVDEVATLMAFEITRDLPLEEVEIETPVSKARAKVIAGKKLGVIPILRAGIGMVDGILKLIPAAKVGHIGLYRDPQTLKPVEYYVKLPSDVEERDFIIVDPMLATGGSAVAAIDALKKRGAKSIKFMCLIAAPEGVKAVETAHPDVDIYIAALDERLNDHGYIVPGLGDAGDRLFGTK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of product-bound Bacillus caldolyticus uracil phosphoribosyltransferase confirms ordered sequential substrate binding.
pubmed doi rcsb
source organism Bacillus caldolyticus
molecule tags Transferase
molecule keywords URACIL PHOSPHORIBOSYLTRANSFERASE
total genus 51
structure length 208
sequence length 208
chains with identical sequence B
ec nomenclature ec 2.4.2.9: Uracil phosphoribosyltransferase.
pdb deposition date 2001-02-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF14681 UPRTase Uracil phosphoribosyltransferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2020 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1i5eA00
1QB7A 1STOA 3M3HA 1XZNA 5BSKA 1HMPA 1Y0BA 1IBSA 3LPNA 3ACCA 1HGXA 5KAPA 2PS1A 1UPFA 5IAOA 2GEBA 3N2LA 4M0PA 1TC1A 4P84A 5E38A 4MB6A 3S5JA 1XZ8A 4RANA 1I13A 2JKZA 1BD3A 1BZYA 1NULA 2P1ZA 1A98A 4QYIA 4QRIA 4RQBA 3O7MA 4RABA 4RAOA 3KB8A 4P3KA 2XBUA 4FYMA 4RACA 2VFAA 4RHYA 2JI4A 4PAWA 4LYGA 4RV4A 5JV5A 1I0LA 1O57A 5HKLA 1JLSA 1D6NA 4TWBA 1ZN7A 4RHXA 1QK3A 1A4XA 3OZFA 1P19A 3DMPA 1WD5A 3MBIA 1TC2A 1GRVA 1OREA 1XTUA 4M0KA 4ZFNA 1U9ZA 1A97A 5KAMA 2H08A 1GPH1 2FXVA 1A3CA 3LRTA 4S2UA 1DKUA 1O5OA 4P86A 1YFZA 4KN6A 1G9SA 3GGCA 4OHCA 1L1RA 4QYIB 1G9TA 3OHPA 1I5EA 2PRYA 5ESXA 3GEPA 1W30A 1V9SA 1DKRA 4RHUA 1XTTA 2WNSA 5EUCA 3OZGA 4RAQA 1U9YA 4LZOA 1CJBA 1A95A 1QCCA 1R3UA 4PFQA 1OPRA 5K51A 1ZN9A 4JITA 1P4AA 4P81A 2C4KA 1LH0A 3ACDA 1FSGA 4LZAA 1VSTA 1J7JA 1ECGA 1ZN8A 4WMLA 5JSQA 3H83A 1PZMA 1P18A 4RHTA 4RQAA 4Z1OA 2HCRA 1DQNA 2JKYA 4IJQA 2E55A 1I14A 3NAGA 1XTVA 2H06A 4M0UA 2DY0A 1MZVA 2PRZA 3MJDA 1OROA 3EFHA 1VDMA 1G2PA 3GGJA 2YZKA 4X45A 1AO0A 4WN3A 3DAHA 1DBRA 5BQOA 1VCHA 2IGBA 5BQPA 4X44A 4P82A 4F8EA 3ACBA 4LZNA 1UFRA 1DQPA 2EHJA 1I0IA 1QK5A 4P83A 1QB8A 3QW4B 2H07A 5BRNA 1Z7GA 4RADA 2AEEA 4P80A 1UPUA 2JBHA 1JLRA 1P17A 5IPFA 1NONA 3G6WA 1ECFA 1QCDA 1A96A 1ECJA 1ECCA 4LYYA 1ECBA 5ESWA 1G2QA 3HVUA 1L1QA 3DEZA 1BD4A 5HIAA 4JLSA 1QK4A
chains in the Genus database with same CATH superfamily
5ALVA 3QU2A 5ULLA 1E0KA 1QHNA 2C0CA 2AD1A 3U7EB 4P7GA 2CVQA 1Y1LA 4HDKB 1PHRA 2A5FA 3RK4A 3N5KA 1LLUA 3WX0A 4F46A 5JTUA 1C0EA 2V54A 1G21E 4Y67A 4TGLA 4Z4EA 1ZMTA 3KT3A 2PBFA 2QEQA 3OFND 3TDNA 3A4MA 1PQ4A 4HXGA 1E2IA 4BB6A 4PGHA 3KVRA 3NC0C 2DCUA 2QSJA 4MI6A 4Q9AA 5DM1A 3KTDA 2BGRA 1B3BA 1MQAA 3UJ6A 4F71A 1RQ2A 4KBFA 4WOPA 2OXEA 2XCLA 2NXCA 2A57A 2JNWA 3FG9A 3GPDG 3I2FA 2QQ0A 5E2BA 4M37A 5EHQA 3OJXA 3HYLA 4KIWA 4JFAA 2UZ4A 2Z95A 1P72A 5HGJA 5TARA 1YUMA 2VJAA 1SJ9A 2EATA 1SBYA 3MK31 4W5TA 1OZGA 2ZULA 4EYQA 3UPTA 4G0UA 3N0XA 1NQUA 1MX1A 3AM4A 5E4YA 1YU9A 2BFFB 3VDXA 4AY6A 2Q3DA 1Q1EA 1FJXA 3HS3A 4GM1A 2CK3D 1U4SA 1Z07A 4G09A 5DOVA 1YDEA 3DBHB 3H5RA 4A6XA 3GT0A 4FBLA 2XNDA 3D31A 3MPUA 4CM7A 3KSBC 5H82A 1QP7A 3EQ2A 2FR8A 5AK5A 3WGQA 3ZXIA 5JS6A 1YXMA 3F7MA 4Z9FA 3HNPA 3FOWA 3V55A 3JZDA 1E3QA 3ZWWA 1GPH1 1LNZA 1KZ4A 2JAHA 5JPIA 3UAWA 1U2RA 3V4RA 3GGCA 4JGGA 1VTKA 4QJ3A 2J4FA 4FGJA 4R41A 3KQNA 1CF9A 3FPHA 5GONB 1ZJYA 5KQRA 3RO7A 1ZX1A 2ZSJA 5AXDA 4XB6B 2PM8A 2GVDC 3BDAA 1JLMA 5K4HA 3ICOA 3N87A 4O4IF 3FF1A 3KTFA 1Z0AA 1E9EA 3OT5A 4YQYA 1ZUHA 4JNKA 2FG5A 1R5BA 2WR8A 3STUA 2JLZA 1MUUA 3QKUA 3C14C 3OT4A 4YDSA 3RH0A 3TAUA 3VM6A 4QAQA 1J2RA 5FPQA 3EIXA 4FT2A 2P27A 2NZ2A 1ORDA 3LKDA 3BH6A 1JKXA 1RWKA 4KEAA 4W9RA 5TDHA 1RHKA 2E1PA 1W29A 2OCKA 2X9QA 3JXEA 4HYTA 4W82A 1L4YA 1UJMA 5E7QA 1OASA 1FS6A 1E7SA 5EA2A 4X66B 4FMDB 2SECE 4L15A 4DDHA 1FSSA 3NKLA 4B71A 4ILKA 1JJBA 4N54A 5A4AA 5FWXA 3KV1A 1U8XX 2PMWB 2O2EA 2Q0HA 3R4CA 5EVJA 2YKGA 1KAHA 4H6PA 1X8KA 1M8JA 3AR4A 2D0DA 2ZDQA 3K2EA 5BW8A 3JQGB 3KIPA 2ZR9A 3DFFA 2GRJA 3N8NA 4NSNA 4JP8A 4BQQA 2PCJA 3W3AA 4ZYXA 5JSZB 2O23A 2NOAA 4NWIA 3GFVA 5AHRA 3HXTA 4R01A 2OHHA 4LN1A 3WI7A 1KY3A 3HM2A 3M6XA 1T8SA 3NTRA 1CZRA 3R3SA 4G5HA 5D00A 5TMEA 3FYUA 3HUEA 1F2DA 4ZO8A 3VSAA 4BRWA 5K3EA 2MOKA 1YUNA 5HDBB 5AQEA 4WK4B 3IEXA 3CZCA 4MRRA 3ENKA 5D85A 4H7JA 1L4LA 1WX1A 4IX1A 2HRZA 4MI9A 1ILEA 1I7DA 3OZ7A 1B76A 4EJSB 4RTRA 1HE2A 1HYEA 1H69A 2BMAA 3CCBA 1WDLA 2WJYA 3IKLA 4ND2A 4BVBA 4RU1A 1SXJD 1DX6A 5A3JA 1VYTA 1LF5A 1XVUA 3HL0A 1ADGA 1L5WA 1N1MA 2FFAA 4UMDA 3SDBA 3A3NA 3ZY2A 5ABPA 5KIAA 1GPBA 2BP7A 1R74A 1W5AA 4BNFA 5JANA 1WMFA 4DARA 4AC9A 1KMHA 4EI2A 9LDTA 1J1ZA 3ABOB 3TB6A 2R5NA 2VPYA 3ZDYB 2OGWA 3EXFB 5K2MA 3O95A 4EO9A 2OUKA 2IW3A 5A6VA 4YMTA 1KHTA 4AYTA 3K1AB 1F8XA 2D3TA 4MRNA 3T1QA 1Y8QA 4PG8A 4EI9A 5DLEA 1J42A 4L4RA 2IODA 4AWAA 5BQFA 4WXEA 1TCCA 4C0WA 1BOOA 4FI3C 4CODB 4X54A 1X8JA 4EPRA 3HCFA 4EJ2A 5JISA 2JI4A 1TIBA 1RCTE 4FB4A 2XCSB 1CB0A 2C61A 1F0YA 1KU0A 2N42A 5EESA 1W5SA 2C8JA 2SKCA 2OKGA 2P4SA 4CLOB 3KYDA 1R12A 1ZD3A 1I6MA 2P2GA 1P5JA 2NU9A 3BD9A 3MTDA 3VR6A 3B7WA 3D6UA 1KRHA 3TMYA 3UC5A 1D1PA 1PU2A 3JARB 3OOEA 3MAAC 3R76A 1YDHA 5BMVA 2PG3A 2PUHA 1IM5A 2QX7A 4Q1DA 3DEYX 3OM1A 1TQ4A 2QLNA 1O58A 1OAOC 3KKMA 4ILEA 4IY1A 4C21A 1MAAA 4GSKA 4NBKA 3VHLB 4K3UA 3CONA 3I9NA 3OY7A 3HBAA 2WG0A 3G82C 3EASA 4LWQA 3X1XA 4I81A 4UUBA 2FP4B 5K0LA 4RVNA 3AP1A 2P4QA 3AEZA 2V5UA 4TLCA 1N4DA 2XMDA 1TKAA 3DZGA 5GM2A 3SC3A 3WO0A 4D42A 4ENVA 4D81A 2Q28A 3DCYA 5JI3E 3I5MA 2XJ9A 5FA8A 2EIXA 3EGDB 3H5VA 2TMGA 1ZDMA 3FVQA 4E22A 4OJQA 3ZJ4A 1C9DB 4HXFB 4TPKA 1KH2A 3THWA 1DG1G 3SAJA 4K9LA 5J5VA 5J63A 3WRYC 2ZTSA 2PGOA 3F8WA 3CLUD 4MYSA 3OWHA 4UFPA 3ZD7A 2GCIA 2O7RA 1LXCA 3VVMA 4V0SA 4C7VA 2QI9C 2H7YA 3L7AA 4LAFA 4IXWA 5B7QA 4K6CA 5BRJA 2FPPB 1H2AS 4JUBA 4ZANA 1FFHA 5E95A 2FN8A 5C1OA 4XFDA 1QIEA 4K9DA 3UNXA 3KAKA 2H2HA 3DTVA 3A6ZA 3GGPA 1N36B 1XPJA 5JNRA 3CURA 4F3TA 4J1NA 1DAFA 2ZYDA 2WD9A 3FGNA 1BRTA 1EWVA 2OCDA 4K05A 3OIVA 5CXXA 5FOWA 1OFHA 2C88A 5FPYA 4YR7A 3HI6A 4QVIA 3P7MA 2YWHA 3FTPA 4KAJA 4QU8A 4A91A 1RCUA 4V0LA 2C2OA 2ZPUA 3MBOA 1HT2E 5EI5A 3Q7IA 3W79A 1DX9A 2MINA 4NFYA 2DH6A 2AG6A 2NAFA 2QIPA 5B12A 4MW1A 3UB2A 4DR6B 1GRNA 1XCLA 2DX7A 3NYIA 4OQNA 4R9VA 3UAZA 5H59A 5BNTA 3GLRA 2A5YB 4UHEA 3GLSA 4N48A 1B42A 5FUVA 1QRRA 3E9RA 2CDCA 3AF0A 3VKGA 8ATCA 1LGYA 2C1EA 3OE5A 2J5QA 2VZ0A 4W5NA 3SFVA 4P4SB 5JQGA 1PZEA 3EB9A 3HGTA 1TZ2A 4MEAA 4N5NA 4WKOA 3WIUA 3DLIA 4CG2A 3FOCA 5ICFA 1C30B 3LO8A 1U6KA 3QOFA 4BUCA 4OPMA 1XAHA 4DC1A 2DPGA 1Q21A 3FGOA 8MHTA 4GOJA 3T12A 2RBGA 2BH2A 1ZJ4A 1Y48E 4EVSA 4KTTE 3AT1A 3OE7D 1INLA 2C04A 1R6XA 1E0SA 4Q19A 3P0RA 4D8WA 1SUPA 3ETDA 3L43A 2DE0X 4EUNA 4PHTA 5HG0A 4MVJP 1CETA 2BVNA 2XYRA 3OTIA 3REOA 3TTSA 1YSCA 1IK6A 1Z0ZA 1EAMA 1PW7A 1YRAA 2DYKA 4G25A 5D87A 1QFJA 2C00A 3VUFA 5FWNA 1N1EA 1ARZA 5FOSA 4A27A 4U0JA 3M2TA 4TWIA 4P08A 1PSDA 3AUYA 3KRTA 3Q3IA 2CXHA 3FKQA 4GDMA 3H2YA 2FMHA 3EYAA 2DR0A 4W1RA 3VR5D 4RSMA 1YZUA 2BDTA 5DBHX 2FQ1A 4PN3A 3K4HA 5J1SB 1QMPA 3NM4A 1F4PA 3EEOA 1XZDA 1TE2A 4LXXA 4IIJA 4B4VA 3IUEA 1JKIA 2Q3HA 3JQBC 4MPTA 1Q16A 3F5SA 1RYZA 5I9LA 2WIKA 4UMEA 3A06A 1VQ1A 1VE6A 2FXVA 3SI7A 3OJCA 2HMAA 1IONA 5T4FA 5JZMA 4LNHA 5LXTF 2BKUA 1E1CA 1U3FA 4IILA 1DBVO 3GT7A 3QKIA 4WK0B 1SCNE 5CT5A 5CVEA 4ZZ0A 5FA5A 5H68A 3GH1A 4NYMR 4FJ1A 5T5QA 3RM3A 1YZLA 3JZIA 5HKAA 1EI9A 5KDDA 4YDRA 4Y18A 4B80A 4KOEC 4JEHA 1GQRA 1IOVA 2GJAA 3EQ9A 1ULTA 1U1IA 2WWFA 3HHEA 5CCXA 2WM9B 2XDQB 5H4HA 1JA0A 1ML3A 3ZQKA 3VC3A 1JR2A 1T2FA 1G16A 1Z63A 4H3VA 4ZVVA 3GC6A 3BULA 2R7AA 1P62B 5CVTA 2I4OA 1PZMA 1LDGA 2WZBA 2ZRBA 3QHPA 3QPCA 3LC7O 2FPGA 4GEKA 1ILWA 1KYTA 4ZQIA 1YL6A 4V0KA 1OJLA 4KIFA 3QEBZ 2LNDA 2XB4A 4Q3NA 3UG7A 3GLFA 5T6BA 3KNZA 4QXQA 3GGGA 1UMKA 1VDMA 1E9AA 4JVOA 4LI0A 3ZHBA 2QD2A 2G80A 1G8FA 2CUZA 2ZUUA 3EBPA 3L1JA 5BOVA 2AW3A 1BCSB 3ZN2A 4BBPA 2RHHA 3PNLA 4ECEA 3CMCO 1PFVA 2CVZA 2R1VA 3JSAA 5AKZA 4D3SA 4E7PA 1AU9A 1UIRA 3CS3A 5FBLB 3FTDA 3KHUA 3U44A 4C3VA 1N7IA 1LPBB 4MW2A 4NK5A 4EG3A 2Y77A 5EQDA 3TD9A 2YOFA 2HT6A 3IV6A 1XU7A 3ZCTA 4QGFA 1IBLB 3F4KA 2PKEA 5ECYA 1NX9A 1WMBA 2J6CA 4BNDA 2DC1A 1E1QD 1E6EA 1ENZA 3EMDA 3Q9LA 5E6UB 1JIJA 1RABA 2ZROA 3W8NA 6Q21A 2CV0A 2BC9A 2G77B 5KYWA 2IIPA 4ZZIA 1TF2A 4PCAA 2I1WA 4DSZA 3GP8A 3M70A 3OQPA 1SXIA 3QYPA 3REGA 5DWQA 3OTWA 4JLBA 1Y5RA 4O4LB 2PUVA 1EVJA 3KBBA 3D1JA 2ZJYA 2XEDA 2E6UX 3O73A 4HMQA 1RXIA 4UAVA 5JIBA 2QVXX 2CHEA 1Z62A 2YC4C 4F9TA 5LJIA 5F4BA 5C81A 2JIPA 1FB5A 2IUSA 1U2QA 2Q49A 1I01A 2GUWA 4TL9A 4PU0A 4DQUA 3ICQB 3I4FA 2W6ID 4G0YA 4C78A 2FU5C 4TOIA 1AMUA 5CCEA 3KL4A 1YOVB 3CVJA 4P3XA 5DK6A 2QM0A 1U1FA 3BFJA 3AF1A 3DP7A 1NG1A 3DDSA 2AJCA 3LAWA 1WUKS 4BNUA 1KMMA 4QBHA 1N8TA 1TCUA 2QRMA 4PHHA 3W04A 4CM8A 1X80B 2P6MA 1WRBA 1RP1A 2WF7A 3OFVA 1Q0TA 1PJ4A 2WF9A 3P2YA 2VHYA 5MFPA 1PYDA 1OXKB 3SF8A 1HBJA 4PZLA 1QGZA 1XJCA 3CKLA 4L5AA 5EE0A 3WRYA 2QNRA 2VPPA 1VMAA 3I42A 1K75A 4KXWA 1IOZA 1UF9A 1EE2A 3FPAA 4OSOA 5IEBA 4L1KA 3KX2A 4X20A 3L4KA 4X1KB 4CMBA 3M2PA 4CQLB 1MOZA 2X8WA 2EU8A 2J07A 3X1DA 4Z7QB 2AE2A 4NLLA 2OHOA 1T2UA 1NF2A 2V4UA 5GZ6A 4H60A 3ND5A 3CBQA 5GONA 3RK0A 1BN6A 4RGVA 4BQNA 4G24A 5IWCA 2C4MA 1KK0A 2HCTA 3JD3A 3GNQA 1ZEJA 1SCIA 5FI0B 1V8DA 5JI2E 3U7IA 2E48A 1LBTA 1S8OA 1UBFA 2X4LA 5K4AA 1N9ZA 3BJEA 4RVOA 4IIJB 4RJLA 2CLIB 2Q46A 1NF8A 4HFRA 5DBOA 2PEYA 3O8OA 4RCZA 1NYQA 1W2GA 3SHVA 4DDKA 4FHZA 5K6AC 2XZOA 1XTTA 5K5EA 1A8PA 3OLZA 1QTQA 3OCXA 3H7IA 3DPIA 1VB3A 2OLEA 2ZS9A 5FKJA 5ALQA 4MKHA 1RQNA 1JHRA 2IOHA 2JAUA 4FX5A 2GD6A 4YBRA 4MKFA 4RWZA 5CMLA 7YASA 2FK8A 2AUNA 2CE2X 3F7NA 2RGEA 4TXHA 4WX2B 4B4OA 1BE0A 3TLGA 4RQAA 5AW4A 3UHAA 1AA6A 4YJDA 2I4LA 3C4VA 3PQFA 5AJWA 1BMFD 1K08A 3GEMA 1Y9JA 3NZEA 5H3HA 4C7KA 5FPSA 3KYCB 4E70A 1SC1A 2QRZA 1C7QA 5CRIA 1BE8A 3BF7A 1UUFA 4CNBA 3S7ZA 3ANSA 3DXZA 2DZDA 1WXEA 2YRFA 5U4XA 4MROA 2ZK7A 4X44A 2F43B 1YF3A 3T1TA 1QIMA 1TMKA 1SHJA 1KDRA 3QF4B 1O08A 5KTMA 3CVOA 1D0SA 2X6TA 1QS0A 4WWHA 3DOEA 2R86A 2FE1A 2I2DA 1QB8A 4O4LF 3TCNA 1M34B 3AH8A 3M4NA 1L8OA 1YAHA 2Z8YA 2VATA 3E15A 2PBZA 2RB4A 3R0JA 4OQLA 5K8CA 2HJHA 5I4CA 1NXTA 4OQMA 1ZNQO 3R0IA 3DF9A 1YHYA 2DWCA 1QORA 3PEUA 3PNQA 5IBQA 1TPZA 5HXAA 4TXJA 4ABYA 4HV4A 2AN4A 2EG5A 2VN8A 1EXDA 4P31A 4PPGA 3VU1A 2VSYA 2XUAA 1ZOOA 2F8TA 1N8SA 1JSCA 4FCTA 4JYCA 4IIGA 4W9NA 3A9WA 5DNWA 3X2EA 4DB4A 1OYOA 5HA5A 1L4BA 1LDMA 1Y9ZA 4M8SA 4BQPA 1DZIA 2VK4A 1E9BA 3IO3A 2DQ4A 3HVHA 5FQNA 3WGGA 3NHBA 5E2AA 3DBLA 2F8LA 4B8YA 2BMWA 2RHMA 2WM3A 4OI4A 3TIIA 3RC2A 2WBLC 3FJOA 3OE7A 3WWCA 5FUWA 1UPAA 3BTOA 4B7CA 3EDMA 3O1HB 1EM6A 3AYXB 1KOFA 1MH1A 4LVCA 3W3AD 3ZK9A 3ZLTA 4NTZA 4C3OB 5JYCA 5LLTA 2IPNA 4Q7EA 3SEZA 1FTSA 4CV0A 3HRIA 3NDBB 4R71A 1G19A 1PVVA 2GUGA 3NWPA 3RUEA 3O21A 1EDDA 4QBKA 3OQ1A 4EUKA 2O8DB 1PTJC 3O7MA 4YJ2F 4KVGA 1PJ3A 3WZMA 1TO6A 2DKNA 5T8KA 3RRJA 3BIOA 4WZBB 4ZYWA 4EK9A 5CX1B 1UXKA 2C94A 2CFSA 2EZ8A 2EJBA 2VQSA 3C41J 2WSIA 1ZC4A 4IIDA 2VJKA 2I65A 4RY2A 3NTXA 1P31A 1W0KA 2VYVA 1E3TA 1OYYA 1XUOA 5CT8A 5DWDA 3R9KA 3S5UA 5CT6A 1NBOA 2JI8A 2XODA 4YP0A 3FFAA 4RJKA 2FLKA 5CK5A 5JBQA 1M73E 1U2EA 2R25B 1Y1TA 3BSYA 3F6CA 3E9MA 3SFZA 3L93A 3C3YA 1QIKA 3P9XA 2ZZKA 4UCQA 5AESA 1Z6TA 1TECE 1C4XA 1UIMA 4BVJA 2Q1YA 3FCAA 3CWCA 1JECA 3MGAA 4XOIA 2PT7A 3JQAD 3I6QA 5CDFE 1O96A 3TW8B 4UM9D 2G76A 1E62A 1R6DA 4UPDA 5ISMA 3ZS8A 4WK6A 1U63A 3AHEA 5HQTA 2HMYB 4ARSA 4MVJI 1W30A 1GTJ1 5J2TA 2V4MA 3P97A 1GV1A 2CLHB 1DCKA 1XEXA 2IKQA 3R7SA 4QD3A 1QE5A 4A03A 3RBAA 1GLVA 1U0JA 4XA8A 5IT0A 3LOQA 5BWBA 4RDHA 5F5LA 2FA9A 2ZWIA 1EE9A 1RJ9B 3W7VA 2BFEA 3B12A 4HZUA 2RGYA 4JD5A 2W43A 2R11A 2YXLA 3IIIA 4UHJA 4CIWA 4YX9A 4OYLA 1NUQA 3RHFA 4OAOA 2ZW9A 2AC7A 1M0SA 5ESDA 3CNBA 5HE9A 2PGJA 4MRSA 3H9UA 2IELA 2KM1A 3HUDA 3MWFA 3VDNB 3GDHA 2H16A 2HXGA 4LVOA 3DLCA 2QZ4A 2OBNA 3H18A 2Z9CA 5IC4A 5L8VA 3D02A 4WN3A 4JGIA 1XN1A 5KYYA 1ZFNA 1GHTA 2G06A 3I9V6 4HZIA 4OSEA 2YHAA 1Z74A 3TE6A 5BV0A 3TUZC 2PFSA 4G0QA 1CS0B 4PSVA 5H80A 2VXYA 1KH1A 3EF0A 1UPCA 3R9IA 2DBZA 2FP3A 3MWLA 4M87A 1RXWA 4OI0A 3LK6A 3AY6A 4N0EA 2HBRA 3FYSA 3E7PA 2E5LB 3NFYA 1HL3A 2JAPA 4NXNB 1Q0SA 2FI1A 4RK0A 1MC4A 3TR6A 5HJ7A 5KX5B 4JJ8A 5JCOC 2BELA 3UMMA 4XD2A 4RVCA 3HGQA 4RETA 5KZMB 1LSOA 4IFBA 4LHEA 3JQGA 3U1VA 3UMRA 2Y1XA 5I7VA 4UXHA 2WJWA 1RHJA 4IFEA 5IX8A 4F2DA 4BB0A 3KS9A 3UHJA 1QZZA 4O4HF 1YTLA 3UJAA 2XCUA 3V34A 4QATA 4NS4A 4U7FA 4QG7A 2IYRA 3JALB 1YB6A 3DT6A 3TX6A 3AR8A 3UUFA 3D59A 4HHEA 5HUHA 1EHCA 1OFUA 5PGMA 1C2TA 3L4SO 4X8OA 4MVJF 4XM2A 5E38A 4TVSA 5KOJA 5LLSA 2A9FA 3DEIA 4G67A 1V5IA 4MUEA 1MAHA 2PGNA 3D2LA 4B43A 4EJSA 4ZMBA 1UR5A 5IN5A 1DXYA 5AW5A 2YV2A 4IEEA 4E1BA 1FVOA 1BHQ1 5G0WA 1TM1E 1U1GA 1KJ8A 5DE3A 3UA4A 3PX2A 1IL0A 2P6PA 4J2HA 4AZ0A 4IMIB 2CXQA 3Q7QA 5K2OA 2DHCA 3UWKA 5JU6A 3VYSB 4AAYA 4E5DA 3FZQA 3W5BA 3EVCA 2D1RA 2JIRA 4JBLA 4N01A 3SQDA 4C06A 3KSRA 1G3RA 4LQ4A 3QJYA 3R24A 2CWDA 2Z2XA 2FWIA 2IZ0A 2KLHA 3LU1A 3SE0A 1SR8A 5B57C 2PE5A 2JLWA 3FHTA 4QPZA 4BOYA 3DL0A 4CKXA 5KHAA 4ZXFA 3U3ZA 5ALWA 4XRGA 4RTPA 1QQTA 1Q77A 3NOXA 2YVUA 1KJZA 2Y2UA 2XNCA 2YCLA 2TMKA 1BS2A 3MQ2A 1MC8A 1XMXA 4R8SA 1YE5A 4BV3A 4LXIA 2DTDA 3QVVA 4RZXA 2B6NA 1ZRNA 2Y67A 2HK8A 5ELLA 1AGXA 1FU8A 1GZ5A 2C29D 1T9DA 2QQFA 4KQIA 1IZ7A 4MKIA 3C8ZA 1CRZA 1PZXA 2P0YA 4I4TB 3CX8A 3VU8A 4CMEC 2HA5A 1G5FA 4Q21A 2WT8A 1GQSA 1GCIA 1S2OA 4XXHA 2OCBA 3TLMA 5JZOA 1PQYA 1NMQA 2DM6A 4J1TA 2V6MA 5TPZA 1H1DA 2GHQA 3CZPA 5EIWA 3HNOA 2I7CA 1JSZA 3V8BA 1W73A 3RAPR 1RXSA 1XKQA 1M83A 5A05A 5B53A 4A92A 1Q5PA 1E6UA 1UKBA 3OSUA 4UHKA 4QICA 4U63A 1T1IA 1DV2A 3C5VA 4JXJA 4PGGA 2EBUA 4R16A 4TQUS 1LJUA 3DMFA 1MA0A 4M49A 1TAGA 4TLMB 4ZRDA 4LJLA 3RRFA 1ETUA 4MS3A 4ES6A 1CRQA 4BWVA 1U4OA 3ANYB 2RHTA 2XD4A 3BMNB 3L0IB 4R83A 4CW7A 1WPXA 1KOJA 5A9RA 4EO4A 1PG0A 2EHDA 2PQMA 3I0MA 5KNCD 2QL6A 3RAEC 2APJA 2AZXA 1G8AA 4R9NA 4WXHA 5BR1A 4HWKA 1ZWLA 1K0UA 1MTZA 3IQFA 1SUEA 2O19A 4ZYVA 1OIWA 2DEUA 1PS0A 1AQIA 3BCRA 3T1YB 3M9LA 2RBEA 1K5HA 1GGVA 2DWQA 1SU6A 1W88A 3DT8A 1J9ZA 3ECSA 4DLSA 3TECE 3ENNA 2GB4A 4QUBA 4UFNA 4TYPA 4YP5A 1MVNA 1QO0A 2Q5EA 4BTVA 4RZHA 3H4VA 3IE2A 4KAAA 5CJ2A 1OAOA 2JCVA 4OA8A 4FDMA 4ZK6A 1SZPA 2YFHA 4TL7A 1IN7A 2FPIA 2WA2A 1MOQA 1ODKA 1F2UB 5ICSA 5DNDA 3RSFA 2XA2A 2Q1SA 5EINA 1M2KA 1X6VA 3RS9A 5ADWA 3F6RA 3VSCA 1T9KA 2HO4A 3PPVA 1EFRA 3OF2A 1ZY2A 1T5OA 3I9LA 4QDJA 2O2XA 4L4ZA 3CJRA 1NP7A 1M0WA 3ELYA 3R9XA 3MMNA 4WBNB 2VC2B 3KCQA 4U1RA 2CUKA 4US0R 2VF2A 2J9YB 4XFJA 1SGWA 5IUNC 3DZIA 4TMKA 4CDMA 3UFXA 1NULA 1UEIA 4N41A 2IS6A 2V9PA 3CUEF 2QD5A 4UHDA 1PFGA 1FNBA 1HO3A 2FOLA 5H7XA 1KI7A 4CCSA 1YQTA 2R7LA 3DTTA 3L8CA 4QJ5A 3WLOA 5LMCA 3TDMA 2FDRA 2SICE 5CNIA 3NJ8A 4IRXA 3E2IA 4EBFA 4QNMA 1IUNA 1OBHA 5E8JA 2GBLA 1PSZA 4K9OA 4MQ5A 1XL1A 3NW9A 4C7MA 1R2QA 4YEDA 3KAPA 1VKRA 2X76A 1FQJA 1JBKA 2WAYA 2R00A 2QX8A 2F4VB 2KBFA 3DJFA 1RRPA 2D00A 1HE4A 2G04A 2X2OA 2OBYA 3GK3A 3K8QA 3FFXA 4HKTA 1ZOLA 3U7JA 4TYMA 4DG5A 5FTNA 1WZ2A 3HXQA 2YQ5A 4LNUA 2AWNA 2D7CA 5DDIP 2OBBA 3EEQA 3SIXA 4KRGA 5HIMA 3LPLA 4DXAA 1XAJA 6REQA 4EY7A 1PZGA 4DA6A 3B9RA 3EUEA 1N2EA 5ICCA 3JD4A 5L40A 5FPHA 2H31A 1GA4A 2VKTA 3NKVA 4I4LA 5JNWA 1I7SB 4BFXA 1SH7A 2IXBA 4PYJA 1D1SA 3OHPA 1KYYA 3KZKA 3PI7A 4M0EA 4DG8A 2IHUA 3W8RA 3UZUA 3MS7A 2V55B 5KSZA 4QBIA 1BWQA 1IZYA 2I1QA 2BAGA 3DE2X 3MBKA 1V2HE 4JQYA 4Q00A 5BPFA 4MVCA 4Z0PA 4FMPA 4EO7A 4CT4B 3DCNA 5EXEA 4CF4A 1XD2A 2JGRA 3W34A 2P6OA 4AJIA 3AO0B 4NEGA 5AKKA 3TNLA 1VI5A 2WFLA 2EWVA 4UZFA 9ABPA 2REQB 3RU9A 3E9ZA 5CUQA 2C7RA 3AI2A 3IMFA 1BVUA 1ENOA 2CLSA 1YULA 2W8BA 3IX7A 1RXUA 1O54A 4LRXA 4QT0A 3FH0A 4DJJA 4EPVA 4HUTA 2GNAA 2G5CA 1VFNA 2XIJA 4OQDA 1TTTA 4RE5A 3QF7A 1SMKA 2CNKA 2PJRA 2A1UB 3OZBA 1T1JA 1K8QA 2E0IA 2PIDA 1E0JA 3RTCA 2JIMA 3TNYA 2WWIA 3NR2A 4U39A 4BMYA 4EY4A 4ETIA 2HK7A 3BTUA 3O5AA 4L72A 4RD1A 3PQ4A 5ER9A 1BSVA 1GD1O 1MR3F 3WA7A 1QQBA 4TKZA 1BFUA 1ZA1A 4WA8A 4XWOA 1YDFA 3KOZA 4G41A 1OJ7A 1ZJ6A 1DCMA 3TFWA 2JK0A 5I5EA 4D41A 4A0RA 3NH9A 4HDNA 4HDRA 3WV4A 3T5BA 1GXSA 3ITNA 1C9JA 3BB1A 1VG0B 1KO1A 1VCOA 4R2LA 4XSGA 1G7TA 4LV6A 2HWWA 4QVKA 2OXTA 3MAGA 4LZPA 2IK8A 2QLJA 1Y8QB 1CUAA 1TMGE 2XVXA 2O50A 1DX4A 2HMUA 1KAQA 3HSKA 3PC8C 4WI1A 2M98A 4M9QA 4BO6A 3TSOA 3PSHA 2G6BA 4B47A 3GEIA 1U5AA 2XD9A 3IVRA 3O83A 4U3JA 1YJCA 1NIJA 1OY1A 2YXPX 1CNEA 3PNVA 2J5KA 4EPYA 5JMWA 1JMKC 4M9XA 3EXEA 3H9CA 4RSGA 2QP3A 4UEKA 4EOGA 2IZ5A 3AY3A 4F91B 2IYSA 1XQXA 2WKWA 3C43A 10MHA 1NLUA 2VYCA 4O4IB 4Y2QA 5E0OA 3LUDA 5L45A 3EC1A 3M1LA 4FYKA 3W5AA 4J16A 3NHFA 1VPDA 4UZEA 3CUYA 4CWAA 2KE5A 1Z5UA 5BWNA 4B3MB 2XMCA 5FA6A 4DYHA 3TEFA 4HDAA 1AS3A 4EPXA 2PKCA 3H9BA 1VMDA 2F3SA 2QPTA 4JBXA 2VSOA 4ECAA 5KTYA 2PL5A 1MRZA 1N32B 5TV2A 3K09A 3BRSA 3CLSC 1EFUA 2POCA 4RHFA 3RIGA 4IHAA 5IVDA 3IOMA 6YASA 2D1SA 3BXGA 1T8YA 3E22A 4CLRA 1P3JA 2RGUA 1T3HA 2D6FA 1Y1PA 3R4VA 1KZGB 4LECA 3VC7A 5ITSA 5K3AA 1N2JA 1QFZA 1SVUA 3MCTA 3TE7A 2O8EB 3KKEA 3COYA 3HU2A 3TGPA 3THOA 1ACJA 2PZGA 5KJCA 4F8JA 1VIDA 1KK1A 3V6MA 3CGGA 2VBIA 4BFUA 1AKYA 1VBMA 2LE0A 4FGLA 2SNIE 5DW0A 2OA0A 1ZHFA 3VJRA 1EVQA 1SURA 2JASA 4GBED 1B6GA 5F52A 1T4CB 3BXOA 3G2KA 6NULA 3SQNA 1SIOA 2IZ1A 2PZJA 2RGRA 3TOXA 2WK1A 3K05A 4BLQA 5BV7A 3K94A 4YMUA 2JIZD 5AK4A 4UU0A 1S2IA 4FC6A 3RANA 5L9AA 4S0XA 5CLIA 1OYWA 4N03A 3SHOA 1NRWA 1U7UA 1MC5A 4QGAA 4P5EA 2RKOA 1OLSB 2H92A 1ZO8A 2QN2A 4HS4A 5LD2B 3SNHA 3LUCA 4M9ZA 1T36B 3F47A 3MTAA 4OI1A 3VNBA 2AOTB 4CLXA 3M3DA 4COKA 2OV4A 4CDRA 2E85A 3GN2A 1JLHA 4B0PA 2CCGA 2MYUA 2YL2A 3IPCA 4LX8A 5F7XA 4HBGA 2ZE5A 5HYVA 1Z75A 4FBGA 2B5VA 2WHQA 4KCGA 4I1OA 1Y34E 3OF3A 4WZBE 4Z86A 3R3XA 4QUKA 3AEUA 1JEQA 4JNCA 2LUOA 4BX0A 3HDJA 3PC4A 4DCSA 1CY7A 1GTG1 3M8KA 5GWXA 1ZCFA 3PVZA 3OUZA 2QN8A 4R1SA 3TGLA 1LPOA 3FZYA 3OHSX 3L8MA 1C3VA 3IR7A 5I3ZA 1JEJA 1V8BA 4NH0A 1SXQA 1JIKA 2GYYA 3IBYA 3WQRA 3AV3A 2FEMA 1L7EA 3UB4A 2HJGA 5ILOA 3QYAA 4HPJB 2IZZA 3LVRE 2HV9A 1YV9A 3LQFA 2WTNA 5K45A 4YACA 1JIVA 3OZRA 2IYWA 4RGQA 2EJTA 5JD6A 1SHKA 2GM5A 3NNNA 1AXEA 4OGFA 3E6AA 2EW1A 1ZVMA 1QS0B 3HN6A 4M1MA 4ZO4A 4U7JA 5DHTA 5ERGB 4TKUA 3R6LA 2YN4A 1OUMA 3A31A 4OLJA 2A0XA 2I54A 1WZNA 3B13B 2A0WA 1HRDA 5JECA 4R1LA 2J5BA 4QQKA 1HDXA 2N3ZA 2VJNA 4JT8A 1PAUA 1PCXA 2II6A 4HEA6 3U16A 3RODA 4PIMA 1UMDB 3KZNA 2H1FA 2CMFA 1ZVKA 3LM8A 3D1VA 1GV0A 3WJ2A 3RABA 4KLZA 4B3BA 2WVGA 1QZTA 2QR3A 1XI2A 5FOTA 3BEDA 3MOIA 4L5BA 4U3JB 2PD4A 2ZJFA 2ENWA 2J32A 2QF7A 3NHLA 1GLNA 4L3VA 2P65A 4AKHA 5FH9A 1VZ3A 2GVZC 1MX9A 3E0QA 2I6SA 3SDZA 1XDGA 4M98A 4ZOQI 4DRYA 5HKBA 3CNHA 1EGVB 4JN6B 1V4BA 3MYRA 5JFGA 1ZR2A 4EX6A 3FWYA 1CE8B 4LJRA 4CKYA 2YJZA 1DNPA 1G21A 3TMAA 4CQMD 2IDJA 2BTEA 3CNOA 4QU5A 1Q1ZA 3SN6A 5JY1A 4B83A 1CRPA 2M6KA 3S3TA 4K6OA 3CB2A 1Q22A 2DBYA 5TQVA 2OMEA 3VZBA 2F7SA 2V9ZA 4OL9A 1TD1A 3AUSA 4LISA 2JBAB 3UMFA 3NO4A 2QVYX 4MVXA 1AOXA 4GPTA 3K9LA 1L8LA 3HYTA 5CX1A 4D9GA 5CITA 1AH2A 3DMPA 3KQKA 3RS7A 3F6PA 2C92A 1YIDA 4J49A 2MWMA 3THYA 4CL2A 1ZEMA 5ELXA 2HDHA 1CUIA 1G42A 2QVLA 4MRMA 4L9SA 1QVZA 4RVUA 4MUAA 5CJJA 4YV1A 5J47A 1ISPA 4MVJE 3TZCA 2YY6A 5DHQA 2UVQA 3NAMA 1WBDA 1RRVA 3DKIA 2RGXA 4DE5A 1UADA 1VJGA 5LA6B 1PSWA 5AKJA 2X1HA 3GEPA 1V9SA 4X94A 2H18A 5G0UA 2G9QA 4TUYA 1P5FA 3WDLA 4K8OA 3PX7A 3EXG2 1OGYA 3LUKA 1Z0SA 3W77A 1TKBA 2JL1A 4XASA 5LDGA 2QYSA 1ZICA 3DYIA 3BFXA 4YQFA 3HO8A 2YVQA 4PW0A 1LX7A 1IOLA 2AKEA 4JJAA 3J7TA 4S35A 4XJSA 2W2PA 1WA5A 4JSTA 2Q5JA 5IFKA 2EL7A 5IP5A 3SKXA 2WZDA 3D5EA 5KMGB 3UKOA 3QKTA 2H0AA 2DWOA 4KE7A 4KXVA 4Z4HA 2HA3A 3NETA 1WCV1 1JG3A 4HNQA 4FYIA 4U00A 1KAEA 1OROA 4QO7A 4Z1MA 3SYKA 3ZXSA 1GG8A 1JLKA 2I3AA 3HLKA 5HWSA 4JODA 1GPWB 3PENA 1HQCA 4A8TA 4C88A 1PKEA 3SD7A 3H1EA 3G2OA 4LYHA 1CS4C 2MR6A 4PBSA 2VNAA 4KH0A 2QLBA 3E9CA 4U7PB 4UCXA 1M6EX 4NXMB 4RZUA 4E5PA 1V3UA 3O3MB 4HH3C 2F59A 2CJWB 1M2GA 3GRKA 2IPMA 1QX3A 4H1TA 4IDOA 1Z7GA 3KOMA 5ICEA 5E6RA 4DMCA 1OBOA 5LKRA 3OZDA 1FX0B 2GN6A 4ZAXA 2FMTA 3SICE 1CUFA 3S0JA 3S1SA 4DTIA 3O2NA 1KP3A 3NDJA 4NCXA 2TSYB 2WJGA 2IP4A 4C5BA 3I28A 4CM6A 1H9AA 1KJWA 1KDVA 5A2GA 2GEFA 4WOCA 4ZT2A 3V1LA 1L7NA 4Q39A 4BQSA 1XDSA 2XLBA 3I6YA 1SOVA 5EKSA 1WSWA 1GCUA 2Q4DA 3I34X 2QMZA 4MLPA 4X92A 5DM60 2WM8A 2YYZA 1C9NA 1W6UA 2FAXA 3MQ4A 3VZSA 2WKQA 4TKUB 2Y0EA 4JT4A 2GBFA 4REOA 4BJHB 4M3NA 3DOFA 1RJGA 4GC9A 4HDSA 2QTNA 1Y33E 2NTEA 3K2IA 5ERXA 3UENA 2QTLA 3KE9A 4DUYB 4MJLA 5IVHA 3HV2A 2YUTA 1JH8A 4JVNA 3V7NA 2FR1A 4DTCA 1L7DA 4KXQA 1S2GA 2Q0QA 5ECGC 1NTRA 2H5JA 2PH1A 4O8CA 4TS3A 2GZDA 2HRBA 5DZSA 4YCAA 1W75A 2EGGA 1PZNA 2R44A 3K0EA 4URWR 3EPLA 5E1OA 3JS5A 3AINA 1J00A 4RZ2A 1OH7A 3OOHA 3QWBA 4H59A 4J0KA 1UH5A 2TMYA 4TTIA 3ZNOA 2AA3A 1UXOA 4LQLA 1I7PA 1OI7A 2WF8A 4LHVA 2QB5A 1TPYA 2HB6A 2OZVA 7MHTA 1B2RA 1PK8A 3OCVA 3JVIA 5K20A 2JGDA 4F6CA 3EUFA 1MAVA 2WWGA 2CLKB 2C77A 2FK7A 4UQPA 5B3AA 3Q4GA 2FJ0A 4BLVA 2CT8A 2QBYA 4E46A 2JGMA 4YMIA 2NSLA 5J2UB 3RAFC 3LK7A 4BB5A 3GMDA 2I71A 5AI0A 1YL5A 1ODFA 3PD7A 2O3TA 2C9OA 3N05A 2UUCB 1SELA 2BFDA 2JBAA 3AHJA 3GJ3A 1IN6A 4JIMA 3S7TA 5ICGA 1PVOA 2E5FA 5EZYA 1U9IC 1DOHA 4HADA 5IG2A 2XE7A 2I6TA 5JZBA 3PKJA 2H4WA 2Z0MA 1WR8A 1OKKA 2IE0A 3Q3HA 2A67A 5A7GA 1PJSA 3O9VA 4GP6A 1E2KA 4Q4AA 2RARA 3E5HA 4NHOA 3S27A 4B8WA 4F97A 1YJBA 2XWJI 1WL8A 1YJ8A 2NZUG 3IOEA 4HO1X 4ZOLB 4ZVLA 3MTGA 5DI3B 1GNSA 2HRCA 3MMPA 4XB1A 4WZAB 1QCCA 1SVIA 4MO2A 5EIBC 4BEWA 3LT1A 4YRGA 2HSEA 4R84A 1K7YA 4JR2A 2DAPA 1CKEA 4J6EA 1LU9A 1HT3A 4NZYA 2VK2A 4BDSA 2ORIA 3UT0A 4M8IA 2RK3A 1R4MA 4YUXA 4ALJA 1PJTA 3QQ5A 1DMRA 1XTVA 2CB9A 4QOHA 1IY8A 4IOLA 5BN4B 4YAJA 4NCKA 3QH4A 4GWKA 5DN6A 4Q4HB 3JQDA 2XNDD 3OLVA 1C3JA 2FUCA 3MJCA 4JJGA 1PTKA 4A0HA 5CLGA 2B35A 3CEPB 1DC8A 3NHZA 5DEIA 1ZMOA 2C42A 3JQAB 1XRQA 2BCGY 4D25A 1TTQB 2PSJA 4NJEA 4URYR 1Q91A 2D1TA 4OIFA 3IEIA 4EATA 2P6NA 4K0RA 4Y1EA 4ZHQF 1QIHA 4RLSA 1U3CA 2HIHA 1MB3A 3GWZA 3TLJA 4CBVA 5CH5A 4WOJA 4AURA 1JT9A 1T8RA 5K03A 1NJGA 3VOAA 1EP9A 2OGSA 3AU8A 3GY0A 4RADA 2YYSA 4HUQA 4JYBA 4XQ9A 4CF7A 4OATA 4ATNA 2XUZA 2O7QA 2VDQB 4C7BA 4NARA 5EE9A 4LF9B 2JANA 3FCXA 3ANTA 2VZLA 3TG8A 4MKRA 4ZVOA 4A5OA 1I3CA 3WOHA 3IBTA 3E0XA 2B20A 2C3UA 2YV4A 3I12A 3Q2IA 1TZBA 1JHDA 5L3QB 5H02A 1V25A 2ZXEA 5KNCA 3Q85A 2JDIA 3OZEA 1QHSA 1J99A 4LY0A 4U2BA 3BWMA 3PDWA 3PQDA 3PUXA 4WK2B 2PS1A 2XYGA 1PWYE 3KQTA 2ZJ1A 2VG8A 1T2AA 4TUYF 2Z5GA 4WEQA 2FPMA 2FMXA 1F12A 1ZOIA 4LVUA 3OEYA 1BW9B 4LXYA 4JEIA 5KWIA 3U9SA 1SAYA 1FMCA 3GBPA 2VK1A 5LXTA 3JYPA 1ESMA 4MOWA 4DSTA 3UMYA 1U04A 3WLEA 4DR2B 1KQNA 4WDRA 4F9GA 2IYZA 1XROA 2J08A 4LFAB 3BA6A 4AP6A 2HDWA 5F98A 1ZIYA 2WPDA 1W2WB 3X1KA 4B6OA 3ADBA 1CVRA 2HF8A 4I5GA 1QVVA 5D3KA 2A14A 3NEYA 1CUGA 1XF1A 3VNSA 3BBLA 3RT9A 1ADBA 2ZU6A 4J8PA 3PNYA 4TX1A 1DVRA 2FKAA 5ALNA 3UC9A 4H1VA 3T3EA 1YJ5A 4OP2A 3QOXA 3EXHB 4A4DA 4GT1A 4QLBA 2UV8A 1Z3IX 2JCGA 3GEDA 1JWBB 5FYQA 1RKUA 1SWVA 2BFEB 4YUYA 2NUPA 1OBFO 1Z68A 3AUKA 4WNAA 1CQIB 4O3MA 3DFUA 2OWEA 3HJHA 1NBHA 2AFIE 4IPTA 2FEAA 2I4MA 3HCPA 1M1UA 2W8ZA 2XI4A 2OQVA 1U0BB 3GJYA 1H6CA 1GPMA 1Q44A 2X8AA 4XVRA 1KZHA 3V8QA 3AIKA 3PFKA 4Z3DA 3L41A 1HLDA 1LC0A 2Y1CA 3L6OO 1VZ2A 3A9VA 3K2BA 1JG4A 2RIRA 1L4NA 2DU8A 1JDJA 1E6MA 3H2BA 4YIHA 4DQKA 4QUIA 5ARDA 1AUOA 4LMBA 1M1XB 3WIDA 3O4IA 4MYCA 2ZRJA 1X77A 1O7JA 1HC7A 3F90A 4RMHA 2W90A 4QKQA 1W19A 5AOBA 1OPRA 2D2VA 2XA9A 5I3CA 3MLBA 5CBPB 1YDGA 4HTAA 4GMDA 1XCBA 4R1MA 3UJHA 2AXPA 5ENVA 1MIOB 1VPLA 3UPDA 5IUJC 2AMFA 3WK6A 2X9NA 2ZIVB 3W05A 1E7RA 1ADYA 2C2XA 3F6YA 3MILA 3IS3A 5FWDA 2HHHB 1Z38A 3HB7A 3U48A 2HW8A 3UXEA 4YYEA 2XR1A 3HYCA 3MCUA 3CXRA 3DZDA 4GMHA 1DLJA 2Z9BA 3FI0A 5C80A 1RLMA 3OT1A 1HOXA 4IMPA 2CD7A 4FEGA 2RCNA 3G8BA 3WLMA 1OFGA 2A4MA 4M1OA 2C7QA 5K05A 1R0SA 1ZD5A 3I8OA 1UBNA 2CVOA 5BN4A 4OQQA 4S2EA 5HTKA 2D74A 4JI1B 4M86A 4IDNA 1Z13A 2CL5A 1I0IA 4RNCA 3IIJA 4P83A 3QE2A 4B7AA 4ND1A 3D6VA 2FFHA 4M7WA 2WUDA 4NFLA 4BEVA 3U0BA 3WSWA 1PLLA 4NJMB 1OXBB 3U56A 4NJEB 2C03A 3H04A 3H5LA 4U02A 2EERA 1RXCA 2P69A 4TS4A 1P29A 1ZVJA 1ZONA 3IHLA 3Q8WA 4L4UA 4WSOA 3AGQA 1K9SA 1L4MA 2AS0A 3VR4A 3ET5A 3N0TA 1S4MA 4FC7A 4KQJA 5LP6F 3QVMA 4LHYA 1FMTA 5ELMA 1ORTA 3BQNB 2R85A 1NP6A 3DFZA 1N5LA 1UJ4A 1UZAA 2GK7A 4HAZA 4AJPA 1VIYA 1RAFA 1KGSA 5EE3A 4B3FX 1VE3A 1HGXA 2X19A 4KYVA 1QYWA 5EKUA 5M7EA 3P9YA 1TTPB 4OHMA 4FR5A 3H4IA 5D7BA 3IDAA 3IBSA 3G5UA 5FBQB 1XAGA 4K28A 4WQMA 4AL4A 4BUJA 4I4TF 5LZ9A 1DQSA 2ZI3A 2LKCA 3IHWA 4ZPXA 4UMFA 1M2OA 3T5TA 4LSMA 4E2XA 4R5HA 2OCPA 5KNBA 1SBNE 1ECPA 1CZKA 1XZJA 3VDQA 2FDCA 5L4SA 3OZWA 5I47A 2ZYUX 3B78A 2X0EA 1OHHD 5DT9A 2C9CA 4HX2A 4PR3A 5EMLA 1UMCA 2AN5A 2R3SA 2ZUCA 4ZK2A 1N34B 5K0JA 3PC3A 3RNOA 2FR8C 3QVUA 3CX7A 4GX1A 4NG5A 4V24A 4WLOA 4BKQA 3A27A 4XLLA 4L28A 4CHGA 3DR3A 4IH9A 4O29A 2Q6VA 2N1MA 4BQEA 2BZGA 5H3CA 4K87A 1YZGA 2QA5A 4CMHA 1ISRA 3PPXA 1P1IA 5H16A 3I9FA 3MERA 4Q18A 3FVTA 3ANXA 2W6JD 1AN9A 2P0EA 3M7IA 2HBZA 5ENDA 4W5HA 3KJEA 2VQDA 1Z36A 5EJGA 2D0IA 4X1IA 4PX3A 3ENQA 4CQMA 2R7KA 1BA2A 1GGHA 4CMIA 3S8EA 1S8FA 1RLTA 3QGMA 4CM1A 1VKJA 4TMWA 3I64A 4C07A 4RPHA 4TMFA 1D4ZA 5LNK6 1HNXB 4PHFA 2G08A 4ZKDA 2OQ2A 3PGKA 1Y6JA 4OXXA 1EVLA 4EJSC 4YYZA 2AF4C 1H1LB 3Q3JB 2C78A 4KWEA 4L9WA 2NUBA 4EAAA 1MENA 5E6UA 5DGDA 4EF4A 3BZBA 3V4FA 3PBKA 4V1CB 1ZD2P 4WEOA 1NOIA 1TX4B 1TQDA 3VBCA 4UTNA 5LYJF 1ND5A 3DB2A 3U7GA 3ZW8A 3NHAA 4CQJA 1Z0DA 3TCKA 1CB7A 4NULA 1M2WA 3HCNA 5TF4A 3OH8A 4C76A 4KDFA 3OE1A 2D7DA 3FR8A 3DEAA 2FPIB 3I1YA 5FV4A 2LKDA 2VUHB 2ZRAA 3PXUA 4YO7A 4BKUA 3M4XA 3HJCA 2QDKA 3QY0A 1Z45A 4ZRMA 5DX0A 3RRZA 4DIOA 3PNKA 3GVCA 4KWTA 3G7NA 3NBZC 4D80A 2Z5LA 4QDXA 3BH0A 2V3WA 1XZKA 4JR1A 5CB6A 5KJ1A 1DQRA 1PQUA 2GARA 3PD0A 5DEOA 5EQJB 1GZVA 2FOIA 1WS6A 2VJQA 3ZHZA 3E53A 1QNFA 4M9CA 1PT5A 2HSDA 4HSEA 3Q7EA 4ENUA 1N2XA 1SQ5A 2I3BA 1JQBA 3KO8A 2JBHA 1TUEA 1A9XB 3FWHA 1K4YA 1V5FA 1HV8A 1ONNA 3QSGA 2KI5A 1X80A 4KUEA 3UICA 1NW7A 3BXFA 4CG0A 1RYYA 1BHJA 1FDSA 4EWLA 3NG1A 2CL0X 3ER9A 5IHPA 5HBGA 3S2GA 5INTA 4S0ZA 2J33A 1T1SA 5BSRA 1IJEA 4D3XA 2VPWA 4MWSA 3WYGA 3ORHA 2BF4A 2RG1A 4ZCPA 1FTYA 2ZUSA 3QK7A 4DY6A 2Q4BA 5KNBD 4KL8S 2MMCA 3H1FA 4LBWA 3C4QA 4ZAFA 1XVIA 4PEVA 1O6BA 3QBEA 2QTVA 1GNTA 1PGJA 1AUXA 3R1IA 3WNCA 1OGIA 3FXAA 1NXQA 1V7ZA 5TQ2A 3LKVA 4IXDA 4CTOA 4F5EA 4PIPA 1IMOA 4CKEA 4RH1A 3VOTA 5LOVF 2X1LA 1NI5A 1WWKA 1CYEA 4GOOD 2OESA 3RASA 1MJ5A 3G9QA 3GF4A 3H5WA 4KXNA 2NSYA 3T35A 4ARBA 5L4LA 3GFTA 1FNSA 2VDLB 2JZCA 3E1KA 3KJGA 3HY6A 4CUKA 4JT2A 1HEIA 2ZJ3A 3RKUA 1NFRA 2OORA 2YJTD 3G2NA 1K86A 1MG5A 3B1KA 1JIXA 1L1FA 3BHNA 3SZUA 1P0MA 4IINA 3ONVA 2QU7A 2OE2A 2WJPA 1WVGA 3VNRA 5KTKA 2QZZA 2FR0A 2ODBA 4IQ4A 3SIRA 2FE4A 5HMMA 5C5DA 3V1NA 4Q6WA 3R6TA 5CDGA 4B4WA 2JGIA 4O2RA 4XUCA 4YJFA 1HQYE 3DGEC 3HWX1 3PNOA 4W1SA 3P27A 5M04A 1OVMA 3K1YA 1O5TA 1JR6A 1DUVG 1SB8A 5KOHB 2Y71A 2Z2JA 4B09A 4NE9A 3R7WA 1YCGA 4NBUA 3T7IA 2VP4A 5I9SA 3ANLA 3PQEA 1TI7A 1UQTA 1Q6YA 3LVBA 5CDSA 2J0EA 3FYHA 3I2KA 5CFZA 2C7GA 2QN6A 1VB5A 4UXJA 1XK6A 3RWBA 2A94A 5BYBA 1CQJB 4L7QA 1VCNA 3O38A 3TXYA 1DKQA 4RPIA 1K97A 4CMCA 1J20A 4TT3D 4ZGWA 2G07A 2IYQA 1U3UA 2B4RO 4XX1A 5LA6A 4HN2A 5G0SA 4BVHA 3DAYA 1RRMA 4UBMA 3VPAA 1XDWA 3MVEA 4Q15A 2C4TA 1XLWA 3Q6NA 2B92A 3PHCA 3QXJA 4BC0A 3Q7TA 3ESQA 2FRDA 3ZIDA 4BO4A 1C3OB 3T1HB 3EXHC 3VR6D 1AF7A 4REMA 1E7MA 3V7YA 5CA0B 1C4KA 2DY0A 5U1PA 5ITZB 2YUIA 5EWLA 4IIXA 4HF7A 4L9RA 4WAUA 2BM8A 3U5ZB 1N33B 1AO0A 2GCEA 3DB1A 1N3LA 1NY5A 3HZOA 1ZAYA 5AVXA 3FUWA 1YZYA 2FKNA 2FY8A 1U80A 4BZWA 1FC0A 4GI2A 4O63O 1GCAA 2EHJA 4GF5A 1ZRHA 4ZARA 1DWPA 2WICA 4EUEA 1RM4A 5DTJA 3DSRA 1A9YA 3PHJA 1HQDA 3E48A 3W5DA 2AEEA 5CIYA 4H18A 4D8TA 2Z4RA 4Y9RA 4MHOA 3TZLA 4CEJB 4X65B 3DFIA 3CR3C 1OILA 1VHDA 4KR0A 1WDMA 4HC4A 4RQUA 2O8BA 3T7DA 2RGWA 3MWGA 2XY4A 4CTNA 1WKBA 4MP3A 3HJUA 3IXMA 1JSXA 1Y5LA 4AP5A 4AU1A 2QTTA 4E0BA 1YNOA 2P9QA 5EIOA 1STOA 4JA2A 2O8FA 1T0IA 4L8WB 1C30A 2NZYA 1VIMA 1Y3IA 3RSCA 1DC3A 1IUPA 2RHCA 4RGYA 2JFHA 5A3SA 3WB9A 2OAP1 1OYVA 5D6NA 2JFQA 3BIWA 1HE1C 4LC1A 1RWPA 4CMKA 1GY8A 2SHKA 3SBEA 1Y8CA 4OSPA 3WLPA 1XMPA 1Y3FE 1V16A 1KRXA 4EG0A 3LYLA 2WLSA 3B9PA 1Q1BA 4JV5B 3W1WA 3ADPA 2UYQA 3X2SA 1O96B 1P9NA 2BLLA 3DTNA 2WOOA 4EL5A 3GNTA 5E3HA 2IUYA 1OXXK 1A1VA 2AMYA 3L8FA 4NG4A 3FPEA 4C5CA 1FDRA 3OQVA 1SKYB 2ZJAA 1OV4A 3B7GA 5F7JA 4EZIA 2V3CC 1L5HA 4NMXB 1X7ZA 3Q7RA 2KBEA 2CDNA 3I83A 4KUGA 2J3KA 1PWHA 1T5SA 1UPTA 5DM2A 2IHTA 1RWNA 2O9JA 4RHYA 4PE5B 3M6LA 1ZH4A 3MWJA 3RYCA 3LWNA 1P6UA 3WQBA 4NR0A 2ZSIA 4PG5A 3GJQA 1CD5A 4C4ZA 1WCYA 1CLEA 4WNYA 1ESDA 2P62A 1Z35A 3NBXX 3KOXA 2R6AA 1GPKA 1GGEA 1AHIA 2XBLA 2Q3EA 5KREA 3PFBA 1D9XA 2Y05A 3OIGA 1QGOA 3TO5A 1E7QA 1E98A 1LLQA 1Y4UA 1B8VA 3A11A 5L95A 3CJTA 1XNGA 2BEVA 2WPDD 1QRUA 3E58A 5KCZA 4TZ0A 1XL0A 2CKDA 2QRLA 2FN9A 2GZAA 1MQ8B 2ZRCA 1QNLA 2WIAA 4FS8A 1UM9B 5E7MA 3D0QA 4C6TA 2HA4A 2GAJA 3PG5A 2FN7A 3ILSA 2Z3WA 1V95A 3BWEA 4YA6A 3OFNA 2R66A 3GLGB 4B85A 1Z12A 1T5DX 4O4HA 4KHPB 1E3WA 2P3SA 4X61A 3RT7A 4AO8A 4BASA 4B48A 3STVA 1EDOA 1XTKA 2IQIA 1AQUA 4PO8A 1O5IA 1WSBA 4MKZA 4DLNA 4KQ2A 4P32A 1RBMA 4S04A 3UOGA 3RC7A 1P9LA 1RS0A 4MGYR 1L4HA 3A2KA 1IZ9A 4O6VA 1CUHA 3GIDA 3RYIA 5K99A 1N6LA 2JW5A 2V8BA 3A1CA 1AHNA 1IOWA 1D3AA 3KT6A 3ZJUA 5GVRA 1DWUA 1GYPA 1J56A 2XKJE 1UOQA 4OTZA 1P61B 2BWJA 1Y37A 2BGGA 2EDCA 1FDUA 2C3MA 4CR6A 1R4MB 4RKRA 3UHFA 3GZ4A 2IJGX 5KYKA 3HPQA 2QLTA 2Y1KA 1G5QA 2HA2A 5AIAA 2HWKA 1GAJA 4DNXA 3K70C 1T1RA 2BRUA 2IS4A 3HB4X 1D2CA 4JQSA 4M1SA 4B3HA 1RIIA 5LQJA 2WFMA 3M6IA 4QT4A 3ESZA 4KR9A 2I2CA 1ZM3A 3EHEA 1ECCA 4FI3F 3BICA 2OO7A 1ZXBA 4I08A 4B3IA 3HKDB 4COOA 5A06A 1BMFA 4FFLA 1DG3A 3DZ8A 1BDMA 5CDTA 1I30A 2JAQA 5KJFA 4M0KA 4GOKA 3CZAA 3P9IA 4YV0A 5KBYA 1CJSA 2AR0A 3GH3A 4ITVA 1FUIA 3H1GA 1Q14A 3OM8A 5CPBA 2H2WA 3IILA 5D3QA 3RFTA 4JROA 3FTNA 4ZCMA 1M6NA 1NE2A 1QHXA 4BMPB 5JAQA 4KQ1A 5KYGA 1NMSA 4PZ9A 3FNFA 1RWXA 3Q8KA 1JU3A 2W6MA 3BOSA 4MV1A 3VHRA 1NVVR 2H4HA 5CK4A 1BMQA 1RTTA 1DIBA 2FX2A 4LTNA 3NWEA 5DJ5A 3QTBA 5C1PA 1P7CA 2VHWA 4XUEA 3EGOA 5A3RA 3KKNA 4W7IA 1HT1E 1RDFA 3CF4G 2EZTA 2ON6A 4MWBA 4RQBA 4S1WA 2D5CA 4IUBS 5GV7A 2YZMA 3DOHA 3LLVA 2OSBA 4KGDA 4PRZA 2GEJA 3ZGOA 2ECQA 1Z25A 3UWSA 1A71A 1WXFA 3ELBA 3K9GA 4O0MA 2AG8A 2QVGA 4CTKA 2IPXA 2YX1A 3FHOA 3W2TA 4G5QA 5FWXB 1KWKA 1D6NA 2COUA 2JLQA 1SC4A 1CZUA 4Q1AA 3ZDEA 4AJOA 4ZMRA 5KYXB 4REQB 2NP6A 2W22A 1WD5A 1UBRS 2ATCA 1WB4A 2O2CA 2GJ8A 1IC6A 1NUAA 2HX1A 2OHGA 5CTAA 4GXQA 3HTXA 3AERB 5AUQA 4PZAA 2OZKA 3Q7PA 2WOJA 3OLYA 5FV7A 1YVPA 1YS4A 2N47A 1YZQA 2PL9A 4GYKA 4MRAA 5K0ZA 2Y4OA 2V0GA 2PZMA 2AJTA 2BSQA 4F4JA 2GN4A 2AEMA 1K3TA 4PVDA 4BHTA 1I5EA 2XUGA 4P7JA 4YT8A 5G1NA 3QSYA 2C2GA 5ES3A 1GCGA 3B48A 4ZEWA 3PC8A 1BWSA 1IM2A 1RPNA 4IFIA 1QYCA 2B2NA 4MI3A 4PX9A 2G8LA 1HUQA 2YJ4A 3SKVA 4GE3A 4MPRA 1GTL1 1M7GA 5JNTA 3MUOA 4CM9D 3SVLA 1NATA 3VR4H 1G5HA 3VTZA 1P18A 1B26A 3Q5EA 3A1UA 3C98A 1SC6A 3UPUA 3D4IA 4BMXA 4PPYA 4E5KA 1GSOA 3S2SA 4C5AA 4F5YA 4JVSB 1HFWA 4QELA 4Q4LA 1YVUA 1Z47A 2REBA 1W47A 3VR0A 5HGXA 1JQ5A 4GL2A 3QG1A 4UATA 1TAUA 4GM0A 5CH8A 5ES4B 1H22A 3BJZA 3HZHA 2YRXA 2FUG1 3GCXA 5JADA 2WNIA 3H3JA 9ATCA 1IY0A 2GPJA 4HEHA 5ALPA 5AHKA 2M1XA 1LRJA 2DPYA 1E61A 3ABSB 4WBNA 4BFYA 1GTSA 2CCJA 5A0VA 3NV9A 3HN7A 3D8SA 4LOIA 4B6SA 5BSVA 3RWMB 4E4TA 1Q0RA 4QEDA 3U81A 2ISCA 4X8LA 3JQBA 4IIVA 4ZREA 2O5VA 3AF3A 4HJRA 2ZVDA 4G8DA 5J40A 2F3QA 3RIYA 1ZIXA 2H4FA 3LIIA 2P91A 4JBHA 5EP1A 3NTVA 4RORA 4EHNA 4D0NA 2RHRA 1XSEA 4J7XA 4BQIA 1ORRA 1Y7TA 3WOVA 3U19A 3VMMA 4MP6A 5AW2A 5JNLA 2A9PA 2PUEA 3GXBA 1GL7A 5EP2A 1RZRA 1EZZA 3FDZB 3LC1O 3MYYA 3N2EA 4FR2A 4EMUA 5LP6B 1BWPA 1KXZA 4UAJA 4MAFA 1ZGAA 3HN2A 2IU4A 2VPXA 3LWDA 5EE1A 4DJDC 4YP1A 5BWLA 1AHHA 4DA0A 2H51A 4ENTA 3RVSA 3EPHA 4PR0A 2GT1A 1YRHA 4EB6B 2DLDA 1CERA 3FRJA 3K1AA 3P26A 4N7RA 4P3YA 4U4AA 4QGSA 3HI4A 1AKNA 5FBZA 1JIUA 3GFOA 5AVWA 5LFAA 1EKXA 4UU1A 5EQFA 4JELA 2JIQA 3W0LB 5F5XA 4OHKA 2FHSA 2A35A 2BHSA 1FX1A 2DKFA 3HU1A 3P20A 3CYFA 4P33A 4J7CA 3W90A 3EARA 1TT5B 3U3XA 3G1TA 3DTVD 1LBIA 1ZXXA 3EVTA 3PQ7A 1YZKA 1Z2EA 3AWDA 5BVGB 1N7HA 5TXGA 4KRXA 4GZ5A 4KQHA 3FTFA 2SCUA 2B61A 1R8JA 5H1YA 3C2QA 4YDHB 1M3SA 1MRNA 4QYMA 3RUFA 4Y6SA 1I2DA 2ZJ4A 2XCIA 3TBHA 4CCYA 1B1CA 2H4YA 3GV0A 2AI1A 1M1YE 2CZQA 3I45A 2VBGA 4G4JA 3RK1A 4DPMA 5FTKA 1ABEA 2ZSDA 1DKUA 3DS8A 3VBEA 1G8MA 1UDXA 2Z08A 4A23A 1W1WA 5JDIC 3RTDA 2WYVA 5K6AA 4G5XA 4WD3A 4OOEA 3K6KA 2VJPA 1AGNA 1ODTC 3EGDA 2VWPA 3LHFA 2GXSA 2ZIWB 3ADOA 4OHVA 4X1IB 5IT5A 1R0YA 4MUBA 4D9HA 1Y4DE 1R3UA 2CF6A 1QVWA 2AOUA 3F6SA 4Y1GA 2FW9A 3H8WA 2QPAA 4J7AA 4KYTA 2ZIFA 3AONB 2W6JA 1VLZA 4LCEA 3S2EA 2FPPA 5K09A 4ZZ1A 3ZWNA 2EZ4A 4J29A 1RRGA 3F71A 4B6JA 2C5HA 3AKDA 1TD9A 3QW2A 4BTLA 2PRZA 4S1NA 5HFNA 4PGMA 1K88A 1BG6A 5JLJA 1YR6A 2RJNA 3AZOA 4I5FA 1ZJZA 5TLSA 3MXOA 2GESA 2QUKA 1Z0UA 3HABA 1UK7A 4NOLA 2OQRA 4TTPA 2KX7A 4MGEA 1P9OA 1HRKA 1T15A 1WXWA 3W78A 4NZOA 5EIXA 4BGEA 3WLQA 1B43A 2QQ5A 2VNSA 3DVSX 2OZPA 3K6JA 3QA9A 3ND9A 5EZ5A 1E1MA 2PK3A 3HB5X 5JMPA 4B87A 1J6UA 4EW2A 3OUUA 2QENA 2DWPA 3OCWA 2FX5A 5HR5A 2FPWA 2UUOA 3GQBB 1A4IA 2VHQA 4B2YA 4JI0B 1Z0FA 4AS1A 1NLFA 1Q15A 4JC5A 3KUDA 5C2JB 1GZHB 3I9OA 4BGDA 2IPAB 2GHRA 3RUIA 4WXPA 3R7DA 1RWOA 3BIFA 2X86A 3L46A 4U8HA 4W5WA 1H4TA 2AL7A 3JQ7B 4I55F 1DAKA 3TKYA 1QHIA 4W8GA 3JRXA 4AJ2A 2HKIA 1JQJC 4BGIA 4EA8A 4EHLA 2O0KA 4LDNA 2QRQA 4ADSG 4IS2A 4Y6LA 1FJHA 2QE7A 4WBXC 5FLEX 2HWYA 4XLZA 3KEGA 3W2GA 1ZUIA 4D9FA 2FN3A 4WLEA 4OXYA 3L0OA 2XB2A 2X2PA 5EZ6B 1NHGA 2WB2A 3PLAE 4N5HX 3DL2A 4DG9A 2N46A 1FMLA 5JVDA 3AL0C 2WUGA 2R8YA 2NT4A 1IG3A 2WU0A 4L8LA 4D8XA 3CN9A 1MNQA 1ZJJA 5T8KC 3UFBA 3P0JA 4D4IA 2GCOA 4IZIA 3K30A 4AUMA 2XGOA 1JDPA 2ZTUA 3GLGE 4QHTA 4IHQA 3P0IA 1JQ3A 3CH5A 4C3ZA 4G0OA 1MJNA 3EZNA 2CBGA 2QIOA 4ZOEA 3DL4A 4JYPA 3QTTA 1XNJA 3QLVC 5EGSA 3IP7A 1Z4MA 4J43A 5JRJA 2A58A 2A9OA 2E4AA 3DV2A 1PNRA 3O4JA 3VH3A 2GLTA 2X5XA 4JLJA 4PAMA 1OB5A 2B34A 1P7WA 2F1IA 2EG9A 2UZ0A 4D9MA 5T4BA 3UCEA 4CMEA 3EQ6A 1KAOA 4PXSA 1XCJA 1YI8A 3TRKA 3ANMA 9LDBA 1X9IA 4NX2A 5A1TA 3IULA 3MNFA 2HZBA 4GL4A 2QQGA 5B6JA 2HRRA 4P8RA 2VHXA 1JAIA 1H2HA 3QQPA 4RJ2A 5HCUA 5TS3A 2UZ3A 5AICA 4EGJA 4KDEA 3LBAA 4P7FA 4XARA 4EKEA 1JHZA 4PAQA 2C5EA 3R7WB 4YALA 3NASA 1FQOA 1F48A 2DSTA 1B41A 3IQEA 3FAKA 3QVLA 3QUSA 4LOJA 1AB6A 2WV9A 3P2IA 3QU5A 1EM8B 2ST1A 3DULA 3IR5A 3PTAA 2BTQB 3ACDA 2WJ6A 1E9VA 2GBIA 5G3ZA 2O3RA 4O02B 1EVZA 4XEHA 3BMOB 2BL4A 3D6AA 3K8ZA 4XPZA 5L6MB 2H1OA 3RCBA 1S6YA 1UBEA 2AE1A 3W5SA 1IQPA 2WE8A 3TI7A 2P40A 5DU2A 4J0DA 4TTRA 1O94A 1JJIA 5FUMA 4INZA 3ZIUA 1MX5A 4XYEA 1YS2X 4ZVTA 3JAWA 4IZOA 1HI9A 2F1OA 4AQDA 4Z2AA 1NRIA 2ZDGA 4Q5IA 3H87A 3DD5A 1EMDA 1EVEA 1XZFA 3K0AA 5KKNB 5DKFA 1ODJA 5DN9A 5EMKA 1I6LA 4P82A 2YFYA 2I6QA 3KJNA 5TGDA 1LNQA 2ZBVA 1X1AA 2ZRMA 1FA9A 3D0RA 3QVKA 1YMUA 4ME6A 4P36A 1KY2A 3THRA 2CF5A 1LW7A 1Z6YA 4BV9A 4M1TA 4HNVA 2PMFA 1I6KA 3RIXA 3LUBA 3K92A 3RBZA 4BECA 1OU0A 1C0IA 2I4RA 2FLVA 3Q6IA 4NFSA 2Z2ZA 4UFOA 4CMJA 3FSGD 3BGWA 4N6GA 4JLKA 2B8TA 4DIDA 1FXWF 1XKLA 4ALMA 1MGPA 4DJ5X 4RFSB 4L78A 2CXTA 5JDIA 3QG5A 4G97A 1VBKA 2BJVA 3HDTA 5KUTA 1GPDG 1P75A 4OU5A 1BU5A 5HZGA 5F9MA 3RAJA 3R9XB 1XP8A 4MV3A 1V8PA 2AI2A 3FYTA 3GQBA 2ATXA 2NMVA 4LOHA 5IAGA 3IAS6 4EI8A 3BJIC 1S3FA 1ZISA 5BR4A 2Q5QA 4HCJA 5BSUA 3IP1A 2O2YA 2EAUA 5JCPA 1ENPA 3NEPX 4PYQA 4FYWA 3RSHA 1CVIA 1O95D 3HR7A 2X4DA 3TRDA 1JDTA 2ECOA 4NNJA 4ZP1A 4YMSA 5MN4A 1U02A 4KR2A 1EX1A 2WU3A 5DO9A 3O2SB 3F9CA 3DHNA 2P1DA 2C2HA 3EZ9A 4RY0A 2AEJA 1ZC3A 1EWTA 5L3ZA 3AF6A 3DEHA 1C7RA 3EDYA 2VS1A 3OCYA 1L5OA 3R8CA 2UU9B 1F3OA 2DPMA 3LCUA 4EJMA 5CLFA 3QVGA 3QF4A 4LQDA 4MB2A 4X60A 3UUWA 3FPLA 1PR9A 3EF3A 3TB4A 3X44A 3SHQA 4K7JA 1UBCA 3GJ0A 2VUSA 3X1MA 1P3DA 3VKUA 4XSVA 6REQB 3EN0A 3LBNA 4EG7A 1WUHS 3HCBA 1CF2O 2YICA 4P2BA 3E05A 4ND8B 4YWJA 1A88A 2V7TA 3WFJA 1SCDA 2JAXA 4BIMA 4HDQB 3UH0A 4OIMA 1F2TB 3W2EA 1LPPA 4CKWB 4IQGA 3ROGA 4FUTA 2DQYA 2HLDD 1OV6A 3RVKA 4Y30A 3FUTA 1K8YB 1L9KA 1VLVA 3TX2A 2BN4A 1Z0KA 1J8YF 4F4DA 4B3SB 4H2DA 4OXIA 3OX3A 3PRKE 1B93A 3TLEA 4MJXA 4QJBA 5FUXA 1XZMA 4FN5A 5LMNB 2OD7A 4DDUA 1BXRB 2J3QA 2E37A 3LHKA 5CA1F 3VU9A 3ZHRA 3A37A 1SRRA 2CSUA 3A6HA 3SC4A 4ASUA 4JU9A 3KKLA 4EW1A 4NU6A 3TEMA 2VWHA 3F96A 2GJ9A 2K2WA 4ZVPA 5JAMA 3AJEA 1ZGZA 4FE7A 4A36A 3KTAB 5WRFA 1ULSA 1YE8A 2I3ZA 1TK3A 3FSJX 1PS8A 5HOEA 3LXMA 4FIDA 1D6MA 4G4GA 3I9V1 3WNDA 4P54A 1QHHB 4MA4A 4JYZA 1ZVVA 1HE5A 1E1KA 2J3HA 5K0CA 1LWNA 2QMEA 3COZA 5C37A 2BMEA 2OG1A 4RS3A 2FFJA 3DWGA 3GCDA 3KQQA 4IUDS 4RVSA 1VL6A 2NXNA 2JFXA 4TXLA 5GV8A 3G2IA 3EEBA 1FXWA 1CFZA 3SJBA 3PHLA 4OLFA 1QV9A 2CFOA 3S2IA 1GZUA 1K6MA 4KQXA 1JV2B 3C1TA 2YWXA 4ZEXA 3VVBA 1H8HD 3GRUA 3HJGA 1SQ6A 2Q29A 2EBHX 3QKRB 2M1ZA 1W1IA 2WDPA 1FLAA 4OQPA 3SGLA 1A9SA 2GDJA 2WHEA 2YNMC 3SOZA 3ZDRA 4K6FA 1GSHA 5TGTA 2YXNA 5AKLA 4B6FA 1A5BB 5IKMA 1M2FA 1O9GA 2XCRB 4EA6A 1FTGA 2CLCX 2QMYA 1E66A 4PNHA 3VKWA 5DSZA 1VECA 3GJRA 3P9RA 1DO8A 4G9BA 4GR9A 4HGPA 4L08A 4XR4A 5H9VA 4EGCB 1Z56C 2ZU0C 2NADA 2RAUA 2G5GX 3AJDA 2P5TB 1TZCA 3FSRA 3LHSA 1XZNA 4M60A 4Q05A 4DXDA 3GZNA 1SCQA 16PKA 3DW3X 5AUNB 4FDAA 4R51A 4FFPA 1FYWA 1BE6A 3S28A 5A3QA 3PRJA 2QBYB 1UBHS 2O2GA 4DCOA 4ZEMA 3QE9Y 3REQA 5KPDA 4BLWA 4WKCA 2BKEA 3AW8A 4I8XA 3ZZ1A 3AVPA 1TYZA 1GT91 4JENA 2AJBA 4YJ3F 4DLRA 3H4TA 4B9EA 4ENQA 4F9EA 3SSAA 2FZGA 4HQKA 2IQ5A 3AHGA 1P4JA 2C98A 3H3XA 1RJDA 1J0EA 3L6CA 4I3FA 3E3MA 2NU6A 3E22B 1GG5A 1LI4A 3GVHA 1FDTA 3LY9A 3DEKA 4FCVA 1YJAA 4PM4A 2IEGA 2H3EA 3P9NA 1OLXB 4AFNA 1D2AA 4F4CA 5KYYB 2PMEA 5I6DA 4FYMA 2QTMA 2FSVA 1E8DA 1GPNA 1EP3B 1XMIA 3LQRA 4RKQA 3VAAA 1GEEA 3O8LA 3GJZA 1P4HA 1AS0A 4WZAA 3ZCPA 2BYTA 1HKHA 4TRJA 4YRQA 1CS0A 1GR1A 1R8YA 3MGGA 4R7GA 3IPYA 1LDYA 2CMKA 3AM3A 1A4UA 1NJ1A 5BNWA 4HX9A 1E7WA 1JU4A 4D26A 2P5UA 4NZPA 3QUTA 4R5MA 4J90A 1IJFA 1WNTA 1T6YA 2GEUA 3L7OA 4P5DA 4L5IA 1CIVA 4PX5A 3TIXB 1G3MA 1EK2A 4TSFD 5AVUA 2QRGA 5B3JA 2W2XA 2JJ1D 4BX3A 3NBAA 1XZGA 4DUPA 5D01A 4C4SA 4DFDA 5LUAA 1JKMA 3LGAA 4TKMA 2YYYA 4IEIA 4YJGB 2XRYA 4X3CA 4CKWA 1GUAA 2B25A 2UKDA 3MFYA 2X0FA 3ROMA 2IYNA 4CL8A 3JALA 4N5DA 4N0PA 4KV7A 2QL9A 2FTKE 4EX7A 1F20A 5NULA 3OFJA 1QHYA 3IDSA 3R44A 4E88A 1F17A 4X84A 2XV1A 4OBWA 3OQMA 3AFNA 4X91A 1F8YA 5I9TA 3EDCA 3FWNA 4NK4A 2FEKA 4BO5A 2V97A 2ERXA 1G5IA 3VU9B 3CZ9A 4HXYA 2Q5FA 3GB9A 2C5LA 4HQLA 3MWEA 3FNBA 1OXMA 3CKMA 2ZTHA 2JPDA 2OLJA 4ODIA 2RSLA 1DWQA 3EXG1 5EYPA 4ARZB 2GO7A 3QPBA 2PTHA 3KTAA 1FNCA 1OX4B 5DFAA 2QAGB 4GIBA 2KLBA 3DQPA 1FZTA 4QOJA 4A1FA 4MWEA 1G6OA 1OZ0A 4IOJA 3D64A 3ICWA 2DKOA 3OPNA 4X3PA 4EG1A 3T5AA 5K0GA 1N7GA 1DWOA 3GELA 1TUGA 5TNXA 3IA2A 3CVVA 2VDWB 1Z4QA 3QLTA 1MG0A 5JCZA 1J5EB 1M6HA 2ONZA 2XXJA 3L1IA 3JTEA 3P9ZA 3EGIA 4RK4A 3UJ8A 1JPVA 3WL6A 3WXBA 3UJ9A 3NXKA 4KPYA 1YBVA 4RKWA 4PLZA 3CA8A 2Q0XA 2WINI 3EZFA 1VPEA 1XTSA 5DNUA 4PO9A 3KQMA 1L5GB 3WWDA 2HXYA 2VT6A 4AQYB 3WHIA 3L8ZA 1Y1QA 3ROFA 4J4TA 5G2OA 5KQSA 3HLYA 1YIAA 1E1CB 3AFGA 2LCIA 1U2GA 2QRVA 1PEYA 3NIWA 1N5MA 4KN8A 4YAUA 1JJVA 5K8UA 2NM0A 1UKCA 3JVUA 4E07A 3K8OE 1V37A 1EA5A 5JSZA 3WL3A 4US2R 2C07A 4DMRA 1Y6QA 1MF7A 4DV7B 2EW8A 3FMIA 2GHTA 2ZEJA 1R4NB 1COWD 2IYPA 1FVHA 5AMXA 3N59A 5JZ9A 3P94A 2XOKD 1BS9A 3C1UA 3R3UA 3X2FA 2WQ6A 2Q6TA 1L5ZA 2GEBA 3L0YA 1E3IA 2L17A 3VOSA 4IDQA 4C08A 1HA3A 1SCBA 3KQSA 1DJNA 2BKXA 1Z22A 4I9FA 1E6LA 4TTJA 1F60A 2PV0A 3LTNC 2V98A 4HRXA 2IY9A 3ZHYA 2P1ZA 1TEHA 2DSNA 3BXHA 3C6BA 3V4PB 4DQDA 4EP1A 5JWHA 1OAAA 3W3ZB 2QD1A 3C74A 2P9YA 5EHGA 2CD9A 2GPTA 5CXSA 3WLHA 3PIRA 3ELUA 3QMPA 4FNAA 3IUNA 1K7XB 3F7TA 1THMA 3W6ZA 1CZNA 1MRSA 3MTJA 1MIHA 1P0PA 3BAZA 4TVOA 5FADA 4WKNA 1CHNA 1V5GA 5A5VA 2ZUFA 2CUNA 3N8HA 4CKBA 5AW7A 2VDUE 2XQGA 3E9QA 4OX9Y 4ZVSA 3RBXA 3CIFA 3IV7A 4EF6A 3TZQA 2SCUB 3UMVA 1U9ZA 3PA8A 2R47A 4RMNA 4JB2A 1NW6A 3T9FA 1KE1A 2Y0BA 5DGIA 3DFMA 3R5TA 3UT5B 2VYND 2MYNA 1CY0A 5C51B 5F76A 4Z0HO 3UW1A 2HDOA 4JI4B 3KYDB 3BHMA 1V41E 4K81B 1HL7A 1SN7A 5JEEA 4K88A 2CHGA 1WCXA 5HHTA 2LCFA 4BPRA 3QEMA 5JD4A 1GARA 1M0EA 5HSGA 3I6ZA 2ZM5A 3H11B 4HN9A 4ON9A 1RP7A 3MGCA 4FFOA 4CG3A 4YMHA 2CKMA 2C3OA 2ODAA 1V7QA 3K0BA 1CJBA 2DHQA 4HB0A 4WUTA 2YZGA 4R9RA 3K70D 3JD2A 1MT0A 4I9HA 3D7MA 1MHPA 5CJPA 2NP7A 5EJ9A 3PJEA 3ZPXA 4BLUA 2YHBA 3FVRA 3PJRA 1IZZA 4E5SA 1B3RA 5FLXA 1KORA 1XEFA 4DBLE 5HW0A 3HBJA 1LI5A 3ECCA 3LNTA 4C0BA 4GZLA 2YS6A 3STHA 2FZCA 3RTGA 1RC0A 3C3MA 1E79D 3NVAA 1YL7A 4Z8YA 4BNVA 5JXJA 1JHOA 1TEXA 3VTFA 5HZKA 1OKKD 1G3IA 1ONBA 3THWB 2OGZA 1EWKA 3TLBA 3MTIA 1QLHA 5BV1A 3FR7A 4URFA 3WKBA 1KR2A 1NWCA 4G4IA 4MA5A 5IMBA 3QW4B 4BMCA 3PITA 5EFZA 2UYOA 3PUVA 1BJRE 3KLNA 2Q2WA 2F90A 4Z0NA 3ZCRA 4B35A 5DP2A 5IYZF 4WBNF 2WV7A 3GFBA 3O8QA 2A0UA 5DTMA 5IW8A 2OOKA 4PQEA 1P73A 3QJGA 4BRSA 5JVDF 1SHZA 3WYNA 2O4CA 4A9AA 1UEXC 2QN7A 3J81A 3WKAA 4I1VA 1ZM4A 4FX2A 4NRDA 3I2HA 3G7UA 1T1GA 4FIZA 1FYFA 4KPUA 5JNVA 4RA6A 3LF1A 5F5NA 1YB7A 4WFKA 3KSMA 4N9QA 3ROEA 2P9CA 2JJMA 3WAGA 3GJTA 1LK5A 1V26A 3EZXA 1QHEA 3ZIAA 1R15A 1SXJC 2VAVA 3AHCA 4AVYA 3KUUA 4DBZA 4I8IA 3F3KA 1EZ1A 1NXVA 1CZLA 4R2XA 4F3NA 3AG5A 2C20A 2REQA 3LX4A 2VH1A 5JXWA 2W2LD 2R6R1 2VRCD 2FW0A 3KYCA 2ROQA 4YFYA 1HZJA 3L02A 4H4CA 3O2JA 1R5OA 5CBPA 1YRLA 1FS4A 4PO1A 2UVDA 1B6SA 2I03A 3M9XA 4R6XA 3EGXA 2CL7X 4PGAA 1AX9A 3NHSA 5CP8A 1RJFA 4P22A 4RTNA 2Z56A 3AX6A 3Q2OA 2QNIA 2YJ5A 4LNUB 2MSLA 4B74A 4OEHA 3UMJA 5CVJA 1RC1A 4OCZA 4MW6A 5C0OE 1P6XA 4ZGBA 1LLDA 2O7VA 3E9DA 4QEKA 1THZA 4QJ4A 3DC2A 4YTEA 2BCEA 3SMVA 3GLIB 5CG1A 4CQNA 2IS2A 1U0OC 2PZAA 2RG7A 2ZAGA 4AJJA 1U98A 3FJ1A 3IP6A 2ERYA 3A32A 4WY5A 5EOVA 3TQSA 1LQUA 1QH0A 1A72A 1W93A 4XE5A 1KZ9A 1L1EA 4QHSA 2RK4A 2V6JA 2Q5OA 3ICCA 1FJ2A 2AH5A 1J23A 2R6JA 2DXIA 4KACA 3K6SA 1NUPA 1NQVA 5CR9A 4EMSA 2J6BA 3CPHA 3M5CA 1N92A 1NOJA 5LVAA 3Q8MA 3TD2A 4NYIR 1AXGA 3BBPA 4Y9SA 5BYAA 3I6BA 3HFJA 1Y9AA 1C1DA 2R60A 1W4CA 2CFRA