1I5LA

Crystal structure of an sm-like protein (af-sm1) from archaeoglobus fulgidus complexed with short poly-u rna
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
71
structure length
71
Chain Sequence
b'PRPLDVLNRSLKSPVIVRLKGGREFRGTLDGYDIHMNLVLLDAEEIQNGEVVRKVGSVVIRGDTVVFVSPA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 5'-R(*UP*UP*U)-3'
publication title RNA binding in an Sm core domain: X-ray structure and functional analysis of an archaeal Sm protein complex.
pubmed doi rcsb
source organism Archaeoglobus fulgidus
molecule tags Rna binding protein/rna
total genus 14
structure length 71
sequence length 71
chains with identical sequence B, C, D, E, F, G, H, I, J, K, L, M, N
ec nomenclature
pdb deposition date 2001-02-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01423 LSM LSM domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.100 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 1i5lA00
2DTHA 4M77A 4M77F 1LNXA 3RESA 3SWNC 4NL3A 2EAYA 3EFSA 4EMHA 5GAMh 5GAN3 5GAN5 3VU3C 3HSBA 3JB9H 4M7DG 5GAOn 3AHUA 4PJOC 3RIRA 4QVDA 4M7DE 4JUVA 3SWNA 4J6XA 3JCMQ 5GMKl 3FIFA 5GMKh 5GMKm 2RB6A 3V7CA 5GAOq 3SB2A 2JN0A 4M75A 4PJOF 4XTZA 4PJOA 3JCMe 3HFNA 3JCMW 1B34B 1Y96B 3JCMd 1WQ7A 4A54A 4M78C 2HNIA 3EFRA 2DKGA 3PGGA 4NOYA 5GAMg 2VXEA 4C92B 1D3BB 5LJ5e 4C92D 3L1AA 5LJ5d 5LJ3f 3JCMP 4MMLA 4EMGA 3JCMX 5GAN7 4M78A 4C8QB 3RUXA 4XTWA 4XU1A 5GAMj 4C8QD 3BW1A 4C8QF 1I8FA 5GANe 4M7AG 4M7DC 5GANd 1TH7A 2DTOA 3GIBA 2DJZA 5I21A 1YCYA 3V7SA 5LJ3h 4M7AE 4M7DB 5GMKj 1M8VA 4JRKA 2VC8A 3JB9J 4M7DD 3JCMb 2DZCA 4M7DF 2RD1A 1N9SA 4RCBA 3RERA 2E10A 3JCMf 1KQ1A 4M77D 3QHSA 3QO3A 3HFOA 4X9DA 2YLCA 1HXDA 2DXTA 4RCCA 3JCMV 4C92C 5GAMe 5GAOr 5GAMd 4J6WA 4F7UB 4F7UG 5LJ5f 1B34A 1Y96A 2RM4A 4JRIA 3JCMJ 2DXUA 3FJPA 2EJGA 3BFMA 2EJ9A 4Y91A 4C8QC 4F7UE 2CGHA 4C92A 4C92F 1D3BA 4DQ2A 5GMKe 3M4GA 4XU3A 5GMKi 5LJ3j 4XQ3A 1X01A 2YLBA 4OP0A 4C8QA 5LJ3g 5GANf 1LJOA 2E41A 4M7AB 3JB9I 3V8LA 4XU0A 4WF2A 3JB9G 4M75G 4PJOG 1JBMA 4M7AD 2FB7A 3V8JA 2K57A 4N0AC 4M75E 4PJOE 2EJFA 1U1TA 3RKXA 4QVCA 3V7RA 1KQ2A 3RKWA 4M7DA 4EMKB 5GAN4 3BY7A 1HK9A 2ZGWA 4N0AA 2DZ9A 4X9CA 2E64A 4M78G 2YHTA 1N9RA 3RKYA 5GAMf 4NL2A 4V2SA 4M78E 5LJ3e 2VXFA 5LJ3d 2Y90A 5GAOl 3JCMg 3JCMc 4M77G 4M77B 4A53A 5GAOm 2QTXA 2DTIA 4F7UA 2E1HA 3L2ZA 4M77E 4MMKA 4F7UF 5LJ5j 3JCMh 5GAN6 5LJ5g 1JRIA 4M7AC 1WQWA 4XTXA 3SWNB 3FB9A 4M75C 3V8KA 5LJ5h 4HA8A 1WPYA 3QUIA 5GAOp 4M75B 4PJOB 1BIAA 4HT8A 5CAIA 5GANj 3JB9D 4M7AA 4M7AF 4M75D 4PJOD 5GANg 4EMKC 1I5LA 4XTVA 3JB9F 4M75F 2E65A 5GAN2 4J5YA 5DY9A 3BDUA 4J6YA 5GANh 1M5Q1 2FYKA 2I2LA 2RA2A 1U1SA 3QSUA 1LOJA 1I81A 4XTYA 4C92G 4EMKA 1I4K1 1H641 4M78B 5GAN8 2DEQA 4HT9A 2EWNA 4C92E 4PNOA 4M78D 3INZA 1MGQA 4M77C 1BIBA 4M78F 4C8QG 4XTUA 4C8QE 2DVEA 4XU2A 1WNLA 4JLIA
chains in the Genus database with same CATH superfamily
2DTHA 3RMQA 3ASKA 2QEXT 3VYGA 5GAMh 1M30A 2J6OA 3DLLA 3I56T 4PJOC 2MOXA 1I07A 4QVDA 1GCPA 1YI2Q 4BUGA 3FIFA 5GMKh 4WCIA 1YJWT 2K5IA 2HQXA 4X34A 3HFNA 3JCMd 2EFIA 2CKKA 1D3BB 1YJ9T 5GJWB 2K3XA 3RUXA 2XDDA 4AFUC 2M02A 3IQLA 2OTLA 1GRIA 2KK4A 3V7SA 3CXCP 2D0NA 5AT1B 2JZ2A 2DRMA 3TREA 3J7AF 5GAMe 1SSHA 3QKJA 2K3YA 3G4SQ 3VV0A 2LCLA 2CYZB 4BY6C 4F7UE 5GMKe 2HBWA 2BUDA 1VA7A 2K7AA 3JRZA 1XJWB 5KYUB 2CZ6B 2EYZA 2PUOB 1ZA2B 2C0IA 2V1RA 3JB9I 3OS1A 1TSFA 3PMTA 2M9UA 2CP7A 1RL2A 3QXEB 3M0QA 2D8HA 1TUDA 4C5GA 3OMCA 4N4GA 2LCSA 4PJJA 1B7TA 1GL5A 2QTXA 2JS2A 5KE2A 2W10A 3NPFA 3OYEA 2D8JA 2K3BA 2LC4A 4GLMA 4MZPA 3KUFA 2CZ1B 4OB3B 1Y57A 2I0NA 4FT4A 5GANj 1M1KR 1WGSA 5DY9A 1WJRA 2RN8A 1JO8A 4J6YA 2K6DA 1BCOA 3CMAA 4XTYA 2COWA 4FM4B 4ZN3A 2LJ3A 1VQ4Q 4JLGA 4E7LA 1E6HA 1EZZB 2EAYA 2EPDA 2GNCA 2OTJA 2CSIA 3EGXA 5L23A 2RI3A 1QLYA 1AHJB 2KR3A 2J05A 1W2BS 3VRZA 4QQGA 1AZGB 1NPPA 3EG9B 1VQOA 2EQUA 1M2VB 1IREB 3CD6A 1U8RA 5CO7A 3CCEA 4ZN1A 4OGCA 5LJ3h 4QVZA 3THKA 3QZ5B 3UATA 1OPKA 2X51A 1MHNA 1QCNA 5D6WA 3NTIA 1WHMA 2E4HA 3H0IA 2DXTA 1JEGA 2ZAEA 2JVVA 2LP5A 1WYXA 1BBZA 2VWFA 3A8OB 3RNJA 3LWIA 2O31A 2GBQA 2E12A 4J9IA 4OP0A 5KYWB 4J9HA 3JB9G 1B07A 1KIKA 2VB6A 2F2XA 2OTLQ 2FB7A 2RJEA 1VYUA 2D6FA 1MUZA 1OEBA 1YN8A 4EMKB 1W4SA 4OMNA 1MV3A 3GLXA 2BTTA 4E7HA 5LJ3e 3ULRB 4KGVB 2HBPA 4IUPA 3X24B 4MMKA 2AT1B 3EG3A 2V1QA 1QQJA 2QAZA 2HKQB 2OJ2A 2FVUA 1D0YA 2G3RA 5HCKA 4HA8A 3V8KA 1AZEA 4M75B 4LUDA 2RHUA 4AFSC 1KFZA 1QVFS 3NMZC 1ZA1B 4PJMA 3E1SA 2VGMA 3QYGB 3GF5A 3UPUA 2QA4T 2KT8A 4C8QG 2PVDB 1Q81R 4FYXB 1JXMA 1UEBA 1S72A 4JLIA 3VU3C 2LNHB 4M77F 1QP2A 1WFWA 2BKDN 2AIRB 3OYAA 5IHIA 5GAOn 3MP6A 4F14A 4ESRA 2RB6A 1PSFA 2GFAA 2YRVA 1UTIA 2E3IA 1VQPT 2EKHA 2NUZA 4FYYB 3WXMB 3MJXA 3CMAQ 3L1AA 1X6OA 1M8MA 2RJCA 4Z02A 1IHVA 4XTWA 5J26A 4AFQC 1VUBA 2EYQA 1W6XA 1RACB 1E7OA 3P8BB 2OTJQ 3ZEHA 3D7SB 4RCBA 4GLKA 3CC4T 3OYFA 2CP3A 1KQ1A 2DILA 3QO3A 1MMNA 1VQOQ 4C92F 3CD6Q 2WACA 4KGZB 4E7KA 2ZPEB 1ZHIA 3C95A 3CCEQ 4J9CA 5DLOA 2BIVA 3DLMA 1PD0A 2QASA 4XU0A 4WF2A 2ZPIB 1NJIC 2DL8A 1YJNA 3CCRT 4M7DA 3RKXA 3CC2A 1Q86R 2JT4A 1HK9A 3RKYA 1OPLA 4FSSA 1TU0B 1TUGB 2QYZA 3I55T 2DERA 1K0SA 4PL6A 2RQUA 4XTXA 2NWMA 4M75C 1W1FA 2F2WA 4DBRA 2VGNA 1M3BA 4M75D 2FPEA 1WJQA 2CH4A 2KVQG 4C92G 3A5ZB 3L2UA 2J6FA 4C8QE 4OMPA 2OI3A 4B6MA 2COZA 4FT2A 4ELYC 1PNJA 2F69A 1AOJA 1Q95G 3DB3A 1N5ZA 5GAOq 4N4IA 2RJDA 2JMAA 3CCQT 2ZPGB 2FEIA 4OMMA 1SSFA 2Y4YA 3CXCA 5KYXA 4MMLA 4EMGA 2YXYA 4M78A 3CCSA 2LQ8A 3BW1A 2V8IA 4LN2A 3PVLA 2MAMA 2EKOA 2JTFA 3OYKA 1S72Q 4R0KA 2LQKA 4LNPA 5IXBA 5KCOA 2P84A 4M7DF 2WSCE 3I56A 1G5VA 1OOTA 3TQ7P 3EGDA 2LTOA 2YT6A 1EIFA 1YJWA 3MO8A 5I2MA 1NEGA 1PKSA 2FL7A 2K2VA 3PFSA 4D6WA 4DQ2A 2QG9B 1VQNT 2EGCA 4ZNXA 1X01A 3ME9A 5GANf 2YUPA 3EFOB 3HP9A 3E9FA 1F1BB 1KD1C 3V8LA 3FLGA 3QPHA 4RTXA 1WHGA 1KQ2A 5DLQE 5A0DA 2C06A 2ZGWA 1VQLA 2O9VA 2J6KA 2NUTB 3BE3A 1Q82C 1OV3A 5GAOl 2NLUA 4F7UA 5LJ5j 4J9FA 2KYMA 1EX4A 2DBMA 1WQWA 2JMCA 4FW1A 5KH6A 1LVKA 4JDSA 1KQSS 3QUIA 5GAOp 4C5IA 4E6RA 3KBGA 2NUPB 4M7AF 1K8AR 5KE3A 5GANg 1WX6A 1UJ0A 1RAFB 1NG2A 1YJNQ 3CC2Q 4IURA 2QQAA 4CC2A 1WXTA 1AWOA 2DEQA 4C92E 4M78F 1M90C 3OW2S 3OYMA 2A37A 1R77A 1WNLA 3EFSA 2F5TX 2E70A 1WHJA 3VUBA 9ATCB 1G3TA 1BKBA 2ROLA 2VUBA 3G7ZA 1DJ7B 4PJOF 2EQJA 2L89A 5C0MA 4ME7A 4OB1B 3CMET 3L2RA 1YNZA 1P92A 4IUQA 3VS4A 1YITT 4F17A 1GFCA 2RF0A 1NE8A 2H3EB 4CI0C 4M7AG 2BZYA 1K9MR 1J3TA 2QQRA 2PZ1A 3M0PA 4RTWA 3SD4A 4FU6A 1SHFA 2DA9A 2KRNA 4M4ZA 1VOMA 4JJNK 2DETA 4LDUA 1FMVA 2EYYA 3OSSC 4J6WA 4BD3A 2RM4A 3FJPA 3H6ZA 4J7IA 4O5VA 1G2BA 1D3BA 4XU3A 1KC8C 1BI0A 3CCSQ 4PJOG 1JBMA 5FROA 2PUKB 1SG5A 2EJFA 1KHIA 4DOVA 4FIBA 1IRXA 4ORZA 1OI1A 3I56Q 1QCOA 2GCXA 4NL2A 5ECAA 2L3PA 2D9TA 5CCAA 3H8ZA 1YJWQ 4D8KA 5KCHA 2LJ0A 2Z0WA 2X35A 3JCMh 2KRMA 3OA6A 2H8HA 5KYUA 4DOWA 4HVWA 3CCJA 4RMOA 1Q7YR 4J5YA 3SDZA 4R56A 1M5Q1 2FYKA 3AT1B 4A63B 3M57A 5KYNA 4DEYA 4J7FA 3UA6A 1E6GA 2CDTA 1VQLQ 2CS7A 2L3SA 3L2QA 1VYVA 2DIGA 3VS0A 3GNFB 2GF7A 4AG2C 2DD5A 3EG1A 1AWWA 1N8RR 2RH2A 1KJWA 3UDCA 2J06A 4KUDK 1LPLA 2ED1A 2EYWA 3LLRA 1AWXA 3OBWA 4HKEA 1Y96B 3JCMe 3JCMW 1NJIU 4M78C 2DKGA 4FCYA 3EH1A 2CSQA 4LUEA 4HXJA 4BACA 4JJBA 2GTOA 4XAXB 2QA4A 2XHCA 2HL5C 2DO3A 1H8KA 4A4EA 5J39A 5FU6B 4M7AE 2EQIA 3CCMT 2KT1A 1YIJT 1QWEA 5FU7B 1PD1A 4C0FA 1K76A 2LNVA 3RERA 1JU5C 5GJVB 5GAOr 1VQPA 2LQNA 2ABLA 3BFMA 1M2VA 4JZ3A 2IVWA 3C12A 2ZZDA 1JJ2A 1SPKA 5GMKi 1GBQA 1BU1A 4YTLA 1TXQA 4LDVA 5I2SA 3J80E 4RTTA 2KNBB 3FJ5A 3E9GA 4PJOE 2DM1A 1V76A 5CK9A 3HL8A 2YUQA 1TTHB 5GAOm 3L2ZA 3PMIA 1WLPB 5CKBA 3I5RA 1WIEA 4ZTJA 5FRNA 1BIAA 1D1AA 5KYWA 1RAHB 3R6OA 1VQMT 3M0SA 1VQ9T 1NPRA 3G6ET 2YRCA 1CKBA 3CCRA 3QSUA 3S3OA 4EMKA 1I4K1 2KE9A 2EBPA 2FZCB 2OAUA 3M59A 3CCVQ 3TVTA 4XTUA 3PE0A 4A4KA 3I55A 2KGTA 1LNXA 2KRSA 1UGSB 4L6V5 5GAN5 1K73C 2CT4A 3Q1JA 4B9XA 4RG2A 2Y4XA 3EAEA 3SFMA 3V7CA 1KD1U 2JN0A 4M75A 3CCJQ 2HAXA 3QDRB 1ZX6A 2RK2A 1I0CA 3NTKA 3M55A 2HSEB 1Y0MA 3PT9A 1Q82U 1AD5A 3CCLT 1BI1A 1I8FA 1QVGS 3PIOA 2R58A 4EPCA 2RK1A 3M0RA 5CVIA 8AT1B 4JRKA 1N6AA 3FRNA 1EFNA 1XNIA 2DZCA 1FYNA 1IZ6A 4IUVA 2DMOA 3VS7A 1WJSA 4E47A 3QDFA 4E7ZA 7AT1B 2AKKA 4BDYA 2HZYA 5LJ5f 4PFOA 4LDXA 1JXOA 3EHRA 1RAGB 3CCQA 1WHLA 3CBMA 3HRUA 4ZTFA 1KQSP 1M90U 2E41A 2QA4Q 4OGEA 2CREA 1UG1A 1UDLA 4AG1C 4QW2A 1ZQ1A 2AHJB 4X9CA 3H0HA 1W2BA 3OW2P 5I22A 4A53A 1VQPQ 2DTIA 2VYTA 2X9HA 5LJ5g 1VQNA 3L42A 2CT3A 1G8XA 2LRQA 3X20B 3CPWS 4M75F 3MEWA 1WZOA 2RA2A 3EG2A 4NS5A 3OYYA 1NYGA 4Q5WA 4JJDA 2MWPA 4JZ4A 1H92A 4L59A 2LX7A 3LYIA 1QVPA 3META 3JV3A 2IG0A 2OX7A 1IB8A 1Y07A 1UHFA 1KC8U 2DE0X 1OULA 1M3AA 3SB2A 3BDLA 3JAME 1TS9A 1UJYA 4LXCA 5D6YA 3CCRQ 4F16A 1I5OB 4RTVA 4QKUA 4C8QB 5I11A 3G71A 4J9BA 1VQ6T 5A0GA 2A7YA 4BI8B 1RAAB 5GANd 3QIIA 3MCAB 2FZGB 1FX7A 2ENMA 2IPOB 3A8LB 4EDUA 1MMGA 4C0ZA 1D0XA 1YCSB 2DYBA 4QT7A 4X9DA 4DBQA 2MMPA 1QVFA 2EQMA 2EJGA 4Y91A 1JQQA 2CGHA 4N4HA 4R55A 2BZ8A 1ZBJA 1YITA 3M58A 2C0TA 2RNAA 2DBKA 1T0HA 3TSZA 2ED0A 3O8VA 1ZSGA 2FRYA 4MZMA 5CR2A 4N0AA 1D09B 2NYSA 2E64A 5GAMf 2CP0A 2C0OA 4C5HA 3C94A 4M77G 3LX7A 4M77B 2JTMA 4GBQA 2F1LA 3CCQQ 5GAN6 2GQVA 2DFUA 3G1JA 3HHTB 2HKNA 1UGQB 3EFOA 3R6NA 2XG8D 3JB9D 1SEMA 4EMKC 4C0DB 4Z89A 1WI7A 1VQ7T 1NBEB 3A98A 1TG0A 1VYTA 4QQDA 1JJ2P 3MKDA 1M27C 1C1AA 1FWZA 2NUTA 2RHXA 5GAMg 2L3RA 1XQHA 4A4HA 4JS4A 2EQKA 2HSPA 3QZ9B 3VKIA 2YSQA 4HCKA 1VQNQ 2RI2A 2QDYB 2DXBA 1B3QA 1OQKA 2DL3A 2DX1A 1BB9A 2NUPA 2K5FA 2VV5A 1WQ7A 1ZUKA 4C92B 3OYCA 4ATOA 2XICA 1G83A 4C8QD 1X6BA 2R57A 5FWBA 2GTJA 1PKTA 1ZSZB 2V8JA 4FYVB 3CMAT 5IT9E 1C0MA 1X27A 2GFUA 2P0QA 3QHSA 4RCCA 2MPXC 2DL5A 2DEUA 1G3WA 3M4GA 2MK5A 4J8OA 1WHKA 2YLBA 3VUZA 3G71Q 4KRTA 2GGRA 1LJOA 1M2OA 3TU4K 2WSEE 4PJLA 2QEXA 1VQOT 3MHXA 4QVCA 1K73U 3WVEB 3CBOA 3C4SA 1D1BA 3X28B 4PLLA 3OYNA 1VQKT 4VUBA 4V2SA 3WVDB 1WHHA 1BK2A 3E19A 4LD6A 2E1HA 2FO0A 4M77E 2GQIA 1YJ9A 4OVAA 1HYOA 3SWNB 4C5EA 2MCNA 3P8HA 3H41A 1YITQ 2X3WD 1R0CB 2A3LA 2ROTA 1D0ZA 1XTDA 1OZ3A 2LMJA 3M9QA 2FHDA 1M1KC 8ATCB 2E5KA 2PU9B 2G6FX 4M7DG 3AHUA 1OZ2A 2RHIA 1ACMB 2SEMA 4E7IA 1W2BP 2L5QA 2LT1A 3CC7T 3RMSA 2O4XB 2A0FB 1KHCA 4A54A 1VQMA 4J9GA 5FRMA 1BI2A 2P4TA 3G6EA 4C92D 2QGGA 1K0XA 1SRLA 3J81E 5EC7A 3NGPA 3EHQA 5CIUA 1S1NA 2QQSA 4WTOB 2KYBA 1KQSA 3TSWA 3OY9A 3M5AA 1HXDA 3JCMV 3OQ5A 2JXBA 1SKUB 1S72T 1Y96A 1VQ5T 5KYYB 1CKAA 3N5BB 2EW3A 2A28A 2LDMA 4M7AB 3OW2A 2DYIA 1BCMA 3VJPA 3SEMA 3OS0A 3CCLA 4KBMB 2K57A 5IXFA 4N0AC 2KROA 2O9SA 1KG1A 1U1TA 4DEXA 1UUEA 2LX9A 1GBRA 4RG8A 4BE2A 1U06A 3MP1A 1YHQT 4M78G 2X4WA 5D6XA 1KK7A 3CQTA 4F7UF 2M16A 2VKNA 2HQEA 1UFFA 2M51A 1PCXA 3OS5A 5IHNA 4PJOB 1K4US 1QVFP 2ZPFB 2QEXQ 2B8AA 5CKEA 2IIMA 1QKXA 4HT9A 3DKMA 5GAN8 2O88A 3REAB 4DBFA 4D8DA 1RI9A 1PC0A 2RI5A 1BYMA 4NL3A 1YJNT 5GAN3 4BE0A 1YJ9Q 3CC2T 3JB9H 3P8DA 3VS1A 4M7DE 3QYHB 2MIOA 1Q81C 2QXFA 1Z9QA 2E5QA 2HMAA 2FRWA 5HKCA 2XU8A 3PGGA 3CCUT 4X1VA 1IGUA 2K9GA 1G3SA 4TVRA 1RLQC 5LJ5d 2XIDA 3OS2A 4BY6B 5GAMj 4IUTA 4E2FB 2M1HA 1VQ8T 2HCKA 2QTVA 2YUOA 1UGPB 5GMKj 2RHZA 2VC8A 2KY9A 1YP5A 2EVRA 2L0AA 2RD1A 1PHTA 3VS5A 3MP8A 2E10A 3M4YA 3HFOA 3FC3A 3O5ZA 4B9WA 1VQMQ 1NJIR 3URGA 2ECZA 1RABB 3G6EQ 2YWWA 3F70A 2RQWA 2DAQA 2KEAA 3S3MA 2JNGA 1VQ6A 4M7AD 4A4FA 5HK0A 1U3OA 1XOVA 2P0KA 2BZXA 3V7RA 5LL6S 2VVKA 4RTZA 3CCST 1YFNA 4M78E 5J3BA 2EGEA 2FG0A 2WSFE 2JUFA 3EG9A 1Q86C 5IAYA 3RBBB 3A8GB 1UE9A 1AEYA 2P0PA 3VS2A 2KI7A 2KMTA 3HKSA 4HT8A 4PJOD 2LCCA 3CCLQ 1I5LA 3S6WA 3M0TA 3BDUA 3FDRA 3NTHA 4HCBA 1LOJA 2BE9B 1QWFA 3GOXA 4IIMA 3CC4A 4CC3A 1IO6A 1HD3A 3CBPA 2X4YA 1UB4A 2XKOC 3CPFA 2PQWA 1NLOC 3MEUA 1VQLT 1KSWA 1ABQA 2MWOA 1B34B 4MDWA 1TUCA 2HNIA 2O2OA 1MNEA 4NOYA 1VQ7A 3JSCA 2FZKB 2HDAA 1ABOA 2CZ7B 1NYFA 5IH2A 2A36A 5IN1A 4EIKA 2DNUA 2QI2A 3ER0A 1Z9ZA 1QW1A 1AVZC 2COYA 1T3LA 1TH7A 5HY6A 1M8VA 4C0GA 2KAFA 2P4RA 5EG2A 1WXBA 3L2VA 2K79A 1KD1R 5GAMd 1H3HA 2DD4A 2AKLA 3M56A 1YI2T 4IIOA 5LJ3j 4C8QA 5FU6C 2PVOB 2SRCA 1M1KU 1Q82R 1PM3A 5FU7C 3V8JA 4UC4A 1NZ9A 2HD0A 2RQRA 3RKWA 1G3YA 4BB7A 4OF1A 3PNWC 3LW5E 2DZ9A 3LWHA 2RQTA 1X69A 2QQBA 3E2UA 2ESWA 3RDVA 2LZ6B 1M1GA 1QVGA 5CAIA 1VQ6Q 3G4ST 1M90R 1H3ZA 3JB9F 4II1A 5GAN2 5GANh 1ZUUA 2AZVA 1H641 2HQHA 2DVJA 1K8AC 1VQKA 2CUBA 2ZCFB 2F2VA 4M77A 2FPFA 2OAWA 5D7UA 5M9OA 3JCMQ 2LQWA 2E6ZA 3CCVT 4Y28E 2J7IA 2KXCA 3KFVA 2XMFA 1V29B 4LDYA 1NLPC 2M0YA 4OMLA 3CC4Q 4BDZA 1GFDA 2KSSA 1O75A 1MMDA 4QQ6A 4HVUA 2AZSA 3UWNA 4C8QF 3CCJT 5GANe 1GXIE 4ANJA 2YUNA 2DTOA 3GIBA 2B86A 2DLPA 3HRSA 3SHWA 1VQ4T 1KC8R 3JCMf 4AT1B 2RO0A 3CC7A 3CPWA 4Y92A 1K9MC 4Z8AA 4FL6A 1AWJA 1WDXA 4JRIA 3OYDA 1WA7A 3OB9A 1VQ7Q 2V8KA 3DB4A 3HTRA 1PRLC 4C92A 3KXTA 1U5SA 1RUWA 4FSXA 3EH2A 2DRKA 4E7SA 1R8OB 1OU8A 1IGQA 4CC4B 1NEBA 4M75G 3I55Q 3LGLA 2KXDA 4L5GA 2MI6A 1ZSZA 4DA4A 4PK4A 5GAN4 3BY7A 2VASA 3VRYA 1Q81U 1N9RA 4PJNA 1M4ZA 5LJ3d 4JJCA 3JCMg 2CP2A 2JTEA 4IKFA 3EGXB 4RTUA 3MEAA 3QBYA 4AMCA 3CMEA 3PIPA 1VQ5A 1UGVA 1ARKA 1PRMC 1RLPC 4MDXA 3S3NA 2QGFB 4XTVA 2DK3A 4OMOA 3UT1A 2QQ9A 5CKDA 4AFZC 4JRPA 3INZA 1RADB 1YHQA 2HL3A 2OTLT 1Q7YC 1M9SA 2DVEA 1CSKA 5IHKA 3M0UA 1K1ZA 3HPWA 5AYFA 4BI3A 2XK0A 3SWNA 4J6XA 5GMKl 1FMWA 4HCZA 4A4GA 1T0JA 2RQVA 2VXEA 3H0FA 5C6SA 2CH4W 3I35A 3JCMP 2L3QA 2ZPBB 1N8RC 4OB2B 4LD9K 2KBTA 2JJ9A 1O9SA 1VQKQ 2XD0A 2LVMA 1M1FA 5L8RE 5I21A 1YCYA 1Q86U 1LCKA 1X2KA 1SRMA 1N9SA 1FMKA 1HSQA 4PFPA 2O4XA 2YLCA 4C8QC 2K2MA 3CCUA 1X75C 3OSVA 3QJYA 3ZL7C 3I5SA 1MV0B 1ZBXA 1VQ8A 4KH1B 1A0NB 4M75E 1T3SA 4J9EA 4Z88A 3QG1A 3GNGA 2JM8A 2CP5A 3CXCS 2YDLA 2MF2A 1M3CA 4MZTA 3CC7Q 1X43A 2EYXA 4OB0B 5CKHA 2OTJT 3REBB 1GCQA 1YBYA 3TEEA 4IUUA 4JS5A 5KYYA 1HJDA 4KGXB 1VIFA 3OYIA 1QKWA 2K4YA 4M7AA 3H9NA 3A8HB 2RHYA 5A0LA 2L8DA 2E65A 3M53A 1FXXA 3CCMA 2H3JA 4PKCC 3CD6T 1YIJA 4JPBW 1AT1B 2I2LA 3GBQA 4J83A 1I81A 2CUDA 1K73R 3CCET 4PNOA 4M77C 2R5AA 4M77D 2PVGB 4FW2A 3CMEQ 3HSBA 1VQ5Q 3RIRA 3FEOA 3OYHA 4JUVA 4C0DC 2EIFA 4PJOA 4CRIA 1Y71A 4RKUE 3VS6A 1X6GA 4P5NA 1RI0A 2DF6A 5LJ3f 2JOYA 2RPNA 1D1CA 1OU9A 3ZBDA 1UGRB 1QVGP 4XU1A 1YHQQ 2RMOA 1MMAA 2ZPHB 2DJZA 3X26B 4M7DB 3LH0A 3A1PA 2E6NA 3QWXX 4ZGEB 2XDBA 1ZUYA 3I9QA 4JRQA 5DM7R 2D1XA 4J9DA 1UECA 1YWPA 5CQYA 3EGUA 4C92C 2YRDA 3OBYA 1VQ9A 2DXUA 3L2WA 2DL4A 3ZFJA 4GY5A 1JB0E 4KULA 2XI9A 4BI4A 2JS0A 4XQ3A 2X3XD 5LJ3g 4O6JA 1K8AU 2X4JA 1ZSZC 1W70A 4ELZC 1RAIB 1V1CA 2BE7D 1BI3A 1PG5B 1QP3A 4LE9A 4HCCA 3CEYA 3G71T 2M0OA 2VXFA 4KT0E 4K11A 3OYLA 4LDWA 1R0BG 3CCUQ 3NHNA 1VIEA 2FPDA 2E3HA 1YI2A 4OMQA 2DJQA 2AK5A 5LJ5h 1WPYA 3CPWP 1C6VX 5CKFA 2W0ZA 1VQ8Q 1YWOA 4HVVA 3OYJA 2JW4A 4PFZA 2QK0A 5KYXB 4M78B 3MEVA 1K9MU 1RAEB 1K9AA 2L2PA 3JCMJ 2V26A 3SWNC 3RESA 3U23A 4EMHA 4PLIA 3GPLA 4KUIA 2JM9A 1NM7A 3RR6A 3PVQA 1UHCA 3EGDB 3NFCA 5GMKm 2A08A 4FYWB 4XTZA 3GP8A 2CZ0B 3G4SA 3EFRA 3HRTA 2LJ1A 3CCMQ 5CQXA 1YIJQ 5LJ5e 3QJ6A 3JCMX 2DXCA 4ZGJB 5GAN7 1IHWA 4XK8E 2KQWA 4M7DC 1PSEA 3JB9J 3UF4A 4CC7A 4M7DD 4ZGDB 3JCMb 2ATCB 1TOVA 3CCVA 1Y7XA 4F7UB 4F7UG 1B34A 2EJ9A 1ZLMA 1OX9A 2XDPA 5HK3A 1MNDA 1QMCA 2K5LA 2F5KA 1Q7YU 2DPPB 3OYBA 4DBHA 1WXUA 3UA7A 2DL7A 5A2QE 4RTYA 2QDLA 4OMFB 3EG0A 2PNIA 3VYHB 2HEQA 5FLXE 1GCQC 2YHTA 1VQ4A 1OYXA 4BE1A 3C0CA 3OYGA 3QWYA 3VS3A 2Y90A 1QCFA 2RJFA 2PTKA 3PTAA 3JCMc 1VQ9Q 2CP6A 1IXDA 1SHGA 3LGFA 1JRIA 4M7AC 1N8RU 3FB9A 3TCJA 4KH0B 1OX8A 2O01E 1N27A 1X2QA 3A8MB 4RUGA 5FW9A 3X25B 4F04B 6AT1B 1TWBA 2DIQA 2KDSA 2MYSA 5FWCA 2EGAA 1SF9A 3MPUB 4E7JA 1PWTA 1U1SA 3M54A 2X4XA 2EWNA 1JJ2S 4M78D 3T9NA 1MGQA 3LH5A 1BIBA 2D0QB 2R5MA 3OMGA 4XU2A 2LT4A 1I1JA
chains in the Genus database with same CATH topology
2DTHA 3RMQA 3ASKA 4M77A 2QEXT 3VYGA 4JS4A 2EQKA 3EFSA 5GAMh 2F5TX 3QZ9B 3DLLA 2E70A 3VKIA 3I56T 4PJOC 4QVDA 3VUBA 5M9OA 3JCMQ 2RI2A 2QDYB 4BUGA 1G3TA 1BKBA 2DXBA 2E6ZA 2VUBA 3FIFA 5GMKh 3G7ZA 1DJ7B 3CCVT 2K5IA 1YJWT 2HQXA 4X34A 2EQJA 4Y28E 2K5FA 2L89A 4PJOF 3HFNA 2VV5A 5C0MA 3JCMd 1WQ7A 2EFIA 1V29B 4ME7A 4OB1B 2CKKA 4LDYA 4C92B 1D3BB 3OYCA 3CMET 3L2RA 1YJ9T 4ATOA 1P92A 4IUQA 2XICA 1YITT 4BDZA 2K3XA 3RUXA 2KSSA 2XDDA 1O75A 4C8QD 4QQ6A 1NE8A 3UWNA 4C8QF 4CI0C 5GANe 3CCJT 4M7AG 2R57A 2OTLA 1GXIE 2DTOA 3GIBA 2KK4A 2QQRA 3V7SA 2V8JA 3CMAT 3HRSA 3SD4A 1VQ4T 5IT9E 4FU6A 3JCMf 3CC7A 2RO0A 2GFUA 2P0QA 2JZ2A 3QHSA 3CPWA 1K9MC 4JJNK 3TREA 3J7AF 4RCCA 5GAMe 4FL6A 3QKJA 4LDUA 2K3YA 3OSSC 4J6WA 3VV0A 4BD3A 4JRIA 2LCLA 2RM4A 3OYDA 2CYZB 3FJPA 3H6ZA 3OB9A 4J7IA 4BY6C 2V8KA 3DB4A 4O5VA 4F7UE 4C92A 1D3BA 1G3WA 5GMKe 2BUDA 3M4GA 4XU3A 3KXTA 1KC8C 3JRZA 4FSXA 4J8OA 2CZ6B 2YLBA 2PUOB 1R8OB 3VUZA 1BI0A 1LJOA 3JB9I 3OS1A 3TU4K 2WSEE 3PMTA 4M75G 4PJOG 1JBMA 5FROA 2PUKB 2M9UA 3LGLA 2QEXA 1RL2A 1VQOT 2EJFA 4L5GA 1KHIA 2MI6A 3MHXA 3QXEB 4QVCA 4DOVA 1K73U 4DA4A 4FIBA 5GAN4 3BY7A 3WVEB 3CBOA 1OI1A 3C4SA 3X28B 4C5GA 3OMCA 4N4GA 4PLLA 3OYNA 1N9RA 2GCXA 1Q81U 4VUBA 1VQKT 4NL2A 4V2SA 2D9TA 3WVDB 5CCAA 3QSUA 1M4ZA 5LJ3d 3H8ZA 3JCMg 3E19A 4LD6A 5KCHA 2QTXA 4IKFA 2E1HA 5KE2A 4M77E 2X35A 3MEAA 3QBYA 3JCMh 3CMEA 1YJ9A 4OVAA 3PIPA 3OYEA 3OA6A 1VQ5A 3SWNB 4C5EA 3P8HA 2LC4A 4MZPA 4DOWA 3KUFA 2CZ1B 4MDXA 4OB3B 3S3NA 4FT4A 5GANj 2A3LA 3CCJA 4RMOA 4XTVA 1WGSA 2DK3A 4J5YA 5DY9A 1WJRA 3UT1A 4J6YA 3SDZA 4R56A 1M5Q1 2FYKA 1XTDA 1OZ3A 2QQ9A 3M57A 5CKDA 3CMAA 4XTYA 3M9QA 4FM4B 4J7FA 4ZN3A 2FHDA 4JRPA 3INZA 1YHQA 2CS7A 4JLGA 2OTLT 1Q7YC 3L2QA 1M9SA 1M1KC 2DVEA 2DIGA 4E7LA 3GNFB 2GF7A 2EAYA 2OTJA 1H3ZA 2PU9B 3HPWA 5AYFA 4M7DG 2DD5A 4BI3A 3AHUA 1OZ2A 2RHIA 2RI3A 2XK0A 3SWNA 4E7IA 2L5QA 2LT1A 4J6XA 5GMKl 3CC7T 3RMSA 1AHJB 2RH2A 1W2BS 2O4XB 4HCZA 3UDCA 4KUDK 4A4GA 3OBWA 3LLRA 3JCMe 1NJIU 4HKEA 3JCMW 1Y96B 4QQGA 1KHCA 4A54A 1NPPA 4M78C 1VQOA 1VQMA 2DKGA 2EQUA 5FRMA 2VXEA 1BI2A 1IREB 2P4TA 3G6EA 3CD6A 4C92D 1U8RA 5C6SA 3JCMP 4BACA 2ZPBB 1N8RC 4XAXB 5CO7A 4OB2B 3CCEA 4LD9K 3J81E 2QA4A 2XHCA 1O9SA 2XD0A 2DO3A 4ZN1A 2LVMA 4A4EA 1M1FA 5J39A 5L8RE 4OGCA 5CIUA 5FU6B 5I21A 1YCYA 4M7AE 5LJ3h 1Q86U 2QQSA 3CCMT 4QVZA 3QZ5B 1YIJT 5FU7B 1N9SA 1MHNA 5D6WA 4C0FA 1KQSA 2LNVA 3NTIA 3OY9A 3RERA 3M5AA 2O4XA 1HXDA 2DXTA 2YLCA 3OQ5A 3JCMV 5GAOr 1S72T 1VQPA 1Y96A 2JVVA 4C8QC 3BFMA 1VQ5T 3CCUA 1X75C 3A8OB 2IVWA 3C12A 2ZZDA 3LWIA 3N5BB 3OSVA 5GMKi 1JJ2A 3QJYA 4YTLA 2E12A 4OP0A 2LDMA 4M7AB 3OW2A 3VJPA 4LDVA 3JB9G 1ZBXA 3OS0A 3CCLA 4KBMB 5I2SA 3J80E 2FB7A 2RJEA 1VQ8A 2K57A 3E9GA 4N0AC 4M75E 2D6FA 4PJOE 1KG1A 1U1TA 3QG1A 3GNGA 4EMKB 1W4SA 2LX9A 3CXCS 4RG8A 4BE2A 3MP1A 3GLXA 1YHQT 4M78G 2MF2A 5CK9A 3HL8A 4MZTA 4E7HA 5LJ3e 2X4WA 4OB0B 5CKHA 5D6XA 4A4HA 2HBPA 4IUPA 5GAOm 2OTJT 3X24B 3L2ZA 4F7UF 4MMKA 1YBYA 3PMIA 3TEEA 4IUUA 4JS5A 5CKBA 2M16A 2FVUA 2G3RA 2HQEA 3V8KA 4HA8A 4ZTJA 5FRNA 1VIFA 3OS5A 4M75B 3OYIA 1BIAA 4PJOB 2K4YA 4M7AA 3A8HB 3R6OA 2RHYA 1VQMT 5A0LA 2L8DA 1VQ9T 2E65A 1NPRA 2ZPFB 2RHUA 3M53A 2B8AA 1FXXA 5CKEA 2H3JA 4PKCC 3G6ET 3CCMA 1QVFS 1YIJA 3CD6T 2I2LA 4J83A 3CCRA 3E1SA 3S3OA 1I81A 4EMKA 2VGMA 3QYGB 1I4K1 3DKMA 3GF5A 5GAN8 3CCET 4HT9A 3UPUA 4PNOA 2QA4T 4M77C 2OAUA 4C8QG 2PVDB 3M59A 2R5AA 4XTUA 1UEBA 4M77D 4A4KA 4JLIA 3VU3C 1S72A 2RI5A 3I55A 2PVGB 1LNXA 4M77F 1QP2A 1BYMA 4NL3A 1YJNT 2BKDN 3OYAA 5GAN3 1UGSB 4BE0A 4L6V5 5GAN5 3CC2T 1K73C 3HSBA 3JB9H 3Q1JA 5GAOn 3RIRA 3MP6A 3P8DA 3FEOA 3OYHA 4M7DE 4JUVA 3QYHB 4B9XA 4C0DC 4RG2A 1Q81C 2Y4XA 2RB6A 3EAEA 3SFMA 1PSFA 2GFAA 2QXFA 2YRVA 2EIFA 3V7CA 2E5QA 2JN0A 4M75A 1KD1U 1VQPT 4CRIA 4PJOA 1Y71A 2HAXA 4RKUE 5HKCA 3QDRB 2RK2A 2XU8A 3PGGA 4P5NA 3NTKA 3WXMB 3CCUT 1G3SA 1RI0A 4TVRA 3L1AA 3M55A 5LJ3f 1X6OA 5LJ5d 2JOYA 2RJCA 2XIDA 3OS2A 4Z02A 3ZBDA 4BY6B 4XTWA 1UGRB 4XU1A 3PT9A 5J26A 5GAMj 1Q82U 3CCLT 4IUTA 1BI1A 1I8FA 2M1HA 1QVGS 1VQ8T 3PIOA 2R58A 4EPCA 2ZPHB 2DJZA 2RK1A 3X26B 1VUBA 2EYQA 5CVIA 4M7DB 1UGPB 5GMKj 3LH0A 2RHZA 3P8BB 4JRKA 2VC8A 2KY9A 3ZEHA 1N6AA 3FRNA 1XNIA 2DZCA 2E6NA 2RD1A 4RCBA 1IZ6A 4GLKA 4IUVA 4ZGEB 3CC4T 2XDBA 3OYFA 3MP8A 2E10A 1WJSA 4E47A 1KQ1A 5DM7R 4JRQA 3QO3A 3M4YA 3HFOA 3FC3A 5CQYA 4C92C 4BDYA 3OBYA 1VQ9A 4B9WA 5LJ5f 4LDXA 2DXUA 3L2WA 3URGA 3ZFJA 3CCQA 4GY5A 4C92F 1JB0E 2WACA 4KULA 4E7KA 2XI9A 3F70A 2ZPEB 3CBMA 3HRUA 4BI4A 4ZTFA 4XQ3A 1ZHIA 3C95A 2DAQA 5LJ3g 4O6JA 5DLOA 2BIVA 2JNGA 2E41A 3DLMA 4OGEA 3S3MA 1K8AU 2X4JA 1VQ6A 4XU0A 4WF2A 4A4FA 4M7AD 2ZPIB 4ELZC 5HK0A 1NJIC 1YJNA 1BI3A 3CCRT 1XOVA 3RKXA 3CC2A 2P0KA 3V7RA 4M7DA 1QP3A 4QW2A 1HK9A 5LL6S 1ZQ1A 4HCCA 2AHJB 3CEYA 4X9CA 3RKYA 3G71T 1W2BA 3CCST 2M0OA 4M78E 5J3BA 2VXFA 4KT0E 2L3RA 3I55T 2WSFE 4A53A 3OYLA 2JUFA 2DTIA 4LDWA 2VYTA 1Q86C 5IAYA 3A8GB 4PL6A 5LJ5g 1VIEA 2P0PA 4XTXA 1VQNA 3L42A 4M75C 1YI2A 5LJ5h 1WPYA 2VGNA 1M90U 2KMTA 3HKSA 2LRQA 4HT8A 5CKFA 3X20B 3CPWS 4M75D 2LCCA 4PJOD 1I5LA 4M75F 3S6WA 1WJQA 3MEWA 3OYJA 3BDUA 3FDRA 3NTHA 2RA2A 4HCBA 2KVQG 1LOJA 4C92G 3A5ZB 4M78B 3GOXA 3CC4A 3MEVA 4NS5A 3CBPA 3OYYA 2X4YA 3L2UA 1K9MU 4Q5WA 4C8QE 1UB4A 2MWPA 2XKOC 3JCMJ 3SWNC 3RESA 3CPFA 3LYIA 3META 1QVPA 4FT2A 2PQWA 4L59A 2IG0A 4PLIA 4EMHA 4ELYC 2F69A 4KUIA 1Y07A 1KC8U 3MEUA 3DB3A 1VQLT 5GMKm 3NFCA 5GAOq 3SB2A 2MWOA 4XTZA 3GP8A 2CZ0B 4N4IA 2RJDA 1B34B 4MDWA 3G4SA 2HNIA 3BDLA 3EFRA 3HRTA 4NOYA 5GAMg 5CQXA 3JAME 3CCQT 1VQ7A 3JSCA 5D6YA 5LJ5e 2ZPGB 3QJ6A 1SSFA 2Y4YA 3CXCA 2CZ7B 4MMLA 4EMGA 3JCMX 2DXCA 4M78A 4C8QB 4ZGJB 5GAN7 3G71A 5IN1A 3CCSA 2LQ8A 3BW1A 4XK8E 2V8IA 5A0GA 1VQ6T 2MAMA 2QI2A 2A7YA 2EKOA 2JTFA 4BI8B 3OYKA 3ER0A 2KQWA 4M7DC 1QW1A 5GANd 1TH7A 1PSEA 2LQKA 5HY6A 5KCOA 1M8VA 4C0GA 3QIIA 3JB9J 4M7DD 2KAFA 4ZGDB 3MCAB 3JCMb 4M7DF 1FX7A 2WSCE 5EG2A 3A8LB 4EDUA 3I56A 1G5VA 3L2VA 4C0ZA 2LTOA 4X9DA 1EIFA 3CCVA 1YJWA 5GAMd 1Y7XA 2MMPA 4F7UB 4F7UG 1B34A 3MO8A 5I2MA 1QVFA 2DD4A 2EQMA 2EJGA 2FL7A 2EJ9A 2K2VA 3PFSA 4Y91A 2CGHA 4D6WA 4N4HA 4DQ2A 3M56A 1VQNT 4R55A 1YI2T 2XDPA 5HK3A 5LJ3j 2K5LA 1X01A 3ME9A 2F5KA 3M58A 5FU6C 3HP9A 3E9FA 4C8QA 2PVOB 5GANf 1YITA 1KD1C 1Q7YU 1M1KU 2DPPB 3FLGA 3V8LA 3QPHA 3OYBA 5FU7C 3V8JA 4UC4A 3GPLA 1NZ9A 2HD0A 5A2QE 1KQ2A 5DLQE 1G3YA 3O8VA 3RKWA 5A0DA 4OMFB 4BB7A 4OF1A 4MZMA 2C06A 5CR2A 2ZGWA 3PNWC 3LW5E 2DZ9A 4N0AA 3VYHB 5FLXE 2E64A 3LWHA 1VQLA 2YHTA 5GAMf 1OYXA 4BE1A 1VQ4A 1Q82C 3OYGA 2Y90A 2RJFA 4C5HA 5GAOl 3PTAA 3JCMc 3C94A 4M77G 3LX7A 4M77B 2NLUA 4F7UA 2JTMA 2QQBA 5LJ5j 5GAN6 3LGFA 1JRIA 4M7AC 2GQVA 1WQWA 1N8RU 5KH6A 3FB9A 3TCJA 4JDSA 1KQSS 3HHTB 1M1GA 3QUIA 2O01E 5GAOp 4C5IA 1UGQB 1N27A 3KBGA 2XG8D 3A8MB 5CAIA 3JB9D 3X25B 3G4ST 1QVGA 4M7AF 2DIQA 5KE3A 5GANg 4EMKC 3JB9F 2KDSA 4C0DB 4II1A 5GAN2 1VQ7T 5GANh 4E7JA 4IURA 4QQDA 1U1SA 2QQAA 3M54A 1H641 2X4XA 2DEQA 2EWNA 4C92E 1JJ2S 1FWZA 4M78D 3T9NA 1MGQA 1BIBA 4M78F 1K8AC 1M90C 2RHXA 2D0QB 1VQKA 2R5MA 3OW2S 3OMGA 3OYMA 2ZCFB 4XU2A 2LT4A 1WNLA 1XQHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2DTH A;  4M77 A;  4M77 F;  1LNX A;  3RES A;  3SWN C;  4NL3 A;  2EAY A;  3EFS A;  4EMH A;  5GAM h;  5GAN 3;  5GAN 5;  3VU3 C;  3HSB A;  3JB9 H;  4M7D G;  5GAO n;  3AHU A;  4PJO C;  3RIR A;  4QVD A;  4M7D E;  4JUV A;  3SWN A;  4J6X A;  3JCM Q;  5GMK l;  3FIF A;  5GMK h;  5GMK m;  2RB6 A;  3V7C A;  5GAO q;  3SB2 A;  2JN0 A;  4M75 A;  4PJO F;  4XTZ A;  4PJO A;  3JCM e;  3HFN A;  3JCM W;  1B34 B;  1Y96 B;  3JCM d;  1WQ7 A;  4A54 A;  4M78 C;  2HNI A;  3EFR A;  2DKG A;  3PGG A;  4NOY A;  5GAM g;  2VXE A;  4C92 B;  1D3B B;  5LJ5 e;  4C92 D;  3L1A A;  5LJ5 d;  5LJ3 f;  3JCM P;  4MML A;  4EMG A;  3JCM X;  5GAN 7;  4M78 A;  4C8Q B;  3RUX A;  4XTW A;  4XU1 A;  5GAM j;  4C8Q D;  3BW1 A;  4C8Q F;  1I8F A;  5GAN e;  4M7A G;  4M7D C;  5GAN d;  1TH7 A;  2DTO A;  3GIB A;  2DJZ A;  5I21 A;  1YCY A;  3V7S A;  5LJ3 h;  4M7A E;  4M7D B;  5GMK j;  1M8V A;  4JRK A;  2VC8 A;  3JB9 J;  4M7D D;  3JCM b;  2DZC A;  4M7D F;  2RD1 A;  1N9S A;  4RCB A;  3RER A;  2E10 A;  3JCM f;  1KQ1 A;  4M77 D;  3QHS A;  3QO3 A;  3HFO A;  4X9D A;  2YLC A;  1HXD A;  2DXT A;  4RCC A;  3JCM V;  4C92 C;  5GAM e;  5GAO r;  5GAM d;  4J6W A;  4F7U B;  4F7U G;  5LJ5 f;  1B34 A;  1Y96 A;  2RM4 A;  4JRI A;  3JCM J;  2DXU A;  3FJP A;  2EJG A;  3BFM A;  2EJ9 A;  4Y91 A;  4C8Q C;  4F7U E;  2CGH A;  4C92 A;  4C92 F;  1D3B A;  4DQ2 A;  5GMK e;  3M4G A;  4XU3 A;  5GMK i;  5LJ3 j;  4XQ3 A;  1X01 A;  2YLB A;  4OP0 A;  4C8Q A;  5LJ3 g;  5GAN f;  1LJO A;  2E41 A;  4M7A B;  3JB9 I;  3V8L A;  4XU0 A;  4WF2 A;  3JB9 G;  4M75 G;  4PJO G;  1JBM A;  4M7A D;  2FB7 A;  3V8J A;  2K57 A;  4N0A C;  4M75 E;  4PJO E;  2EJF A;  1U1T A;  3RKX A;  4QVC A;  3V7R A;  1KQ2 A;  3RKW A;  4M7D A;  4EMK B;  5GAN 4;  3BY7 A;  1HK9 A;  2ZGW A;  4N0A A;  2DZ9 A;  4X9C A;  2E64 A;  4M78 G;  2YHT A;  1N9R A;  3RKY A;  5GAM f;  4NL2 A;  4V2S A;  4M78 E;  5LJ3 e;  2VXF A;  5LJ3 d;  2Y90 A;  5GAO l;  3JCM g;  3JCM c;  4M77 G;  4M77 B;  4A53 A;  5GAO m;  2QTX A;  2DTI A;  4F7U A;  2E1H A;  3L2Z A;  4M77 E;  4MMK A;  4F7U F;  5LJ5 j;  3JCM h;  5GAN 6;  5LJ5 g;  1JRI A;  4M7A C;  1WQW A;  4XTX A;  3SWN B;  3FB9 A;  4M75 C;  3V8K A;  5LJ5 h;  4HA8 A;  1WPY A;  3QUI A;  5GAO p;  4M75 B;  4PJO B;  1BIA A;  4HT8 A;  5CAI A;  5GAN j;  3JB9 D;  4M7A A;  4M7A F;  4M75 D;  4PJO D;  5GAN g;  4EMK C;  1I5L A;  4XTV A;  3JB9 F;  4M75 F;  2E65 A;  5GAN 2;  4J5Y A;  5DY9 A;  3BDU A;  4J6Y A;  5GAN h;  1M5Q 1;  2FYK A;  2I2L A;  2RA2 A;  1U1S A;  3QSU A;  1LOJ A;  1I81 A;  4XTY A;  4C92 G;  4EMK A;  1I4K 1;  1H64 1;  4M78 B;  5GAN 8;  2DEQ A;  4HT9 A;  2EWN A;  4C92 E;  4PNO A;  4M78 D;  3INZ A;  1MGQ A;  4M77 C;  1BIB A;  4M78 F;  4C8Q G;  4XTU A;  4C8Q E;  2DVE A;  4XU2 A;  1WNL A;  4JLI A; 
#chains in the Genus database with same CATH topology
 2DTH A;  3RMQ A;  3ASK A;  2QEX T;  3VYG A;  5GAM h;  1M30 A;  2J6O A;  3DLL A;  3I56 T;  4PJO C;  2MOX A;  1I07 A;  4QVD A;  1GCP A;  1YI2 Q;  4BUG A;  3FIF A;  5GMK h;  4WCI A;  1YJW T;  2K5I A;  2HQX A;  4X34 A;  3HFN A;  3JCM d;  2EFI A;  2CKK A;  1D3B B;  1YJ9 T;  5GJW B;  2K3X A;  3RUX A;  2XDD A;  4AFU C;  2M02 A;  3IQL A;  2OTL A;  1GRI A;  2KK4 A;  3V7S A;  3CXC P;  2D0N A;  5AT1 B;  2JZ2 A;  2DRM A;  3TRE A;  3J7A F;  5GAM e;  1SSH A;  3QKJ A;  2K3Y A;  3G4S Q;  3VV0 A;  2LCL A;  2CYZ B;  4BY6 C;  4F7U E;  5GMK e;  2HBW A;  2BUD A;  1VA7 A;  2K7A A;  3JRZ A;  1XJW B;  5KYU B;  2CZ6 B;  2EYZ A;  2PUO B;  1ZA2 B;  2C0I A;  2V1R A;  3JB9 I;  3OS1 A;  1TSF A;  3PMT A;  2M9U A;  2CP7 A;  1RL2 A;  3QXE B;  3M0Q A;  2D8H A;  1TUD A;  4C5G A;  3OMC A;  4N4G A;  2LCS A;  4PJJ A;  1B7T A;  1GL5 A;  2QTX A;  2JS2 A;  5KE2 A;  2W10 A;  3NPF A;  3OYE A;  2D8J A;  2K3B A;  2LC4 A;  4GLM A;  4MZP A;  3KUF A;  2CZ1 B;  4OB3 B;  1Y57 A;  2I0N A;  4FT4 A;  5GAN j;  1M1K R;  1WGS A;  5DY9 A;  1WJR A;  2RN8 A;  1JO8 A;  4J6Y A;  2K6D A;  1BCO A;  3CMA A;  4XTY A;  2COW A;  4FM4 B;  4ZN3 A;  2LJ3 A;  1VQ4 Q;  4JLG A;  4E7L A;  1E6H A;  1EZZ B;  2EAY A;  2EPD A;  2GNC A;  2OTJ A;  2CSI A;  3EGX A;  5L23 A;  2RI3 A;  1QLY A;  1AHJ B;  2KR3 A;  2J05 A;  1W2B S;  3VRZ A;  4QQG A;  1AZG B;  1NPP A;  3EG9 B;  1VQO A;  2EQU A;  1M2V B;  1IRE B;  3CD6 A;  1U8R A;  5CO7 A;  3CCE A;  4ZN1 A;  4OGC A;  5LJ3 h;  4QVZ A;  3THK A;  3QZ5 B;  3UAT A;  1OPK A;  2X51 A;  1MHN A;  1QCN A;  5D6W A;  3NTI A;  1WHM A;  2E4H A;  3H0I A;  2DXT A;  1JEG A;  2ZAE A;  2JVV A;  2LP5 A;  1WYX A;  1BBZ A;  2VWF A;  3A8O B;  3RNJ A;  3LWI A;  2O31 A;  2GBQ A;  2E12 A;  4J9I A;  4OP0 A;  5KYW B;  4J9H A;  3JB9 G;  1B07 A;  1KIK A;  2VB6 A;  2F2X A;  2OTL Q;  2FB7 A;  2RJE A;  1VYU A;  2D6F A;  1MUZ A;  1OEB A;  1YN8 A;  4EMK B;  1W4S A;  4OMN A;  1MV3 A;  3GLX A;  2BTT A;  4E7H A;  5LJ3 e;  3ULR B;  4KGV B;  2HBP A;  4IUP A;  3X24 B;  4MMK A;  2AT1 B;  3EG3 A;  2V1Q A;  1QQJ A;  2QAZ A;  2HKQ B;  2OJ2 A;  2FVU A;  1D0Y A;  2G3R A;  5HCK A;  4HA8 A;  3V8K A;  1AZE A;  4M75 B;  4LUD A;  2RHU A;  4AFS C;  1KFZ A;  1QVF S;  3NMZ C;  1ZA1 B;  4PJM A;  3E1S A;  2VGM A;  3QYG B;  3GF5 A;  3UPU A;  2QA4 T;  2KT8 A;  4C8Q G;  2PVD B;  1Q81 R;  4FYX B;  1JXM A;  1UEB A;  1S72 A;  4JLI A;  3VU3 C;  2LNH B;  4M77 F;  1QP2 A;  1WFW A;  2BKD N;  2AIR B;  3OYA A;  5IHI A;  5GAO n;  3MP6 A;  4F14 A;  4ESR A;  2RB6 A;  1PSF A;  2GFA A;  2YRV A;  1UTI A;  2E3I A;  1VQP T;  2EKH A;  2NUZ A;  4FYY B;  3WXM B;  3MJX A;  3CMA Q;  3L1A A;  1X6O A;  1M8M A;  2RJC A;  4Z02 A;  1IHV A;  4XTW A;  5J26 A;  4AFQ C;  1VUB A;  2EYQ A;  1W6X A;  1RAC B;  1E7O A;  3P8B B;  2OTJ Q;  3ZEH A;  3D7S B;  4RCB A;  4GLK A;  3CC4 T;  3OYF A;  2CP3 A;  1KQ1 A;  2DIL A;  3QO3 A;  1MMN A;  1VQO Q;  4C92 F;  3CD6 Q;  2WAC A;  4KGZ B;  4E7K A;  2ZPE B;  1ZHI A;  3C95 A;  3CCE Q;  4J9C A;  5DLO A;  2BIV A;  3DLM A;  1PD0 A;  2QAS A;  4XU0 A;  4WF2 A;  2ZPI B;  1NJI C;  2DL8 A;  1YJN A;  3CCR T;  4M7D A;  3RKX A;  3CC2 A;  1Q86 R;  2JT4 A;  1HK9 A;  3RKY A;  1OPL A;  4FSS A;  1TU0 B;  1TUG B;  2QYZ A;  3I55 T;  2DER A;  1K0S A;  4PL6 A;  2RQU A;  4XTX A;  2NWM A;  4M75 C;  1W1F A;  2F2W A;  4DBR A;  2VGN A;  1M3B A;  4M75 D;  2FPE A;  1WJQ A;  2CH4 A;  2KVQ G;  4C92 G;  3A5Z B;  3L2U A;  2J6F A;  4C8Q E;  4OMP A;  2OI3 A;  4B6M A;  2COZ A;  4FT2 A;  4ELY C;  1PNJ A;  2F69 A;  1AOJ A;  1Q95 G;  3DB3 A;  1N5Z A;  5GAO q;  4N4I A;  2RJD A;  2JMA A;  3CCQ T;  2ZPG B;  2FEI A;  4OMM A;  1SSF A;  2Y4Y A;  3CXC A;  5KYX A;  4MML A;  4EMG A;  2YXY A;  4M78 A;  3CCS A;  2LQ8 A;  3BW1 A;  2V8I A;  4LN2 A;  3PVL A;  2MAM A;  2EKO A;  2JTF A;  3OYK A;  1S72 Q;  4R0K A;  2LQK A;  4LNP A;  5IXB A;  5KCO A;  2P84 A;  4M7D F;  2WSC E;  3I56 A;  1G5V A;  1OOT A;  3TQ7 P;  3EGD A;  2LTO A;  2YT6 A;  1EIF A;  1YJW A;  3MO8 A;  5I2M A;  1NEG A;  1PKS A;  2FL7 A;  2K2V A;  3PFS A;  4D6W A;  4DQ2 A;  2QG9 B;  1VQN T;  2EGC A;  4ZNX A;  1X01 A;  3ME9 A;  5GAN f;  2YUP A;  3EFO B;  3HP9 A;  3E9F A;  1F1B B;  1KD1 C;  3V8L A;  3FLG A;  3QPH A;  4RTX A;  1WHG A;  1KQ2 A;  5DLQ E;  5A0D A;  2C06 A;  2ZGW A;  1VQL A;  2O9V A;  2J6K A;  2NUT B;  3BE3 A;  1Q82 C;  1OV3 A;  5GAO l;  2NLU A;  4F7U A;  5LJ5 j;  4J9F A;  2KYM A;  1EX4 A;  2DBM A;  1WQW A;  2JMC A;  4FW1 A;  5KH6 A;  1LVK A;  4JDS A;  1KQS S;  3QUI A;  5GAO p;  4C5I A;  4E6R A;  3KBG A;  2NUP B;  4M7A F;  1K8A R;  5KE3 A;  5GAN g;  1WX6 A;  1UJ0 A;  1RAF B;  1NG2 A;  1YJN Q;  3CC2 Q;  4IUR A;  2QQA A;  4CC2 A;  1WXT A;  1AWO A;  2DEQ A;  4C92 E;  4M78 F;  1M90 C;  3OW2 S;  3OYM A;  2A37 A;  1R77 A;  1WNL A;  3EFS A;  2F5T X;  2E70 A;  1WHJ A;  3VUB A;  9ATC B;  1G3T A;  1BKB A;  2ROL A;  2VUB A;  3G7Z A;  1DJ7 B;  4PJO F;  2EQJ A;  2L89 A;  5C0M A;  4ME7 A;  4OB1 B;  3CME T;  3L2R A;  1YNZ A;  1P92 A;  4IUQ A;  3VS4 A;  1YIT T;  4F17 A;  1GFC A;  2RF0 A;  1NE8 A;  2H3E B;  4CI0 C;  4M7A G;  2BZY A;  1K9M R;  1J3T A;  2QQR A;  2PZ1 A;  3M0P A;  4RTW A;  3SD4 A;  4FU6 A;  1SHF A;  2DA9 A;  2KRN A;  4M4Z A;  1VOM A;  4JJN K;  2DET A;  4LDU A;  1FMV A;  2EYY A;  3OSS C;  4J6W A;  4BD3 A;  2RM4 A;  3FJP A;  3H6Z A;  4J7I A;  4O5V A;  1G2B A;  1D3B A;  4XU3 A;  1KC8 C;  1BI0 A;  3CCS Q;  4PJO G;  1JBM A;  5FRO A;  2PUK B;  1SG5 A;  2EJF A;  1KHI A;  4DOV A;  4FIB A;  1IRX A;  4ORZ A;  1OI1 A;  3I56 Q;  1QCO A;  2GCX A;  4NL2 A;  5ECA A;  2L3P A;  2D9T A;  5CCA A;  3H8Z A;  1YJW Q;  4D8K A;  5KCH A;  2LJ0 A;  2Z0W A;  2X35 A;  3JCM h;  2KRM A;  3OA6 A;  2H8H A;  5KYU A;  4DOW A;  4HVW A;  3CCJ A;  4RMO A;  1Q7Y R;  4J5Y A;  3SDZ A;  4R56 A;  1M5Q 1;  2FYK A;  3AT1 B;  4A63 B;  3M57 A;  5KYN A;  4DEY A;  4J7F A;  3UA6 A;  1E6G A;  2CDT A;  1VQL Q;  2CS7 A;  2L3S A;  3L2Q A;  1VYV A;  2DIG A;  3VS0 A;  3GNF B;  2GF7 A;  4AG2 C;  2DD5 A;  3EG1 A;  1AWW A;  1N8R R;  2RH2 A;  1KJW A;  3UDC A;  2J06 A;  4KUD K;  1LPL A;  2ED1 A;  2EYW A;  3LLR A;  1AWX A;  3OBW A;  4HKE A;  1Y96 B;  3JCM e;  3JCM W;  1NJI U;  4M78 C;  2DKG A;  4FCY A;  3EH1 A;  2CSQ A;  4LUE A;  4HXJ A;  4BAC A;  4JJB A;  2GTO A;  4XAX B;  2QA4 A;  2XHC A;  2HL5 C;  2DO3 A;  1H8K A;  4A4E A;  5J39 A;  5FU6 B;  4M7A E;  2EQI A;  3CCM T;  2KT1 A;  1YIJ T;  1QWE A;  5FU7 B;  1PD1 A;  4C0F A;  1K76 A;  2LNV A;  3RER A;  1JU5 C;  5GJV B;  5GAO r;  1VQP A;  2LQN A;  2ABL A;  3BFM A;  1M2V A;  4JZ3 A;  2IVW A;  3C12 A;  2ZZD A;  1JJ2 A;  1SPK A;  5GMK i;  1GBQ A;  1BU1 A;  4YTL A;  1TXQ A;  4LDV A;  5I2S A;  3J80 E;  4RTT A;  2KNB B;  3FJ5 A;  3E9G A;  4PJO E;  2DM1 A;  1V76 A;  5CK9 A;  3HL8 A;  2YUQ A;  1TTH B;  5GAO m;  3L2Z A;  3PMI A;  1WLP B;  5CKB A;  3I5R A;  1WIE A;  4ZTJ A;  5FRN A;  1BIA A;  1D1A A;  5KYW A;  1RAH B;  3R6O A;  1VQM T;  3M0S A;  1VQ9 T;  1NPR A;  3G6E T;  2YRC A;  1CKB A;  3CCR A;  3QSU A;  3S3O A;  4EMK A;  1I4K 1;  2KE9 A;  2EBP A;  2FZC B;  2OAU A;  3M59 A;  3CCV Q;  3TVT A;  4XTU A;  3PE0 A;  4A4K A;  3I55 A;  2KGT A;  1LNX A;  2KRS A;  1UGS B;  4L6V 5;  5GAN 5;  1K73 C;  2CT4 A;  3Q1J A;  4B9X A;  4RG2 A;  2Y4X A;  3EAE A;  3SFM A;  3V7C A;  1KD1 U;  2JN0 A;  4M75 A;  3CCJ Q;  2HAX A;  3QDR B;  1ZX6 A;  2RK2 A;  1I0C A;  3NTK A;  3M55 A;  2HSE B;  1Y0M A;  3PT9 A;  1Q82 U;  1AD5 A;  3CCL T;  1BI1 A;  1I8F A;  1QVG S;  3PIO A;  2R58 A;  4EPC A;  2RK1 A;  3M0R A;  5CVI A;  8AT1 B;  4JRK A;  1N6A A;  3FRN A;  1EFN A;  1XNI A;  2DZC A;  1FYN A;  1IZ6 A;  4IUV A;  2DMO A;  3VS7 A;  1WJS A;  4E47 A;  3QDF A;  4E7Z A;  7AT1 B;  2AKK A;  4BDY A;  2HZY A;  5LJ5 f;  4PFO A;  4LDX A;  1JXO A;  3EHR A;  1RAG B;  3CCQ A;  1WHL A;  3CBM A;  3HRU A;  4ZTF A;  1KQS P;  1M90 U;  2E41 A;  2QA4 Q;  4OGE A;  2CRE A;  1UG1 A;  1UDL A;  4AG1 C;  4QW2 A;  1ZQ1 A;  2AHJ B;  4X9C A;  3H0H A;  1W2B A;  3OW2 P;  5I22 A;  4A53 A;  1VQP Q;  2DTI A;  2VYT A;  2X9H A;  5LJ5 g;  1VQN A;  3L42 A;  2CT3 A;  1G8X A;  2LRQ A;  3X20 B;  3CPW S;  4M75 F;  3MEW A;  1WZO A;  2RA2 A;  3EG2 A;  4NS5 A;  3OYY A;  1NYG A;  4Q5W A;  4JJD A;  2MWP A;  4JZ4 A;  1H92 A;  4L59 A;  2LX7 A;  3LYI A;  1QVP A;  3MET A;  3JV3 A;  2IG0 A;  2OX7 A;  1IB8 A;  1Y07 A;  1UHF A;  1KC8 U;  2DE0 X;  1OUL A;  1M3A A;  3SB2 A;  3BDL A;  3JAM E;  1TS9 A;  1UJY A;  4LXC A;  5D6Y A;  3CCR Q;  4F16 A;  1I5O B;  4RTV A;  4QKU A;  4C8Q B;  5I11 A;  3G71 A;  4J9B A;  1VQ6 T;  5A0G A;  2A7Y A;  4BI8 B;  1RAA B;  5GAN d;  3QII A;  3MCA B;  2FZG B;  1FX7 A;  2ENM A;  2IPO B;  3A8L B;  4EDU A;  1MMG A;  4C0Z A;  1D0X A;  1YCS B;  2DYB A;  4QT7 A;  4X9D A;  4DBQ A;  2MMP A;  1QVF A;  2EQM A;  2EJG A;  4Y91 A;  1JQQ A;  2CGH A;  4N4H A;  4R55 A;  2BZ8 A;  1ZBJ A;  1YIT A;  3M58 A;  2C0T A;  2RNA A;  2DBK A;  1T0H A;  3TSZ A;  2ED0 A;  3O8V A;  1ZSG A;  2FRY A;  4MZM A;  5CR2 A;  4N0A A;  1D09 B;  2NYS A;  2E64 A;  5GAM f;  2CP0 A;  2C0O A;  4C5H A;  3C94 A;  4M77 G;  3LX7 A;  4M77 B;  2JTM A;  4GBQ A;  2F1L A;  3CCQ Q;  5GAN 6;  2GQV A;  2DFU A;  3G1J A;  3HHT B;  2HKN A;  1UGQ B;  3EFO A;  3R6N A;  2XG8 D;  3JB9 D;  1SEM A;  4EMK C;  4C0D B;  4Z89 A;  1WI7 A;  1VQ7 T;  1NBE B;  3A98 A;  1TG0 A;  1VYT A;  4QQD A;  1JJ2 P;  3MKD A;  1M27 C;  1C1A A;  1FWZ A;  2NUT A;  2RHX A;  5GAM g;  2L3R A;  1XQH A;  4A4H A;  4JS4 A;  2EQK A;  2HSP A;  3QZ9 B;  3VKI A;  2YSQ A;  4HCK A;  1VQN Q;  2RI2 A;  2QDY B;  2DXB A;  1B3Q A;  1OQK A;  2DL3 A;  2DX1 A;  1BB9 A;  2NUP A;  2K5F A;  2VV5 A;  1WQ7 A;  1ZUK A;  4C92 B;  3OYC A;  4ATO A;  2XIC A;  1G83 A;  4C8Q D;  1X6B A;  2R57 A;  5FWB A;  2GTJ A;  1PKT A;  1ZSZ B;  2V8J A;  4FYV B;  3CMA T;  5IT9 E;  1C0M A;  1X27 A;  2GFU A;  2P0Q A;  3QHS A;  4RCC A;  2MPX C;  2DL5 A;  2DEU A;  1G3W A;  3M4G A;  2MK5 A;  4J8O A;  1WHK A;  2YLB A;  3VUZ A;  3G71 Q;  4KRT A;  2GGR A;  1LJO A;  1M2O A;  3TU4 K;  2WSE E;  4PJL A;  2QEX A;  1VQO T;  3MHX A;  4QVC A;  1K73 U;  3WVE B;  3CBO A;  3C4S A;  1D1B A;  3X28 B;  4PLL A;  3OYN A;  1VQK T;  4VUB A;  4V2S A;  3WVD B;  1WHH A;  1BK2 A;  3E19 A;  4LD6 A;  2E1H A;  2FO0 A;  4M77 E;  2GQI A;  1YJ9 A;  4OVA A;  1HYO A;  3SWN B;  4C5E A;  2MCN A;  3P8H A;  3H41 A;  1YIT Q;  2X3W D;  1R0C B;  2A3L A;  2ROT A;  1D0Z A;  1XTD A;  1OZ3 A;  2LMJ A;  3M9Q A;  2FHD A;  1M1K C;  8ATC B;  2E5K A;  2PU9 B;  2G6F X;  4M7D G;  3AHU A;  1OZ2 A;  2RHI A;  1ACM B;  2SEM A;  4E7I A;  1W2B P;  2L5Q A;  2LT1 A;  3CC7 T;  3RMS A;  2O4X B;  2A0F B;  1KHC A;  4A54 A;  1VQM A;  4J9G A;  5FRM A;  1BI2 A;  2P4T A;  3G6E A;  4C92 D;  2QGG A;  1K0X A;  1SRL A;  3J81 E;  5EC7 A;  3NGP A;  3EHQ A;  5CIU A;  1S1N A;  2QQS A;  4WTO B;  2KYB A;  1KQS A;  3TSW A;  3OY9 A;  3M5A A;  1HXD A;  3JCM V;  3OQ5 A;  2JXB A;  1SKU B;  1S72 T;  1Y96 A;  1VQ5 T;  5KYY B;  1CKA A;  3N5B B;  2EW3 A;  2A28 A;  2LDM A;  4M7A B;  3OW2 A;  2DYI A;  1BCM A;  3VJP A;  3SEM A;  3OS0 A;  3CCL A;  4KBM B;  2K57 A;  5IXF A;  4N0A C;  2KRO A;  2O9S A;  1KG1 A;  1U1T A;  4DEX A;  1UUE A;  2LX9 A;  1GBR A;  4RG8 A;  4BE2 A;  1U06 A;  3MP1 A;  1YHQ T;  4M78 G;  2X4W A;  5D6X A;  1KK7 A;  3CQT A;  4F7U F;  2M16 A;  2VKN A;  2HQE A;  1UFF A;  2M51 A;  1PCX A;  3OS5 A;  5IHN A;  4PJO B;  1K4U S;  1QVF P;  2ZPF B;  2QEX Q;  2B8A A;  5CKE A;  2IIM A;  1QKX A;  4HT9 A;  3DKM A;  5GAN 8;  2O88 A;  3REA B;  4DBF A;  4D8D A;  1RI9 A;  1PC0 A;  2RI5 A;  1BYM A;  4NL3 A;  1YJN T;  5GAN 3;  4BE0 A;  1YJ9 Q;  3CC2 T;  3JB9 H;  3P8D A;  3VS1 A;  4M7D E;  3QYH B;  2MIO A;  1Q81 C;  2QXF A;  1Z9Q A;  2E5Q A;  2HMA A;  2FRW A;  5HKC A;  2XU8 A;  3PGG A;  3CCU T;  4X1V A;  1IGU A;  2K9G A;  1G3S A;  4TVR A;  1RLQ C;  5LJ5 d;  2XID A;  3OS2 A;  4BY6 B;  5GAM j;  4IUT A;  4E2F B;  2M1H A;  1VQ8 T;  2HCK A;  2QTV A;  2YUO A;  1UGP B;  5GMK j;  2RHZ A;  2VC8 A;  2KY9 A;  1YP5 A;  2EVR A;  2L0A A;  2RD1 A;  1PHT A;  3VS5 A;  3MP8 A;  2E10 A;  3M4Y A;  3HFO A;  3FC3 A;  3O5Z A;  4B9W A;  1VQM Q;  1NJI R;  3URG A;  2ECZ A;  1RAB B;  3G6E Q;  2YWW A;  3F70 A;  2RQW A;  2DAQ A;  2KEA A;  3S3M A;  2JNG A;  1VQ6 A;  4M7A D;  4A4F A;  5HK0 A;  1U3O A;  1XOV A;  2P0K A;  2BZX A;  3V7R A;  5LL6 S;  2VVK A;  4RTZ A;  3CCS T;  1YFN A;  4M78 E;  5J3B A;  2EGE A;  2FG0 A;  2WSF E;  2JUF A;  3EG9 A;  1Q86 C;  5IAY A;  3RBB B;  3A8G B;  1UE9 A;  1AEY A;  2P0P A;  3VS2 A;  2KI7 A;  2KMT A;  3HKS A;  4HT8 A;  4PJO D;  2LCC A;  3CCL Q;  1I5L A;  3S6W A;  3M0T A;  3BDU A;  3FDR A;  3NTH A;  4HCB A;  1LOJ A;  2BE9 B;  1QWF A;  3GOX A;  4IIM A;  3CC4 A;  4CC3 A;  1IO6 A;  1HD3 A;  3CBP A;  2X4Y A;  1UB4 A;  2XKO C;  3CPF A;  2PQW A;  1NLO C;  3MEU A;  1VQL T;  1KSW A;  1ABQ A;  2MWO A;  1B34 B;  4MDW A;  1TUC A;  2HNI A;  2O2O A;  1MNE A;  4NOY A;  1VQ7 A;  3JSC A;  2FZK B;  2HDA A;  1ABO A;  2CZ7 B;  1NYF A;  5IH2 A;  2A36 A;  5IN1 A;  4EIK A;  2DNU A;  2QI2 A;  3ER0 A;  1Z9Z A;  1QW1 A;  1AVZ C;  2COY A;  1T3L A;  1TH7 A;  5HY6 A;  1M8V A;  4C0G A;  2KAF A;  2P4R A;  5EG2 A;  1WXB A;  3L2V A;  2K79 A;  1KD1 R;  5GAM d;  1H3H A;  2DD4 A;  2AKL A;  3M56 A;  1YI2 T;  4IIO A;  5LJ3 j;  4C8Q A;  5FU6 C;  2PVO B;  2SRC A;  1M1K U;  1Q82 R;  1PM3 A;  5FU7 C;  3V8J A;  4UC4 A;  1NZ9 A;  2HD0 A;  2RQR A;  3RKW A;  1G3Y A;  4BB7 A;  4OF1 A;  3PNW C;  3LW5 E;  2DZ9 A;  3LWH A;  2RQT A;  1X69 A;  2QQB A;  3E2U A;  2ESW A;  3RDV A;  2LZ6 B;  1M1G A;  1QVG A;  5CAI A;  1VQ6 Q;  3G4S T;  1M90 R;  1H3Z A;  3JB9 F;  4II1 A;  5GAN 2;  5GAN h;  1ZUU A;  2AZV A;  1H64 1;  2HQH A;  2DVJ A;  1K8A C;  1VQK A;  2CUB A;  2ZCF B;  2F2V A;  4M77 A;  2FPF A;  2OAW A;  5D7U A;  5M9O A;  3JCM Q;  2LQW A;  2E6Z A;  3CCV T;  4Y28 E;  2J7I A;  2KXC A;  3KFV A;  2XMF A;  1V29 B;  4LDY A;  1NLP C;  2M0Y A;  4OML A;  3CC4 Q;  4BDZ A;  1GFD A;  2KSS A;  1O75 A;  1MMD A;  4QQ6 A;  4HVU A;  2AZS A;  3UWN A;  4C8Q F;  3CCJ T;  5GAN e;  1GXI E;  4ANJ A;  2YUN A;  2DTO A;  3GIB A;  2B86 A;  2DLP A;  3HRS A;  3SHW A;  1VQ4 T;  1KC8 R;  3JCM f;  4AT1 B;  2RO0 A;  3CC7 A;  3CPW A;  4Y92 A;  1K9M C;  4Z8A A;  4FL6 A;  1AWJ A;  1WDX A;  4JRI A;  3OYD A;  1WA7 A;  3OB9 A;  1VQ7 Q;  2V8K A;  3DB4 A;  3HTR A;  1PRL C;  4C92 A;  3KXT A;  1U5S A;  1RUW A;  4FSX A;  3EH2 A;  2DRK A;  4E7S A;  1R8O B;  1OU8 A;  1IGQ A;  4CC4 B;  1NEB A;  4M75 G;  3I55 Q;  3LGL A;  2KXD A;  4L5G A;  2MI6 A;  1ZSZ A;  4DA4 A;  4PK4 A;  5GAN 4;  3BY7 A;  2VAS A;  3VRY A;  1Q81 U;  1N9R A;  4PJN A;  1M4Z A;  5LJ3 d;  4JJC A;  3JCM g;  2CP2 A;  2JTE A;  4IKF A;  3EGX B;  4RTU A;  3MEA A;  3QBY A;  4AMC A;  3CME A;  3PIP A;  1VQ5 A;  1UGV A;  1ARK A;  1PRM C;  1RLP C;  4MDX A;  3S3N A;  2QGF B;  4XTV A;  2DK3 A;  4OMO A;  3UT1 A;  2QQ9 A;  5CKD A;  4AFZ C;  4JRP A;  3INZ A;  1RAD B;  1YHQ A;  2HL3 A;  2OTL T;  1Q7Y C;  1M9S A;  2DVE A;  1CSK A;  5IHK A;  3M0U A;  1K1Z A;  3HPW A;  5AYF A;  4BI3 A;  2XK0 A;  3SWN A;  4J6X A;  5GMK l;  1FMW A;  4HCZ A;  4A4G A;  1T0J A;  2RQV A;  2VXE A;  3H0F A;  5C6S A;  2CH4 W;  3I35 A;  3JCM P;  2L3Q A;  2ZPB B;  1N8R C;  4OB2 B;  4LD9 K;  2KBT A;  2JJ9 A;  1O9S A;  1VQK Q;  2XD0 A;  2LVM A;  1M1F A;  5L8R E;  5I21 A;  1YCY A;  1Q86 U;  1LCK A;  1X2K A;  1SRM A;  1N9S A;  1FMK A;  1HSQ A;  4PFP A;  2O4X A;  2YLC A;  4C8Q C;  2K2M A;  3CCU A;  1X75 C;  3OSV A;  3QJY A;  3ZL7 C;  3I5S A;  1MV0 B;  1ZBX A;  1VQ8 A;  4KH1 B;  1A0N B;  4M75 E;  1T3S A;  4J9E A;  4Z88 A;  3QG1 A;  3GNG A;  2JM8 A;  2CP5 A;  3CXC S;  2YDL A;  2MF2 A;  1M3C A;  4MZT A;  3CC7 Q;  1X43 A;  2EYX A;  4OB0 B;  5CKH A;  2OTJ T;  3REB B;  1GCQ A;  1YBY A;  3TEE A;  4IUU A;  4JS5 A;  5KYY A;  1HJD A;  4KGX B;  1VIF A;  3OYI A;  1QKW A;  2K4Y A;  4M7A A;  3H9N A;  3A8H B;  2RHY A;  5A0L A;  2L8D A;  2E65 A;  3M53 A;  1FXX A;  3CCM A;  2H3J A;  4PKC C;  3CD6 T;  1YIJ A;  4JPB W;  1AT1 B;  2I2L A;  3GBQ A;  4J83 A;  1I81 A;  2CUD A;  1K73 R;  3CCE T;  4PNO A;  4M77 C;  2R5A A;  4M77 D;  2PVG B;  4FW2 A;  3CME Q;  3HSB A;  1VQ5 Q;  3RIR A;  3FEO A;  3OYH A;  4JUV A;  4C0D C;  2EIF A;  4PJO A;  4CRI A;  1Y71 A;  4RKU E;  3VS6 A;  1X6G A;  4P5N A;  1RI0 A;  2DF6 A;  5LJ3 f;  2JOY A;  2RPN A;  1D1C A;  1OU9 A;  3ZBD A;  1UGR B;  1QVG P;  4XU1 A;  1YHQ Q;  2RMO A;  1MMA A;  2ZPH B;  2DJZ A;  3X26 B;  4M7D B;  3LH0 A;  3A1P A;  2E6N A;  3QWX X;  4ZGE B;  2XDB A;  1ZUY A;  3I9Q A;  4JRQ A;  5DM7 R;  2D1X A;  4J9D A;  1UEC A;  1YWP A;  5CQY A;  3EGU A;  4C92 C;  2YRD A;  3OBY A;  1VQ9 A;  2DXU A;  3L2W A;  2DL4 A;  3ZFJ A;  4GY5 A;  1JB0 E;  4KUL A;  2XI9 A;  4BI4 A;  2JS0 A;  4XQ3 A;  2X3X D;  5LJ3 g;  4O6J A;  1K8A U;  2X4J A;  1ZSZ C;  1W70 A;  4ELZ C;  1RAI B;  1V1C A;  2BE7 D;  1BI3 A;  1PG5 B;  1QP3 A;  4LE9 A;  4HCC A;  3CEY A;  3G71 T;  2M0O A;  2VXF A;  4KT0 E;  4K11 A;  3OYL A;  4LDW A;  1R0B G;  3CCU Q;  3NHN A;  1VIE A;  2FPD A;  2E3H A;  1YI2 A;  4OMQ A;  2DJQ A;  2AK5 A;  5LJ5 h;  1WPY A;  3CPW P;  1C6V X;  5CKF A;  2W0Z A;  1VQ8 Q;  1YWO A;  4HVV A;  3OYJ A;  2JW4 A;  4PFZ A;  2QK0 A;  5KYX B;  4M78 B;  3MEV A;  1K9M U;  1RAE B;  1K9A A;  2L2P A;  3JCM J;  2V26 A;  3SWN C;  3RES A;  3U23 A;  4EMH A;  4PLI A;  3GPL A;  4KUI A;  2JM9 A;  1NM7 A;  3RR6 A;  3PVQ A;  1UHC A;  3EGD B;  3NFC A;  5GMK m;  2A08 A;  4FYW B;  4XTZ A;  3GP8 A;  2CZ0 B;  3G4S A;  3EFR A;  3HRT A;  2LJ1 A;  3CCM Q;  5CQX A;  1YIJ Q;  5LJ5 e;  3QJ6 A;  3JCM X;  2DXC A;  4ZGJ B;  5GAN 7;  1IHW A;  4XK8 E;  2KQW A;  4M7D C;  1PSE A;  3JB9 J;  3UF4 A;  4CC7 A;  4M7D D;  4ZGD B;  3JCM b;  2ATC B;  1TOV A;  3CCV A;  1Y7X A;  4F7U B;  4F7U G;  1B34 A;  2EJ9 A;  1ZLM A;  1OX9 A;  2XDP A;  5HK3 A;  1MND A;  1QMC A;  2K5L A;  2F5K A;  1Q7Y U;  2DPP B;  3OYB A;  4DBH A;  1WXU A;  3UA7 A;  2DL7 A;  5A2Q E;  4RTY A;  2QDL A;  4OMF B;  3EG0 A;  2PNI A;  3VYH B;  2HEQ A;  5FLX E;  1GCQ C;  2YHT A;  1VQ4 A;  1OYX A;  4BE1 A;  3C0C A;  3OYG A;  3QWY A;  3VS3 A;  2Y90 A;  1QCF A;  2RJF A;  2PTK A;  3PTA A;  3JCM c;  1VQ9 Q;  2CP6 A;  1IXD A;  1SHG A;  3LGF A;  1JRI A;  4M7A C;  1N8R U;  3FB9 A;  3TCJ A;  4KH0 B;  1OX8 A;  2O01 E;  1N27 A;  1X2Q A;  3A8M B;  4RUG A;  5FW9 A;  3X25 B;  4F04 B;  6AT1 B;  1TWB A;  2DIQ A;  2KDS A;  2MYS A;  5FWC A;  2EGA A;  1SF9 A;  3MPU B;  4E7J A;  1PWT A;  1U1S A;  3M54 A;  2X4X A;  2EWN A;  1JJ2 S;  4M78 D;  3T9N A;  1MGQ A;  3LH5 A;  1BIB A;  2D0Q B;  2R5M A;  3OMG A;  4XU2 A;  2LT4 A;  1I1J A; 
#chains in the Genus database with same CATH homology
 2DTH A;  3RMQ A;  3ASK A;  4M77 A;  2QEX T;  3VYG A;  4JS4 A;  2EQK A;  3EFS A;  5GAM h;  2F5T X;  3QZ9 B;  3DLL A;  2E70 A;  3VKI A;  3I56 T;  4PJO C;  4QVD A;  3VUB A;  5M9O A;  3JCM Q;  2RI2 A;  2QDY B;  4BUG A;  1G3T A;  1BKB A;  2DXB A;  2E6Z A;  2VUB A;  3FIF A;  5GMK h;  3G7Z A;  1DJ7 B;  3CCV T;  2K5I A;  1YJW T;  2HQX A;  4X34 A;  2EQJ A;  4Y28 E;  2K5F A;  2L89 A;  4PJO F;  3HFN A;  2VV5 A;  5C0M A;  3JCM d;  1WQ7 A;  2EFI A;  1V29 B;  4ME7 A;  4OB1 B;  2CKK A;  4LDY A;  4C92 B;  1D3B B;  3OYC A;  3CME T;  3L2R A;  1YJ9 T;  4ATO A;  1P92 A;  4IUQ A;  2XIC A;  1YIT T;  4BDZ A;  2K3X A;  3RUX A;  2KSS A;  2XDD A;  1O75 A;  4C8Q D;  4QQ6 A;  1NE8 A;  3UWN A;  4C8Q F;  4CI0 C;  5GAN e;  3CCJ T;  4M7A G;  2R57 A;  2OTL A;  1GXI E;  2DTO A;  3GIB A;  2KK4 A;  2QQR A;  3V7S A;  2V8J A;  3CMA T;  3HRS A;  3SD4 A;  1VQ4 T;  5IT9 E;  4FU6 A;  3JCM f;  3CC7 A;  2RO0 A;  2GFU A;  2P0Q A;  2JZ2 A;  3QHS A;  3CPW A;  1K9M C;  4JJN K;  3TRE A;  3J7A F;  4RCC A;  5GAM e;  4FL6 A;  3QKJ A;  4LDU A;  2K3Y A;  3OSS C;  4J6W A;  3VV0 A;  4BD3 A;  4JRI A;  2LCL A;  2RM4 A;  3OYD A;  2CYZ B;  3FJP A;  3H6Z A;  3OB9 A;  4J7I A;  4BY6 C;  2V8K A;  3DB4 A;  4O5V A;  4F7U E;  4C92 A;  1D3B A;  1G3W A;  5GMK e;  2BUD A;  3M4G A;  4XU3 A;  3KXT A;  1KC8 C;  3JRZ A;  4FSX A;  4J8O A;  2CZ6 B;  2YLB A;  2PUO B;  1R8O B;  3VUZ A;  1BI0 A;  1LJO A;  3JB9 I;  3OS1 A;  3TU4 K;  2WSE E;  3PMT A;  4M75 G;  4PJO G;  1JBM A;  5FRO A;  2PUK B;  2M9U A;  3LGL A;  2QEX A;  1RL2 A;  1VQO T;  2EJF A;  4L5G A;  1KHI A;  2MI6 A;  3MHX A;  3QXE B;  4QVC A;  4DOV A;  1K73 U;  4DA4 A;  4FIB A;  5GAN 4;  3BY7 A;  3WVE B;  3CBO A;  1OI1 A;  3C4S A;  3X28 B;  4C5G A;  3OMC A;  4N4G A;  4PLL A;  3OYN A;  1N9R A;  2GCX A;  1Q81 U;  4VUB A;  1VQK T;  4NL2 A;  4V2S A;  2D9T A;  3WVD B;  5CCA A;  3QSU A;  1M4Z A;  5LJ3 d;  3H8Z A;  3JCM g;  3E19 A;  4LD6 A;  5KCH A;  2QTX A;  4IKF A;  2E1H A;  5KE2 A;  4M77 E;  2X35 A;  3MEA A;  3QBY A;  3JCM h;  3CME A;  1YJ9 A;  4OVA A;  3PIP A;  3OYE A;  3OA6 A;  1VQ5 A;  3SWN B;  4C5E A;  3P8H A;  2LC4 A;  4MZP A;  4DOW A;  3KUF A;  2CZ1 B;  4MDX A;  4OB3 B;  3S3N A;  4FT4 A;  5GAN j;  2A3L A;  3CCJ A;  4RMO A;  4XTV A;  1WGS A;  2DK3 A;  4J5Y A;  5DY9 A;  1WJR A;  3UT1 A;  4J6Y A;  3SDZ A;  4R56 A;  1M5Q 1;  2FYK A;  1XTD A;  1OZ3 A;  2QQ9 A;  3M57 A;  5CKD A;  3CMA A;  4XTY A;  3M9Q A;  4FM4 B;  4J7F A;  4ZN3 A;  2FHD A;  4JRP A;  3INZ A;  1YHQ A;  2CS7 A;  4JLG A;  2OTL T;  1Q7Y C;  3L2Q A;  1M9S A;  1M1K C;  2DVE A;  2DIG A;  4E7L A;  3GNF B;  2GF7 A;  2EAY A;  2OTJ A;  1H3Z A;  2PU9 B;  3HPW A;  5AYF A;  4M7D G;  2DD5 A;  4BI3 A;  3AHU A;  1OZ2 A;  2RHI A;  2RI3 A;  2XK0 A;  3SWN A;  4E7I A;  2L5Q A;  2LT1 A;  4J6X A;  5GMK l;  3CC7 T;  3RMS A;  1AHJ B;  2RH2 A;  1W2B S;  2O4X B;  4HCZ A;  3UDC A;  4KUD K;  4A4G A;  3OBW A;  3LLR A;  3JCM e;  1NJI U;  4HKE A;  3JCM W;  1Y96 B;  4QQG A;  1KHC A;  4A54 A;  1NPP A;  4M78 C;  1VQO A;  1VQM A;  2DKG A;  2EQU A;  5FRM A;  2VXE A;  1BI2 A;  1IRE B;  2P4T A;  3G6E A;  3CD6 A;  4C92 D;  1U8R A;  5C6S A;  3JCM P;  4BAC A;  2ZPB B;  1N8R C;  4XAX B;  5CO7 A;  4OB2 B;  3CCE A;  4LD9 K;  3J81 E;  2QA4 A;  2XHC A;  1O9S A;  2XD0 A;  2DO3 A;  4ZN1 A;  2LVM A;  4A4E A;  1M1F A;  5J39 A;  5L8R E;  4OGC A;  5CIU A;  5FU6 B;  5I21 A;  1YCY A;  4M7A E;  5LJ3 h;  1Q86 U;  2QQS A;  3CCM T;  4QVZ A;  3QZ5 B;  1YIJ T;  5FU7 B;  1N9S A;  1MHN A;  5D6W A;  4C0F A;  1KQS A;  2LNV A;  3NTI A;  3OY9 A;  3RER A;  3M5A A;  2O4X A;  1HXD A;  2DXT A;  2YLC A;  3OQ5 A;  3JCM V;  5GAO r;  1S72 T;  1VQP A;  1Y96 A;  2JVV A;  4C8Q C;  3BFM A;  1VQ5 T;  3CCU A;  1X75 C;  3A8O B;  2IVW A;  3C12 A;  2ZZD A;  3LWI A;  3N5B B;  3OSV A;  5GMK i;  1JJ2 A;  3QJY A;  4YTL A;  2E12 A;  4OP0 A;  2LDM A;  4M7A B;  3OW2 A;  3VJP A;  4LDV A;  3JB9 G;  1ZBX A;  3OS0 A;  3CCL A;  4KBM B;  5I2S A;  3J80 E;  2FB7 A;  2RJE A;  1VQ8 A;  2K57 A;  3E9G A;  4N0A C;  4M75 E;  2D6F A;  4PJO E;  1KG1 A;  1U1T A;  3QG1 A;  3GNG A;  4EMK B;  1W4S A;  2LX9 A;  3CXC S;  4RG8 A;  4BE2 A;  3MP1 A;  3GLX A;  1YHQ T;  4M78 G;  2MF2 A;  5CK9 A;  3HL8 A;  4MZT A;  4E7H A;  5LJ3 e;  2X4W A;  4OB0 B;  5CKH A;  5D6X A;  4A4H A;  2HBP A;  4IUP A;  5GAO m;  2OTJ T;  3X24 B;  3L2Z A;  4F7U F;  4MMK A;  1YBY A;  3PMI A;  3TEE A;  4IUU A;  4JS5 A;  5CKB A;  2M16 A;  2FVU A;  2G3R A;  2HQE A;  3V8K A;  4HA8 A;  4ZTJ A;  5FRN A;  1VIF A;  3OS5 A;  4M75 B;  3OYI A;  1BIA A;  4PJO B;  2K4Y A;  4M7A A;  3A8H B;  3R6O A;  2RHY A;  1VQM T;  5A0L A;  2L8D A;  1VQ9 T;  2E65 A;  1NPR A;  2ZPF B;  2RHU A;  3M53 A;  2B8A A;  1FXX A;  5CKE A;  2H3J A;  4PKC C;  3G6E T;  3CCM A;  1QVF S;  1YIJ A;  3CD6 T;  2I2L A;  4J83 A;  3CCR A;  3E1S A;  3S3O A;  1I81 A;  4EMK A;  2VGM A;  3QYG B;  1I4K 1;  3DKM A;  3GF5 A;  5GAN 8;  3CCE T;  4HT9 A;  3UPU A;  4PNO A;  2QA4 T;  4M77 C;  2OAU A;  4C8Q G;  2PVD B;  3M59 A;  2R5A A;  4XTU A;  1UEB A;  4M77 D;  4A4K A;  4JLI A;  3VU3 C;  1S72 A;  2RI5 A;  3I55 A;  2PVG B;  1LNX A;  4M77 F;  1QP2 A;  1BYM A;  4NL3 A;  1YJN T;  2BKD N;  3OYA A;  5GAN 3;  1UGS B;  4BE0 A;  4L6V 5;  5GAN 5;  3CC2 T;  1K73 C;  3HSB A;  3JB9 H;  3Q1J A;  5GAO n;  3RIR A;  3MP6 A;  3P8D A;  3FEO A;  3OYH A;  4M7D E;  4JUV A;  3QYH B;  4B9X A;  4C0D C;  4RG2 A;  1Q81 C;  2Y4X A;  2RB6 A;  3EAE A;  3SFM A;  1PSF A;  2GFA A;  2QXF A;  2YRV A;  2EIF A;  3V7C A;  2E5Q A;  2JN0 A;  4M75 A;  1KD1 U;  1VQP T;  4CRI A;  4PJO A;  1Y71 A;  2HAX A;  4RKU E;  5HKC A;  3QDR B;  2RK2 A;  2XU8 A;  3PGG A;  4P5N A;  3NTK A;  3WXM B;  3CCU T;  1G3S A;  1RI0 A;  4TVR A;  3L1A A;  3M55 A;  5LJ3 f;  1X6O A;  5LJ5 d;  2JOY A;  2RJC A;  2XID A;  3OS2 A;  4Z02 A;  3ZBD A;  4BY6 B;  4XTW A;  1UGR B;  4XU1 A;  3PT9 A;  5J26 A;  5GAM j;  1Q82 U;  3CCL T;  4IUT A;  1BI1 A;  1I8F A;  2M1H A;  1QVG S;  1VQ8 T;  3PIO A;  2R58 A;  4EPC A;  2ZPH B;  2DJZ A;  2RK1 A;  3X26 B;  1VUB A;  2EYQ A;  5CVI A;  4M7D B;  1UGP B;  5GMK j;  3LH0 A;  2RHZ A;  3P8B B;  4JRK A;  2VC8 A;  2KY9 A;  3ZEH A;  1N6A A;  3FRN A;  1XNI A;  2DZC A;  2E6N A;  2RD1 A;  4RCB A;  1IZ6 A;  4GLK A;  4IUV A;  4ZGE B;  3CC4 T;  2XDB A;  3OYF A;  3MP8 A;  2E10 A;  1WJS A;  4E47 A;  1KQ1 A;  5DM7 R;  4JRQ A;  3QO3 A;  3M4Y A;  3HFO A;  3FC3 A;  5CQY A;  4C92 C;  4BDY A;  3OBY A;  1VQ9 A;  4B9W A;  5LJ5 f;  4LDX A;  2DXU A;  3L2W A;  3URG A;  3ZFJ A;  3CCQ A;  4GY5 A;  4C92 F;  1JB0 E;  2WAC A;  4KUL A;  4E7K A;  2XI9 A;  3F70 A;  2ZPE B;  3CBM A;  3HRU A;  4BI4 A;  4ZTF A;  4XQ3 A;  1ZHI A;  3C95 A;  2DAQ A;  5LJ3 g;  4O6J A;  5DLO A;  2BIV A;  2JNG A;  2E41 A;  3DLM A;  4OGE A;  3S3M A;  1K8A U;  2X4J A;  1VQ6 A;  4XU0 A;  4WF2 A;  4A4F A;  4M7A D;  2ZPI B;  4ELZ C;  5HK0 A;  1NJI C;  1YJN A;  1BI3 A;  3CCR T;  1XOV A;  3RKX A;  3CC2 A;  2P0K A;  3V7R A;  4M7D A;  1QP3 A;  4QW2 A;  1HK9 A;  5LL6 S;  1ZQ1 A;  4HCC A;  2AHJ B;  3CEY A;  4X9C A;  3RKY A;  3G71 T;  1W2B A;  3CCS T;  2M0O A;  4M78 E;  5J3B A;  2VXF A;  4KT0 E;  2L3R A;  3I55 T;  2WSF E;  4A53 A;  3OYL A;  2JUF A;  2DTI A;  4LDW A;  2VYT A;  1Q86 C;  5IAY A;  3A8G B;  4PL6 A;  5LJ5 g;  1VIE A;  2P0P A;  4XTX A;  1VQN A;  3L42 A;  4M75 C;  1YI2 A;  5LJ5 h;  1WPY A;  2VGN A;  1M90 U;  2KMT A;  3HKS A;  2LRQ A;  4HT8 A;  5CKF A;  3X20 B;  3CPW S;  4M75 D;  2LCC A;  4PJO D;  1I5L A;  4M75 F;  3S6W A;  1WJQ A;  3MEW A;  3OYJ A;  3BDU A;  3FDR A;  3NTH A;  2RA2 A;  4HCB A;  2KVQ G;  1LOJ A;  4C92 G;  3A5Z B;  4M78 B;  3GOX A;  3CC4 A;  3MEV A;  4NS5 A;  3CBP A;  3OYY A;  2X4Y A;  3L2U A;  1K9M U;  4Q5W A;  4C8Q E;  1UB4 A;  2MWP A;  2XKO C;  3JCM J;  3SWN C;  3RES A;  3CPF A;  3LYI A;  3MET A;  1QVP A;  4FT2 A;  2PQW A;  4L59 A;  2IG0 A;  4PLI A;  4EMH A;  4ELY C;  2F69 A;  4KUI A;  1Y07 A;  1KC8 U;  3MEU A;  3DB3 A;  1VQL T;  5GMK m;  3NFC A;  5GAO q;  3SB2 A;  2MWO A;  4XTZ A;  3GP8 A;  2CZ0 B;  4N4I A;  2RJD A;  1B34 B;  4MDW A;  3G4S A;  2HNI A;  3BDL A;  3EFR A;  3HRT A;  4NOY A;  5GAM g;  5CQX A;  3JAM E;  3CCQ T;  1VQ7 A;  3JSC A;  5D6Y A;  5LJ5 e;  2ZPG B;  3QJ6 A;  1SSF A;  2Y4Y A;  3CXC A;  2CZ7 B;  4MML A;  4EMG A;  3JCM X;  2DXC A;  4M78 A;  4C8Q B;  4ZGJ B;  5GAN 7;  3G71 A;  5IN1 A;  3CCS A;  2LQ8 A;  3BW1 A;  4XK8 E;  2V8I A;  5A0G A;  1VQ6 T;  2MAM A;  2QI2 A;  2A7Y A;  2EKO A;  2JTF A;  4BI8 B;  3OYK A;  3ER0 A;  2KQW A;  4M7D C;  1QW1 A;  5GAN d;  1TH7 A;  1PSE A;  2LQK A;  5HY6 A;  5KCO A;  1M8V A;  4C0G A;  3QII A;  3JB9 J;  4M7D D;  2KAF A;  4ZGD B;  3MCA B;  3JCM b;  4M7D F;  1FX7 A;  2WSC E;  5EG2 A;  3A8L B;  4EDU A;  3I56 A;  1G5V A;  3L2V A;  4C0Z A;  2LTO A;  4X9D A;  1EIF A;  3CCV A;  1YJW A;  5GAM d;  1Y7X A;  2MMP A;  4F7U B;  4F7U G;  1B34 A;  3MO8 A;  5I2M A;  1QVF A;  2DD4 A;  2EQM A;  2EJG A;  2FL7 A;  2EJ9 A;  2K2V A;  3PFS A;  4Y91 A;  2CGH A;  4D6W A;  4N4H A;  4DQ2 A;  3M56 A;  1VQN T;  4R55 A;  1YI2 T;  2XDP A;  5HK3 A;  5LJ3 j;  2K5L A;  1X01 A;  3ME9 A;  2F5K A;  3M58 A;  5FU6 C;  3HP9 A;  3E9F A;  4C8Q A;  2PVO B;  5GAN f;  1YIT A;  1KD1 C;  1Q7Y U;  1M1K U;  2DPP B;  3FLG A;  3V8L A;  3QPH A;  3OYB A;  5FU7 C;  3V8J A;  4UC4 A;  3GPL A;  1NZ9 A;  2HD0 A;  5A2Q E;  1KQ2 A;  5DLQ E;  1G3Y A;  3O8V A;  3RKW A;  5A0D A;  4OMF B;  4BB7 A;  4OF1 A;  4MZM A;  2C06 A;  5CR2 A;  2ZGW A;  3PNW C;  3LW5 E;  2DZ9 A;  4N0A A;  3VYH B;  5FLX E;  2E64 A;  3LWH A;  1VQL A;  2YHT A;  5GAM f;  1OYX A;  4BE1 A;  1VQ4 A;  1Q82 C;  3OYG A;  2Y90 A;  2RJF A;  4C5H A;  5GAO l;  3PTA A;  3JCM c;  3C94 A;  4M77 G;  3LX7 A;  4M77 B;  2NLU A;  4F7U A;  2JTM A;  2QQB A;  5LJ5 j;  5GAN 6;  3LGF A;  1JRI A;  4M7A C;  2GQV A;  1WQW A;  1N8R U;  5KH6 A;  3FB9 A;  3TCJ A;  4JDS A;  1KQS S;  3HHT B;  1M1G A;  3QUI A;  2O01 E;  5GAO p;  4C5I A;  1UGQ B;  1N27 A;  3KBG A;  2XG8 D;  3A8M B;  5CAI A;  3JB9 D;  3X25 B;  3G4S T;  1QVG A;  4M7A F;  2DIQ A;  5KE3 A;  5GAN g;  4EMK C;  3JB9 F;  2KDS A;  4C0D B;  4II1 A;  5GAN 2;  1VQ7 T;  5GAN h;  4E7J A;  4IUR A;  4QQD A;  1U1S A;  2QQA A;  3M54 A;  1H64 1;  2X4X A;  2DEQ A;  2EWN A;  4C92 E;  1JJ2 S;  1FWZ A;  4M78 D;  3T9N A;  1MGQ A;  1BIB A;  4M78 F;  1K8A C;  1M90 C;  2RHX A;  2D0Q B;  1VQK A;  2R5M A;  3OW2 S;  3OMG A;  3OYM A;  2ZCF B;  4XU2 A;  2LT4 A;  1WNL A;  1XQH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...