1I5LA

Crystal structure of an sm-like protein (af-sm1) from archaeoglobus fulgidus complexed with short poly-u rna
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
71
structure length
71
Chain Sequence
PRPLDVLNRSLKSPVIVRLKGGREFRGTLDGYDIHMNLVLLDAEEIQNGEVVRKVGSVVIRGDTVVFVSPA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title RNA binding in an Sm core domain: X-ray structure and functional analysis of an archaeal Sm protein complex.
pubmed doi rcsb
source organism Archaeoglobus fulgidus
molecule tags Rna binding protein/rna
molecule keywords 5'-R(*UP*UP*U)-3'
total genus 14
structure length 71
sequence length 71
chains with identical sequence B, C, D, E, F, G, H, I, J, K, L, M, N
ec nomenclature
pdb deposition date 2001-02-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01423 LSM LSM domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.100 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 1i5lA00
1BIBA 1HXDA 5GAMe 5GAOn 4C92C 2E10A 3BDUA 4J6YA 1WQ7A 4F7UA 3HFOA 3INZA 3L2ZA 4M78A 3JB9H 4F7UB 1M8VA 4XTUA 3JCMV 5LJ5d 3EFSA 1LJOA 4X9DA 4M7AA 4XU3A 3V8JA 4C92D 5GAN6 5GAOl 5GMKl 4EMGA 2DXUA 3PGGA 1YCYA 5LJ5h 1B34B 5LJ5j 5LJ5g 2E64A 1WPYA 1WQWA 2DJZA 2FB7A 4M75F 5GANg 4PJOG 3RERA 1N9SA 4MMLA 4RCCA 4M78G 2DTOA 4C92E 4NL2A 2E65A 4PNOA 4PJOB 2FYKA 4XQ3A 1D3BB 5I21A 4M7DC 1HK9A 2K57A 5GAN5 4PJOE 4M77A 2DXTA 2VC8A 1I4K1 4X9CA 3RKXA 2I2LA 1Y96A 2EWNA 4M78E 4C8QB 4M75B 5DY9A 1H641 4C92G 2RM4A 4RCBA 4QVCA 3HFNA 3JCMf 1N9RA 4C8QD 5GMKm 4NL3A 2DKGA 2DTIA 2EAYA 5CAIA 3V8LA 4A53A 5LJ3d 3EFRA 4XU0A 5GMKh 4F7UG 3FB9A 4J6XA 3V8KA 5GAMd 3JCMP 3BFMA 3QUIA 4JUVA 3V7SA 4EMKA 5LJ3g 3JB9F 3FJPA 4M7DA 1LNXA 4NOYA 3RESA 1U1TA 2RA2A 3M4GA 4M7AB 4M7DD 4PJOA 4M78B 4F7UE 1M5Q1 4HT9A 3SWNB 4C92A 2EJGA 4M77C 4HT8A 4XTYA 3JCMh 5GAN7 4M77G 1KQ2A 4QVDA 2QTXA 3RKYA 5GMKj 4EMKC 3L1AA 4JRKA 4M7AF 4XTWA 1Y96B 4OP0A 4M78F 4C92F 4J5YA 3JCMe 5GANd 3JB9D 3QHSA 4PJOF 4M7AE 2EJ9A 1BIAA 1D3BA 4EMHA 3JCMb 2DTHA 4N0AA 4Y91A 3RIRA 4C8QF 3JCMW 4M7DE 5LJ5f 3QSUA 4C8QG 4M75G 3JCMc 4C92B 4M77E 4PJOD 1JBMA 3HSBA 2DZ9A 4M75A 4XU2A 1U1SA 2ZGWA 4M7AD 4EMKB 1KQ1A 3V7CA 3BY7A 5GMKi 5GAMg 3VU3C 4M75E 3RKWA 4C8QE 4N0AC 4DQ2A 4M7AG 4V2SA 2RD1A 4M75D 5GAOr 2DZCA 1JRIA 4PJOC 4M7DB 4HA8A 3SWNA 1X01A 3JB9I 5GMKe 4M7DG 2DEQA 4JRIA 4M77D 5GANh 5GANj 5LJ3e 5GAN3 3SB2A 4MMKA 3V7RA 5LJ5e 5GAOq 1TH7A 2E1HA 5GANe 3JCMd 2EJFA 5GAN2 1I8FA 2YLCA 3JB9G 4A54A 3AHUA 4M75C 5LJ3f 4C8QC 5GAMf 2VXEA 2CGHA 4XU1A 3RUXA 2VXFA 2HNIA 4M78D 1I81A 3FIFA 3JCMX 4M77F 1LOJA 3QO3A 3JCMg 4J6WA 5GAOp 5GAMj 2YLBA 5GAMh 5GAN8 1WNLA 5LJ3h 5LJ3j 3JCMQ 5GAOm 3JCMJ 4JLIA 2Y90A 4M7AC 2YHTA 3JB9J 2RB6A 4M78C 4WF2A 3SWNC 4XTZA 3BW1A 1I5LA 2E41A 4M7DF 4M77B 4XTVA 2DVEA 3GIBA 1B34A 4F7UF 4C8QA 1MGQA 2JN0A 5GANf 5GAN4 4XTXA
chains in the Genus database with same CATH superfamily
3LYIA 3QWXX 4C92C 1O9SA 4OMQA 2YRDA 2NUZA 1BKBA 2LRQA 3CXCS 3JSCA 1VQ6A 4M7AA 1ACMB 4BI4A 5GAOl 1YIJT 1PRMC 1YCYA 3A8OB 2MIOA 1W1FA 2VASA 4LD9K 5I2SA 1WHLA 4BI8B 1AWOA 4N4GA 2PVOB 4PFPA 1K76A 2EIFA 1YJWA 1LVKA 2K57A 3J81E 1N6AA 3VRZA 3QG1A 1ZX6A 2ZPEB 4C8QD 5GMKm 2WSFE 1M1FA 2O01E 3FJPA 1IHVA 2M02A 3P8DA 2QGGA 2EJGA 3G6ET 1IB8A 3OBYA 2MK5A 1Y71A 3R6OA 3HRTA 5KCHA 1OI1A 5A0DA 4AFSC 5J26A 3VS6A 2C0IA 2KQWA 2DBMA 2MPXC 2V8JA 4M77E 3HRSA 1UG1A 1V1CA 1FMKA 2H3EB 1VQOA 1EIFA 5FU6B 1VQ5A 1JRIA 4E6RA 3MCAB 3RMSA 2RJFA 1WZOA 3OYNA 3CCVQ 1YJ9T 4C0DC 3VUBA 1KC8C 3GNFB 3TQ7P 1UEBA 2DD5A 2ED1A 2ZAEA 2VKNA 2AK5A 2EYYA 4FYVB 3JCMX 1ZA2B 1WFWA 2CZ1B 2O31A 2PNIA 4WF2A 3SWNC 1Q86U 2K9GA 4KH1B 1YHQQ 3I55T 2XHCA 3LWHA 2XDPA 4KUDK 5GAN4 3ULRB 1ABQA 1BU1A 1JEGA 1AWWA 2QDLA 3BDUA 4M78A 5KCOA 4XTUA 5LJ5d 2DL7A 2PUKB 4J7FA 1M3CA 3M0UA 2KT8A 1NEBA 2E64A 2RK1A 4KT0E 1RACB 1PKTA 2GQVA 2M0YA 3BE3A 2XK0A 2QQAA 5I2MA 1WJQA 1VQ4T 5CKFA 3QBYA 1I4K1 2X35A 2EFIA 1OU9A 1H641 2DJQA 2YUOA 4NL3A 2QEXQ 5CAIA 1YCSB 1WX6A 2LJ0A 2KXDA 5CKEA 4M7DD 4BY6B 3OYHA 1M1KU 2J05A 1VQMT 4BD3A 4RTXA 2LC4A 2A3LA 1RL2A 1N5ZA 4E7IA 4BACA 1ZQ1A 6AT1B 4ORZA 4KUIA 1FXXA 2FL7A 1V29B 1UDLA 2P4RA 4RUGA 1M2OA 3CC4A 2PQWA 1KC8U 4N4HA 2GGRA 3PIPA 4V2SA 5KYWA 1UGRB 2F69A 2HL3A 5LJ3e 1G8XA 4J83A 3JB9G 2LNHB 1YITT 1K9AA 2CGHA 1RI0A 1PWTA 1Q81R 1I81A 3EH1A 1JQQA 3PVQA 5GAOp 2CH4W 3GP8A 1B7TA 2G6FX 1I5LA 3E9GA 2XU8A 5IHNA 5CVIA 1VA7A 1X6GA 1SRMA 3S3OA 1B07A 3I56A 3CD6T 1OYXA 5KYUB 2OTLA 2K7AA 3QPHA 2DYIA 2JOYA 3V8JA 3OYFA 2CT3A 2VUBA 2MWOA 5IAYA 1Q82R 3LGFA 3EG9A 4AG2C 2MWPA 4PFZA 4PNOA 1PNJA 1YJWT 1KD1U 2DYBA 2EKHA 4J9FA 3G6EA 3A98A 2XKOC 3HKSA 1AVZC 1ZLMA 4RCBA 4QVCA 1XQHA 3HFNA 1X27A 2DTIA 2QXFA 1FMVA 1XJWB 3QDRB 1G5VA 3UPUA 4QVZA 1KJWA 1Q82C 4HT8A 5GAN7 3QDFA 2E6ZA 2QTXA 3E1SA 4ME7A 4E47A 1T3LA 2RPNA 2HDAA 3PNWC 4J5YA 1M3BA 4WTOB 3EHRA 3G4ST 1PSEA 1VQ5Q 3MP1A 5IH2A 4OMNA 2EKOA 3M59A 4RG2A 1AHJB 1NLPC 2KRNA 3JCMc 4PJOD 1Y07A 4M75A 2YUQA 3DB4A 2KRMA 4J9IA 1KG1A 2FPEA 4M75D 2FG0A 2D0NA 3TVTA 1BI2A 1GFCA 2D8JA 2EGAA 1FX7A 2KROA 2DVJA 1BCOA 1KHCA 2RHIA 3A8HB 1VIFA 2HMAA 2O88A 2JW4A 3FJ5A 1VQ7Q 3OSVA 3EGXB 1UTIA 2AT1B 2DRMA 3UF4A 2IG0A 3QJYA 3OBWA 3RBBB 3HRUA 3CD6Q 5GAN8 3JCMQ 2YDLA 1VQ8A 1W2BS 4RTUA 1GCQA 1WXTA 4DBHA 4E7KA 3PTAA 3BW1A 3L2RA 3ZEHA 1EX4A 2E3IA 2EBPA 2FPFA 2ECZA 4FW2A 3UT1A 4ZNXA 2COYA 2KAFA 3SDZA 2OTLT 3M57A 3CPWS 3INZA 3JB9H 1M1KR 1M27C 4X9DA 2RK2A 3J7AF 1VQLA 3CCMA 2HSPA 3KBGA 2F2XA 4Z02A 4AT1B 3Q1JA 3P8BB 2H8HA 3GBQA 3QKJA 2LDMA 2PZ1A 4OMMA 4FSSA 2EYZA 2HZYA 4C92G 2YUNA 2RM4A 1WI7A 1RI9A 2DETA 1M1KC 5LJ3d 1SF9A 2F2VA 2R58A 3V8KA 1KK7A 3BFMA 3HL8A 4PJOE 1W2BA 1HJDA 1BB9A 1TU0B 3KUFA 1M90R 1H3ZA 2AKLA 1G3YA 1ZHIA 4RTWA 3REAB 2QK0A 1R0BG 4C92F 3CPWA 1MV0B 3WVDB 1BIAA 3CCQQ 3RIRA 4M7DE 1YWOA 1Q95G 2X3XD 1JB0E 2E12A 2IPOB 3PIOA 1PSFA 4LDXA 1QP3A 2K79A 4P5NA 2ZCFB 2VGMA 4IUTA 3CMAT 3EG0A 4DQ2A 3H0FA 2OAUA 5GAOr 1Q7YR 2MMPA 4GY5A 4J9CA 4ZGEB 3A8LB 1QKWA 2VYTA 8ATCB 2XICA 1WHGA 1RAAB 1NPRA 4DEXA 2VXEA 3REBB 2KY9A 3P8HA 1M90U 4LN2A 3FIFA 3O8VA 1M4ZA 2PTKA 1K0SA 3OMCA 1JXOA 3CC2A 4FU6A 3I56Q 2KK4A 2K4YA 3GNGA 4XTVA 3OYDA 2Y4XA 3G4SQ 2LQWA 2RHXA 2QQRA 3CCJQ 3H9NA 3OYAA 3OB9A 5CKDA 3TSWA 1NG2A 4R55A 5CO7A 3QZ5B 2DXCA 3CCVA 4IIOA 2WACA 2K3YA 4QQGA 2R5AA 1VQ9T 3RERA 3OYIA 4N4IA 4PKCC 2DIQA 3EGUA 3H0IA 4QQ6A 2E3HA 1UE9A 1QWFA 2RQWA 4RG8A 5GMKh 1PC0A 4K11A 4JS5A 4C0DB 2CUBA 1M3AA 1WGSA 1UJ0A 2RA2A 4JJBA 5IN1A 1IXDA 4BB7A 5AYFA 1VQKA 4C92A 5IHKA 3I5RA 3L1AA 2QA4A 3CCLA 4IURA 4LDUA 3A8MB 4QQDA 2QGFB 1OZ3A 2OX7A 3JCMW 1IGQA 2CZ6B 1W70A 3HSBA 4XU2A 1GFDA 4KRTA 3N5BB 1KQ1A 3BY7A 1N8RC 2DO3A 2DZCA 3M4YA 3EH2A 3LLRA 2LMJA 5GANj 1G3TA 1VUBA 3LX7A 2DNUA 2YT6A 4PJJA 1VQ8Q 5GANe 2HQEA 2HL5C 4ZN1A 3VUZA 4XU1A 2XDDA 3VYHB 2BZYA 1K0XA 1WNLA 5LL6S 1Q7YC 1QVFP 2GNCA 4JJCA 4Y92A 3GIBA 2YWWA 1VQNT 3CCMQ 2JN0A 4F7UA 1CKBA 3JCMV 3CC2T 3EGXA 1TUDA 5EC7A 4LDYA 1D1AA 2DXUA 3PGGA 2M9UA 5HKCA 2HCKA 2C06A 2GFUA 1NLOC 5EG2A 1BBZA 2RHUA 3F70A 4R0KA 1K1ZA 3E19A 2JTFA 1MNEA 4TVRA 3OYLA 2E5QA 1WLPB 3JCMf 3I5SA 4HCZA 2EW3A 3EFRA 1YJNQ 1M2VB 3WVEB 3CCRA 2EQMA 3DKMA 3M4GA 2CZ7B 1VQ4A 5AT1B 3CCQA 1I07A 4XTYA 1VQOT 5J39A 3CXCP 1K9MC 1EFNA 3S3NA 3BDLA 4J7IA 3X25B 2RJCA 3NTIA 2V26A 2V1QA 3NHNA 4N0AA 3CQTA 4OGCA 4AMCA 1NZ9A 2KGTA 2ZGWA 4DOWA 3CMAA 3VU3C 4C8QE 2M51A 1RADB 4M7AG 1PD0A 3M0PA 3CC7A 2NYSA 2O9VA 3EGDA 5GANh 1G83A 1W6XA 3JAME 4D6WA 5LJ5e 2DM1A 5GAOq 2MI6A 5LJ3f 2X4JA 4QW2A 2CH4A 4FL6A 5CKHA 4C0GA 1R77A 1N8RR 3VS7A 2HBWA 4A4EA 2Y90A 4ZGJB 4OMOA 2QQBA 1AT1B 1C1AA 5FU7C 1Y0MA 3H8ZA 1PCXA 2LCLA 1LCKA 1ABOA 1MHNA 1YJWQ 4BDZA 1Q81C 1YI2A 4JRPA 3OSSC 1B34B 2FRWA 1WJRA 1QVGP 3ASKA 3G1JA 2QG9B 3EHQA 4M77A 3MEVA 3I56T 3CD6A 3CCLT 3CCUQ 3E9FA 1JU5C 5FROA 5IXFA 4OGEA 4C5IA 3CCSQ 2ZPFB 1WA7A 3CCRT 4M7DA 1RAHB 2G3RA 5D7UA 1YITA 2HBPA 1C6VX 2CREA 4IIMA 4L59A 3QHSA 3QYGB 1NPPA 4F17A 4AFUC 2DTHA 2F2WA 2PVGB 4PFOA 4RTVA 3PMTA 1JBMA 2JTMA 3RNJA 4A4FA 4M75E 4JJDA 2MCNA 4R56A 2KYMA 3SWNA 5IHIA 1BI3A 4IUUA 1XTDA 1TXQA 3C94A 5KYUA 2RQTA 4UC4A 2QYZA 4MZMA 4MMKA 2E4HA 1WDXA 5GAN2 4BUGA 3AHUA 1T0HA 3M0TA 4LD6A 1KQSS 4IKFA 2JTEA 1Q7YU 4JZ4A 1H92A 1IZ6A 5KYXA 3TU4K 2X3WD 1ARKA 5CIUA 3CMEQ 3NTHA 1RAIB 2AKKA 1SSFA 4M78C 1Q81U 2DERA 3CCUT 4ANJA 4M7DF 2DMOA 2KRSA 1UGQB 2A37A 2F5TX 1Y57A 1HXDA 5GAOn 2E10A 1RABB 1E6GA 1FWZA 3HFOA 4LDWA 4CC2A 1QCNA 1CSKA 4XU3A 1B3QA 1SEMA 4E2FB 1YI2T 4LXCA 1OX8A 1GL5A 4LUEA 2RI2A 5LJ5j 2J6KA 3OYMA 4VUBA 1TOVA 1OPKA 1YJNA 4IUQA 4BI3A 2A08A 2E65A 4PJOB 1ZBJA 3MP6A 1P92A 2COZA 3WXMB 4M75B 5FW9A 1KQSA 1LPLA 2FEIA 2D6FA 1M1GA 3V8LA 4L5GA 4J6XA 3QUIA 2CKKA 4X34A 3FLGA 4F7UE 1N27A 2X9HA 4M77C 2D1XA 2X4XA 1EZZB 1ZUUA 2DIGA 4C0FA 2DLPA 1BI0A 1PRLC 3S3MA 1X2KA 4KGZB 1D3BA 2F1LA 2L0AA 3M9QA 3LWIA 1QW1A 3M53A 3CC7Q 2GFAA 2HEQA 1AEYA 4FSXA 2XDBA 2OTJQ 3LGLA 5D6WA 3C0CA 2R5MA 2DRKA 2BUDA 3RKWA 2X4YA 4GLMA 4N0AC 1KIKA 1OX9A 4DBRA 5GMKe 2DEQA 3VS2A 2QQ9A 2JMAA 3U23A 2V8KA 2E1HA 3TCJA 5A0GA 5HK0A 4J9DA 1JJ2P 1H3HA 1FYNA 1R8OB 3MP8A 2BZXA 4J6WA 1WJSA 3UWNA 4EPCA 3OW2A 1D1CA 4EDUA 4Y28E 4XTZA 1QQJA 1YI2Q 3CCEA 1BK2A 1VQ9Q 4E7SA 1JJ2S 3M0RA 4E7ZA 1YIJA 2IIMA 3URGA 5GMKl 1X6BA 1WPYA 1QVFA 5GANg 2JMCA 4ATOA 2K5IA 4PJOG 3CPFA 1D0ZA 2CUDA 1AOJA 5I21A 1X75C 1VQ6T 2RO0A 2EVRA 1Y96A 4FT2A 1VQPA 4AFZC 2LQKA 2VGNA 3UDCA 1N9RA 3SFMA 2RN8A 2D0QB 3I35A 1XNIA 2E70A 5ECAA 3G71A 4M4ZA 5C0MA 2AHJB 4NS5A 3OA6A 2LTOA 3RESA 1UJYA 1I5OB 2VB6A 4ZTJA 2B86A 3EG3A 3OW2P 2D8HA 1MV3A 2FHDA 1ZSZB 1M30A 3GF5A 3PVLA 2RMOA 3JCMe 2DF6A 2L3SA 4PJOF 1JJ2A 2ZPGB 3EG1A 4EMHA 3UA6A 4LUDA 4Y91A 1K4US 2J06A 3VS3A 2GF7A 1QVFS 3PMIA 5GMKi 4Z8AA 1F1BB 1SG5A 3I9QA 1VQ7A 2AIRB 4PJOC 2K3XA 2RQRA 3ZBDA 2QI2A 3AT1B 1ZUKA 1QCOA 4RTTA 3DLMA 4YTLA 4A4GA 3CMEA 2EJFA 2KSSA 5FRMA 3L42A 3QYHB 2BKDN 2QASA 2CT4A 4D8DA 1RAEB 4DBFA 3X24B 3OYBA 1OV3A 2VVKA 5KE2A 2EYWA 1QP2A 5LJ3h 1SHGA 2V8IA 4J9GA 1DJ7B 1AZGB 2JXBA 1H8KA 1E7OA 1ZBXA 2P0QA 3CMAQ 4BDYA 5GANf 3CCET 2DPPB 5I22A 3ER0A 3J80E 4JPBW 2FZKB 2DL8A 4J6YA 1KQSP 5DLOA 1X43A 1Y7XA 4X1VA 1GCPA 1U8RA 1I1JA 3NMZC 4EMGA 1NYGA 4OVAA 5LJ5g 2AZSA 3VKIA 4RCCA 3M54A 3UATA 4C92E 2JT4A 2WSCE 2E5KA 1HK9A 4II1A 1PKSA 1A0NB 5HCKA 1NJIR 4FT4A 3GOXA 3E2UA 1S1NA 5FLXE 1GCQC 4A53A 5GAMd 5J3BA 2KE9A 3CCJT 4M78B 4DA4A 3JCMh 1IHWA 4M77G 3D7SB 4GLKA 3RKYA 1OOTA 2HKNA 2KBTA 4WCIA 3MHXA 3I55Q 3JCMb 1AZEA 3OYJA 3T9NA 1C0MA 4M7AD 4EMKB 4KBMB 1UGVA 1WXUA 1X01A 1IGUA 3FDRA 3CC7T 2DILA 1K8AC 2LT1A 2PU9B 1QVGS 1K9MR 3VJPA 3LH5A 2XD0A 2I0NA 3EAEA 3VS1A 4ESRA 2QAZA 1YJNT 3CC4T 1MMNA 1MMDA 4J9HA 1HSQA 2DD4A 1YBYA 2RJDA 1TUGB 2VXFA 4ELZC 1QWEA 1D0XA 1VYTA 2A7YA 5GAMh 1GBQA 5LJ3j 1Z9QA 2YRCA 1CKAA 3JRZA 4GBQA 2OTJT 3CBMA 4M77B 1PG5B 3VV0A 1YWPA 1NJIU 2VWFA 2M0OA 2CP7A 4JRQA 1LJOA 2ZPIB 2Z0WA 1UUEA 1YHQT 3A8GB 2GTJA 2PUOB 2P0PA 4HVWA 4HVUA 1WQWA 1K9MU 5L8RE 2DK3A 2DTOA 4J9BA 2RHZA 3H6ZA 1BCMA 3OS1A 3KXTA 4XQ3A 1TS9A 2J6OA 4F14A 3A5ZB 2DXBA 4F7UB 2EWNA 2NUTA 4A4KA 2DKGA 1VQ8T 4Q5WA 4XU0A 4F7UG 4OB0B 1VYVA 3G71T 2NLUA 2EYQA 1M5Q1 1X69A 2XMFA 2NUPA 5FRNA 1UB4A 2EQUA 2ENMA 2EGEA 1KQ2A 2L3RA 3DB3A 4KGVB 5KYYB 1PM3A 2OAWA 4MZTA 4KULA 2EJ9A 2EGCA 1PD1A 4PJLA 3MEWA 1NJIC 4MDXA 4JZ3A 5DLQE 3M56A 1M2VA 2E6NA 5LJ5f 3QSUA 4C92B 2CP3A 1SRLA 1D0YA 4F16A 5GAMg 4E7JA 2RI3A 2L8DA 2LZ6B 4OB1B 2OTLQ 5CR2A 1N8RU 2DAQA 5GAN3 1YFNA 2RNAA 1VQOQ 3LH0A 2FPDA 2KMTA 3L2WA 2WSEE 2YLCA 2DBKA 2KI7A 2B8AA 3EFOB 2A28A 4PK4A 3TEEA 3HTRA 2KDSA 4M78D 4M77F 1SHFA 4JJNK 4XAXB 1ZSZC 3C95A 4KGXB 4L6V5 4LDVA 3CMET 1K8AR 2E41A 2K6DA 1RLPC 2OTJA 2ZPHB 3OYYA 2DA9A 5A0LA 3DLLA 1WIEA 1M8VA 3PFSA 2EQIA 1TWBA 1KD1C 1IRXA 1YHQA 1K73C 2JVVA 4AG1C 1MMGA 4JLGA 3CBPA 2DJZA 1N9SA 1TG0A 4MMLA 4M78G 1QMCA 3FEOA 1NBEB 3LW5E 4HCKA 2CP5A 2GTOA 2KNBB 2M1HA 4X9CA 3RKXA 1WHKA 1VQ4Q 1BI1A 1MNDA 2EAYA 4A4HA 4J8OA 3FB9A 2QEXT 3CCEQ 3G4SA 3JB9F 3EG9B 3OS5A 1UHCA 3I55A 1VQ9A 2CP0A 3VS5A 2EQKA 5KH6A 1NE8A 3C12A 4JRKA 4M7AF 1Z9ZA 4C5GA 5GANd 1IO6A 2DE0X 1VQ5T 4EIKA 1QKXA 8AT1B 2JNGA 2P4TA 2YXYA 1BYMA 9ATCB 2KYBA 4RTYA 2K5FA 4IUVA 2CDTA 1AD5A 3THKA 1QVPA 2DX1A 2DFUA 2YUPA 3SHWA 1WHMA 1OULA 1VQLQ 3V7RA 1UFFA 1J3TA 3JCMd 4MDWA 3MEUA 2O4XA 1WHHA 2QA4Q 1Q86R 4HVVA 1NYFA 1LOJA 3JCMg 2MF2A 2LCCA 2R57A 4CI0C 1ZUYA 2PVDB 2L89A 1X2QA 1V76A 2V1RA 1T3SA 1MGQA 1YP5A 2FVUA 2ROTA 3R6NA 3FC3A 3L2ZA 4QKUA 2Y4YA 2K3BA 3EFSA 1Q86C 1Q82U 2LCSA 4C92D 3MPUB 5LJ5h 1U5SA 2CZ0B 2JM8A 2QQSA 4M75F 3QJ6A 4PL6A 4LNPA 2RJEA 1TUCA 3X20B 3H41A 3ME9A 1AWXA 2KT1A 2NWMA 1HD3A 4M78E 4C8QB 1KFZA 4BE1A 2K2MA 3JCMP 1NM7A 1OEBA 1WYXA 1GXIE 4PLIA 2C0TA 4JUVA 1JXMA 3OW2S 4M7AB 2CS7A 3G6EQ 1RLQC 3OS2A 3UA7A 4Z88A 1VIEA 2HQHA 5L23A 2J6FA 2DL3A 4CC4B 5FWCA 1U3OA 2LX7A 5HK3A 1KC8R 3HP9A 3EGDB 2K5LA 4BE0A 2LQ8A 4DOVA 2ED0A 2CP2A 2NUPB 5D6XA 3TSZA 4E7LA 2DL5A 2ATCB 1VQPT 2RD1A 3TREA 4RKUE 4M77D 4BE2A 1ZSGA 2GCXA 4FM4B 2LQNA 3G7ZA 1U06A 2AZVA 4O5VA 1G2BA 1X6OA 1TTHB 5M9OA 5GAMf 4B9WA 2HNIA 2RHYA 1ZA1B 3QO3A 3OYGA 2F5KA 2YLBA 3VYGA 5GAOm 2RI5A 4ZTFA 3JB9J 3CCVT 1YJ9Q 3M5AA 1VQMQ 4FYYB 5A2QE 2DEUA 2JM9A 1B34A 1W2BP 1MMAA 2BTTA 4XK8E 2H3JA 3X26B 1BIBA 1UECA 1I0CA 1SSHA 4B6MA 1RUWA 5CKBA 1M9SA 4FCYA 3O5ZA 2DL4A 3CCLQ 1OU8A 2KVQG 2MAMA 4DBQA 1NEGA 1GBRA 4RMOA 1S72Q 3CEYA 3VRYA 1GRIA 2XG8D 4JS4A 4EMKA 1OZ2A 3CCST 2FO0A 4PJOA 3SWNB 2COWA 1XOVA 4OB3B 4D8KA 2JJ9A 2IVWA 2JZ2A 4EMKC 4HXJA 1Y96B 3JB9D 5CQXA 3QXEB 3OMGA 2BZ8A 2XI9A 4C8QF 5KYXB 2KXCA 3CPWP 4E7HA 3OYKA 2DZ9A 4CC3A 1U1SA 2KR3A 3MJXA 3H0HA 3V7CA 1M8MA 7AT1B 2JUFA 1T0JA 3ZL7C 1VOMA 2M16A 3JB9I 1SKUB 4M7DG 4CRIA 3NFCA 3S6WA 1YITQ 1VQNA 1I8FA 2L3QA 4B9XA 2GQIA 4HKEA 2BE9B 1KD1R 2J7IA 5KYNA 4ELYC 4FYWB 4DEYA 2P0KA 2RQVA 2QEXA 2RB6A 2VV5A 3SEMA 3CCMT 3NTKA 2LP5A 4F7UF 2SEMA 5GJVB 1RAFB 2W10A 5GAMe 1UGPB 3CC2Q 1WQ7A 3IQLA 2MYSA 2RH2A 5GAN6 1VQPQ 2YRVA 2LX9A 1WHJA 3C4SA 1QVGA 3CCJA 5GJWB 5KYYA 3NPFA 2O9SA 3CCQT 1VQ6Q 2FYKA 1D3BB 4M7DC 5FWBA 3QIIA 4Z89A 3EG2A 2I2LA 1D09B 3OYCA 1MUZA 5CQYA 3OS0A 4PJMA 1O75A 2HSEB 4QT7A 4ZGDB 2BE7D 5LJ3g 1LNXA 2W0ZA 2HQXA 1U1TA 2HD0A 2FZGB 3M58A 2EPDA 3MKDA 4CC7A 4HT9A 2ESWA 3PT9A 5C6SA 4QVDA 2OI3A 4OF1A 4OMFB 2L3PA 4OP0A 3QZ9B 4M7AE 3A1PA 4OMPA 3M0SA 5DM7R 2C0OA 1VQKQ 4A63B 1OPLA 1SPKA 1K73U 2LT4A 4M75G 3VS0A 3ZFJA 1W4SA 1D1BA 2LVMA 2RF0A 3RMQA 2FZCB 4OMLA 4M7DB 4PJNA 1VQLT 4JRIA 1S72T 3FRNA 2JS2A 3NGPA 4C5EA 1TH7A 4MZPA 4KH0B 3GPLA 5HY6A 1YJ9A 4A54A 1VQMA 1QCFA 4C8QC 3CBOA 3RUXA 2L2PA 5GAMj 3OY9A 3JCMJ 3MEAA 2GBQA 3QWYA 4JLIA 2SRCA 4M7AC 3CCUA 4BY6C 3RDVA 2NUTB 3KFVA 2ZZDA 3CCSA 4HCCA 4XTXA 3GLXA 3MO8A 2BIVA 5I11A 1JO8A 4O6JA 2MOXA 2CYZB 1WXBA 3L2UA 2O2OA 4J9EA 1RAGB 4ZN3A 2ABLA 2K2VA 3L2QA 1S72A 5FU7B 1M90C 2EQJA 2CSIA 1G3SA 2FB7A 4C5HA 5FU6C 2KEAA 1VQKT 4NL2A 2RQUA 1YNZA 4C0ZA 4PLLA 3HPWA 3L2VA 2DXTA 2VC8A 4RTZA 4OB2B 2QTVA 5GAN5 5DY9A 3M55A 1PHTA 1ZSZA 5GMKj 4HCBA 4LE9A 2QDYB 2CSQA 3V7SA 2ZPBB 1K73R 4NOYA 4AFQC 2ROLA 3X28B 5CK9A 2A36A 3M0QA 3SD4A 2A0FB 1R0CB 5KYWB 1OQKA 1YIJQ 2HAXA 4XTWA 4M78F 3EFOA 3CCRQ 1QLYA 1E6HA 2EYXA 1UGSB 3RR6A 2XIDA 2O4XB 1UHFA 2LJ3A 1KHIA 2D9TA 4C8QG 1IREB 5D6YA 3CXCA 5IT9E 1VQNQ 2LJ1A 2JS0A 2X4WA 4HA8A 3G71Q 1VYUA 3META 1AWJA 1KSWA 4FIBA 3OYEA 3CC4Q 3SB2A 1HYOA 3PE0A 3HHTB 1K8AU 5CCAA 2YSQA 3VS4A 2HKQB 4M75C 3OQ5A 1VQ7T 2X51A 4F04B 4JDSA 2QA4T 2L5QA 5KE3A 1YN8A 2LNVA 2YHTA 4IUPA 2P84A 5IXBA 2FRYA 1TSFA 2DVEA 4C8QA 2OJ2A 1FMWA 4FYXB 3JV3A 4FW1A 1G3WA 2CP6A
chains in the Genus database with same CATH topology
3LYIA 4C92C 1O9SA 3FC3A 3L2ZA 3OYAA 1JJ2S 3OB9A 2Y4YA 5CKDA 1BKBA 2LRQA 3EFSA 3JSCA 3CXCS 1VQ6A 4M7AA 1Q86C 1YIJA 1Q82U 4C92D 4BI4A 4R55A 3URGA 5GMKl 5CO7A 5GAOl 1YIJT 3A8OB 1YCYA 3QZ5B 2DXCA 3CCVA 5LJ5h 2CZ0B 1WPYA 2QQSA 2WACA 2K3YA 4M75F 2R5AA 2K5IA 3QJ6A 4PL6A 4QQGA 2RJEA 3CPFA 4PJOG 4BI8B 5I2SA 3X20B 3OYIA 4N4GA 2PVOB 3ME9A 4N4IA 2EIFA 1YJWA 5I21A 2K57A 4PKCC 2DIQA 1N6AA 3J81E 1X75C 1VQ6T 2RO0A 4QQ6A 1Y96A 3QG1A 4FT2A 4M78E 4C8QB 1VQPA 4LD9K 2LQKA 2VGNA 4RG8A 2ZPEB 3UDCA 1N9RA 4C8QD 3SFMA 5GMKm 4BE1A 2D0QB 1XNIA 2WSFE 5GMKh 2E70A 4JS5A 1M1FA 4C0DB 3G71A 5C0MA 2AHJB 4PLIA 3JCMP 1GXIE 4NS5A 1WGSA 4JUVA 3OA6A 2O01E 2LTOA 3FJPA 3RESA 3OW2S 2RA2A 4M7AB 2CS7A 3P8DA 5IN1A 3OS2A 4ZTJA 4BB7A 5AYFA 1VQKA 4C92A 2EJGA 1VIEA 3G6ET 2FHDA 3L1AA 3GF5A 3OBYA 2QA4A 1Y71A 3CCLA 3R6OA 4IURA 4LDUA 3JCMe 3HRTA 5KCHA 4PJOF 3A8MB 4QQDA 1JJ2A 2ZPGB 1QVFA 4EMHA 1OI1A 5A0DA 5HK3A 5J26A 1OZ3A 2KQWA 3HP9A 4Y91A 3JCMW 2K5LA 4BE0A 2CZ6B 2GF7A 2V8JA 2LQ8A 4M77E 4DOVA 3HSBA 3HRSA 4XU2A 1QVFS 3N5BB 1KQ1A 3PMIA 3BY7A 5D6XA 5GMKi 4E7LA 1VQOA 1N8RC 1EIFA 5FU6B 2DO3A 1VQPT 2RD1A 1VQ5A 2DZCA 1JRIA 3M4YA 1VQ7A 4PJOC 3MCAB 2K3XA 3RMSA 3LLRA 3TREA 2RJFA 3ZBDA 4RKUE 2QI2A 4M77D 5GANj 4BE2A 1G3TA 2GCXA 4FM4B 1VUBA 3OYNA 3LX7A 3DLMA 3G7ZA 4YTLA 4A4GA 4O5VA 3CMEA 1YJ9T 5GANe 4C0DC 3VUBA 1X6OA 2EJFA 2HQEA 3GNFB 1UEBA 2KSSA 1KC8C 2DD5A 5FRMA 3L42A 3QYHB 2BKDN 4ZN1A 5M9OA 3VUZA 5GAMf 4B9WA 4XU1A 3X24B 3OYBA 2XDDA 3VYHB 2HNIA 2RHYA 3JCMX 3QO3A 5KE2A 2F5KA 3OYGA 2YLBA 1QP2A 1WNLA 5LJ3h 3VYGA 5GAOm 2RI5A 2V8IA 4ZTFA 5LL6S 2CZ1B 1Q7YC 3RERA 3JB9J 3CCVT 4WF2A 3M5AA 1DJ7B 3SWNC 1Q86U 5A2QE 3GIBA 1ZBXA 2P0QA 1B34A 3I55T 2XHCA 3LWHA 2XDPA 2JN0A 4BDYA 5GANf 3CCET 4KUDK 2DPPB 5GAN4 4XK8E 2H3JA 3ER0A 3X26B 3J80E 1BIBA 3BDUA 4J6YA 4F7UA 4M78A 5KCOA 5CKBA 4XTUA 3JCMV 5DLOA 5LJ5d 3CC2T 1Y7XA 1M9SA 1U8RA 2PUKB 4LDYA 4J7FA 4EMGA 2DXUA 3PGGA 2KVQG 2M9UA 2MAMA 4OVAA 5HKCA 5LJ5g 2E64A 2RK1A 2C06A 2GFUA 4KT0E 3VKIA 4RCCA 3M54A 5EG2A 4C92E 2GQVA 2RHUA 2WSCE 3F70A 2XK0A 2QQAA 5I2MA 1WJQA 1VQ4T 1HK9A 5CKFA 3QBYA 4II1A 1I4K1 3E19A 2JTFA 2X35A 4RMOA 2EFIA 4TVRA 3OYLA 3CEYA 2E5QA 1H641 4FT4A 3JCMf 3GOXA 4NL3A 4HCZA 5FLXE 4A53A 5CAIA 3EFRA 2XG8D 5GAMd 4JS4A 4EMKA 5J3BA 3WVEB 5CKEA 3CCRA 1OZ2A 2EQMA 3DKMA 3M4GA 3CCST 3CCJT 4M78B 4BY6B 3OYHA 2CZ7B 1M1KU 4M7DD 1VQ4A 4PJOA 3SWNB 3CCQA 1VQMT 4DA4A 4BD3A 1VQ9T 1XOVA 4XTYA 4OB3B 3JCMh 4M77G 5J39A 1VQOT 2LC4A 4GLKA 2IVWA 3RKYA 2A3LA 2JZ2A 1RL2A 4EMKC 4E7IA 1K9MC 1Y96B 3MHXA 3BDLA 4BACA 3S3NA 4J7IA 1ZQ1A 3X25B 5CQXA 2RJCA 3JB9D 3QXEB 3NTIA 3JCMb 4KUIA 1FXXA 2FL7A 1V29B 4N0AA 3OMGA 3OYJA 2XI9A 4OGCA 3T9NA 4C8QF 1NZ9A 4E7HA 3OYKA 2DZ9A 1U1SA 2ZGWA 4DOWA 4M7AD 3CMAA 4EMKB 3V7CA 3CC4A 2PQWA 1KC8U 4N4HA 2JUFA 3VU3C 4KBMB 4C8QE 4M7AG 3PIPA 4V2SA 3CC7A 1UGRB 1X01A 2F69A 3FDRA 3CC7T 2M16A 3JB9I 1K8AC 4M7DG 2LT1A 2PU9B 4CRIA 1QVGS 5GANh 5LJ3e 4J83A 3VJPA 3NFCA 2XD0A 3EAEA 3JAME 3S6WA 4D6WA 5LJ5e 5GAOq 1VQNA 3JB9G 1YJNT 1I8FA 2MI6A 3CC4T 3GPLA 1YITT 4B9XA 5LJ3f 2X4JA 4QW2A 2DD4A 2CGHA 1YBYA 2RJDA 1RI0A 4FL6A 2VXFA 4HKEA 5CKHA 4C0GA 4ELYC 1I81A 4ELZC 5GAOp 2A7YA 5GAMh 5LJ3j 4A4EA 3GP8A 2P0KA 2Y90A 4ZGJB 2QEXA 2RB6A 2QQBA 2VV5A 3JRZA 2OTJT 3CCMT 3CBMA 1I5LA 3E9GA 2XU8A 4M77B 5FU7C 3NTKA 4F7UF 5CVIA 3VV0A 1NJIU 3H8ZA 2M0OA 5GAMe 3S3OA 1UGPB 2LCLA 1WQ7A 3I56A 3CD6T 1OYXA 2OTLA 4JRQA 3QPHA 1MHNA 1LJOA 2ZPIB 4BDZA 2JOYA 3V8JA 1YI2A 3OYFA 1Q81C 2RH2A 4JRPA 2VUBA 5GAN6 1YHQT 2MWOA 3OSSC 5IAYA 3A8GB 2PUOB 1B34B 2P0PA 2LX9A 2YRVA 1WJRA 1WQWA 3C4SA 3LGFA 1QVGA 1K9MU 3ASKA 3CCJA 2MWPA 5L8RE 2DK3A 2DTOA 3CCQT 2RHZA 3H6ZA 4PNOA 3OS1A 3KXTA 2FYKA 4XQ3A 1D3BB 4M7DC 1KD1U 1YJWT 4M77A 3A5ZB 3MEVA 3QIIA 2DXBA 3I56T 2I2LA 2XKOC 2EWNA 3HKSA 4F7UB 3CD6A 3CCLT 4RCBA 4QVCA 1XQHA 3HFNA 4A4KA 3E9FA 2DKGA 2DTIA 1VQ8T 4Q5WA 3OYCA 2QXFA 4XU0A 5CQYA 4F7UG 4OB0B 1O75A 5FROA 3OS0A 4ZGDB 4OGEA 4C5IA 5LJ3g 2ZPFB 3G71T 3CCRT 2NLUA 4M7DA 1LNXA 3QDRB 2HQXA 1U1TA 2G3RA 2EYQA 2HD0A 3M58A 1G5VA 3UPUA 4QVZA 1M5Q1 4HT9A 1Q82C 1YITA 1UB4A 5FRNA 2EQUA 4HT8A 2HBPA 5GAN7 3PT9A 5C6SA 1KQ2A 2L3RA 4QVDA 2E6ZA 2QTXA 3E1SA 4ME7A 4OF1A 4E47A 4L59A 3DB3A 4OMFB 4OP0A 3PNWC 4J5YA 4MZTA 4KULA 1VQNT 3QHSA 3QYGB 3QZ9B 4M7AE 1NPPA 2EJ9A 3G4ST 1NJIC 4MDXA 3MEWA 2DTHA 2PVGB 1PSEA 5DLQE 5DM7R 3MP1A 3CC2A 3M56A 2EKOA 2E6NA 5LJ5f 3QSUA 1K73U 3M59A 4RG2A 1AHJB 2LT4A 3PMTA 4M75G 3JCMc 4C92B 4PJOD 1JBMA 1Y07A 4M75A 3ZFJA 2JTMA 1W4SA 4A4FA 3DB4A 2LVMA 5GAMg 4E7JA 3RMQA 1KG1A 4M75E 4R56A 4M75D 2RI3A 4M7DB 1BI2A 2L8DA 3SWNA 4E7KA 4OB1B 1BI3A 4IUUA 1FX7A 5CR2A 1N8RU 1VQLT 4JRIA 1XTDA 3C94A 4UC4A 2DAQA 5GAN3 1S72T 3FRNA 1KHCA 3G6EA 4MZMA 2RHIA 4MMKA 3LH0A 4C5EA 3A8HB 1TH7A 1VIFA 2KMTA 4MZPA 5HY6A 5GAN2 4BUGA 2WSEE 2YLCA 4A54A 3L2WA 1YJ9A 1VQMA 3AHUA 3OSVA 2B8AA 4C8QC 4LD6A 3CBOA 1KQSS 3RUXA 4IKFA 3TEEA 1Q7YU 2KDSA 4M78D 1IZ6A 2IG0A 4M77F 3TU4K 3QJYA 3OBWA 3HRUA 5GAMj 3OY9A 3JCMJ 5GAN8 4JJNK 3MEAA 3C95A 4XAXB 5CIUA 3JCMQ 3NTHA 1W2BS 4JLIA 1VQ8A 4M7AC 4L6V5 3CCUA 4LDVA 1SSFA 4M78C 4BY6C 3PTAA 3BW1A 3L2RA 3CMET 3ZEHA 3CCUT 1Q81U 2E41A 4M7DF 2OTJA 2ZPHB 3OYYA 1UGQB 2ZZDA 3CCSA 4HCCA 5A0LA 2F5TX 4XTXA 3GLXA 3MO8A 3DLLA 1HXDA 5GAOn 3UT1A 2BIVA 2E10A 3SDZA 2KAFA 2OTLT 3JB9H 4LDWA 1FWZA 3HFOA 3INZA 3M57A 4O6JA 3CPWS 1M8VA 3PFSA 2CYZB 4X9DA 2RK2A 1KD1C 4XU3A 3L2UA 1YHQA 3J7AF 1K73C 1VQLA 1YI2T 4ZN3A 3CCMA 2K2VA 3L2QA 2JVVA 1S72A 5FU7B 2RI2A 5LJ5j 4JLGA 1M90C 3OYMA 2EQJA 3CBPA 3KBGA 2DJZA 4VUBA 1G3SA 2FB7A 4Z02A 3Q1JA 4C5HA 1N9SA 1YJNA 4IUQA 3P8BB 4MMLA 5FU6C 4M78G 4BI3A 1VQKT 3FEOA 4NL2A 2E65A 3LW5E 4PJOB 3QKJA 4C0ZA 2LDMA 3MP6A 4PLLA 1P92A 2M1HA 3HPWA 3L2VA 3WXMB 2DXTA 2VC8A 4X9CA 4OB2B 3RKXA 1BI1A 5GAN5 4M75B 5DY9A 4C92G 2RM4A 3M55A 1KQSA 2D6FA 1M1GA 2EAYA 4A4HA 1M1KC 3V8LA 5GMKj 4J8OA 4L5GA 5LJ3d 4HCBA 2QDYB 2R58A 3FB9A 4J6XA 3V8KA 2QEXT 3BFMA 3QUIA 3HL8A 3V7SA 2ZPBB 3G4SA 2CKKA 3JB9F 4PJOE 4NOYA 4X34A 3OS5A 3FLGA 1W2BA 3I55A 1VQ9A 4F7UE 1N27A 3X28B 3KUFA 5CK9A 1H3ZA 4M77C 2X4XA 2EQKA 3SD4A 1G3YA 1NE8A 5KH6A 3C12A 2DIGA 1ZHIA 4JRKA 2HAXA 4XTWA 4M7AF 4C5GA 4C92F 4M78F 4C0FA 5GANd 1BI0A 1VQ5T 3CPWA 3S3MA 3WVDB 1BIAA 1D3BA 5GANg 1UGSB 3M9QA 4ATOA 3LWIA 2XIDA 1QW1A 2O4XB 3M53A 2JNGA 2P4TA 2GFAA 3RIRA 4M7DE 1KHIA 2D9TA 4C8QG 1BYMA 1JB0E 2E12A 4FSXA 3PIOA 1IREB 5D6YA 2XDBA 1PSFA 4LDXA 1QP3A 3LGLA 2ZCFB 4P5NA 5D6WA 2VGMA 3CXCA 5IT9E 4IUTA 2R5MA 2K5FA 4IUVA 2BUDA 2X4YA 3RKWA 3CMAT 4N0AC 4DQ2A 1QVPA 2OAUA 5GAOr 2MMPA 2X4WA 4HA8A 3META 4GY5A 5GMKe 2DEQA 4FIBA 4ZGEB 3A8LB 3OYEA 2VYTA 2QQ9A 2XICA 3SB2A 3V7RA 3HHTB 2V8KA 5CCAA 2E1HA 1K8AU 3JCMd 3TCJA 5A0GA 4MDWA 5HK0A 1NPRA 3MEUA 2O4XA 4M75C 2VXEA 2KY9A 3OQ5A 1VQ7T 1R8OB 3P8HA 1M90U 3MP8A 3FIFA 3O8VA 4JDSA 1LOJA 1M4ZA 2L5QA 3JCMg 4J6WA 5KE3A 2QA4T 3OMCA 1WJSA 2MF2A 2LNVA 3UWNA 4EPCA 4FU6A 2LCCA 2R57A 4CI0C 4EDUA 3OW2A 2KK4A 2K4YA 2YHTA 4IUPA 4XTZA 4Y28E 2PVDB 3GNGA 2L89A 4XTVA 3OYDA 2DVEA 2Y4XA 3CCEA 4C8QA 2RHXA 1MGQA 2QQRA 2FVUA 1G3WA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1BIB A;  1HXD A;  5GAM e;  5GAO n;  4C92 C;  2E10 A;  3BDU A;  4J6Y A;  1WQ7 A;  4F7U A;  3HFO A;  3INZ A;  3L2Z A;  4M78 A;  3JB9 H;  4F7U B;  1M8V A;  4XTU A;  3JCM V;  5LJ5 d;  3EFS A;  1LJO A;  4X9D A;  4M7A A;  4XU3 A;  3V8J A;  4C92 D;  5GAN 6;  5GAO l;  5GMK l;  4EMG A;  2DXU A;  3PGG A;  1YCY A;  5LJ5 h;  1B34 B;  5LJ5 j;  5LJ5 g;  2E64 A;  1WPY A;  1WQW A;  2DJZ A;  2FB7 A;  4M75 F;  5GAN g;  4PJO G;  3RER A;  1N9S A;  4MML A;  4RCC A;  4M78 G;  2DTO A;  4C92 E;  4NL2 A;  2E65 A;  4PNO A;  4PJO B;  2FYK A;  4XQ3 A;  1D3B B;  5I21 A;  4M7D C;  1HK9 A;  2K57 A;  5GAN 5;  4PJO E;  4M77 A;  2DXT A;  2VC8 A;  1I4K 1;  4X9C A;  3RKX A;  2I2L A;  1Y96 A;  2EWN A;  4M78 E;  4C8Q B;  4M75 B;  5DY9 A;  1H64 1;  4C92 G;  2RM4 A;  4RCB A;  4QVC A;  3HFN A;  3JCM f;  1N9R A;  4C8Q D;  5GMK m;  4NL3 A;  2DKG A;  2DTI A;  2EAY A;  5CAI A;  3V8L A;  4A53 A;  5LJ3 d;  3EFR A;  4XU0 A;  5GMK h;  4F7U G;  3FB9 A;  4J6X A;  3V8K A;  5GAM d;  3JCM P;  3BFM A;  3QUI A;  4JUV A;  3V7S A;  4EMK A;  5LJ3 g;  3JB9 F;  3FJP A;  4M7D A;  1LNX A;  4NOY A;  3RES A;  1U1T A;  2RA2 A;  3M4G A;  4M7A B;  4M7D D;  4PJO A;  4M78 B;  4F7U E;  1M5Q 1;  4HT9 A;  3SWN B;  4C92 A;  2EJG A;  4M77 C;  4HT8 A;  4XTY A;  3JCM h;  5GAN 7;  4M77 G;  1KQ2 A;  4QVD A;  2QTX A;  3RKY A;  5GMK j;  4EMK C;  3L1A A;  4JRK A;  4M7A F;  4XTW A;  1Y96 B;  4OP0 A;  4M78 F;  4C92 F;  4J5Y A;  3JCM e;  5GAN d;  3JB9 D;  3QHS A;  4PJO F;  4M7A E;  2EJ9 A;  1BIA A;  1D3B A;  4EMH A;  3JCM b;  2DTH A;  4N0A A;  4Y91 A;  3RIR A;  4C8Q F;  3JCM W;  4M7D E;  5LJ5 f;  3QSU A;  4C8Q G;  4M75 G;  3JCM c;  4C92 B;  4M77 E;  4PJO D;  1JBM A;  3HSB A;  2DZ9 A;  4M75 A;  4XU2 A;  1U1S A;  2ZGW A;  4M7A D;  4EMK B;  1KQ1 A;  3V7C A;  3BY7 A;  5GMK i;  5GAM g;  3VU3 C;  4M75 E;  3RKW A;  4C8Q E;  4N0A C;  4DQ2 A;  4M7A G;  4V2S A;  2RD1 A;  4M75 D;  5GAO r;  2DZC A;  1JRI A;  4PJO C;  4M7D B;  4HA8 A;  3SWN A;  1X01 A;  3JB9 I;  5GMK e;  4M7D G;  2DEQ A;  4JRI A;  4M77 D;  5GAN h;  5GAN j;  5LJ3 e;  5GAN 3;  3SB2 A;  4MMK A;  3V7R A;  5LJ5 e;  5GAO q;  1TH7 A;  2E1H A;  5GAN e;  3JCM d;  2EJF A;  5GAN 2;  1I8F A;  2YLC A;  3JB9 G;  4A54 A;  3AHU A;  4M75 C;  5LJ3 f;  4C8Q C;  5GAM f;  2VXE A;  2CGH A;  4XU1 A;  3RUX A;  2VXF A;  2HNI A;  4M78 D;  1I81 A;  3FIF A;  3JCM X;  4M77 F;  1LOJ A;  3QO3 A;  3JCM g;  4J6W A;  5GAO p;  5GAM j;  2YLB A;  5GAM h;  5GAN 8;  1WNL A;  5LJ3 h;  5LJ3 j;  3JCM Q;  5GAO m;  3JCM J;  4JLI A;  2Y90 A;  4M7A C;  2YHT A;  3JB9 J;  2RB6 A;  4M78 C;  4WF2 A;  3SWN C;  4XTZ A;  3BW1 A;  1I5L A;  2E41 A;  4M7D F;  4M77 B;  4XTV A;  2DVE A;  3GIB A;  1B34 A;  4F7U F;  4C8Q A;  1MGQ A;  2JN0 A;  5GAN f;  5GAN 4;  4XTX A; 
#chains in the Genus database with same CATH topology
 3LYI A;  3QWX X;  4C92 C;  1O9S A;  4OMQ A;  2YRD A;  2NUZ A;  1BKB A;  2LRQ A;  3CXC S;  3JSC A;  1VQ6 A;  4M7A A;  1ACM B;  4BI4 A;  5GAO l;  1YIJ T;  1PRM C;  1YCY A;  3A8O B;  2MIO A;  1W1F A;  2VAS A;  4LD9 K;  5I2S A;  1WHL A;  4BI8 B;  1AWO A;  4N4G A;  2PVO B;  4PFP A;  1K76 A;  2EIF A;  1YJW A;  1LVK A;  2K57 A;  3J81 E;  1N6A A;  3VRZ A;  3QG1 A;  1ZX6 A;  2ZPE B;  4C8Q D;  5GMK m;  2WSF E;  1M1F A;  2O01 E;  3FJP A;  1IHV A;  2M02 A;  3P8D A;  2QGG A;  2EJG A;  3G6E T;  1IB8 A;  3OBY A;  2MK5 A;  1Y71 A;  3R6O A;  3HRT A;  5KCH A;  1OI1 A;  5A0D A;  4AFS C;  5J26 A;  3VS6 A;  2C0I A;  2KQW A;  2DBM A;  2MPX C;  2V8J A;  4M77 E;  3HRS A;  1UG1 A;  1V1C A;  1FMK A;  2H3E B;  1VQO A;  1EIF A;  5FU6 B;  1VQ5 A;  1JRI A;  4E6R A;  3MCA B;  3RMS A;  2RJF A;  1WZO A;  3OYN A;  3CCV Q;  1YJ9 T;  4C0D C;  3VUB A;  1KC8 C;  3GNF B;  3TQ7 P;  1UEB A;  2DD5 A;  2ED1 A;  2ZAE A;  2VKN A;  2AK5 A;  2EYY A;  4FYV B;  3JCM X;  1ZA2 B;  1WFW A;  2CZ1 B;  2O31 A;  2PNI A;  4WF2 A;  3SWN C;  1Q86 U;  2K9G A;  4KH1 B;  1YHQ Q;  3I55 T;  2XHC A;  3LWH A;  2XDP A;  4KUD K;  5GAN 4;  3ULR B;  1ABQ A;  1BU1 A;  1JEG A;  1AWW A;  2QDL A;  3BDU A;  4M78 A;  5KCO A;  4XTU A;  5LJ5 d;  2DL7 A;  2PUK B;  4J7F A;  1M3C A;  3M0U A;  2KT8 A;  1NEB A;  2E64 A;  2RK1 A;  4KT0 E;  1RAC B;  1PKT A;  2GQV A;  2M0Y A;  3BE3 A;  2XK0 A;  2QQA A;  5I2M A;  1WJQ A;  1VQ4 T;  5CKF A;  3QBY A;  1I4K 1;  2X35 A;  2EFI A;  1OU9 A;  1H64 1;  2DJQ A;  2YUO A;  4NL3 A;  2QEX Q;  5CAI A;  1YCS B;  1WX6 A;  2LJ0 A;  2KXD A;  5CKE A;  4M7D D;  4BY6 B;  3OYH A;  1M1K U;  2J05 A;  1VQM T;  4BD3 A;  4RTX A;  2LC4 A;  2A3L A;  1RL2 A;  1N5Z A;  4E7I A;  4BAC A;  1ZQ1 A;  6AT1 B;  4ORZ A;  4KUI A;  1FXX A;  2FL7 A;  1V29 B;  1UDL A;  2P4R A;  4RUG A;  1M2O A;  3CC4 A;  2PQW A;  1KC8 U;  4N4H A;  2GGR A;  3PIP A;  4V2S A;  5KYW A;  1UGR B;  2F69 A;  2HL3 A;  5LJ3 e;  1G8X A;  4J83 A;  3JB9 G;  2LNH B;  1YIT T;  1K9A A;  2CGH A;  1RI0 A;  1PWT A;  1Q81 R;  1I81 A;  3EH1 A;  1JQQ A;  3PVQ A;  5GAO p;  2CH4 W;  3GP8 A;  1B7T A;  2G6F X;  1I5L A;  3E9G A;  2XU8 A;  5IHN A;  5CVI A;  1VA7 A;  1X6G A;  1SRM A;  3S3O A;  1B07 A;  3I56 A;  3CD6 T;  1OYX A;  5KYU B;  2OTL A;  2K7A A;  3QPH A;  2DYI A;  2JOY A;  3V8J A;  3OYF A;  2CT3 A;  2VUB A;  2MWO A;  5IAY A;  1Q82 R;  3LGF A;  3EG9 A;  4AG2 C;  2MWP A;  4PFZ A;  4PNO A;  1PNJ A;  1YJW T;  1KD1 U;  2DYB A;  2EKH A;  4J9F A;  3G6E A;  3A98 A;  2XKO C;  3HKS A;  1AVZ C;  1ZLM A;  4RCB A;  4QVC A;  1XQH A;  3HFN A;  1X27 A;  2DTI A;  2QXF A;  1FMV A;  1XJW B;  3QDR B;  1G5V A;  3UPU A;  4QVZ A;  1KJW A;  1Q82 C;  4HT8 A;  5GAN 7;  3QDF A;  2E6Z A;  2QTX A;  3E1S A;  4ME7 A;  4E47 A;  1T3L A;  2RPN A;  2HDA A;  3PNW C;  4J5Y A;  1M3B A;  4WTO B;  3EHR A;  3G4S T;  1PSE A;  1VQ5 Q;  3MP1 A;  5IH2 A;  4OMN A;  2EKO A;  3M59 A;  4RG2 A;  1AHJ B;  1NLP C;  2KRN A;  3JCM c;  4PJO D;  1Y07 A;  4M75 A;  2YUQ A;  3DB4 A;  2KRM A;  4J9I A;  1KG1 A;  2FPE A;  4M75 D;  2FG0 A;  2D0N A;  3TVT A;  1BI2 A;  1GFC A;  2D8J A;  2EGA A;  1FX7 A;  2KRO A;  2DVJ A;  1BCO A;  1KHC A;  2RHI A;  3A8H B;  1VIF A;  2HMA A;  2O88 A;  2JW4 A;  3FJ5 A;  1VQ7 Q;  3OSV A;  3EGX B;  1UTI A;  2AT1 B;  2DRM A;  3UF4 A;  2IG0 A;  3QJY A;  3OBW A;  3RBB B;  3HRU A;  3CD6 Q;  5GAN 8;  3JCM Q;  2YDL A;  1VQ8 A;  1W2B S;  4RTU A;  1GCQ A;  1WXT A;  4DBH A;  4E7K A;  3PTA A;  3BW1 A;  3L2R A;  3ZEH A;  1EX4 A;  2E3I A;  2EBP A;  2FPF A;  2ECZ A;  4FW2 A;  3UT1 A;  4ZNX A;  2COY A;  2KAF A;  3SDZ A;  2OTL T;  3M57 A;  3CPW S;  3INZ A;  3JB9 H;  1M1K R;  1M27 C;  4X9D A;  2RK2 A;  3J7A F;  1VQL A;  3CCM A;  2HSP A;  3KBG A;  2F2X A;  4Z02 A;  4AT1 B;  3Q1J A;  3P8B B;  2H8H A;  3GBQ A;  3QKJ A;  2LDM A;  2PZ1 A;  4OMM A;  4FSS A;  2EYZ A;  2HZY A;  4C92 G;  2YUN A;  2RM4 A;  1WI7 A;  1RI9 A;  2DET A;  1M1K C;  5LJ3 d;  1SF9 A;  2F2V A;  2R58 A;  3V8K A;  1KK7 A;  3BFM A;  3HL8 A;  4PJO E;  1W2B A;  1HJD A;  1BB9 A;  1TU0 B;  3KUF A;  1M90 R;  1H3Z A;  2AKL A;  1G3Y A;  1ZHI A;  4RTW A;  3REA B;  2QK0 A;  1R0B G;  4C92 F;  3CPW A;  1MV0 B;  3WVD B;  1BIA A;  3CCQ Q;  3RIR A;  4M7D E;  1YWO A;  1Q95 G;  2X3X D;  1JB0 E;  2E12 A;  2IPO B;  3PIO A;  1PSF A;  4LDX A;  1QP3 A;  2K79 A;  4P5N A;  2ZCF B;  2VGM A;  4IUT A;  3CMA T;  3EG0 A;  4DQ2 A;  3H0F A;  2OAU A;  5GAO r;  1Q7Y R;  2MMP A;  4GY5 A;  4J9C A;  4ZGE B;  3A8L B;  1QKW A;  2VYT A;  8ATC B;  2XIC A;  1WHG A;  1RAA B;  1NPR A;  4DEX A;  2VXE A;  3REB B;  2KY9 A;  3P8H A;  1M90 U;  4LN2 A;  3FIF A;  3O8V A;  1M4Z A;  2PTK A;  1K0S A;  3OMC A;  1JXO A;  3CC2 A;  4FU6 A;  3I56 Q;  2KK4 A;  2K4Y A;  3GNG A;  4XTV A;  3OYD A;  2Y4X A;  3G4S Q;  2LQW A;  2RHX A;  2QQR A;  3CCJ Q;  3H9N A;  3OYA A;  3OB9 A;  5CKD A;  3TSW A;  1NG2 A;  4R55 A;  5CO7 A;  3QZ5 B;  2DXC A;  3CCV A;  4IIO A;  2WAC A;  2K3Y A;  4QQG A;  2R5A A;  1VQ9 T;  3RER A;  3OYI A;  4N4I A;  4PKC C;  2DIQ A;  3EGU A;  3H0I A;  4QQ6 A;  2E3H A;  1UE9 A;  1QWF A;  2RQW A;  4RG8 A;  5GMK h;  1PC0 A;  4K11 A;  4JS5 A;  4C0D B;  2CUB A;  1M3A A;  1WGS A;  1UJ0 A;  2RA2 A;  4JJB A;  5IN1 A;  1IXD A;  4BB7 A;  5AYF A;  1VQK A;  4C92 A;  5IHK A;  3I5R A;  3L1A A;  2QA4 A;  3CCL A;  4IUR A;  4LDU A;  3A8M B;  4QQD A;  2QGF B;  1OZ3 A;  2OX7 A;  3JCM W;  1IGQ A;  2CZ6 B;  1W70 A;  3HSB A;  4XU2 A;  1GFD A;  4KRT A;  3N5B B;  1KQ1 A;  3BY7 A;  1N8R C;  2DO3 A;  2DZC A;  3M4Y A;  3EH2 A;  3LLR A;  2LMJ A;  5GAN j;  1G3T A;  1VUB A;  3LX7 A;  2DNU A;  2YT6 A;  4PJJ A;  1VQ8 Q;  5GAN e;  2HQE A;  2HL5 C;  4ZN1 A;  3VUZ A;  4XU1 A;  2XDD A;  3VYH B;  2BZY A;  1K0X A;  1WNL A;  5LL6 S;  1Q7Y C;  1QVF P;  2GNC A;  4JJC A;  4Y92 A;  3GIB A;  2YWW A;  1VQN T;  3CCM Q;  2JN0 A;  4F7U A;  1CKB A;  3JCM V;  3CC2 T;  3EGX A;  1TUD A;  5EC7 A;  4LDY A;  1D1A A;  2DXU A;  3PGG A;  2M9U A;  5HKC A;  2HCK A;  2C06 A;  2GFU A;  1NLO C;  5EG2 A;  1BBZ A;  2RHU A;  3F70 A;  4R0K A;  1K1Z A;  3E19 A;  2JTF A;  1MNE A;  4TVR A;  3OYL A;  2E5Q A;  1WLP B;  3JCM f;  3I5S A;  4HCZ A;  2EW3 A;  3EFR A;  1YJN Q;  1M2V B;  3WVE B;  3CCR A;  2EQM A;  3DKM A;  3M4G A;  2CZ7 B;  1VQ4 A;  5AT1 B;  3CCQ A;  1I07 A;  4XTY A;  1VQO T;  5J39 A;  3CXC P;  1K9M C;  1EFN A;  3S3N A;  3BDL A;  4J7I A;  3X25 B;  2RJC A;  3NTI A;  2V26 A;  2V1Q A;  3NHN A;  4N0A A;  3CQT A;  4OGC A;  4AMC A;  1NZ9 A;  2KGT A;  2ZGW A;  4DOW A;  3CMA A;  3VU3 C;  4C8Q E;  2M51 A;  1RAD B;  4M7A G;  1PD0 A;  3M0P A;  3CC7 A;  2NYS A;  2O9V A;  3EGD A;  5GAN h;  1G83 A;  1W6X A;  3JAM E;  4D6W A;  5LJ5 e;  2DM1 A;  5GAO q;  2MI6 A;  5LJ3 f;  2X4J A;  4QW2 A;  2CH4 A;  4FL6 A;  5CKH A;  4C0G A;  1R77 A;  1N8R R;  3VS7 A;  2HBW A;  4A4E A;  2Y90 A;  4ZGJ B;  4OMO A;  2QQB A;  1AT1 B;  1C1A A;  5FU7 C;  1Y0M A;  3H8Z A;  1PCX A;  2LCL A;  1LCK A;  1ABO A;  1MHN A;  1YJW Q;  4BDZ A;  1Q81 C;  1YI2 A;  4JRP A;  3OSS C;  1B34 B;  2FRW A;  1WJR A;  1QVG P;  3ASK A;  3G1J A;  2QG9 B;  3EHQ A;  4M77 A;  3MEV A;  3I56 T;  3CD6 A;  3CCL T;  3CCU Q;  3E9F A;  1JU5 C;  5FRO A;  5IXF A;  4OGE A;  4C5I A;  3CCS Q;  2ZPF B;  1WA7 A;  3CCR T;  4M7D A;  1RAH B;  2G3R A;  5D7U A;  1YIT A;  2HBP A;  1C6V X;  2CRE A;  4IIM A;  4L59 A;  3QHS A;  3QYG B;  1NPP A;  4F17 A;  4AFU C;  2DTH A;  2F2W A;  2PVG B;  4PFO A;  4RTV A;  3PMT A;  1JBM A;  2JTM A;  3RNJ A;  4A4F A;  4M75 E;  4JJD A;  2MCN A;  4R56 A;  2KYM A;  3SWN A;  5IHI A;  1BI3 A;  4IUU A;  1XTD A;  1TXQ A;  3C94 A;  5KYU A;  2RQT A;  4UC4 A;  2QYZ A;  4MZM A;  4MMK A;  2E4H A;  1WDX A;  5GAN 2;  4BUG A;  3AHU A;  1T0H A;  3M0T A;  4LD6 A;  1KQS S;  4IKF A;  2JTE A;  1Q7Y U;  4JZ4 A;  1H92 A;  1IZ6 A;  5KYX A;  3TU4 K;  2X3W D;  1ARK A;  5CIU A;  3CME Q;  3NTH A;  1RAI B;  2AKK A;  1SSF A;  4M78 C;  1Q81 U;  2DER A;  3CCU T;  4ANJ A;  4M7D F;  2DMO A;  2KRS A;  1UGQ B;  2A37 A;  2F5T X;  1Y57 A;  1HXD A;  5GAO n;  2E10 A;  1RAB B;  1E6G A;  1FWZ A;  3HFO A;  4LDW A;  4CC2 A;  1QCN A;  1CSK A;  4XU3 A;  1B3Q A;  1SEM A;  4E2F B;  1YI2 T;  4LXC A;  1OX8 A;  1GL5 A;  4LUE A;  2RI2 A;  5LJ5 j;  2J6K A;  3OYM A;  4VUB A;  1TOV A;  1OPK A;  1YJN A;  4IUQ A;  4BI3 A;  2A08 A;  2E65 A;  4PJO B;  1ZBJ A;  3MP6 A;  1P92 A;  2COZ A;  3WXM B;  4M75 B;  5FW9 A;  1KQS A;  1LPL A;  2FEI A;  2D6F A;  1M1G A;  3V8L A;  4L5G A;  4J6X A;  3QUI A;  2CKK A;  4X34 A;  3FLG A;  4F7U E;  1N27 A;  2X9H A;  4M77 C;  2D1X A;  2X4X A;  1EZZ B;  1ZUU A;  2DIG A;  4C0F A;  2DLP A;  1BI0 A;  1PRL C;  3S3M A;  1X2K A;  4KGZ B;  1D3B A;  2F1L A;  2L0A A;  3M9Q A;  3LWI A;  1QW1 A;  3M53 A;  3CC7 Q;  2GFA A;  2HEQ A;  1AEY A;  4FSX A;  2XDB A;  2OTJ Q;  3LGL A;  5D6W A;  3C0C A;  2R5M A;  2DRK A;  2BUD A;  3RKW A;  2X4Y A;  4GLM A;  4N0A C;  1KIK A;  1OX9 A;  4DBR A;  5GMK e;  2DEQ A;  3VS2 A;  2QQ9 A;  2JMA A;  3U23 A;  2V8K A;  2E1H A;  3TCJ A;  5A0G A;  5HK0 A;  4J9D A;  1JJ2 P;  1H3H A;  1FYN A;  1R8O B;  3MP8 A;  2BZX A;  4J6W A;  1WJS A;  3UWN A;  4EPC A;  3OW2 A;  1D1C A;  4EDU A;  4Y28 E;  4XTZ A;  1QQJ A;  1YI2 Q;  3CCE A;  1BK2 A;  1VQ9 Q;  4E7S A;  1JJ2 S;  3M0R A;  4E7Z A;  1YIJ A;  2IIM A;  3URG A;  5GMK l;  1X6B A;  1WPY A;  1QVF A;  5GAN g;  2JMC A;  4ATO A;  2K5I A;  4PJO G;  3CPF A;  1D0Z A;  2CUD A;  1AOJ A;  5I21 A;  1X75 C;  1VQ6 T;  2RO0 A;  2EVR A;  1Y96 A;  4FT2 A;  1VQP A;  4AFZ C;  2LQK A;  2VGN A;  3UDC A;  1N9R A;  3SFM A;  2RN8 A;  2D0Q B;  3I35 A;  1XNI A;  2E70 A;  5ECA A;  3G71 A;  4M4Z A;  5C0M A;  2AHJ B;  4NS5 A;  3OA6 A;  2LTO A;  3RES A;  1UJY A;  1I5O B;  2VB6 A;  4ZTJ A;  2B86 A;  3EG3 A;  3OW2 P;  2D8H A;  1MV3 A;  2FHD A;  1ZSZ B;  1M30 A;  3GF5 A;  3PVL A;  2RMO A;  3JCM e;  2DF6 A;  2L3S A;  4PJO F;  1JJ2 A;  2ZPG B;  3EG1 A;  4EMH A;  3UA6 A;  4LUD A;  4Y91 A;  1K4U S;  2J06 A;  3VS3 A;  2GF7 A;  1QVF S;  3PMI A;  5GMK i;  4Z8A A;  1F1B B;  1SG5 A;  3I9Q A;  1VQ7 A;  2AIR B;  4PJO C;  2K3X A;  2RQR A;  3ZBD A;  2QI2 A;  3AT1 B;  1ZUK A;  1QCO A;  4RTT A;  3DLM A;  4YTL A;  4A4G A;  3CME A;  2EJF A;  2KSS A;  5FRM A;  3L42 A;  3QYH B;  2BKD N;  2QAS A;  2CT4 A;  4D8D A;  1RAE B;  4DBF A;  3X24 B;  3OYB A;  1OV3 A;  2VVK A;  5KE2 A;  2EYW A;  1QP2 A;  5LJ3 h;  1SHG A;  2V8I A;  4J9G A;  1DJ7 B;  1AZG B;  2JXB A;  1H8K A;  1E7O A;  1ZBX A;  2P0Q A;  3CMA Q;  4BDY A;  5GAN f;  3CCE T;  2DPP B;  5I22 A;  3ER0 A;  3J80 E;  4JPB W;  2FZK B;  2DL8 A;  4J6Y A;  1KQS P;  5DLO A;  1X43 A;  1Y7X A;  4X1V A;  1GCP A;  1U8R A;  1I1J A;  3NMZ C;  4EMG A;  1NYG A;  4OVA A;  5LJ5 g;  2AZS A;  3VKI A;  4RCC A;  3M54 A;  3UAT A;  4C92 E;  2JT4 A;  2WSC E;  2E5K A;  1HK9 A;  4II1 A;  1PKS A;  1A0N B;  5HCK A;  1NJI R;  4FT4 A;  3GOX A;  3E2U A;  1S1N A;  5FLX E;  1GCQ C;  4A53 A;  5GAM d;  5J3B A;  2KE9 A;  3CCJ T;  4M78 B;  4DA4 A;  3JCM h;  1IHW A;  4M77 G;  3D7S B;  4GLK A;  3RKY A;  1OOT A;  2HKN A;  2KBT A;  4WCI A;  3MHX A;  3I55 Q;  3JCM b;  1AZE A;  3OYJ A;  3T9N A;  1C0M A;  4M7A D;  4EMK B;  4KBM B;  1UGV A;  1WXU A;  1X01 A;  1IGU A;  3FDR A;  3CC7 T;  2DIL A;  1K8A C;  2LT1 A;  2PU9 B;  1QVG S;  1K9M R;  3VJP A;  3LH5 A;  2XD0 A;  2I0N A;  3EAE A;  3VS1 A;  4ESR A;  2QAZ A;  1YJN T;  3CC4 T;  1MMN A;  1MMD A;  4J9H A;  1HSQ A;  2DD4 A;  1YBY A;  2RJD A;  1TUG B;  2VXF A;  4ELZ C;  1QWE A;  1D0X A;  1VYT A;  2A7Y A;  5GAM h;  1GBQ A;  5LJ3 j;  1Z9Q A;  2YRC A;  1CKA A;  3JRZ A;  4GBQ A;  2OTJ T;  3CBM A;  4M77 B;  1PG5 B;  3VV0 A;  1YWP A;  1NJI U;  2VWF A;  2M0O A;  2CP7 A;  4JRQ A;  1LJO A;  2ZPI B;  2Z0W A;  1UUE A;  1YHQ T;  3A8G B;  2GTJ A;  2PUO B;  2P0P A;  4HVW A;  4HVU A;  1WQW A;  1K9M U;  5L8R E;  2DK3 A;  2DTO A;  4J9B A;  2RHZ A;  3H6Z A;  1BCM A;  3OS1 A;  3KXT A;  4XQ3 A;  1TS9 A;  2J6O A;  4F14 A;  3A5Z B;  2DXB A;  4F7U B;  2EWN A;  2NUT A;  4A4K A;  2DKG A;  1VQ8 T;  4Q5W A;  4XU0 A;  4F7U G;  4OB0 B;  1VYV A;  3G71 T;  2NLU A;  2EYQ A;  1M5Q 1;  1X69 A;  2XMF A;  2NUP A;  5FRN A;  1UB4 A;  2EQU A;  2ENM A;  2EGE A;  1KQ2 A;  2L3R A;  3DB3 A;  4KGV B;  5KYY B;  1PM3 A;  2OAW A;  4MZT A;  4KUL A;  2EJ9 A;  2EGC A;  1PD1 A;  4PJL A;  3MEW A;  1NJI C;  4MDX A;  4JZ3 A;  5DLQ E;  3M56 A;  1M2V A;  2E6N A;  5LJ5 f;  3QSU A;  4C92 B;  2CP3 A;  1SRL A;  1D0Y A;  4F16 A;  5GAM g;  4E7J A;  2RI3 A;  2L8D A;  2LZ6 B;  4OB1 B;  2OTL Q;  5CR2 A;  1N8R U;  2DAQ A;  5GAN 3;  1YFN A;  2RNA A;  1VQO Q;  3LH0 A;  2FPD A;  2KMT A;  3L2W A;  2WSE E;  2YLC A;  2DBK A;  2KI7 A;  2B8A A;  3EFO B;  2A28 A;  4PK4 A;  3TEE A;  3HTR A;  2KDS A;  4M78 D;  4M77 F;  1SHF A;  4JJN K;  4XAX B;  1ZSZ C;  3C95 A;  4KGX B;  4L6V 5;  4LDV A;  3CME T;  1K8A R;  2E41 A;  2K6D A;  1RLP C;  2OTJ A;  2ZPH B;  3OYY A;  2DA9 A;  5A0L A;  3DLL A;  1WIE A;  1M8V A;  3PFS A;  2EQI A;  1TWB A;  1KD1 C;  1IRX A;  1YHQ A;  1K73 C;  2JVV A;  4AG1 C;  1MMG A;  4JLG A;  3CBP A;  2DJZ A;  1N9S A;  1TG0 A;  4MML A;  4M78 G;  1QMC A;  3FEO A;  1NBE B;  3LW5 E;  4HCK A;  2CP5 A;  2GTO A;  2KNB B;  2M1H A;  4X9C A;  3RKX A;  1WHK A;  1VQ4 Q;  1BI1 A;  1MND A;  2EAY A;  4A4H A;  4J8O A;  3FB9 A;  2QEX T;  3CCE Q;  3G4S A;  3JB9 F;  3EG9 B;  3OS5 A;  1UHC A;  3I55 A;  1VQ9 A;  2CP0 A;  3VS5 A;  2EQK A;  5KH6 A;  1NE8 A;  3C12 A;  4JRK A;  4M7A F;  1Z9Z A;  4C5G A;  5GAN d;  1IO6 A;  2DE0 X;  1VQ5 T;  4EIK A;  1QKX A;  8AT1 B;  2JNG A;  2P4T A;  2YXY A;  1BYM A;  9ATC B;  2KYB A;  4RTY A;  2K5F A;  4IUV A;  2CDT A;  1AD5 A;  3THK A;  1QVP A;  2DX1 A;  2DFU A;  2YUP A;  3SHW A;  1WHM A;  1OUL A;  1VQL Q;  3V7R A;  1UFF A;  1J3T A;  3JCM d;  4MDW A;  3MEU A;  2O4X A;  1WHH A;  2QA4 Q;  1Q86 R;  4HVV A;  1NYF A;  1LOJ A;  3JCM g;  2MF2 A;  2LCC A;  2R57 A;  4CI0 C;  1ZUY A;  2PVD B;  2L89 A;  1X2Q A;  1V76 A;  2V1R A;  1T3S A;  1MGQ A;  1YP5 A;  2FVU A;  2ROT A;  3R6N A;  3FC3 A;  3L2Z A;  4QKU A;  2Y4Y A;  2K3B A;  3EFS A;  1Q86 C;  1Q82 U;  2LCS A;  4C92 D;  3MPU B;  5LJ5 h;  1U5S A;  2CZ0 B;  2JM8 A;  2QQS A;  4M75 F;  3QJ6 A;  4PL6 A;  4LNP A;  2RJE A;  1TUC A;  3X20 B;  3H41 A;  3ME9 A;  1AWX A;  2KT1 A;  2NWM A;  1HD3 A;  4M78 E;  4C8Q B;  1KFZ A;  4BE1 A;  2K2M A;  3JCM P;  1NM7 A;  1OEB A;  1WYX A;  1GXI E;  4PLI A;  2C0T A;  4JUV A;  1JXM A;  3OW2 S;  4M7A B;  2CS7 A;  3G6E Q;  1RLQ C;  3OS2 A;  3UA7 A;  4Z88 A;  1VIE A;  2HQH A;  5L23 A;  2J6F A;  2DL3 A;  4CC4 B;  5FWC A;  1U3O A;  2LX7 A;  5HK3 A;  1KC8 R;  3HP9 A;  3EGD B;  2K5L A;  4BE0 A;  2LQ8 A;  4DOV A;  2ED0 A;  2CP2 A;  2NUP B;  5D6X A;  3TSZ A;  4E7L A;  2DL5 A;  2ATC B;  1VQP T;  2RD1 A;  3TRE A;  4RKU E;  4M77 D;  4BE2 A;  1ZSG A;  2GCX A;  4FM4 B;  2LQN A;  3G7Z A;  1U06 A;  2AZV A;  4O5V A;  1G2B A;  1X6O A;  1TTH B;  5M9O A;  5GAM f;  4B9W A;  2HNI A;  2RHY A;  1ZA1 B;  3QO3 A;  3OYG A;  2F5K A;  2YLB A;  3VYG A;  5GAO m;  2RI5 A;  4ZTF A;  3JB9 J;  3CCV T;  1YJ9 Q;  3M5A A;  1VQM Q;  4FYY B;  5A2Q E;  2DEU A;  2JM9 A;  1B34 A;  1W2B P;  1MMA A;  2BTT A;  4XK8 E;  2H3J A;  3X26 B;  1BIB A;  1UEC A;  1I0C A;  1SSH A;  4B6M A;  1RUW A;  5CKB A;  1M9S A;  4FCY A;  3O5Z A;  2DL4 A;  3CCL Q;  1OU8 A;  2KVQ G;  2MAM A;  4DBQ A;  1NEG A;  1GBR A;  4RMO A;  1S72 Q;  3CEY A;  3VRY A;  1GRI A;  2XG8 D;  4JS4 A;  4EMK A;  1OZ2 A;  3CCS T;  2FO0 A;  4PJO A;  3SWN B;  2COW A;  1XOV A;  4OB3 B;  4D8K A;  2JJ9 A;  2IVW A;  2JZ2 A;  4EMK C;  4HXJ A;  1Y96 B;  3JB9 D;  5CQX A;  3QXE B;  3OMG A;  2BZ8 A;  2XI9 A;  4C8Q F;  5KYX B;  2KXC A;  3CPW P;  4E7H A;  3OYK A;  2DZ9 A;  4CC3 A;  1U1S A;  2KR3 A;  3MJX A;  3H0H A;  3V7C A;  1M8M A;  7AT1 B;  2JUF A;  1T0J A;  3ZL7 C;  1VOM A;  2M16 A;  3JB9 I;  1SKU B;  4M7D G;  4CRI A;  3NFC A;  3S6W A;  1YIT Q;  1VQN A;  1I8F A;  2L3Q A;  4B9X A;  2GQI A;  4HKE A;  2BE9 B;  1KD1 R;  2J7I A;  5KYN A;  4ELY C;  4FYW B;  4DEY A;  2P0K A;  2RQV A;  2QEX A;  2RB6 A;  2VV5 A;  3SEM A;  3CCM T;  3NTK A;  2LP5 A;  4F7U F;  2SEM A;  5GJV B;  1RAF B;  2W10 A;  5GAM e;  1UGP B;  3CC2 Q;  1WQ7 A;  3IQL A;  2MYS A;  2RH2 A;  5GAN 6;  1VQP Q;  2YRV A;  2LX9 A;  1WHJ A;  3C4S A;  1QVG A;  3CCJ A;  5GJW B;  5KYY A;  3NPF A;  2O9S A;  3CCQ T;  1VQ6 Q;  2FYK A;  1D3B B;  4M7D C;  5FWB A;  3QII A;  4Z89 A;  3EG2 A;  2I2L A;  1D09 B;  3OYC A;  1MUZ A;  5CQY A;  3OS0 A;  4PJM A;  1O75 A;  2HSE B;  4QT7 A;  4ZGD B;  2BE7 D;  5LJ3 g;  1LNX A;  2W0Z A;  2HQX A;  1U1T A;  2HD0 A;  2FZG B;  3M58 A;  2EPD A;  3MKD A;  4CC7 A;  4HT9 A;  2ESW A;  3PT9 A;  5C6S A;  4QVD A;  2OI3 A;  4OF1 A;  4OMF B;  2L3P A;  4OP0 A;  3QZ9 B;  4M7A E;  3A1P A;  4OMP A;  3M0S A;  5DM7 R;  2C0O A;  1VQK Q;  4A63 B;  1OPL A;  1SPK A;  1K73 U;  2LT4 A;  4M75 G;  3VS0 A;  3ZFJ A;  1W4S A;  1D1B A;  2LVM A;  2RF0 A;  3RMQ A;  2FZC B;  4OML A;  4M7D B;  4PJN A;  1VQL T;  4JRI A;  1S72 T;  3FRN A;  2JS2 A;  3NGP A;  4C5E A;  1TH7 A;  4MZP A;  4KH0 B;  3GPL A;  5HY6 A;  1YJ9 A;  4A54 A;  1VQM A;  1QCF A;  4C8Q C;  3CBO A;  3RUX A;  2L2P A;  5GAM j;  3OY9 A;  3JCM J;  3MEA A;  2GBQ A;  3QWY A;  4JLI A;  2SRC A;  4M7A C;  3CCU A;  4BY6 C;  3RDV A;  2NUT B;  3KFV A;  2ZZD A;  3CCS A;  4HCC A;  4XTX A;  3GLX A;  3MO8 A;  2BIV A;  5I11 A;  1JO8 A;  4O6J A;  2MOX A;  2CYZ B;  1WXB A;  3L2U A;  2O2O A;  4J9E A;  1RAG B;  4ZN3 A;  2ABL A;  2K2V A;  3L2Q A;  1S72 A;  5FU7 B;  1M90 C;  2EQJ A;  2CSI A;  1G3S A;  2FB7 A;  4C5H A;  5FU6 C;  2KEA A;  1VQK T;  4NL2 A;  2RQU A;  1YNZ A;  4C0Z A;  4PLL A;  3HPW A;  3L2V A;  2DXT A;  2VC8 A;  4RTZ A;  4OB2 B;  2QTV A;  5GAN 5;  5DY9 A;  3M55 A;  1PHT A;  1ZSZ A;  5GMK j;  4HCB A;  4LE9 A;  2QDY B;  2CSQ A;  3V7S A;  2ZPB B;  1K73 R;  4NOY A;  4AFQ C;  2ROL A;  3X28 B;  5CK9 A;  2A36 A;  3M0Q A;  3SD4 A;  2A0F B;  1R0C B;  5KYW B;  1OQK A;  1YIJ Q;  2HAX A;  4XTW A;  4M78 F;  3EFO A;  3CCR Q;  1QLY A;  1E6H A;  2EYX A;  1UGS B;  3RR6 A;  2XID A;  2O4X B;  1UHF A;  2LJ3 A;  1KHI A;  2D9T A;  4C8Q G;  1IRE B;  5D6Y A;  3CXC A;  5IT9 E;  1VQN Q;  2LJ1 A;  2JS0 A;  2X4W A;  4HA8 A;  3G71 Q;  1VYU A;  3MET A;  1AWJ A;  1KSW A;  4FIB A;  3OYE A;  3CC4 Q;  3SB2 A;  1HYO A;  3PE0 A;  3HHT B;  1K8A U;  5CCA A;  2YSQ A;  3VS4 A;  2HKQ B;  4M75 C;  3OQ5 A;  1VQ7 T;  2X51 A;  4F04 B;  4JDS A;  2QA4 T;  2L5Q A;  5KE3 A;  1YN8 A;  2LNV A;  2YHT A;  4IUP A;  2P84 A;  5IXB A;  2FRY A;  1TSF A;  2DVE A;  4C8Q A;  2OJ2 A;  1FMW A;  4FYX B;  3JV3 A;  4FW1 A;  1G3W A;  2CP6 A; 
#chains in the Genus database with same CATH homology
 3LYI A;  4C92 C;  1O9S A;  3FC3 A;  3L2Z A;  3OYA A;  1JJ2 S;  3OB9 A;  2Y4Y A;  5CKD A;  1BKB A;  2LRQ A;  3EFS A;  3JSC A;  3CXC S;  1VQ6 A;  4M7A A;  1Q86 C;  1YIJ A;  1Q82 U;  4C92 D;  4BI4 A;  4R55 A;  3URG A;  5GMK l;  5CO7 A;  5GAO l;  1YIJ T;  3A8O B;  1YCY A;  3QZ5 B;  2DXC A;  3CCV A;  5LJ5 h;  2CZ0 B;  1WPY A;  2QQS A;  2WAC A;  2K3Y A;  4M75 F;  2R5A A;  2K5I A;  3QJ6 A;  4PL6 A;  4QQG A;  2RJE A;  3CPF A;  4PJO G;  4BI8 B;  5I2S A;  3X20 B;  3OYI A;  4N4G A;  2PVO B;  3ME9 A;  4N4I A;  2EIF A;  1YJW A;  5I21 A;  2K57 A;  4PKC C;  2DIQ A;  1N6A A;  3J81 E;  1X75 C;  1VQ6 T;  2RO0 A;  4QQ6 A;  1Y96 A;  3QG1 A;  4FT2 A;  4M78 E;  4C8Q B;  1VQP A;  4LD9 K;  2LQK A;  2VGN A;  4RG8 A;  2ZPE B;  3UDC A;  1N9R A;  4C8Q D;  3SFM A;  5GMK m;  4BE1 A;  2D0Q B;  1XNI A;  2WSF E;  5GMK h;  2E70 A;  4JS5 A;  1M1F A;  4C0D B;  3G71 A;  5C0M A;  2AHJ B;  4PLI A;  3JCM P;  1GXI E;  4NS5 A;  1WGS A;  4JUV A;  3OA6 A;  2O01 E;  2LTO A;  3FJP A;  3RES A;  3OW2 S;  2RA2 A;  4M7A B;  2CS7 A;  3P8D A;  5IN1 A;  3OS2 A;  4ZTJ A;  4BB7 A;  5AYF A;  1VQK A;  4C92 A;  2EJG A;  1VIE A;  3G6E T;  2FHD A;  3L1A A;  3GF5 A;  3OBY A;  2QA4 A;  1Y71 A;  3CCL A;  3R6O A;  4IUR A;  4LDU A;  3JCM e;  3HRT A;  5KCH A;  4PJO F;  3A8M B;  4QQD A;  1JJ2 A;  2ZPG B;  1QVF A;  4EMH A;  1OI1 A;  5A0D A;  5HK3 A;  5J26 A;  1OZ3 A;  2KQW A;  3HP9 A;  4Y91 A;  3JCM W;  2K5L A;  4BE0 A;  2CZ6 B;  2GF7 A;  2V8J A;  2LQ8 A;  4M77 E;  4DOV A;  3HSB A;  3HRS A;  4XU2 A;  1QVF S;  3N5B B;  1KQ1 A;  3PMI A;  3BY7 A;  5D6X A;  5GMK i;  4E7L A;  1VQO A;  1N8R C;  1EIF A;  5FU6 B;  2DO3 A;  1VQP T;  2RD1 A;  1VQ5 A;  2DZC A;  1JRI A;  3M4Y A;  1VQ7 A;  4PJO C;  3MCA B;  2K3X A;  3RMS A;  3LLR A;  3TRE A;  2RJF A;  3ZBD A;  4RKU E;  2QI2 A;  4M77 D;  5GAN j;  4BE2 A;  1G3T A;  2GCX A;  4FM4 B;  1VUB A;  3OYN A;  3LX7 A;  3DLM A;  3G7Z A;  4YTL A;  4A4G A;  4O5V A;  3CME A;  1YJ9 T;  5GAN e;  4C0D C;  3VUB A;  1X6O A;  2EJF A;  2HQE A;  3GNF B;  1UEB A;  2KSS A;  1KC8 C;  2DD5 A;  5FRM A;  3L42 A;  3QYH B;  2BKD N;  4ZN1 A;  5M9O A;  3VUZ A;  5GAM f;  4B9W A;  4XU1 A;  3X24 B;  3OYB A;  2XDD A;  3VYH B;  2HNI A;  2RHY A;  3JCM X;  3QO3 A;  5KE2 A;  2F5K A;  3OYG A;  2YLB A;  1QP2 A;  1WNL A;  5LJ3 h;  3VYG A;  5GAO m;  2RI5 A;  2V8I A;  4ZTF A;  5LL6 S;  2CZ1 B;  1Q7Y C;  3RER A;  3JB9 J;  3CCV T;  4WF2 A;  3M5A A;  1DJ7 B;  3SWN C;  1Q86 U;  5A2Q E;  3GIB A;  1ZBX A;  2P0Q A;  1B34 A;  3I55 T;  2XHC A;  3LWH A;  2XDP A;  2JN0 A;  4BDY A;  5GAN f;  3CCE T;  4KUD K;  2DPP B;  5GAN 4;  4XK8 E;  2H3J A;  3ER0 A;  3X26 B;  3J80 E;  1BIB A;  3BDU A;  4J6Y A;  4F7U A;  4M78 A;  5KCO A;  5CKB A;  4XTU A;  3JCM V;  5DLO A;  5LJ5 d;  3CC2 T;  1Y7X A;  1M9S A;  1U8R A;  2PUK B;  4LDY A;  4J7F A;  4EMG A;  2DXU A;  3PGG A;  2KVQ G;  2M9U A;  2MAM A;  4OVA A;  5HKC A;  5LJ5 g;  2E64 A;  2RK1 A;  2C06 A;  2GFU A;  4KT0 E;  3VKI A;  4RCC A;  3M54 A;  5EG2 A;  4C92 E;  2GQV A;  2RHU A;  2WSC E;  3F70 A;  2XK0 A;  2QQA A;  5I2M A;  1WJQ A;  1VQ4 T;  1HK9 A;  5CKF A;  3QBY A;  4II1 A;  1I4K 1;  3E19 A;  2JTF A;  2X35 A;  4RMO A;  2EFI A;  4TVR A;  3OYL A;  3CEY A;  2E5Q A;  1H64 1;  4FT4 A;  3JCM f;  3GOX A;  4NL3 A;  4HCZ A;  5FLX E;  4A53 A;  5CAI A;  3EFR A;  2XG8 D;  5GAM d;  4JS4 A;  4EMK A;  5J3B A;  3WVE B;  5CKE A;  3CCR A;  1OZ2 A;  2EQM A;  3DKM A;  3M4G A;  3CCS T;  3CCJ T;  4M78 B;  4BY6 B;  3OYH A;  2CZ7 B;  1M1K U;  4M7D D;  1VQ4 A;  4PJO A;  3SWN B;  3CCQ A;  1VQM T;  4DA4 A;  4BD3 A;  1VQ9 T;  1XOV A;  4XTY A;  4OB3 B;  3JCM h;  4M77 G;  5J39 A;  1VQO T;  2LC4 A;  4GLK A;  2IVW A;  3RKY A;  2A3L A;  2JZ2 A;  1RL2 A;  4EMK C;  4E7I A;  1K9M C;  1Y96 B;  3MHX A;  3BDL A;  4BAC A;  3S3N A;  4J7I A;  1ZQ1 A;  3X25 B;  5CQX A;  2RJC A;  3JB9 D;  3QXE B;  3NTI A;  3JCM b;  4KUI A;  1FXX A;  2FL7 A;  1V29 B;  4N0A A;  3OMG A;  3OYJ A;  2XI9 A;  4OGC A;  3T9N A;  4C8Q F;  1NZ9 A;  4E7H A;  3OYK A;  2DZ9 A;  1U1S A;  2ZGW A;  4DOW A;  4M7A D;  3CMA A;  4EMK B;  3V7C A;  3CC4 A;  2PQW A;  1KC8 U;  4N4H A;  2JUF A;  3VU3 C;  4KBM B;  4C8Q E;  4M7A G;  3PIP A;  4V2S A;  3CC7 A;  1UGR B;  1X01 A;  2F69 A;  3FDR A;  3CC7 T;  2M16 A;  3JB9 I;  1K8A C;  4M7D G;  2LT1 A;  2PU9 B;  4CRI A;  1QVG S;  5GAN h;  5LJ3 e;  4J83 A;  3VJP A;  3NFC A;  2XD0 A;  3EAE A;  3JAM E;  3S6W A;  4D6W A;  5LJ5 e;  5GAO q;  1VQN A;  3JB9 G;  1YJN T;  1I8F A;  2MI6 A;  3CC4 T;  3GPL A;  1YIT T;  4B9X A;  5LJ3 f;  2X4J A;  4QW2 A;  2DD4 A;  2CGH A;  1YBY A;  2RJD A;  1RI0 A;  4FL6 A;  2VXF A;  4HKE A;  5CKH A;  4C0G A;  4ELY C;  1I81 A;  4ELZ C;  5GAO p;  2A7Y A;  5GAM h;  5LJ3 j;  4A4E A;  3GP8 A;  2P0K A;  2Y90 A;  4ZGJ B;  2QEX A;  2RB6 A;  2QQB A;  2VV5 A;  3JRZ A;  2OTJ T;  3CCM T;  3CBM A;  1I5L A;  3E9G A;  2XU8 A;  4M77 B;  5FU7 C;  3NTK A;  4F7U F;  5CVI A;  3VV0 A;  1NJI U;  3H8Z A;  2M0O A;  5GAM e;  3S3O A;  1UGP B;  2LCL A;  1WQ7 A;  3I56 A;  3CD6 T;  1OYX A;  2OTL A;  4JRQ A;  3QPH A;  1MHN A;  1LJO A;  2ZPI B;  4BDZ A;  2JOY A;  3V8J A;  1YI2 A;  3OYF A;  1Q81 C;  2RH2 A;  4JRP A;  2VUB A;  5GAN 6;  1YHQ T;  2MWO A;  3OSS C;  5IAY A;  3A8G B;  2PUO B;  1B34 B;  2P0P A;  2LX9 A;  2YRV A;  1WJR A;  1WQW A;  3C4S A;  3LGF A;  1QVG A;  1K9M U;  3ASK A;  3CCJ A;  2MWP A;  5L8R E;  2DK3 A;  2DTO A;  3CCQ T;  2RHZ A;  3H6Z A;  4PNO A;  3OS1 A;  3KXT A;  2FYK A;  4XQ3 A;  1D3B B;  4M7D C;  1KD1 U;  1YJW T;  4M77 A;  3A5Z B;  3MEV A;  3QII A;  2DXB A;  3I56 T;  2I2L A;  2XKO C;  2EWN A;  3HKS A;  4F7U B;  3CD6 A;  3CCL T;  4RCB A;  4QVC A;  1XQH A;  3HFN A;  4A4K A;  3E9F A;  2DKG A;  2DTI A;  1VQ8 T;  4Q5W A;  3OYC A;  2QXF A;  4XU0 A;  5CQY A;  4F7U G;  4OB0 B;  1O75 A;  5FRO A;  3OS0 A;  4ZGD B;  4OGE A;  4C5I A;  5LJ3 g;  2ZPF B;  3G71 T;  3CCR T;  2NLU A;  4M7D A;  1LNX A;  3QDR B;  2HQX A;  1U1T A;  2G3R A;  2EYQ A;  2HD0 A;  3M58 A;  1G5V A;  3UPU A;  4QVZ A;  1M5Q 1;  4HT9 A;  1Q82 C;  1YIT A;  1UB4 A;  5FRN A;  2EQU A;  4HT8 A;  2HBP A;  5GAN 7;  3PT9 A;  5C6S A;  1KQ2 A;  2L3R A;  4QVD A;  2E6Z A;  2QTX A;  3E1S A;  4ME7 A;  4OF1 A;  4E47 A;  4L59 A;  3DB3 A;  4OMF B;  4OP0 A;  3PNW C;  4J5Y A;  4MZT A;  4KUL A;  1VQN T;  3QHS A;  3QYG B;  3QZ9 B;  4M7A E;  1NPP A;  2EJ9 A;  3G4S T;  1NJI C;  4MDX A;  3MEW A;  2DTH A;  2PVG B;  1PSE A;  5DLQ E;  5DM7 R;  3MP1 A;  3CC2 A;  3M56 A;  2EKO A;  2E6N A;  5LJ5 f;  3QSU A;  1K73 U;  3M59 A;  4RG2 A;  1AHJ B;  2LT4 A;  3PMT A;  4M75 G;  3JCM c;  4C92 B;  4PJO D;  1JBM A;  1Y07 A;  4M75 A;  3ZFJ A;  2JTM A;  1W4S A;  4A4F A;  3DB4 A;  2LVM A;  5GAM g;  4E7J A;  3RMQ A;  1KG1 A;  4M75 E;  4R56 A;  4M75 D;  2RI3 A;  4M7D B;  1BI2 A;  2L8D A;  3SWN A;  4E7K A;  4OB1 B;  1BI3 A;  4IUU A;  1FX7 A;  5CR2 A;  1N8R U;  1VQL T;  4JRI A;  1XTD A;  3C94 A;  4UC4 A;  2DAQ A;  5GAN 3;  1S72 T;  3FRN A;  1KHC A;  3G6E A;  4MZM A;  2RHI A;  4MMK A;  3LH0 A;  4C5E A;  3A8H B;  1TH7 A;  1VIF A;  2KMT A;  4MZP A;  5HY6 A;  5GAN 2;  4BUG A;  2WSE E;  2YLC A;  4A54 A;  3L2W A;  1YJ9 A;  1VQM A;  3AHU A;  3OSV A;  2B8A A;  4C8Q C;  4LD6 A;  3CBO A;  1KQS S;  3RUX A;  4IKF A;  3TEE A;  1Q7Y U;  2KDS A;  4M78 D;  1IZ6 A;  2IG0 A;  4M77 F;  3TU4 K;  3QJY A;  3OBW A;  3HRU A;  5GAM j;  3OY9 A;  3JCM J;  5GAN 8;  4JJN K;  3MEA A;  3C95 A;  4XAX B;  5CIU A;  3JCM Q;  3NTH A;  1W2B S;  4JLI A;  1VQ8 A;  4M7A C;  4L6V 5;  3CCU A;  4LDV A;  1SSF A;  4M78 C;  4BY6 C;  3PTA A;  3BW1 A;  3L2R A;  3CME T;  3ZEH A;  3CCU T;  1Q81 U;  2E41 A;  4M7D F;  2OTJ A;  2ZPH B;  3OYY A;  1UGQ B;  2ZZD A;  3CCS A;  4HCC A;  5A0L A;  2F5T X;  4XTX A;  3GLX A;  3MO8 A;  3DLL A;  1HXD A;  5GAO n;  3UT1 A;  2BIV A;  2E10 A;  3SDZ A;  2KAF A;  2OTL T;  3JB9 H;  4LDW A;  1FWZ A;  3HFO A;  3INZ A;  3M57 A;  4O6J A;  3CPW S;  1M8V A;  3PFS A;  2CYZ B;  4X9D A;  2RK2 A;  1KD1 C;  4XU3 A;  3L2U A;  1YHQ A;  3J7A F;  1K73 C;  1VQL A;  1YI2 T;  4ZN3 A;  3CCM A;  2K2V A;  3L2Q A;  2JVV A;  1S72 A;  5FU7 B;  2RI2 A;  5LJ5 j;  4JLG A;  1M90 C;  3OYM A;  2EQJ A;  3CBP A;  3KBG A;  2DJZ A;  4VUB A;  1G3S A;  2FB7 A;  4Z02 A;  3Q1J A;  4C5H A;  1N9S A;  1YJN A;  4IUQ A;  3P8B B;  4MML A;  5FU6 C;  4M78 G;  4BI3 A;  1VQK T;  3FEO A;  4NL2 A;  2E65 A;  3LW5 E;  4PJO B;  3QKJ A;  4C0Z A;  2LDM A;  3MP6 A;  4PLL A;  1P92 A;  2M1H A;  3HPW A;  3L2V A;  3WXM B;  2DXT A;  2VC8 A;  4X9C A;  4OB2 B;  3RKX A;  1BI1 A;  5GAN 5;  4M75 B;  5DY9 A;  4C92 G;  2RM4 A;  3M55 A;  1KQS A;  2D6F A;  1M1G A;  2EAY A;  4A4H A;  1M1K C;  3V8L A;  5GMK j;  4J8O A;  4L5G A;  5LJ3 d;  4HCB A;  2QDY B;  2R58 A;  3FB9 A;  4J6X A;  3V8K A;  2QEX T;  3BFM A;  3QUI A;  3HL8 A;  3V7S A;  2ZPB B;  3G4S A;  2CKK A;  3JB9 F;  4PJO E;  4NOY A;  4X34 A;  3OS5 A;  3FLG A;  1W2B A;  3I55 A;  1VQ9 A;  4F7U E;  1N27 A;  3X28 B;  3KUF A;  5CK9 A;  1H3Z A;  4M77 C;  2X4X A;  2EQK A;  3SD4 A;  1G3Y A;  1NE8 A;  5KH6 A;  3C12 A;  2DIG A;  1ZHI A;  4JRK A;  2HAX A;  4XTW A;  4M7A F;  4C5G A;  4C92 F;  4M78 F;  4C0F A;  5GAN d;  1BI0 A;  1VQ5 T;  3CPW A;  3S3M A;  3WVD B;  1BIA A;  1D3B A;  5GAN g;  1UGS B;  3M9Q A;  4ATO A;  3LWI A;  2XID A;  1QW1 A;  2O4X B;  3M53 A;  2JNG A;  2P4T A;  2GFA A;  3RIR A;  4M7D E;  1KHI A;  2D9T A;  4C8Q G;  1BYM A;  1JB0 E;  2E12 A;  4FSX A;  3PIO A;  1IRE B;  5D6Y A;  2XDB A;  1PSF A;  4LDX A;  1QP3 A;  3LGL A;  2ZCF B;  4P5N A;  5D6W A;  2VGM A;  3CXC A;  5IT9 E;  4IUT A;  2R5M A;  2K5F A;  4IUV A;  2BUD A;  2X4Y A;  3RKW A;  3CMA T;  4N0A C;  4DQ2 A;  1QVP A;  2OAU A;  5GAO r;  2MMP A;  2X4W A;  4HA8 A;  3MET A;  4GY5 A;  5GMK e;  2DEQ A;  4FIB A;  4ZGE B;  3A8L B;  3OYE A;  2VYT A;  2QQ9 A;  2XIC A;  3SB2 A;  3V7R A;  3HHT B;  2V8K A;  5CCA A;  2E1H A;  1K8A U;  3JCM d;  3TCJ A;  5A0G A;  4MDW A;  5HK0 A;  1NPR A;  3MEU A;  2O4X A;  4M75 C;  2VXE A;  2KY9 A;  3OQ5 A;  1VQ7 T;  1R8O B;  3P8H A;  1M90 U;  3MP8 A;  3FIF A;  3O8V A;  4JDS A;  1LOJ A;  1M4Z A;  2L5Q A;  3JCM g;  4J6W A;  5KE3 A;  2QA4 T;  3OMC A;  1WJS A;  2MF2 A;  2LNV A;  3UWN A;  4EPC A;  4FU6 A;  2LCC A;  2R57 A;  4CI0 C;  4EDU A;  3OW2 A;  2KK4 A;  2K4Y A;  2YHT A;  4IUP A;  4XTZ A;  4Y28 E;  2PVD B;  3GNG A;  2L89 A;  4XTV A;  3OYD A;  2DVE A;  2Y4X A;  3CCE A;  4C8Q A;  2RHX A;  1MGQ A;  2QQR A;  2FVU A;  1G3W A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...