1I5LA

Crystal structure of an sm-like protein (af-sm1) from archaeoglobus fulgidus complexed with short poly-u rna
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
71
structure length
71
Chain Sequence
PRPLDVLNRSLKSPVIVRLKGGREFRGTLDGYDIHMNLVLLDAEEIQNGEVVRKVGSVVIRGDTVVFVSPA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 5'-R(*UP*UP*U)-3'
publication title RNA binding in an Sm core domain: X-ray structure and functional analysis of an archaeal Sm protein complex.
pubmed doi rcsb
source organism Archaeoglobus fulgidus
molecule tags Rna binding protein/rna
total genus 14
structure length 71
sequence length 71
chains with identical sequence B, C, D, E, F, G, H, I, J, K, L, M, N
ec nomenclature
pdb deposition date 2001-02-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01423 LSM LSM domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.100 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 1i5lA00
1HK9A 3JCMe 2RD1A 5CAIA 5GAMj 5GAOn 3RKXA 5GAMh 4C92B 4XTVA 5LJ5g 1BIBA 4PNOA 4XTYA 5GAOp 2Y90A 3BW1A 4Y91A 4J6WA 2JN0A 1N9SA 2DXTA 1X01A 4F7UA 5GAN3 4C92F 4EMKB 2E64A 4PJOF 5LJ3d 3JB9J 3JB9G 5GMKe 5GANh 3V7CA 5LJ3e 2EAYA 4M77F 5LJ5h 2DTIA 2YLBA 1U1TA 2QTXA 1WPYA 4HT9A 3JCMh 2VC8A 4M7DE 3JCMc 4XTZA 4PJOC 2DTHA 3QUIA 2EJFA 2E1HA 1B34A 4RCCA 3RUXA 2ZGWA 5GAOm 3QSUA 4M7AC 4M77C 2YLCA 4M75C 4C8QC 2VXFA 3V7SA 1JRIA 3FB9A 5GMKh 4HA8A 2E10A 5LJ3h 4M78F 5GAN8 3JB9D 3SWNA 2E65A 1WNLA 3JB9I 4RCBA 4HT8A 4F7UB 4M7DA 3JCMV 3JCMX 4X9DA 1I8FA 3INZA 4A54A 3PGGA 4EMHA 4X9CA 4A53A 4XTWA 5GAMf 2FB7A 1KQ2A 1M5Q1 4XU3A 3JCMb 3HSBA 5GANj 4M78C 3HFOA 4F7UF 4PJOE 3FIFA 3V7RA 1MGQA 5LJ5j 3SB2A 4M7AE 2DJZA 2DTOA 3L1AA 4N0AC 3JCMQ 4M77E 2RM4A 4M75E 4C8QE 4JRIA 3BDUA 4C92C 5GANf 1B34B 1YCYA 1U1SA 4V2SA 4QVCA 3BFMA 1I81A 4M7AG 1I4K1 4JUVA 1WQ7A 2RB6A 3JB9F 4M75G 1LJOA 2FYKA 4C8QG 3JCMf 4EMKC 3QO3A 4M7DG 5GAN6 4PJOA 1JBMA 5GMKj 3SWNB 5LJ3j 4M7AA 2HNIA 3EFSA 1LOJA 4M77A 4M75A 4C8QA 4M7DB 1LNXA 4M78E 3JCMP 5GAMe 4XU2A 2EJGA 3L2ZA 3RKWA 3VU3C 2K57A 1TH7A 5GAOr 3BY7A 5LJ3f 4PJOD 1D3BA 5DY9A 1Y96A 4M78G 4C92E 5GAMg 5GAN4 1WQWA 3V8KA 4M7AD 2I2LA 4M75D 4XTXA 4C8QD 4DQ2A 2DVEA 3JCMW 2VXEA 1KQ1A 4XU1A 5GMKi 4M7DD 5GMKl 1BIAA 4C92G 4M78A 4PJOG 3JCMJ 2DXUA 5GAN2 1I5LA 3JB9H 5LJ5f 3RESA 5GANg 5GAN5 4N0AA 4M77G 3QHSA 2RA2A 3RIRA 4PJOB 2EJ9A 4QVDA 4JLIA 4C92A 3HFNA 4JRKA 1N9RA 4M7AB 2E41A 2EWNA 4XTUA 3JCMg 5GAN7 4M77B 2DKGA 4M75B 4C8QB 5GAOq 1H641 4XQ3A 4M78D 4MMLA 3RKYA 5GAMd 4NOYA 4EMKA 4M7AF 4MMKA 2DZCA 5I21A 4M75F 3V8JA 4C8QF 1D3BB 2CGHA 1Y96B 4WF2A 4C92D 2DZ9A 3AHUA 4M7DF 3V8LA 4J5YA 4J6XA 4J6YA 4NL2A 4EMGA 2YHTA 5LJ3g 5GMKm 5GANd 3RERA 4OP0A 4XU0A 4F7UE 4M77D 1HXDA 5GANe 3FJPA 5LJ5d 5GAOl 3SWNC 4M78B 4NL3A 1M8VA 5LJ5e 2DEQA 3M4GA 4M7DC 3JCMd 3GIBA 3EFRA 4F7UG
chains in the Genus database with same CATH superfamily
4E7LA 3JCMe 3GNGA 2RQWA 4XTYA 3CXCA 1VUBA 1E7OA 2JN0A 1KC8U 4L5GA 4C92F 4ATOA 2DERA 2E64A 5LJ3d 2J6KA 2YUNA 2EAYA 2I0NA 3PIOA 3NGPA 4FYYB 4LDVA 3JCMh 2HSPA 1D1CA 5GAOm 1AOJA 2JM8A 4J9DA 3CBPA 2EQMA 2P0QA 5KYYA 5GAN8 2E65A 4YTLA 1YWPA 4RCBA 3DLMA 1MV3A 1ZUKA 2LJ3A 2RI5A 4XTWA 3CC7T 2FB7A 4XU3A 1VQMT 3ASKA 1XTDA 4BI4A 4BUGA 2CZ0B 3V7RA 1WX6A 1KK7A 1IHWA 2A08A 4M75E 1YIJQ 4JRIA 3BDUA 5HK0A 4LN2A 1SEMA 4QVCA 3VYGA 2Y4XA 2FYKA 4C8QG 4OB0B 4M7DG 1ZSGA 2EGEA 5GMKj 3QKJA 3PIPA 4JJBA 4C8QA 4OMNA 5GAOr 2AK5A 1QWEA 1OPLA 3SFMA 2ROTA 1G8XA 5AYFA 1SKUB 2LT4A 1QLYA 1PG5B 1HJDA 1YBYA 1KG1A 2DL3A 2YRDA 4KT0E 3S6WA 2EYWA 2VGNA 2KI7A 1VQOQ 2IIMA 4PJOB 4QVDA 2MYSA 3FC3A 2EYYA 3EH1A 1YJWT 4XQ3A 2LQ8A 4M78D 3PTAA 1PSFA 4NOYA 2CP7A 2LP5A 4C8QF 5FRNA 1TSFA 4M7DF 3CBMA 4F16A 1GFCA 1M4ZA 1PNJA 4J9FA 2C0OA 2RHUA 3OS5A 5CKFA 5GAOl 3R6OA 2DF6A 3ZBDA 1QVFA 5GAOp 4DA4A 3C12A 4ANJA 3UA6A 2O4XB 3S3MA 4PLIA 2V1RA 4OF1A 3CCEQ 1KQSS 1RI0A 5KCOA 2DL7A 2M0YA 2RK2A 2QEXQ 1M3BA 1CKBA 1UEBA 3DB3A 2XICA 3EHQA 2KNBB 1Y0MA 5IH2A 1KIKA 3VKIA 1UE9A 2V8IA 1M3CA 5GJVB 2JS2A 2F1LA 2A37A 1NZ9A 3M0SA 1QVGA 1I0CA 1Z9QA 2H8HA 4OMQA 1WDXA 2XDPA 4J9GA 1VQLA 1PC0A 1TWBA 4M77E 1KFZA 4C0DC 1HYOA 4DEXA 2RJDA 2D1XA 3CCST 1PKTA 4QQ6A 1YWOA 1GCQA 1I81A 2KRSA 2HZYA 5DLQE 1SHFA 2RJCA 4M75G 2BZYA 2V8KA 3CC2T 1LOJA 2ZPHB 4IUPA 4M75A 3FEOA 2K9GA 3CCQA 2PVOB 1NJIR 5GAN4 3HTRA 2I2LA 2VXEA 1M1KR 3LGLA 3A5ZB 1VQOT 5GANg 1SSHA 1ZLMA 1YJ9T 2OTJQ 4D6WA 2EJ9A 1YHQT 1RABB 5FW9A 2DBMA 5GAN7 4AFUC 1M27C 4LD9K 4AFSC 1QCOA 3CXCP 2J05A 2KROA 4M75F 1JQQA 2LJ0A 1VQ8Q 1M1GA 4J5YA 4NL2A 4EMGA 4F04B 2EPDA 4OP0A 2H3EB 3EGXA 2EQJA 1I5OB 1RAEB 2QA4T 3DKMA 4PNOA 1BK2A 3OYIA 3CCMT 4DOWA 2OAUA 1NJIC 4HKEA 1LPLA 2CYZB 3EFOA 2J06A 2OTLQ 4ZN3A 2HL5C 2P84A 1M1KC 3HPWA 4O5VA 3UWNA 2O01E 2KYBA 3TQ7P 2VV5A 1D0XA 1LVKA 4Z89A 1BB9A 5HCKA 4HA8A 3C95A 1V76A 2JMCA 1OPKA 2ROLA 3PGGA 1KQ2A 3HFOA 1VIEA 4KUIA 2LRQA 2O9VA 5KYXA 2FZCB 2K3YA 4OGEA 4C92C 2NYSA 2MIOA 3PT9A 4FIBA 2G3RA 1VQKQ 3CC7A 2JS0A 4MZPA 3OYJA 1VQMA 1VQNQ 1UJYA 4E47A 4M77A 2DRMA 3M4YA 4M7DB 1LNXA 1ZX6A 4M78E 5GAMe 1CKAA 5KYUB 5LJ3f 2EW3A 1YJNQ 2RHZA 2EFIA 2KAFA 3A8LB 2JXBA 2CP0A 5KYNA 3I55Q 4F14A 2XU8A 3OB9A 3E19A 3ME9A 4M7AB 5FWBA 5FU6B 1QVFP 2D0NA 2V1QA 3EG9B 2AIRB 2PZ1A 2CS7A 2O2OA 3CMEQ 3E2UA 2DZCA 2KT8A 2EQIA 1VQPA 5J39A 2QASA 3V8LA 2XIDA 2LVMA 4CI0C 2DIGA 1YJWA 3OYKA 2YUQA 5FLXE 5IT9E 2RJFA 2K2MA 4Y28E 2LZ6B 3I56T 1RL2A 2O88A 2E4HA 1RACB 1N9SA 1OX9A 1QVGP 3D7SB 3PMIA 2DYIA 3A8OB 2OTLT 3LGFA 1WIEA 1WHGA 1Y7XA 2ED0A 2FRWA 2VC8A 3N5BB 1IB8A 4C8QC 4OMOA 3UT1A 3JB9I 4OB2B 1Q86U 1XJWB 2HMAA 1ABQA 1K73U 1GBQA 5KYWA 1PHTA 1FYNA 1WYXA 3CCUT 2DD5A 5GJWB 1VQ4T 5CKDA 5IXFA 3JCMQ 4Z02A 2A36A 2FZKB 2FO0A 4HCKA 2DETA 1KD1C 1B34B 2JUFA 3KFVA 3EG0A 1ZBXA 3ZFJA 1BKBA 1VQNT 1VQ7Q 3GNFB 2J6OA 1WXTA 5I2SA 4C0ZA 2COYA 5A2QE 3OYNA 3VS3A 3L2ZA 1SRMA 4JS5A 3OYYA 2ZCFB 1KJWA 2OI3A 3X24B 4M78G 2YDLA 4LDUA 1GCPA 3LX7A 2R5MA 4KH0B 1GL5A 3I55T 2MCNA 4M78A 4BE1A 3GOXA 2ZPBB 1G5VA 1VQLQ 4HCCA 4LDWA 1N9RA 2EWNA 1Y07A 3CMET 4UC4A 4N4HA 1U8RA 4JRPA 4QT7A 1WHLA 1YJ9A 1YHQA 2YHTA 3RERA 5GANe 4K11A 3TVTA 2PVGB 2OJ2A 3JCMd 1KC8R 3PE0A 4XK8E 2CP6A 1AWXA 1R0CB 1K0SA 2CP2A 4PFZA 1N6AA 1UHFA 5GANh 1Q7YU 1NEBA 1PKSA 1GCQC 1EFNA 1AT1B 2HDAA 3CCRQ 2QTXA 2QA4A 1VQ5Q 1N5ZA 1QKWA 3QUIA 2E1HA 3CCVT 4M75C 1Q81R 2DYBA 1QW1A 3G7ZA 3EGDB 4LXCA 1X2KA 2E10A 2RQTA 1QVPA 4A63B 2NWMA 2VUBA 2LCSA 4GLKA 5IN1A 3CXCS 3M0QA 4EMHA 4X9CA 4ELYC 1K8AU 4N4GA 3FIFA 5LJ5j 2QDLA 2E3HA 3G4SQ 5FU7C 3L2UA 1KC8C 1OU9A 4JJCA 3L42A 1SPKA 1S1NA 1VQ7T 1RADB 2PUKB 3OYGA 2EIFA 2XDBA 2GBQA 2X4YA 5CQXA 3CQTA 2CZ7B 2PNIA 1D1BA 2RMOA 5C0MA 1Y96A 1WQWA 3V8KA 2CH4A 3CEYA 1YITQ 2YRCA 2QGFB 3HKSA 1X27A 4DQ2A 2DK3A 1M9SA 2LDMA 1TUCA 5LJ5f 3I5RA 3H8ZA 4RTUA 3X20B 2LCLA 3QWYA 4LE9A 4JS4A 4FCYA 3R6NA 4FT4A 4E7KA 1T0HA 1XQHA 4EMKA 1AWWA 2DLPA 2YUOA 4J6YA 2F2XA 2CREA 4M77D 3M55A 2RD1A 1MHNA 2YXYA 3Q1JA 2XKOC 4OGCA 2HBPA 2JTFA 5GMKe 1IGUA 3LH5A 3V7CA 1TG0A 2EKHA 1NLOC 2O9SA 2DTIA 2OAWA 3MKDA 3JRZA 1U1TA 4J9EA 4ELZC 3C94A 4HT9A 1C0MA 1R8OB 3CC4A 4AT1B 4ORZA 4M77C 3MP8A 2MWOA 4BDYA 1VQPQ 4AFQC 5GMKh 1QVFS 3LWIA 1G83A 1S72Q 3JCMX 3G71Q 5J3BA 2MPXC 2QGGA 1BBZA 1MNDA 3HP9A 3JCMb 3CD6Q 3X28B 1FMKA 3H0HA 3MEVA 4WCIA 3L1AA 1C1AA 2AKLA 4B6MA 2C0TA 2RI2A 2M16A 2PTKA 2VWFA 4FSXA 1RI9A 4CC4B 5CKHA 3VS2A 5GAN6 1VQ4A 1JBMA 3CCJA 1LCKA 2DX1A 1W70A 1QVGS 3FDRA 1Q81U 1BYMA 3QYGB 1TH7A 4OMMA 3ER0A 2NUZA 1ZBJA 1D3BA 5GAMg 1W4SA 3KBGA 3VS1A 2LX9A 5A0GA 1OI1A 4PFPA 3NHNA 2K5FA 2QI2A 3CCLA 2LQNA 4JDSA 3G6EQ 2RHYA 3TU4K 4JZ4A 3VYHB 2XG8D 2JM9A 1B7TA 3LW5E 2Y4YA 3V8JA 2BE7D 1M30A 2DEUA 4D8KA 1KHCA 2VB6A 1IGQA 4XU0A 1W2BS 3EAEA 4FW1A 3RMSA 3A1PA 1OZ3A 4B9WA 4C0DB 2NUTB 2KBTA 3EHRA 1N27A 1VQ6Q 2EGAA 3UF4A 1TTHB 4J6WA 4NS5A 2KVQG 1VA7A 2GQVA 5IAYA 2YSQA 3TEEA 2QYZA 2RF0A 5CIUA 2L3PA 1G2BA 4XTZA 4RUGA 1QCFA 4EPCA 1Z9ZA 3RBBB 1IZ6A 3QSUA 3CMAA 4J8OA 2YLCA 2L3SA 4R0KA 2KYMA 3FB9A 3M5AA 3NFCA 5L23A 2CDTA 1WNLA 1S72T 3G71T 4HT8A 4F7UB 2V26A 3IQLA 1VYVA 4A54A 1I8FA 3M0RA 3VS0A 3CCVA 1D09B 1FMVA 4M78C 1C6VX 2LCCA 2BIVA 3M0TA 2X3WD 1ZUUA 2JT4A 1OV3A 1ZUYA 1U1SA 4V2SA 3OW2S 2RB6A 1LJOA 1TXQA 3JCMf 1T3LA 2RJEA 2ECZA 2GFUA 2ZPIB 2A28A 1JJ2P 1EZZB 4PJOD 4RKUE 5HKCA 4C5HA 1H92A 1ZSZA 1YIJT 3S3NA 3E9GA 3E9FA 2GQIA 6AT1B 1GFDA 3MHXA 4BI3A 3BDLA 1M2VA 4N0AA 2J6FA 1U3OA 3RIRA 2K79A 4C5IA 2DE0X 2BTTA 4OMFB 3HRUA 3SHWA 3OS1A 2AZSA 2HL3A 4A4GA 4MDWA 1F1BB 3PVLA 5ECAA 2X4XA 3CPWP 2M51A 2NUPB 2RQVA 3QDRB 2DZ9A 3QZ9B 2D8JA 1UGRB 4TVRA 2KY9A 1RAHB 1N8RU 3MP1A 3M0UA 1ACMB 1TS9A 4C92B 4XTVA 4QW2A 2X9HA 1YI2A 3EGUA 4HCZA 4RTZA 4JLGA 3KUFA 2GTOA 3BE3A 4C5GA 2ZGWA 8AT1B 1Q86R 1I1JA 1UFFA 4C0FA 1K73R 5IHNA 1SF9A 2DM1A 3MO8A 2EVRA 2DRKA 2IPOB 4X9DA 1MUZA 3U23A 3CCET 4AG2C 1X43A 1X75C 2QQBA 3VS5A 2QEXT 3H0FA 3QG1A 1BI0A 2DJZA 1VQ9Q 2FRYA 3RNJA 2EBPA 1ZA2B 4ZGEB 3NPFA 5KYYB 4EMKC 2X3XD 5LJ3j 4VUBA 1PD1A 2DNUA 4DBRA 2P4RA 2OX7A 5D7UA 1Q86C 1KQ1A 2V8JA 1K73C 4X34A 3NTHA 2D9TA 4M77G 2E5QA 4JLIA 3HFNA 2COZA 2RQUA 1GXIE 4C8QB 3F70A 3OYEA 4DBFA 3S3OA 4R55A 4ZN1A 1UB4A 3M53A 3AHUA 3CCJQ 5GANd 4BY6C 4PJMA 2K5LA 2A3LA 2HSEB 2K5IA 5LL6S 4NL3A 3O5ZA 1A0NB 1WXUA 1O9SA 2CKKA 2R58A 3WVDB 3JSCA 4C5EA 2OTJT 5GAMh 2K6DA 2FPEA 2CP5A 1UGPB 1Q7YR 3BW1A 3SD4A 1NPPA 4PJLA 1NM7A 4M77F 1WJRA 2LNHB 1VQ8T 2YLBA 3JCMc 2GNCA 2DTHA 3J80E 2QTVA 1EIFA 1TUDA 2WACA 1Y57A 3KXTA 2QQAA 1JRIA 1BCMA 3QZ5B 1K8AR 1CSKA 2QXFA 3SWNA 4RG2A 3L2WA 4PJOE 4DBHA 1NLPC 1AWJA 3A98A 3I35A 3OYAA 1WGSA 4JUVA 1Q7YC 3QO3A 2DBKA 4KGXB 2RHXA 3SEMA 2G6FX 4Z8AA 2MMPA 3MEUA 3CMAQ 3O8VA 5EC7A 2QQSA 4FT2A 2KR3A 2F69A 4M7AD 1PRLC 1G3TA 1BIAA 1FX7A 2FL7A 1J3TA 2M0OA 3PFSA 2M9UA 2QAZA 1VQKT 1NPRA 4RTWA 3C0CA 4J7IA 1K8AC 2CP3A 1SRLA 4KUDK 3RMQA 4FYWB 2QQ9A 4M75B 4Z88A 3PNWC 2X35A 3CCSA 2QK0A 2DXBA 1YJNT 2YUPA 2CGHA 4WF2A 2EGCA 8ATCB 2MWPA 3A8MB 3CC2A 3M54A 5AT1B 1QP3A 3FJPA 3OA6A 4E7SA 5LJ5e 2O31A 1XNIA 5FU7B 3CPFA 4KGVB 1D1AA 2AZVA 4DEYA 2Y90A 2KT1A 1X01A 2RN8A 4L6V5 5CCAA 2DA9A 2RPNA 1NYFA 3OSSC 3OYDA 2FZGB 1VQOA 1KSWA 2JTEA 5LJ5h 4KULA 1JEGA 3ULRB 4AFZC 2HQXA 3AT1B 1HSQA 3URGA 3EGXB 4RCCA 4F17A 3CCQQ 3GF5A 2ZZDA 1Q82U 3VS6A 3RR6A 1JO8A 2RO0A 4FYVB 4JZ3A 2VKNA 3OBWA 3JB9D 4M78F 1ZA1B 1ZSZC 3HRSA 4JJDA 3H0IA 2SRCA 3P8BB 1KQSP 3T9NA 5HY6A 3EFOB 1WHMA 5CK9A 2DTOA 4N0AC 1T0JA 2KDSA 3CCMA 2COWA 2GGRA 1AHJB 1WQ7A 5CKEA 5CO7A 1X69A 4J9HA 4BB7A 2DL5A 2QEXA 4PJOA 2VYTA 4CC7A 4E7ZA 2LQWA 1MMDA 5A0LA 1SSFA 1UGVA 1P92A 4XU2A 2BKDN 4JRQA 2DJQA 4PKCC 2R5AA 2GCXA 4ZTFA 2AKKA 4HVUA 2SEMA 1G3WA 3UATA 5KE2A 3QDFA 3JCMW 5KYXB 1D0ZA 3JAME 1WJQA 4OMPA 1FMWA 1I5LA 1WA7A 3JB9H 2PUOB 5J26A 1X2QA 4GLMA 1QKXA 3M59A 4M77B 1H641 2O4XA 3C4SA 4MMLA 2AT1B 3FLGA 2L0AA 1U06A 5LJ3g 1Y71A 4HVWA 1NG2A 1Q81C 3MEWA 4E7HA 3L2RA 2DPPB 2R57A 3FRNA 3M4GA 4ZGDB 2HQEA 2EYQA 3OS2A 1VQLT 1BIBA 3FJ5A 2DXTA 1JJ2A 4O6JA 3CC7Q 4MZMA 4FSSA 1VQMQ 1G3YA 1M90U 1H3ZA 4ZNXA 1WPYA 1IREB 4M7DE 2HKQB 1TUGB 1DJ7B 2KXDA 2WSEE 5IHIA 1WLPB 1VQ8A 4FYXB 4J9IA 4A4HA 2RNAA 3VS4A 4B9XA 1NE8A 3CPWA 3TCJA 2FPDA 3CCRT 4ZTJA 3I56A 4M7AE 1VQ5T 4PJJA 1UGQB 2RHIA 5GANf 1B3QA 3L2VA 3BFMA 4IURA 1OOTA 2X51A 1SHGA 3OYBA 2OTLA 1K1ZA 4LNPA 3VRZA 3REAB 2DILA 3X25B 1JB0E 3OMGA 1YJWQ 1R0BG 4CC2A 3GPLA 5KYWB 4BI8B 2LMJA 5DY9A 4LUDA 4BE0A 2F2WA 3HL8A 2KQWA 3OS0A 3M0PA 3G4ST 1K76A 4KBMB 1FWZA 5GMKi 1PSEA 3UDCA 3PMTA 1NEGA 2RK1A 5GAN5 3OQ5A 3CCUA 4BD3A 4JRKA 5M9OA 1O75A 5GAOq 2CSIA 1VQKA 3MJXA 2WSFE 5I21A 1VQNA 2LQKA 1YITT 2KE9A 3H6ZA 4J83A 5GMKm 4JJNK 1N8RR 4ME7A 1IHVA 1HXDA 1QCNA 2FEIA 4M78B 3SWNC 2JOYA 1OZ2A 2DEQA 1YJNA 4D8DA 1UECA 5D6WA 1BU1A 1UJ0A 3I55A 1PD0A 4AMCA 1RAGB 2DL4A 3OYCA 5I11A 1ZQ1A 3OMCA 5I22A 2QG9B 1Q95G 4OB1B 3RDVA 1H8KA 3G1JA 1IRXA 1ZHIA 3GP8A 2HCKA 2LTOA 3LYIA 3CMEA 3CCSQ 2X4WA 2XD0A 5I2MA 2A7YA 3OYLA 2VXFA 4IUTA 3QBYA 4IUUA 3CC2Q 2L3QA 4M7DA 3JCMV 3TSZA 1I07A 5D6XA 3TREA 5KYUA 1N8RC 4E2FB 1M2OA 2ZAEA 3J81E 2EQKA 4M7AG 1I4K1 1R77A 3EH2A 4GBQA 2VASA 4E7JA 1VQPT 4QVZA 1YJ9Q 2X4JA 1YHQQ 4E7IA 1AEYA 4M7AA 1PRMC 2FG0A 2KGTA 3EG9A 2DIQA 4II1A 2DO3A 2L89A 4WTOB 3CD6T 3QWXX 4AG1C 2DXCA 4L59A 2E12A 4BE2A 2P0KA 2DVEA 5CR2A 3M9QA 5GMKl 5DLOA 4HCBA 3VUBA 2FHDA 3QHSA 3M56A 2QA4Q 2E3IA 2K7AA 3UA7A 3CCMQ 4XTUA 1SG5A 3THKA 2DD4A 3HHTB 3X26B 5GAMd 2PU9B 4LDYA 4M7AF 3MCAB 4MMKA 5IHKA 1Y96B 3MEAA 1VQ7A 1AWOA 1WZOA 2P0PA 2ED1A 3SDZA 2ATCB 3PVQA 2DL8A 1M8VA 1WHHA 1OQKA 4X1VA 3EFRA 2DMOA 2GFAA 1RAAB 5LJ5g 1BI1A 2EYZA 2FPFA 3G6ET 2ZPGB 3I9QA 1BI3A 5GAN3 4EMKB 3JB9G 5CKBA 1RLPC 3QXEB 5LJ3e 2P4TA 2RQRA 2F5KA 3TSWA 2L8DA 1OULA 2B8AA 4PJOC 4IUVA 3OYMA 3REBB 3J7AF 2EJFA 1T3SA 1B34A 4P5NA 1WI7A 1VQ6T 2PQWA 5LJ3h 4BDZA 3MPUB 1E6HA 1OEBA 1ABOA 3VUZA 2NLUA 1TOVA 2M02A 2BZXA 3SB2A 1W2BA 2RM4A 3EG1A 2KRNA 3OBYA 2E70A 1VYUA 3JB9F 2MOXA 3NTIA 3CCRA 4BY6B 1VQ5A 4ESRA 5D6YA 4J9CA 3QJ6A 4A4EA 4BACA 2FVUA 4OB3B 1MV0B 1X6BA 1PWTA 3RKWA 2PVDB 2K57A 2B86A 2IVWA 1BCOA 2D8HA 4RTXA 1KHIA 3P8HA 1X6OA 1UG1A 2RA2A 3I56Q 1UUEA 1YP5A 2QDYB 3GLXA 3G4SA 3CC4Q 3DB4A 3LH0A 1M1FA 1KQSA 1WFWA 2VVKA 1D3BB 4C92D 1U5SA 2ABLA 4J6XA 3NTKA 3OW2A 1IXDA 1QMCA 5LJ5d 2DVJA 9ATCB 1WJSA 2HAXA 2YWWA 4EDUA 3QJYA 5CAIA 2ESWA 3EGDA 4IIOA 2EQUA 1YITA 3I5SA 1MNEA 1PCXA 4A4KA 2W0ZA 1E6GA 2MAMA 4LD6A 3CBOA 2LJ1A 3CCUQ 1WXBA 1Q82R 1VQ4Q 2JVVA 3QIIA 4LUEA 1QWFA 5L8RE 4IUQA 2LT1A 2CH4W 1OYXA 2MF2A 4FM4B 3A8HB 5IXBA 3INZA 1V29B 5CVIA 4A53A 2CUDA 1ARKA 1MGQA 2E5KA 3CCLQ 5KE3A 3VJPA 2WSCE 1K4US 1K9AA 2RH2A 2J7IA 3GBQA 1G3SA 3OY9A 4QKUA 1HD3A 2LNVA 4RTVA 1W6XA 4OMLA 7AT1B 3JCMP 5KH6A 3LWHA 1Q82C 3VU3C 3QYHB 3BY7A 1UDLA 1M8MA 1VQ9T 4C8QD 4QQGA 4XU1A 1S72A 4M7DD 3G71A 4IKFA 2YRVA 1NJIU 3JCMJ 2C0IA 5GAN2 3M57A 1KD1R 3RESA 3CD6A 2E6ZA 1M3AA 3M58A 1M1KU 3CC4T 2ZPFB 3JCMg 3HRTA 3P8DA 2CT4A 3DLLA 3VRYA 1GRIA 1ZSZB 4F7UE 2VGMA 2GTJA 1JXMA 4RTYA 2L5QA 3CCVQ 2QQRA 1M2VB 2YT6A 4M7DC 2W10A 2K3BA 2IG0A 5GAMj 5GAOn 3META 2BUDA 3L2QA 2F2VA 1JU5C 1M90R 1YIJA 1K9MR 2HQHA 2CZ6B 1YN8A 4PFOA 1UTIA 2Z0WA 5FWCA 3JB9J 1YFNA 1D0YA 2JW4A 3CCJT 5HK3A 3G6EA 1NYGA 2L2PA 3A8GB 2HKNA 1W2BP 3EG2A 4M7AC 5FU6C 1JXOA 2CUBA 1WHJA 3OYFA 3ZL7C 1WHKA 2E6NA 4PK4A 4N4IA 5GAMf 2A0FB 1JJ2S 3HSBA 3CCLT 2CT3A 1VQ6A 5DM7R 3EG3A 2LC4A 3E1SA 2HD0A 3H9NA 2JNGA 2KMTA 5CQYA 1H3HA 4RG8A 5KCHA 2EKOA 1M90C 3NMZC 4DBQA 4Y92A 3H41A 1RLQC 1K9MC 2EYXA 4KH1B 4E6RA 3UPUA 3CPWS 4HXJA 4KGZB 4C92E 4Q5WA 4M75D 4XTXA 4IIMA 1YI2Q 4PJOG 4RTTA 3OW2P 2DXUA 4R56A 4JPBW 1UHCA 2ENMA 3VV0A 2BE9B 3CCEA 4DOVA 1RUWA 2NUTA 2XK0A 1K0XA 5FRMA 2E41A 4J9BA 1B07A 2JTMA 3RKYA 3CMAT 4HVVA 4FL6A 3VS7A 4PLLA 5A0DA 1RAFB 1AVZC 3JV3A 1YNZA 2GF7A 2K4YA 4LDXA 2K2VA 1AZEA 1MMNA 1YCSB 3GIBA 4F7UG 1HK9A 2KRMA 4PJNA 3RKXA 3WXMB 1VIFA 4Y91A 1VOMA 4F7UA 1W1FA 3MP6A 1KD1U 3OYHA 1TU0B 1X6GA 2DAQA 4PJOF 2JJ9A 2CZ1B 3LLRA 2AHJB 2MI6A 1OU8A 2K3XA 4FU6A 2MK5A 4FW2A 2RI3A 4A4FA 3RUXA 3OSVA 3V7SA 4CC3A 2JMAA 2KEAA 2KK4A 1FXXA 3ZEHA 1RAIB 1MMGA 1XOVA 1M5Q1 2XI9A 2XDDA 5GANj 4F7UF 2H3JA 2LX7A 5EG2A 4J7FA 2KXCA 2DFUA 2OTJA 5C6SA 4C8QE 1K9MU 4PL6A 1YCYA 3CCQT 4OVAA 2BZ8A 1QP2A 2XMFA 2D6FA 2JZ2A 2L3RA 1AD5A 1BI2A 2KSSA 3QPHA 3SWNB 2HNIA 3EFSA 1PM3A 1UGSB 2CSQA 4CRIA 1NBEB 2HEQA 2EJGA 1MMAA 5FROA 2NUPA 4M4ZA 1VYTA 4ZGJB 1YI2T 1GBRA 1IO6A 4C92G 4EIKA 4RMOA 4MDXA 4XAXB 2ZPEB 2F5TX 2HBWA 3WVEB 4C92A 1VQ9A 1OX8A 4KRTA 2DKGA 1V1CA 1QQJA 2M1HA 4QQDA 4GY5A 1AZGB 2D0QB 4C0GA 4MZTA 1EX4A 2C06A 2XHCA
chains in the Genus database with same CATH topology
4E7LA 3JSCA 4C5EA 3JCMe 2GFAA 2OTJT 3GNGA 5GAMh 5LJ5g 1BI1A 4XTYA 1UGPB 3G6ET 2ZPGB 3CXCA 3BW1A 1VUBA 2JN0A 1KC8U 1BI3A 4L5GA 5GAN3 4C92F 4ATOA 4EMKB 2E64A 5LJ3d 3SD4A 3JB9G 5CKBA 1N6AA 3QXEB 1NPPA 5GANh 5LJ3e 2EAYA 2P4TA 3PIOA 1Q7YU 4M77F 1WJRA 2F5KA 1VQ8T 2L8DA 2YLBA 2QTXA 4LDVA 2QA4A 2B8AA 3JCMh 3JCMc 1O9SA 4PJOC 4IUVA 3OYMA 2DTHA 3QUIA 2EJFA 2E1HA 1B34A 5GAOm 1EIFA 3J80E 3J7AF 2WACA 3CCVT 4M75C 3KXTA 1QW1A 3CBPA 2EQMA 1JRIA 2P0QA 2QQAA 3G7ZA 4P5NA 3QZ5B 1VQ6T 2E10A 2PQWA 5LJ3h 1QVPA 5GAN8 2QXFA 2VUBA 3SWNA 2E65A 4RG2A 4YTLA 4BDZA 4GLKA 4RCBA 3L2WA 5IN1A 3DLMA 3VUZA 3CXCS 2NLUA 4EMHA 2RI5A 4X9CA 4XTWA 4ELYC 2FB7A 3CC7T 4XU3A 1VQMT 3ASKA 1K8AU 4N4GA 1XTDA 4BI4A 4BUGA 2CZ0B 4PJOE 3FIFA 3V7RA 5LJ5j 3SB2A 1W2BA 2RM4A 4M75E 5FU7C 4JRIA 3OYAA 3BDUA 5FRMA 3L2UA 3OBYA 5HK0A 1KC8C 1WGSA 2E70A 4QVCA 3VYGA 4JUVA 3L42A 2Y4XA 3JB9F 2FYKA 3NTIA 4C8QG 1VQ7T 4OB0B 2PUKB 1Q7YC 3OYGA 2EIFA 3QO3A 4M7DG 3CCRA 4BY6B 5GMKj 3QKJA 1VQ5A 2XDBA 3PIPA 2X4YA 2RHXA 5CQXA 5D6YA 4A4EA 3QJ6A 4BACA 2FVUA 2MMPA 4OB3B 2CZ7B 4C8QA 3MEUA 3O8VA 3RKWA 2PVDB 2K57A 5GAOr 2IVWA 5C0MA 2QQSA 1Y96A 4FT2A 3SFMA 2F69A 5AYFA 1WQWA 3V8KA 2LT4A 3CEYA 4M7AD 3HKSA 1G3TA 4DQ2A 1YBYA 2DK3A 1KG1A 1M9SA 1BIAA 1FX7A 2FL7A 2LDMA 1KHIA 2M0OA 2M9UA 3P8HA 3PFSA 1VQKT 4KT0E 3S6WA 1NPRA 2VGNA 1X6OA 5LJ5f 1K8AC 4J7IA 3H8ZA 2RA2A 4PJOB 4QVDA 2QDYB 3GLXA 3FC3A 4KUDK 3RMQA 3X20B 2LCLA 3G4SA 2QQ9A 4M75B 4JS4A 1YJWT 3PNWC 3DB4A 2LQ8A 1M1FA 3LH0A 4FT4A 4M78D 1PSFA 4NOYA 4XQ3A 2X35A 1XQHA 4EMKA 3CCSA 4E7KA 1KQSA 2DXBA 1YJNT 4C8QF 5FRNA 1D3BB 2CGHA 4WF2A 4C92D 4M7DF 4J6XA 4J6YA 3CBMA 2MWPA 3A8MB 3CC2A 3NTKA 1M4ZA 3M54A 4M77D 3OW2A 1QP3A 3FJPA 3OA6A 5LJ5d 2RHUA 3OS5A 5LJ5e 1WJSA 5CKFA 5GAOl 2HAXA 4EDUA 3R6OA 3QJYA 3ZBDA 1XNIA 3M55A 2RD1A 1MHNA 5FU7B 5CAIA 1YITA 2EQUA 3CPFA 1QVFA 5GAOp 3Q1JA 3C12A 4DA4A 2XKOC 2Y90A 4A4KA 2O4XB 1X01A 4OGCA 3S3MA 4L6V5 2HBPA 4PLIA 5CCAA 2MAMA 2JTFA 4LD6A 4OF1A 5GMKe 3CBOA 1KQSS 3V7CA 3OSSC 1RI0A 3OYDA 5KCOA 1VQOA 5LJ5h 2RK2A 2DTIA 4KULA 3JRZA 1U1TA 4ELZC 3DB3A 1UEBA 3C94A 4HT9A 2XICA 2HQXA 1R8OB 3CC4A 2JVVA 3URGA 4RCCA 3QIIA 3GF5A 2ZZDA 4M77C 5L8RE 3MP8A 1Q82U 2MWOA 3VKIA 4IUQA 2RO0A 2V8IA 4BDYA 2LT1A 5GMKh 3OBWA 1OYXA 2MF2A 4M78F 3JB9D 1NZ9A 4FM4B 1QVGA 1QVFS 3LWIA 3A8HB 3JCMX 3HRSA 5J3BA 3INZA 1V29B 3P8BB 5CVIA 4A53A 3T9NA 3HP9A 5HY6A 3JCMb 3X28B 2XDPA 3MEVA 1MGQA 5CK9A 2DTOA 3L1AA 4N0AC 5KE3A 1VQLA 4M77E 3VJPA 2KDSA 3CCMA 4C0DC 2RI2A 2RJDA 2M16A 2WSCE 3CCST 4QQ6A 1I81A 1AHJB 5DLQE 1WQ7A 2RH2A 4FSXA 5CKEA 2RJCA 4M75G 5CO7A 2V8KA 5CKHA 4BB7A 5GAN6 2QEXA 4PJOA 1VQ4A 1JBMA 1G3SA 2VYTA 3CCJA 3OY9A 3CC2T 2LNVA 1LOJA 2ZPHB 4IUPA 4M75A 1QVGS 3JCMP 3FDRA 3FEOA 5A0LA 5KH6A 1SSFA 3LWHA 1P92A 1Q81U 4XU2A 2BKDN 3CCQA 4JRQA 1BYMA 3QYGB 3VU3C 1Q82C 1TH7A 3QYHB 4PKCC 3BY7A 2PVOB 3ER0A 2R5AA 1D3BA 2GCXA 4ZTFA 5GAMg 5GAN4 1W4SA 1VQ9T 1G3WA 3KBGA 5KE2A 2I2LA 3JCMW 2LX9A 4C8QD 3JAME 2VXEA 1WJQA 4QQGA 4XU1A 5A0GA 3G71A 1S72A 1OI1A 2YRVA 4IKFA 4M7DD 1NJIU 3LGLA 3JCMJ 5GAN2 1I5LA 3M57A 3JB9H 3A5ZB 1VQOT 3RESA 5GANg 3CD6A 2PUOB 2E6ZA 5J26A 1YJ9T 4D6WA 2EJ9A 2K5FA 2QI2A 1YHQT 3CCLA 3M58A 4JDSA 3CC4T 1M1KU 2ZPFB 2RHYA 3M59A 3JCMg 5GAN7 3TU4K 4M77B 4LD9K 3VYHB 1H641 2O4XA 3C4SA 4MMLA 3HRTA 3P8DA 2XG8D 3LW5E 2Y4YA 3DLLA 4M75F 3V8JA 3FLGA 1M1GA 4J5YA 4NL2A 4EMGA 1Y71A 5LJ3g 1KHCA 4OP0A 4XU0A 2VGMA 4F7UE 1W2BS 1Q81C 2EQJA 3MEWA 4E7HA 3EAEA 3L2RA 3RMSA 2L5QA 2R57A 2DPPB 2QQRA 3FRNA 3M4GA 4ZGDB 2HQEA 4M7DC 2EYQA 1OZ3A 2IG0A 4B9WA 5GAMj 4C0DB 5GAOn 3OS2A 1VQLT 2QA4T 1N27A 1BIBA 3DKMA 3META 4PNOA 3OYIA 3CCMT 2BUDA 3L2QA 4DOWA 4J6WA 1YIJA 2OAUA 2DXTA 4NS5A 1JJ2A 4O6JA 1NJIC 2CZ6B 2KVQG 3JB9J 2GQVA 4MZMA 4HKEA 5IAYA 1G3YA 2CYZB 1M90U 3TEEA 3PTAA 3CCJT 4ZN3A 5HK3A 5CIUA 1M1KC 1H3ZA 3G6EA 1WPYA 3HPWA 1IREB 4M7DE 4O5VA 4XTZA 3UWNA 3A8GB 2O01E 4EPCA 1DJ7B 1IZ6A 3QSUA 4M7AC 2VV5A 5FU6C 2WSEE 3CMAA 4J8OA 2YLCA 3OYFA 3NFCA 3FB9A 3M5AA 1VQ8A 4HA8A 3C95A 4A4HA 1WNLA 1S72T 3G71T 4HT8A 2E6NA 4F7UB 4B9XA 1NE8A 4A54A 1I8FA 3CPWA 3TCJA 3PGGA 4N4IA 5GAMf 3CCVA 1KQ2A 1JJ2S 3HSBA 4M78C 3HFOA 1VIEA 3CCLT 3CCRT 4ZTJA 3I56A 2LCCA 2BIVA 4KUIA 2LRQA 5DM7R 1VQ5T 1VQ6A 4M7AE 2LC4A 1UGQB 2RHIA 3E1SA 2K3YA 2HD0A 4OGEA 4C92C 2JNGA 5GANf 2KMTA 3PT9A 1U1SA 4FIBA 2G3RA 4V2SA 3L2VA 3BFMA 5CQYA 3OW2S 3CC7A 2RB6A 4MZPA 4IURA 3OYJA 4RG8A 1LJOA 1VQMA 5KCHA 2EKOA 3JCMf 3OYBA 1M90C 2OTLA 1K9MC 2RJEA 3X25B 1JB0E 4E47A 3OMGA 4M77A 3M4YA 2GFUA 4M7DB 1LNXA 4M78E 5GAMe 2ZPIB 3GPLA 3UPUA 4BI8B 5LJ3f 3CPWS 2RHZA 4PJOD 5DY9A 4C92E 4Q5WA 2EFIA 4RKUE 5HKCA 4C5HA 4BE0A 3HL8A 2KQWA 3OS0A 2KAFA 3G4ST 4M75D 3A8LB 3E9GA 4KBMB 4XTXA 3S3NA 1FWZA 5GMKi 1YIJT 3E9FA 1PSEA 3UDCA 4PJOG 2DXUA 3MHXA 3PMTA 4BI3A 3BDLA 4R56A 2RK1A 5GAN5 3VV0A 3CCEA 4N0AA 2XU8A 3OQ5A 3RIRA 4DOVA 4BD3A 3CCUA 3OB9A 2XK0A 3E19A 4C5IA 3ME9A 4JRKA 4M7AB 5FU6B 2E41A 4OMFB 1O75A 3HRUA 2JTMA 5M9OA 5GAOq 4A4GA 3OS1A 4MDWA 2CS7A 3RKYA 3CMAT 1VQKA 2X4XA 2WSFE 2DZCA 4FL6A 5I21A 1VQNA 3QDRB 4PLLA 5A0DA 2DZ9A 2LQKA 3QZ9B 5J39A 3V8LA 1VQPA 1YITT 2XIDA 2LVMA 3H6ZA 4J83A 5GMKm 4JJNK 2GF7A 2K4YA 4CI0C 4ME7A 2DIGA 1YJWA 1HXDA 1UGRB 3OYKA 4LDXA 2K2VA 3SWNC 4M78B 2JOYA 1OZ2A 2DEQA 2KY9A 4TVRA 5FLXE 5IT9E 1YJNA 3GIBA 2RJFA 4F7UG 1N8RU 3MP1A 1HK9A 4Y28E 3I56T 1RL2A 3RKXA 4C92B 4XTVA 4QW2A 3WXMB 5D6WA 1VIFA 4Y91A 1N9SA 4F7UA 1YI2A 3MP6A 3I55A 3OYHA 1KD1U 4HCZA 2DAQA 3PMIA 4PJOF 2CZ1B 3LLRA 2AHJB 3A8OB 2MI6A 2OTLT 4JLGA 3LGFA 3OYCA 2K3XA 3KUFA 1ZQ1A 3OMCA 1Y7XA 4OB1B 4FU6A 1ZHIA 2VC8A 4C5GA 3GP8A 2RI3A 4A4FA 3LYIA 2LTOA 3RUXA 3CMEA 3OSVA 2X4WA 2ZGWA 2XD0A 3N5BB 5I2MA 4C8QC 2A7YA 3OYLA 2VXFA 3V7SA 4C0FA 4IUTA 2KK4A 1FXXA 3UT1A 3QBYA 3ZEHA 3MO8A 4IUUA 3JB9I 4OB2B 1Q86U 4M7DA 3JCMV 1XOVA 1K73U 4X9DA 5D6XA 3TREA 3CCET 1M5Q1 2XI9A 2XDDA 3CCUT 2DD5A 1X75C 4F7UF 5GANj 2H3JA 2QQBA 5EG2A 1N8RC 4J7FA 2QEXT 1VQ4T 3QG1A 2OTJA 5CKDA 1BI0A 2DJZA 5C6SA 3JCMQ 4Z02A 4C8QE 1K9MU 3J81E 4PL6A 1KD1C 1B34B 1YCYA 2JUFA 3ZFJA 1ZBXA 2EQKA 3CCQT 4M7AG 1BKBA 4ZGEB 4OVAA 1I4K1 1VQNT 4E7JA 1VQPT 1QP2A 4QVZA 4EMKC 2D6FA 2JZ2A 2L3RA 2X4JA 3GNFB 1BI2A 2KSSA 3QPHA 4E7IA 3SWNB 5LJ3j 4M7AA 2HNIA 3EFSA 5I2SA 4C0ZA 1UGSB 4CRIA 2DIQA 4II1A 2DO3A 2L89A 5A2QE 3OYNA 4VUBA 2EJGA 3L2ZA 4JS5A 3OYYA 2ZCFB 3CD6T 5FROA 3X24B 4M78G 2DXCA 4L59A 2E12A 4LDUA 4BE2A 4ZGJB 1Q86C 3LX7A 2P0KA 2DVEA 2R5MA 1YI2T 5CR2A 1KQ1A 3M9QA 3I55T 2V8JA 5GMKl 1K73C 4C92G 4X34A 5DLOA 4M78A 4HCBA 3NTHA 2D9TA 4RMOA 3VUBA 4MDXA 4XAXB 2FHDA 2ZPEB 4BE1A 2F5TX 4M77G 3QHSA 3GOXA 2ZPBB 1G5VA 3M56A 3WVEB 2E5QA 4JLIA 4C92A 4HCCA 3HFNA 4LDWA 1VQ9A 1N9RA 2EWNA 4XTUA 1Y07A 2DKGA 3CMET 2DD4A 3HHTB 4C8QB 3F70A 4UC4A 1GXIE 3X26B 5GAMd 2PU9B 3OYEA 2M1HA 3S3OA 4LDYA 4N4HA 4QQDA 4M7AF 3MCAB 4MMKA 4GY5A 4R55A 1U8RA 4JRPA 2D0QB 1UB4A 1Y96B 3MEAA 4C0GA 4ZN1A 3M53A 1YJ9A 1VQ7A 3AHUA 1YHQA 4MZTA 2P0PA 2YHTA 2C06A 5GANd 3RERA 2XHCA 3SDZA 4BY6C 5GANe 2K5LA 2A3LA 1M8VA 4NL3A 2K5IA 5LL6S 2PVGB 3JCMd 2CKKA 3WVDB 2R58A 3EFRA 4XK8E
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1HK9 A;  3JCM e;  2RD1 A;  5CAI A;  5GAM j;  5GAO n;  3RKX A;  5GAM h;  4C92 B;  4XTV A;  5LJ5 g;  1BIB A;  4PNO A;  4XTY A;  5GAO p;  2Y90 A;  3BW1 A;  4Y91 A;  4J6W A;  2JN0 A;  1N9S A;  2DXT A;  1X01 A;  4F7U A;  5GAN 3;  4C92 F;  4EMK B;  2E64 A;  4PJO F;  5LJ3 d;  3JB9 J;  3JB9 G;  5GMK e;  5GAN h;  3V7C A;  5LJ3 e;  2EAY A;  4M77 F;  5LJ5 h;  2DTI A;  2YLB A;  1U1T A;  2QTX A;  1WPY A;  4HT9 A;  3JCM h;  2VC8 A;  4M7D E;  3JCM c;  4XTZ A;  4PJO C;  2DTH A;  3QUI A;  2EJF A;  2E1H A;  1B34 A;  4RCC A;  3RUX A;  2ZGW A;  5GAO m;  3QSU A;  4M7A C;  4M77 C;  2YLC A;  4M75 C;  4C8Q C;  2VXF A;  3V7S A;  1JRI A;  3FB9 A;  5GMK h;  4HA8 A;  2E10 A;  5LJ3 h;  4M78 F;  5GAN 8;  3JB9 D;  3SWN A;  2E65 A;  1WNL A;  3JB9 I;  4RCB A;  4HT8 A;  4F7U B;  4M7D A;  3JCM V;  3JCM X;  4X9D A;  1I8F A;  3INZ A;  4A54 A;  3PGG A;  4EMH A;  4X9C A;  4A53 A;  4XTW A;  5GAM f;  2FB7 A;  1KQ2 A;  1M5Q 1;  4XU3 A;  3JCM b;  3HSB A;  5GAN j;  4M78 C;  3HFO A;  4F7U F;  4PJO E;  3FIF A;  3V7R A;  1MGQ A;  5LJ5 j;  3SB2 A;  4M7A E;  2DJZ A;  2DTO A;  3L1A A;  4N0A C;  3JCM Q;  4M77 E;  2RM4 A;  4M75 E;  4C8Q E;  4JRI A;  3BDU A;  4C92 C;  5GAN f;  1B34 B;  1YCY A;  1U1S A;  4V2S A;  4QVC A;  3BFM A;  1I81 A;  4M7A G;  1I4K 1;  4JUV A;  1WQ7 A;  2RB6 A;  3JB9 F;  4M75 G;  1LJO A;  2FYK A;  4C8Q G;  3JCM f;  4EMK C;  3QO3 A;  4M7D G;  5GAN 6;  4PJO A;  1JBM A;  5GMK j;  3SWN B;  5LJ3 j;  4M7A A;  2HNI A;  3EFS A;  1LOJ A;  4M77 A;  4M75 A;  4C8Q A;  4M7D B;  1LNX A;  4M78 E;  3JCM P;  5GAM e;  4XU2 A;  2EJG A;  3L2Z A;  3RKW A;  3VU3 C;  2K57 A;  1TH7 A;  5GAO r;  3BY7 A;  5LJ3 f;  4PJO D;  1D3B A;  5DY9 A;  1Y96 A;  4M78 G;  4C92 E;  5GAM g;  5GAN 4;  1WQW A;  3V8K A;  4M7A D;  2I2L A;  4M75 D;  4XTX A;  4C8Q D;  4DQ2 A;  2DVE A;  3JCM W;  2VXE A;  1KQ1 A;  4XU1 A;  5GMK i;  4M7D D;  5GMK l;  1BIA A;  4C92 G;  4M78 A;  4PJO G;  3JCM J;  2DXU A;  5GAN 2;  1I5L A;  3JB9 H;  5LJ5 f;  3RES A;  5GAN g;  5GAN 5;  4N0A A;  4M77 G;  3QHS A;  2RA2 A;  3RIR A;  4PJO B;  2EJ9 A;  4QVD A;  4JLI A;  4C92 A;  3HFN A;  4JRK A;  1N9R A;  4M7A B;  2E41 A;  2EWN A;  4XTU A;  3JCM g;  5GAN 7;  4M77 B;  2DKG A;  4M75 B;  4C8Q B;  5GAO q;  1H64 1;  4XQ3 A;  4M78 D;  4MML A;  3RKY A;  5GAM d;  4NOY A;  4EMK A;  4M7A F;  4MMK A;  2DZC A;  5I21 A;  4M75 F;  3V8J A;  4C8Q F;  1D3B B;  2CGH A;  1Y96 B;  4WF2 A;  4C92 D;  2DZ9 A;  3AHU A;  4M7D F;  3V8L A;  4J5Y A;  4J6X A;  4J6Y A;  4NL2 A;  4EMG A;  2YHT A;  5LJ3 g;  5GMK m;  5GAN d;  3RER A;  4OP0 A;  4XU0 A;  4F7U E;  4M77 D;  1HXD A;  5GAN e;  3FJP A;  5LJ5 d;  5GAO l;  3SWN C;  4M78 B;  4NL3 A;  1M8V A;  5LJ5 e;  2DEQ A;  3M4G A;  4M7D C;  3JCM d;  3GIB A;  3EFR A;  4F7U G; 
#chains in the Genus database with same CATH topology
 4E7L A;  3JCM e;  3GNG A;  2RQW A;  4XTY A;  3CXC A;  1VUB A;  1E7O A;  2JN0 A;  1KC8 U;  4L5G A;  4C92 F;  4ATO A;  2DER A;  2E64 A;  5LJ3 d;  2J6K A;  2YUN A;  2EAY A;  2I0N A;  3PIO A;  3NGP A;  4FYY B;  4LDV A;  3JCM h;  2HSP A;  1D1C A;  5GAO m;  1AOJ A;  2JM8 A;  4J9D A;  3CBP A;  2EQM A;  2P0Q A;  5KYY A;  5GAN 8;  2E65 A;  4YTL A;  1YWP A;  4RCB A;  3DLM A;  1MV3 A;  1ZUK A;  2LJ3 A;  2RI5 A;  4XTW A;  3CC7 T;  2FB7 A;  4XU3 A;  1VQM T;  3ASK A;  1XTD A;  4BI4 A;  4BUG A;  2CZ0 B;  3V7R A;  1WX6 A;  1KK7 A;  1IHW A;  2A08 A;  4M75 E;  1YIJ Q;  4JRI A;  3BDU A;  5HK0 A;  4LN2 A;  1SEM A;  4QVC A;  3VYG A;  2Y4X A;  2FYK A;  4C8Q G;  4OB0 B;  4M7D G;  1ZSG A;  2EGE A;  5GMK j;  3QKJ A;  3PIP A;  4JJB A;  4C8Q A;  4OMN A;  5GAO r;  2AK5 A;  1QWE A;  1OPL A;  3SFM A;  2ROT A;  1G8X A;  5AYF A;  1SKU B;  2LT4 A;  1QLY A;  1PG5 B;  1HJD A;  1YBY A;  1KG1 A;  2DL3 A;  2YRD A;  4KT0 E;  3S6W A;  2EYW A;  2VGN A;  2KI7 A;  1VQO Q;  2IIM A;  4PJO B;  4QVD A;  2MYS A;  3FC3 A;  2EYY A;  3EH1 A;  1YJW T;  4XQ3 A;  2LQ8 A;  4M78 D;  3PTA A;  1PSF A;  4NOY A;  2CP7 A;  2LP5 A;  4C8Q F;  5FRN A;  1TSF A;  4M7D F;  3CBM A;  4F16 A;  1GFC A;  1M4Z A;  1PNJ A;  4J9F A;  2C0O A;  2RHU A;  3OS5 A;  5CKF A;  5GAO l;  3R6O A;  2DF6 A;  3ZBD A;  1QVF A;  5GAO p;  4DA4 A;  3C12 A;  4ANJ A;  3UA6 A;  2O4X B;  3S3M A;  4PLI A;  2V1R A;  4OF1 A;  3CCE Q;  1KQS S;  1RI0 A;  5KCO A;  2DL7 A;  2M0Y A;  2RK2 A;  2QEX Q;  1M3B A;  1CKB A;  1UEB A;  3DB3 A;  2XIC A;  3EHQ A;  2KNB B;  1Y0M A;  5IH2 A;  1KIK A;  3VKI A;  1UE9 A;  2V8I A;  1M3C A;  5GJV B;  2JS2 A;  2F1L A;  2A37 A;  1NZ9 A;  3M0S A;  1QVG A;  1I0C A;  1Z9Q A;  2H8H A;  4OMQ A;  1WDX A;  2XDP A;  4J9G A;  1VQL A;  1PC0 A;  1TWB A;  4M77 E;  1KFZ A;  4C0D C;  1HYO A;  4DEX A;  2RJD A;  2D1X A;  3CCS T;  1PKT A;  4QQ6 A;  1YWO A;  1GCQ A;  1I81 A;  2KRS A;  2HZY A;  5DLQ E;  1SHF A;  2RJC A;  4M75 G;  2BZY A;  2V8K A;  3CC2 T;  1LOJ A;  2ZPH B;  4IUP A;  4M75 A;  3FEO A;  2K9G A;  3CCQ A;  2PVO B;  1NJI R;  5GAN 4;  3HTR A;  2I2L A;  2VXE A;  1M1K R;  3LGL A;  3A5Z B;  1VQO T;  5GAN g;  1SSH A;  1ZLM A;  1YJ9 T;  2OTJ Q;  4D6W A;  2EJ9 A;  1YHQ T;  1RAB B;  5FW9 A;  2DBM A;  5GAN 7;  4AFU C;  1M27 C;  4LD9 K;  4AFS C;  1QCO A;  3CXC P;  2J05 A;  2KRO A;  4M75 F;  1JQQ A;  2LJ0 A;  1VQ8 Q;  1M1G A;  4J5Y A;  4NL2 A;  4EMG A;  4F04 B;  2EPD A;  4OP0 A;  2H3E B;  3EGX A;  2EQJ A;  1I5O B;  1RAE B;  2QA4 T;  3DKM A;  4PNO A;  1BK2 A;  3OYI A;  3CCM T;  4DOW A;  2OAU A;  1NJI C;  4HKE A;  1LPL A;  2CYZ B;  3EFO A;  2J06 A;  2OTL Q;  4ZN3 A;  2HL5 C;  2P84 A;  1M1K C;  3HPW A;  4O5V A;  3UWN A;  2O01 E;  2KYB A;  3TQ7 P;  2VV5 A;  1D0X A;  1LVK A;  4Z89 A;  1BB9 A;  5HCK A;  4HA8 A;  3C95 A;  1V76 A;  2JMC A;  1OPK A;  2ROL A;  3PGG A;  1KQ2 A;  3HFO A;  1VIE A;  4KUI A;  2LRQ A;  2O9V A;  5KYX A;  2FZC B;  2K3Y A;  4OGE A;  4C92 C;  2NYS A;  2MIO A;  3PT9 A;  4FIB A;  2G3R A;  1VQK Q;  3CC7 A;  2JS0 A;  4MZP A;  3OYJ A;  1VQM A;  1VQN Q;  1UJY A;  4E47 A;  4M77 A;  2DRM A;  3M4Y A;  4M7D B;  1LNX A;  1ZX6 A;  4M78 E;  5GAM e;  1CKA A;  5KYU B;  5LJ3 f;  2EW3 A;  1YJN Q;  2RHZ A;  2EFI A;  2KAF A;  3A8L B;  2JXB A;  2CP0 A;  5KYN A;  3I55 Q;  4F14 A;  2XU8 A;  3OB9 A;  3E19 A;  3ME9 A;  4M7A B;  5FWB A;  5FU6 B;  1QVF P;  2D0N A;  2V1Q A;  3EG9 B;  2AIR B;  2PZ1 A;  2CS7 A;  2O2O A;  3CME Q;  3E2U A;  2DZC A;  2KT8 A;  2EQI A;  1VQP A;  5J39 A;  2QAS A;  3V8L A;  2XID A;  2LVM A;  4CI0 C;  2DIG A;  1YJW A;  3OYK A;  2YUQ A;  5FLX E;  5IT9 E;  2RJF A;  2K2M A;  4Y28 E;  2LZ6 B;  3I56 T;  1RL2 A;  2O88 A;  2E4H A;  1RAC B;  1N9S A;  1OX9 A;  1QVG P;  3D7S B;  3PMI A;  2DYI A;  3A8O B;  2OTL T;  3LGF A;  1WIE A;  1WHG A;  1Y7X A;  2ED0 A;  2FRW A;  2VC8 A;  3N5B B;  1IB8 A;  4C8Q C;  4OMO A;  3UT1 A;  3JB9 I;  4OB2 B;  1Q86 U;  1XJW B;  2HMA A;  1ABQ A;  1K73 U;  1GBQ A;  5KYW A;  1PHT A;  1FYN A;  1WYX A;  3CCU T;  2DD5 A;  5GJW B;  1VQ4 T;  5CKD A;  5IXF A;  3JCM Q;  4Z02 A;  2A36 A;  2FZK B;  2FO0 A;  4HCK A;  2DET A;  1KD1 C;  1B34 B;  2JUF A;  3KFV A;  3EG0 A;  1ZBX A;  3ZFJ A;  1BKB A;  1VQN T;  1VQ7 Q;  3GNF B;  2J6O A;  1WXT A;  5I2S A;  4C0Z A;  2COY A;  5A2Q E;  3OYN A;  3VS3 A;  3L2Z A;  1SRM A;  4JS5 A;  3OYY A;  2ZCF B;  1KJW A;  2OI3 A;  3X24 B;  4M78 G;  2YDL A;  4LDU A;  1GCP A;  3LX7 A;  2R5M A;  4KH0 B;  1GL5 A;  3I55 T;  2MCN A;  4M78 A;  4BE1 A;  3GOX A;  2ZPB B;  1G5V A;  1VQL Q;  4HCC A;  4LDW A;  1N9R A;  2EWN A;  1Y07 A;  3CME T;  4UC4 A;  4N4H A;  1U8R A;  4JRP A;  4QT7 A;  1WHL A;  1YJ9 A;  1YHQ A;  2YHT A;  3RER A;  5GAN e;  4K11 A;  3TVT A;  2PVG B;  2OJ2 A;  3JCM d;  1KC8 R;  3PE0 A;  4XK8 E;  2CP6 A;  1AWX A;  1R0C B;  1K0S A;  2CP2 A;  4PFZ A;  1N6A A;  1UHF A;  5GAN h;  1Q7Y U;  1NEB A;  1PKS A;  1GCQ C;  1EFN A;  1AT1 B;  2HDA A;  3CCR Q;  2QTX A;  2QA4 A;  1VQ5 Q;  1N5Z A;  1QKW A;  3QUI A;  2E1H A;  3CCV T;  4M75 C;  1Q81 R;  2DYB A;  1QW1 A;  3G7Z A;  3EGD B;  4LXC A;  1X2K A;  2E10 A;  2RQT A;  1QVP A;  4A63 B;  2NWM A;  2VUB A;  2LCS A;  4GLK A;  5IN1 A;  3CXC S;  3M0Q A;  4EMH A;  4X9C A;  4ELY C;  1K8A U;  4N4G A;  3FIF A;  5LJ5 j;  2QDL A;  2E3H A;  3G4S Q;  5FU7 C;  3L2U A;  1KC8 C;  1OU9 A;  4JJC A;  3L42 A;  1SPK A;  1S1N A;  1VQ7 T;  1RAD B;  2PUK B;  3OYG A;  2EIF A;  2XDB A;  2GBQ A;  2X4Y A;  5CQX A;  3CQT A;  2CZ7 B;  2PNI A;  1D1B A;  2RMO A;  5C0M A;  1Y96 A;  1WQW A;  3V8K A;  2CH4 A;  3CEY A;  1YIT Q;  2YRC A;  2QGF B;  3HKS A;  1X27 A;  4DQ2 A;  2DK3 A;  1M9S A;  2LDM A;  1TUC A;  5LJ5 f;  3I5R A;  3H8Z A;  4RTU A;  3X20 B;  2LCL A;  3QWY A;  4LE9 A;  4JS4 A;  4FCY A;  3R6N A;  4FT4 A;  4E7K A;  1T0H A;  1XQH A;  4EMK A;  1AWW A;  2DLP A;  2YUO A;  4J6Y A;  2F2X A;  2CRE A;  4M77 D;  3M55 A;  2RD1 A;  1MHN A;  2YXY A;  3Q1J A;  2XKO C;  4OGC A;  2HBP A;  2JTF A;  5GMK e;  1IGU A;  3LH5 A;  3V7C A;  1TG0 A;  2EKH A;  1NLO C;  2O9S A;  2DTI A;  2OAW A;  3MKD A;  3JRZ A;  1U1T A;  4J9E A;  4ELZ C;  3C94 A;  4HT9 A;  1C0M A;  1R8O B;  3CC4 A;  4AT1 B;  4ORZ A;  4M77 C;  3MP8 A;  2MWO A;  4BDY A;  1VQP Q;  4AFQ C;  5GMK h;  1QVF S;  3LWI A;  1G83 A;  1S72 Q;  3JCM X;  3G71 Q;  5J3B A;  2MPX C;  2QGG A;  1BBZ A;  1MND A;  3HP9 A;  3JCM b;  3CD6 Q;  3X28 B;  1FMK A;  3H0H A;  3MEV A;  4WCI A;  3L1A A;  1C1A A;  2AKL A;  4B6M A;  2C0T A;  2RI2 A;  2M16 A;  2PTK A;  2VWF A;  4FSX A;  1RI9 A;  4CC4 B;  5CKH A;  3VS2 A;  5GAN 6;  1VQ4 A;  1JBM A;  3CCJ A;  1LCK A;  2DX1 A;  1W70 A;  1QVG S;  3FDR A;  1Q81 U;  1BYM A;  3QYG B;  1TH7 A;  4OMM A;  3ER0 A;  2NUZ A;  1ZBJ A;  1D3B A;  5GAM g;  1W4S A;  3KBG A;  3VS1 A;  2LX9 A;  5A0G A;  1OI1 A;  4PFP A;  3NHN A;  2K5F A;  2QI2 A;  3CCL A;  2LQN A;  4JDS A;  3G6E Q;  2RHY A;  3TU4 K;  4JZ4 A;  3VYH B;  2XG8 D;  2JM9 A;  1B7T A;  3LW5 E;  2Y4Y A;  3V8J A;  2BE7 D;  1M30 A;  2DEU A;  4D8K A;  1KHC A;  2VB6 A;  1IGQ A;  4XU0 A;  1W2B S;  3EAE A;  4FW1 A;  3RMS A;  3A1P A;  1OZ3 A;  4B9W A;  4C0D B;  2NUT B;  2KBT A;  3EHR A;  1N27 A;  1VQ6 Q;  2EGA A;  3UF4 A;  1TTH B;  4J6W A;  4NS5 A;  2KVQ G;  1VA7 A;  2GQV A;  5IAY A;  2YSQ A;  3TEE A;  2QYZ A;  2RF0 A;  5CIU A;  2L3P A;  1G2B A;  4XTZ A;  4RUG A;  1QCF A;  4EPC A;  1Z9Z A;  3RBB B;  1IZ6 A;  3QSU A;  3CMA A;  4J8O A;  2YLC A;  2L3S A;  4R0K A;  2KYM A;  3FB9 A;  3M5A A;  3NFC A;  5L23 A;  2CDT A;  1WNL A;  1S72 T;  3G71 T;  4HT8 A;  4F7U B;  2V26 A;  3IQL A;  1VYV A;  4A54 A;  1I8F A;  3M0R A;  3VS0 A;  3CCV A;  1D09 B;  1FMV A;  4M78 C;  1C6V X;  2LCC A;  2BIV A;  3M0T A;  2X3W D;  1ZUU A;  2JT4 A;  1OV3 A;  1ZUY A;  1U1S A;  4V2S A;  3OW2 S;  2RB6 A;  1LJO A;  1TXQ A;  3JCM f;  1T3L A;  2RJE A;  2ECZ A;  2GFU A;  2ZPI B;  2A28 A;  1JJ2 P;  1EZZ B;  4PJO D;  4RKU E;  5HKC A;  4C5H A;  1H92 A;  1ZSZ A;  1YIJ T;  3S3N A;  3E9G A;  3E9F A;  2GQI A;  6AT1 B;  1GFD A;  3MHX A;  4BI3 A;  3BDL A;  1M2V A;  4N0A A;  2J6F A;  1U3O A;  3RIR A;  2K79 A;  4C5I A;  2DE0 X;  2BTT A;  4OMF B;  3HRU A;  3SHW A;  3OS1 A;  2AZS A;  2HL3 A;  4A4G A;  4MDW A;  1F1B B;  3PVL A;  5ECA A;  2X4X A;  3CPW P;  2M51 A;  2NUP B;  2RQV A;  3QDR B;  2DZ9 A;  3QZ9 B;  2D8J A;  1UGR B;  4TVR A;  2KY9 A;  1RAH B;  1N8R U;  3MP1 A;  3M0U A;  1ACM B;  1TS9 A;  4C92 B;  4XTV A;  4QW2 A;  2X9H A;  1YI2 A;  3EGU A;  4HCZ A;  4RTZ A;  4JLG A;  3KUF A;  2GTO A;  3BE3 A;  4C5G A;  2ZGW A;  8AT1 B;  1Q86 R;  1I1J A;  1UFF A;  4C0F A;  1K73 R;  5IHN A;  1SF9 A;  2DM1 A;  3MO8 A;  2EVR A;  2DRK A;  2IPO B;  4X9D A;  1MUZ A;  3U23 A;  3CCE T;  4AG2 C;  1X43 A;  1X75 C;  2QQB A;  3VS5 A;  2QEX T;  3H0F A;  3QG1 A;  1BI0 A;  2DJZ A;  1VQ9 Q;  2FRY A;  3RNJ A;  2EBP A;  1ZA2 B;  4ZGE B;  3NPF A;  5KYY B;  4EMK C;  2X3X D;  5LJ3 j;  4VUB A;  1PD1 A;  2DNU A;  4DBR A;  2P4R A;  2OX7 A;  5D7U A;  1Q86 C;  1KQ1 A;  2V8J A;  1K73 C;  4X34 A;  3NTH A;  2D9T A;  4M77 G;  2E5Q A;  4JLI A;  3HFN A;  2COZ A;  2RQU A;  1GXI E;  4C8Q B;  3F70 A;  3OYE A;  4DBF A;  3S3O A;  4R55 A;  4ZN1 A;  1UB4 A;  3M53 A;  3AHU A;  3CCJ Q;  5GAN d;  4BY6 C;  4PJM A;  2K5L A;  2A3L A;  2HSE B;  2K5I A;  5LL6 S;  4NL3 A;  3O5Z A;  1A0N B;  1WXU A;  1O9S A;  2CKK A;  2R58 A;  3WVD B;  3JSC A;  4C5E A;  2OTJ T;  5GAM h;  2K6D A;  2FPE A;  2CP5 A;  1UGP B;  1Q7Y R;  3BW1 A;  3SD4 A;  1NPP A;  4PJL A;  1NM7 A;  4M77 F;  1WJR A;  2LNH B;  1VQ8 T;  2YLB A;  3JCM c;  2GNC A;  2DTH A;  3J80 E;  2QTV A;  1EIF A;  1TUD A;  2WAC A;  1Y57 A;  3KXT A;  2QQA A;  1JRI A;  1BCM A;  3QZ5 B;  1K8A R;  1CSK A;  2QXF A;  3SWN A;  4RG2 A;  3L2W A;  4PJO E;  4DBH A;  1NLP C;  1AWJ A;  3A98 A;  3I35 A;  3OYA A;  1WGS A;  4JUV A;  1Q7Y C;  3QO3 A;  2DBK A;  4KGX B;  2RHX A;  3SEM A;  2G6F X;  4Z8A A;  2MMP A;  3MEU A;  3CMA Q;  3O8V A;  5EC7 A;  2QQS A;  4FT2 A;  2KR3 A;  2F69 A;  4M7A D;  1PRL C;  1G3T A;  1BIA A;  1FX7 A;  2FL7 A;  1J3T A;  2M0O A;  3PFS A;  2M9U A;  2QAZ A;  1VQK T;  1NPR A;  4RTW A;  3C0C A;  4J7I A;  1K8A C;  2CP3 A;  1SRL A;  4KUD K;  3RMQ A;  4FYW B;  2QQ9 A;  4M75 B;  4Z88 A;  3PNW C;  2X35 A;  3CCS A;  2QK0 A;  2DXB A;  1YJN T;  2YUP A;  2CGH A;  4WF2 A;  2EGC A;  8ATC B;  2MWP A;  3A8M B;  3CC2 A;  3M54 A;  5AT1 B;  1QP3 A;  3FJP A;  3OA6 A;  4E7S A;  5LJ5 e;  2O31 A;  1XNI A;  5FU7 B;  3CPF A;  4KGV B;  1D1A A;  2AZV A;  4DEY A;  2Y90 A;  2KT1 A;  1X01 A;  2RN8 A;  4L6V 5;  5CCA A;  2DA9 A;  2RPN A;  1NYF A;  3OSS C;  3OYD A;  2FZG B;  1VQO A;  1KSW A;  2JTE A;  5LJ5 h;  4KUL A;  1JEG A;  3ULR B;  4AFZ C;  2HQX A;  3AT1 B;  1HSQ A;  3URG A;  3EGX B;  4RCC A;  4F17 A;  3CCQ Q;  3GF5 A;  2ZZD A;  1Q82 U;  3VS6 A;  3RR6 A;  1JO8 A;  2RO0 A;  4FYV B;  4JZ3 A;  2VKN A;  3OBW A;  3JB9 D;  4M78 F;  1ZA1 B;  1ZSZ C;  3HRS A;  4JJD A;  3H0I A;  2SRC A;  3P8B B;  1KQS P;  3T9N A;  5HY6 A;  3EFO B;  1WHM A;  5CK9 A;  2DTO A;  4N0A C;  1T0J A;  2KDS A;  3CCM A;  2COW A;  2GGR A;  1AHJ B;  1WQ7 A;  5CKE A;  5CO7 A;  1X69 A;  4J9H A;  4BB7 A;  2DL5 A;  2QEX A;  4PJO A;  2VYT A;  4CC7 A;  4E7Z A;  2LQW A;  1MMD A;  5A0L A;  1SSF A;  1UGV A;  1P92 A;  4XU2 A;  2BKD N;  4JRQ A;  2DJQ A;  4PKC C;  2R5A A;  2GCX A;  4ZTF A;  2AKK A;  4HVU A;  2SEM A;  1G3W A;  3UAT A;  5KE2 A;  3QDF A;  3JCM W;  5KYX B;  1D0Z A;  3JAM E;  1WJQ A;  4OMP A;  1FMW A;  1I5L A;  1WA7 A;  3JB9 H;  2PUO B;  5J26 A;  1X2Q A;  4GLM A;  1QKX A;  3M59 A;  4M77 B;  1H64 1;  2O4X A;  3C4S A;  4MML A;  2AT1 B;  3FLG A;  2L0A A;  1U06 A;  5LJ3 g;  1Y71 A;  4HVW A;  1NG2 A;  1Q81 C;  3MEW A;  4E7H A;  3L2R A;  2DPP B;  2R57 A;  3FRN A;  3M4G A;  4ZGD B;  2HQE A;  2EYQ A;  3OS2 A;  1VQL T;  1BIB A;  3FJ5 A;  2DXT A;  1JJ2 A;  4O6J A;  3CC7 Q;  4MZM A;  4FSS A;  1VQM Q;  1G3Y A;  1M90 U;  1H3Z A;  4ZNX A;  1WPY A;  1IRE B;  4M7D E;  2HKQ B;  1TUG B;  1DJ7 B;  2KXD A;  2WSE E;  5IHI A;  1WLP B;  1VQ8 A;  4FYX B;  4J9I A;  4A4H A;  2RNA A;  3VS4 A;  4B9X A;  1NE8 A;  3CPW A;  3TCJ A;  2FPD A;  3CCR T;  4ZTJ A;  3I56 A;  4M7A E;  1VQ5 T;  4PJJ A;  1UGQ B;  2RHI A;  5GAN f;  1B3Q A;  3L2V A;  3BFM A;  4IUR A;  1OOT A;  2X51 A;  1SHG A;  3OYB A;  2OTL A;  1K1Z A;  4LNP A;  3VRZ A;  3REA B;  2DIL A;  3X25 B;  1JB0 E;  3OMG A;  1YJW Q;  1R0B G;  4CC2 A;  3GPL A;  5KYW B;  4BI8 B;  2LMJ A;  5DY9 A;  4LUD A;  4BE0 A;  2F2W A;  3HL8 A;  2KQW A;  3OS0 A;  3M0P A;  3G4S T;  1K76 A;  4KBM B;  1FWZ A;  5GMK i;  1PSE A;  3UDC A;  3PMT A;  1NEG A;  2RK1 A;  5GAN 5;  3OQ5 A;  3CCU A;  4BD3 A;  4JRK A;  5M9O A;  1O75 A;  5GAO q;  2CSI A;  1VQK A;  3MJX A;  2WSF E;  5I21 A;  1VQN A;  2LQK A;  1YIT T;  2KE9 A;  3H6Z A;  4J83 A;  5GMK m;  4JJN K;  1N8R R;  4ME7 A;  1IHV A;  1HXD A;  1QCN A;  2FEI A;  4M78 B;  3SWN C;  2JOY A;  1OZ2 A;  2DEQ A;  1YJN A;  4D8D A;  1UEC A;  5D6W A;  1BU1 A;  1UJ0 A;  3I55 A;  1PD0 A;  4AMC A;  1RAG B;  2DL4 A;  3OYC A;  5I11 A;  1ZQ1 A;  3OMC A;  5I22 A;  2QG9 B;  1Q95 G;  4OB1 B;  3RDV A;  1H8K A;  3G1J A;  1IRX A;  1ZHI A;  3GP8 A;  2HCK A;  2LTO A;  3LYI A;  3CME A;  3CCS Q;  2X4W A;  2XD0 A;  5I2M A;  2A7Y A;  3OYL A;  2VXF A;  4IUT A;  3QBY A;  4IUU A;  3CC2 Q;  2L3Q A;  4M7D A;  3JCM V;  3TSZ A;  1I07 A;  5D6X A;  3TRE A;  5KYU A;  1N8R C;  4E2F B;  1M2O A;  2ZAE A;  3J81 E;  2EQK A;  4M7A G;  1I4K 1;  1R77 A;  3EH2 A;  4GBQ A;  2VAS A;  4E7J A;  1VQP T;  4QVZ A;  1YJ9 Q;  2X4J A;  1YHQ Q;  4E7I A;  1AEY A;  4M7A A;  1PRM C;  2FG0 A;  2KGT A;  3EG9 A;  2DIQ A;  4II1 A;  2DO3 A;  2L89 A;  4WTO B;  3CD6 T;  3QWX X;  4AG1 C;  2DXC A;  4L59 A;  2E12 A;  4BE2 A;  2P0K A;  2DVE A;  5CR2 A;  3M9Q A;  5GMK l;  5DLO A;  4HCB A;  3VUB A;  2FHD A;  3QHS A;  3M56 A;  2QA4 Q;  2E3I A;  2K7A A;  3UA7 A;  3CCM Q;  4XTU A;  1SG5 A;  3THK A;  2DD4 A;  3HHT B;  3X26 B;  5GAM d;  2PU9 B;  4LDY A;  4M7A F;  3MCA B;  4MMK A;  5IHK A;  1Y96 B;  3MEA A;  1VQ7 A;  1AWO A;  1WZO A;  2P0P A;  2ED1 A;  3SDZ A;  2ATC B;  3PVQ A;  2DL8 A;  1M8V A;  1WHH A;  1OQK A;  4X1V A;  3EFR A;  2DMO A;  2GFA A;  1RAA B;  5LJ5 g;  1BI1 A;  2EYZ A;  2FPF A;  3G6E T;  2ZPG B;  3I9Q A;  1BI3 A;  5GAN 3;  4EMK B;  3JB9 G;  5CKB A;  1RLP C;  3QXE B;  5LJ3 e;  2P4T A;  2RQR A;  2F5K A;  3TSW A;  2L8D A;  1OUL A;  2B8A A;  4PJO C;  4IUV A;  3OYM A;  3REB B;  3J7A F;  2EJF A;  1T3S A;  1B34 A;  4P5N A;  1WI7 A;  1VQ6 T;  2PQW A;  5LJ3 h;  4BDZ A;  3MPU B;  1E6H A;  1OEB A;  1ABO A;  3VUZ A;  2NLU A;  1TOV A;  2M02 A;  2BZX A;  3SB2 A;  1W2B A;  2RM4 A;  3EG1 A;  2KRN A;  3OBY A;  2E70 A;  1VYU A;  3JB9 F;  2MOX A;  3NTI A;  3CCR A;  4BY6 B;  1VQ5 A;  4ESR A;  5D6Y A;  4J9C A;  3QJ6 A;  4A4E A;  4BAC A;  2FVU A;  4OB3 B;  1MV0 B;  1X6B A;  1PWT A;  3RKW A;  2PVD B;  2K57 A;  2B86 A;  2IVW A;  1BCO A;  2D8H A;  4RTX A;  1KHI A;  3P8H A;  1X6O A;  1UG1 A;  2RA2 A;  3I56 Q;  1UUE A;  1YP5 A;  2QDY B;  3GLX A;  3G4S A;  3CC4 Q;  3DB4 A;  3LH0 A;  1M1F A;  1KQS A;  1WFW A;  2VVK A;  1D3B B;  4C92 D;  1U5S A;  2ABL A;  4J6X A;  3NTK A;  3OW2 A;  1IXD A;  1QMC A;  5LJ5 d;  2DVJ A;  9ATC B;  1WJS A;  2HAX A;  2YWW A;  4EDU A;  3QJY A;  5CAI A;  2ESW A;  3EGD A;  4IIO A;  2EQU A;  1YIT A;  3I5S A;  1MNE A;  1PCX A;  4A4K A;  2W0Z A;  1E6G A;  2MAM A;  4LD6 A;  3CBO A;  2LJ1 A;  3CCU Q;  1WXB A;  1Q82 R;  1VQ4 Q;  2JVV A;  3QII A;  4LUE A;  1QWF A;  5L8R E;  4IUQ A;  2LT1 A;  2CH4 W;  1OYX A;  2MF2 A;  4FM4 B;  3A8H B;  5IXB A;  3INZ A;  1V29 B;  5CVI A;  4A53 A;  2CUD A;  1ARK A;  1MGQ A;  2E5K A;  3CCL Q;  5KE3 A;  3VJP A;  2WSC E;  1K4U S;  1K9A A;  2RH2 A;  2J7I A;  3GBQ A;  1G3S A;  3OY9 A;  4QKU A;  1HD3 A;  2LNV A;  4RTV A;  1W6X A;  4OML A;  7AT1 B;  3JCM P;  5KH6 A;  3LWH A;  1Q82 C;  3VU3 C;  3QYH B;  3BY7 A;  1UDL A;  1M8M A;  1VQ9 T;  4C8Q D;  4QQG A;  4XU1 A;  1S72 A;  4M7D D;  3G71 A;  4IKF A;  2YRV A;  1NJI U;  3JCM J;  2C0I A;  5GAN 2;  3M57 A;  1KD1 R;  3RES A;  3CD6 A;  2E6Z A;  1M3A A;  3M58 A;  1M1K U;  3CC4 T;  2ZPF B;  3JCM g;  3HRT A;  3P8D A;  2CT4 A;  3DLL A;  3VRY A;  1GRI A;  1ZSZ B;  4F7U E;  2VGM A;  2GTJ A;  1JXM A;  4RTY A;  2L5Q A;  3CCV Q;  2QQR A;  1M2V B;  2YT6 A;  4M7D C;  2W10 A;  2K3B A;  2IG0 A;  5GAM j;  5GAO n;  3MET A;  2BUD A;  3L2Q A;  2F2V A;  1JU5 C;  1M90 R;  1YIJ A;  1K9M R;  2HQH A;  2CZ6 B;  1YN8 A;  4PFO A;  1UTI A;  2Z0W A;  5FWC A;  3JB9 J;  1YFN A;  1D0Y A;  2JW4 A;  3CCJ T;  5HK3 A;  3G6E A;  1NYG A;  2L2P A;  3A8G B;  2HKN A;  1W2B P;  3EG2 A;  4M7A C;  5FU6 C;  1JXO A;  2CUB A;  1WHJ A;  3OYF A;  3ZL7 C;  1WHK A;  2E6N A;  4PK4 A;  4N4I A;  5GAM f;  2A0F B;  1JJ2 S;  3HSB A;  3CCL T;  2CT3 A;  1VQ6 A;  5DM7 R;  3EG3 A;  2LC4 A;  3E1S A;  2HD0 A;  3H9N A;  2JNG A;  2KMT A;  5CQY A;  1H3H A;  4RG8 A;  5KCH A;  2EKO A;  1M90 C;  3NMZ C;  4DBQ A;  4Y92 A;  3H41 A;  1RLQ C;  1K9M C;  2EYX A;  4KH1 B;  4E6R A;  3UPU A;  3CPW S;  4HXJ A;  4KGZ B;  4C92 E;  4Q5W A;  4M75 D;  4XTX A;  4IIM A;  1YI2 Q;  4PJO G;  4RTT A;  3OW2 P;  2DXU A;  4R56 A;  4JPB W;  1UHC A;  2ENM A;  3VV0 A;  2BE9 B;  3CCE A;  4DOV A;  1RUW A;  2NUT A;  2XK0 A;  1K0X A;  5FRM A;  2E41 A;  4J9B A;  1B07 A;  2JTM A;  3RKY A;  3CMA T;  4HVV A;  4FL6 A;  3VS7 A;  4PLL A;  5A0D A;  1RAF B;  1AVZ C;  3JV3 A;  1YNZ A;  2GF7 A;  2K4Y A;  4LDX A;  2K2V A;  1AZE A;  1MMN A;  1YCS B;  3GIB A;  4F7U G;  1HK9 A;  2KRM A;  4PJN A;  3RKX A;  3WXM B;  1VIF A;  4Y91 A;  1VOM A;  4F7U A;  1W1F A;  3MP6 A;  1KD1 U;  3OYH A;  1TU0 B;  1X6G A;  2DAQ A;  4PJO F;  2JJ9 A;  2CZ1 B;  3LLR A;  2AHJ B;  2MI6 A;  1OU8 A;  2K3X A;  4FU6 A;  2MK5 A;  4FW2 A;  2RI3 A;  4A4F A;  3RUX A;  3OSV A;  3V7S A;  4CC3 A;  2JMA A;  2KEA A;  2KK4 A;  1FXX A;  3ZEH A;  1RAI B;  1MMG A;  1XOV A;  1M5Q 1;  2XI9 A;  2XDD A;  5GAN j;  4F7U F;  2H3J A;  2LX7 A;  5EG2 A;  4J7F A;  2KXC A;  2DFU A;  2OTJ A;  5C6S A;  4C8Q E;  1K9M U;  4PL6 A;  1YCY A;  3CCQ T;  4OVA A;  2BZ8 A;  1QP2 A;  2XMF A;  2D6F A;  2JZ2 A;  2L3R A;  1AD5 A;  1BI2 A;  2KSS A;  3QPH A;  3SWN B;  2HNI A;  3EFS A;  1PM3 A;  1UGS B;  2CSQ A;  4CRI A;  1NBE B;  2HEQ A;  2EJG A;  1MMA A;  5FRO A;  2NUP A;  4M4Z A;  1VYT A;  4ZGJ B;  1YI2 T;  1GBR A;  1IO6 A;  4C92 G;  4EIK A;  4RMO A;  4MDX A;  4XAX B;  2ZPE B;  2F5T X;  2HBW A;  3WVE B;  4C92 A;  1VQ9 A;  1OX8 A;  4KRT A;  2DKG A;  1V1C A;  1QQJ A;  2M1H A;  4QQD A;  4GY5 A;  1AZG B;  2D0Q B;  4C0G A;  4MZT A;  1EX4 A;  2C06 A;  2XHC A; 
#chains in the Genus database with same CATH homology
 4E7L A;  3JSC A;  4C5E A;  3JCM e;  2GFA A;  2OTJ T;  3GNG A;  5GAM h;  5LJ5 g;  1BI1 A;  4XTY A;  1UGP B;  3G6E T;  2ZPG B;  3CXC A;  3BW1 A;  1VUB A;  2JN0 A;  1KC8 U;  1BI3 A;  4L5G A;  5GAN 3;  4C92 F;  4ATO A;  4EMK B;  2E64 A;  5LJ3 d;  3SD4 A;  3JB9 G;  5CKB A;  1N6A A;  3QXE B;  1NPP A;  5GAN h;  5LJ3 e;  2EAY A;  2P4T A;  3PIO A;  1Q7Y U;  4M77 F;  1WJR A;  2F5K A;  1VQ8 T;  2L8D A;  2YLB A;  2QTX A;  4LDV A;  2QA4 A;  2B8A A;  3JCM h;  3JCM c;  1O9S A;  4PJO C;  4IUV A;  3OYM A;  2DTH A;  3QUI A;  2EJF A;  2E1H A;  1B34 A;  5GAO m;  1EIF A;  3J80 E;  3J7A F;  2WAC A;  3CCV T;  4M75 C;  3KXT A;  1QW1 A;  3CBP A;  2EQM A;  1JRI A;  2P0Q A;  2QQA A;  3G7Z A;  4P5N A;  3QZ5 B;  1VQ6 T;  2E10 A;  2PQW A;  5LJ3 h;  1QVP A;  5GAN 8;  2QXF A;  2VUB A;  3SWN A;  2E65 A;  4RG2 A;  4YTL A;  4BDZ A;  4GLK A;  4RCB A;  3L2W A;  5IN1 A;  3DLM A;  3VUZ A;  3CXC S;  2NLU A;  4EMH A;  2RI5 A;  4X9C A;  4XTW A;  4ELY C;  2FB7 A;  3CC7 T;  4XU3 A;  1VQM T;  3ASK A;  1K8A U;  4N4G A;  1XTD A;  4BI4 A;  4BUG A;  2CZ0 B;  4PJO E;  3FIF A;  3V7R A;  5LJ5 j;  3SB2 A;  1W2B A;  2RM4 A;  4M75 E;  5FU7 C;  4JRI A;  3OYA A;  3BDU A;  5FRM A;  3L2U A;  3OBY A;  5HK0 A;  1KC8 C;  1WGS A;  2E70 A;  4QVC A;  3VYG A;  4JUV A;  3L42 A;  2Y4X A;  3JB9 F;  2FYK A;  3NTI A;  4C8Q G;  1VQ7 T;  4OB0 B;  2PUK B;  1Q7Y C;  3OYG A;  2EIF A;  3QO3 A;  4M7D G;  3CCR A;  4BY6 B;  5GMK j;  3QKJ A;  1VQ5 A;  2XDB A;  3PIP A;  2X4Y A;  2RHX A;  5CQX A;  5D6Y A;  4A4E A;  3QJ6 A;  4BAC A;  2FVU A;  2MMP A;  4OB3 B;  2CZ7 B;  4C8Q A;  3MEU A;  3O8V A;  3RKW A;  2PVD B;  2K57 A;  5GAO r;  2IVW A;  5C0M A;  2QQS A;  1Y96 A;  4FT2 A;  3SFM A;  2F69 A;  5AYF A;  1WQW A;  3V8K A;  2LT4 A;  3CEY A;  4M7A D;  3HKS A;  1G3T A;  4DQ2 A;  1YBY A;  2DK3 A;  1KG1 A;  1M9S A;  1BIA A;  1FX7 A;  2FL7 A;  2LDM A;  1KHI A;  2M0O A;  2M9U A;  3P8H A;  3PFS A;  1VQK T;  4KT0 E;  3S6W A;  1NPR A;  2VGN A;  1X6O A;  5LJ5 f;  1K8A C;  4J7I A;  3H8Z A;  2RA2 A;  4PJO B;  4QVD A;  2QDY B;  3GLX A;  3FC3 A;  4KUD K;  3RMQ A;  3X20 B;  2LCL A;  3G4S A;  2QQ9 A;  4M75 B;  4JS4 A;  1YJW T;  3PNW C;  3DB4 A;  2LQ8 A;  1M1F A;  3LH0 A;  4FT4 A;  4M78 D;  1PSF A;  4NOY A;  4XQ3 A;  2X35 A;  1XQH A;  4EMK A;  3CCS A;  4E7K A;  1KQS A;  2DXB A;  1YJN T;  4C8Q F;  5FRN A;  1D3B B;  2CGH A;  4WF2 A;  4C92 D;  4M7D F;  4J6X A;  4J6Y A;  3CBM A;  2MWP A;  3A8M B;  3CC2 A;  3NTK A;  1M4Z A;  3M54 A;  4M77 D;  3OW2 A;  1QP3 A;  3FJP A;  3OA6 A;  5LJ5 d;  2RHU A;  3OS5 A;  5LJ5 e;  1WJS A;  5CKF A;  5GAO l;  2HAX A;  4EDU A;  3R6O A;  3QJY A;  3ZBD A;  1XNI A;  3M55 A;  2RD1 A;  1MHN A;  5FU7 B;  5CAI A;  1YIT A;  2EQU A;  3CPF A;  1QVF A;  5GAO p;  3Q1J A;  3C12 A;  4DA4 A;  2XKO C;  2Y90 A;  4A4K A;  2O4X B;  1X01 A;  4OGC A;  3S3M A;  4L6V 5;  2HBP A;  4PLI A;  5CCA A;  2MAM A;  2JTF A;  4LD6 A;  4OF1 A;  5GMK e;  3CBO A;  1KQS S;  3V7C A;  3OSS C;  1RI0 A;  3OYD A;  5KCO A;  1VQO A;  5LJ5 h;  2RK2 A;  2DTI A;  4KUL A;  3JRZ A;  1U1T A;  4ELZ C;  3DB3 A;  1UEB A;  3C94 A;  4HT9 A;  2XIC A;  2HQX A;  1R8O B;  3CC4 A;  2JVV A;  3URG A;  4RCC A;  3QII A;  3GF5 A;  2ZZD A;  4M77 C;  5L8R E;  3MP8 A;  1Q82 U;  2MWO A;  3VKI A;  4IUQ A;  2RO0 A;  2V8I A;  4BDY A;  2LT1 A;  5GMK h;  3OBW A;  1OYX A;  2MF2 A;  4M78 F;  3JB9 D;  1NZ9 A;  4FM4 B;  1QVG A;  1QVF S;  3LWI A;  3A8H B;  3JCM X;  3HRS A;  5J3B A;  3INZ A;  1V29 B;  3P8B B;  5CVI A;  4A53 A;  3T9N A;  3HP9 A;  5HY6 A;  3JCM b;  3X28 B;  2XDP A;  3MEV A;  1MGQ A;  5CK9 A;  2DTO A;  3L1A A;  4N0A C;  5KE3 A;  1VQL A;  4M77 E;  3VJP A;  2KDS A;  3CCM A;  4C0D C;  2RI2 A;  2RJD A;  2M16 A;  2WSC E;  3CCS T;  4QQ6 A;  1I81 A;  1AHJ B;  5DLQ E;  1WQ7 A;  2RH2 A;  4FSX A;  5CKE A;  2RJC A;  4M75 G;  5CO7 A;  2V8K A;  5CKH A;  4BB7 A;  5GAN 6;  2QEX A;  4PJO A;  1VQ4 A;  1JBM A;  1G3S A;  2VYT A;  3CCJ A;  3OY9 A;  3CC2 T;  2LNV A;  1LOJ A;  2ZPH B;  4IUP A;  4M75 A;  1QVG S;  3JCM P;  3FDR A;  3FEO A;  5A0L A;  5KH6 A;  1SSF A;  3LWH A;  1P92 A;  1Q81 U;  4XU2 A;  2BKD N;  3CCQ A;  4JRQ A;  1BYM A;  3QYG B;  3VU3 C;  1Q82 C;  1TH7 A;  3QYH B;  4PKC C;  3BY7 A;  2PVO B;  3ER0 A;  2R5A A;  1D3B A;  2GCX A;  4ZTF A;  5GAM g;  5GAN 4;  1W4S A;  1VQ9 T;  1G3W A;  3KBG A;  5KE2 A;  2I2L A;  3JCM W;  2LX9 A;  4C8Q D;  3JAM E;  2VXE A;  1WJQ A;  4QQG A;  4XU1 A;  5A0G A;  3G71 A;  1S72 A;  1OI1 A;  2YRV A;  4IKF A;  4M7D D;  1NJI U;  3LGL A;  3JCM J;  5GAN 2;  1I5L A;  3M57 A;  3JB9 H;  3A5Z B;  1VQO T;  3RES A;  5GAN g;  3CD6 A;  2PUO B;  2E6Z A;  5J26 A;  1YJ9 T;  4D6W A;  2EJ9 A;  2K5F A;  2QI2 A;  1YHQ T;  3CCL A;  3M58 A;  4JDS A;  3CC4 T;  1M1K U;  2ZPF B;  2RHY A;  3M59 A;  3JCM g;  5GAN 7;  3TU4 K;  4M77 B;  4LD9 K;  3VYH B;  1H64 1;  2O4X A;  3C4S A;  4MML A;  3HRT A;  3P8D A;  2XG8 D;  3LW5 E;  2Y4Y A;  3DLL A;  4M75 F;  3V8J A;  3FLG A;  1M1G A;  4J5Y A;  4NL2 A;  4EMG A;  1Y71 A;  5LJ3 g;  1KHC A;  4OP0 A;  4XU0 A;  2VGM A;  4F7U E;  1W2B S;  1Q81 C;  2EQJ A;  3MEW A;  4E7H A;  3EAE A;  3L2R A;  3RMS A;  2L5Q A;  2R57 A;  2DPP B;  2QQR A;  3FRN A;  3M4G A;  4ZGD B;  2HQE A;  4M7D C;  2EYQ A;  1OZ3 A;  2IG0 A;  4B9W A;  5GAM j;  4C0D B;  5GAO n;  3OS2 A;  1VQL T;  2QA4 T;  1N27 A;  1BIB A;  3DKM A;  3MET A;  4PNO A;  3OYI A;  3CCM T;  2BUD A;  3L2Q A;  4DOW A;  4J6W A;  1YIJ A;  2OAU A;  2DXT A;  4NS5 A;  1JJ2 A;  4O6J A;  1NJI C;  2CZ6 B;  2KVQ G;  3JB9 J;  2GQV A;  4MZM A;  4HKE A;  5IAY A;  1G3Y A;  2CYZ B;  1M90 U;  3TEE A;  3PTA A;  3CCJ T;  4ZN3 A;  5HK3 A;  5CIU A;  1M1K C;  1H3Z A;  3G6E A;  1WPY A;  3HPW A;  1IRE B;  4M7D E;  4O5V A;  4XTZ A;  3UWN A;  3A8G B;  2O01 E;  4EPC A;  1DJ7 B;  1IZ6 A;  3QSU A;  4M7A C;  2VV5 A;  5FU6 C;  2WSE E;  3CMA A;  4J8O A;  2YLC A;  3OYF A;  3NFC A;  3FB9 A;  3M5A A;  1VQ8 A;  4HA8 A;  3C95 A;  4A4H A;  1WNL A;  1S72 T;  3G71 T;  4HT8 A;  2E6N A;  4F7U B;  4B9X A;  1NE8 A;  4A54 A;  1I8F A;  3CPW A;  3TCJ A;  3PGG A;  4N4I A;  5GAM f;  3CCV A;  1KQ2 A;  1JJ2 S;  3HSB A;  4M78 C;  3HFO A;  1VIE A;  3CCL T;  3CCR T;  4ZTJ A;  3I56 A;  2LCC A;  2BIV A;  4KUI A;  2LRQ A;  5DM7 R;  1VQ5 T;  1VQ6 A;  4M7A E;  2LC4 A;  1UGQ B;  2RHI A;  3E1S A;  2K3Y A;  2HD0 A;  4OGE A;  4C92 C;  2JNG A;  5GAN f;  2KMT A;  3PT9 A;  1U1S A;  4FIB A;  2G3R A;  4V2S A;  3L2V A;  3BFM A;  5CQY A;  3OW2 S;  3CC7 A;  2RB6 A;  4MZP A;  4IUR A;  3OYJ A;  4RG8 A;  1LJO A;  1VQM A;  5KCH A;  2EKO A;  3JCM f;  3OYB A;  1M90 C;  2OTL A;  1K9M C;  2RJE A;  3X25 B;  1JB0 E;  4E47 A;  3OMG A;  4M77 A;  3M4Y A;  2GFU A;  4M7D B;  1LNX A;  4M78 E;  5GAM e;  2ZPI B;  3GPL A;  3UPU A;  4BI8 B;  5LJ3 f;  3CPW S;  2RHZ A;  4PJO D;  5DY9 A;  4C92 E;  4Q5W A;  2EFI A;  4RKU E;  5HKC A;  4C5H A;  4BE0 A;  3HL8 A;  2KQW A;  3OS0 A;  2KAF A;  3G4S T;  4M75 D;  3A8L B;  3E9G A;  4KBM B;  4XTX A;  3S3N A;  1FWZ A;  5GMK i;  1YIJ T;  3E9F A;  1PSE A;  3UDC A;  4PJO G;  2DXU A;  3MHX A;  3PMT A;  4BI3 A;  3BDL A;  4R56 A;  2RK1 A;  5GAN 5;  3VV0 A;  3CCE A;  4N0A A;  2XU8 A;  3OQ5 A;  3RIR A;  4DOV A;  4BD3 A;  3CCU A;  3OB9 A;  2XK0 A;  3E19 A;  4C5I A;  3ME9 A;  4JRK A;  4M7A B;  5FU6 B;  2E41 A;  4OMF B;  1O75 A;  3HRU A;  2JTM A;  5M9O A;  5GAO q;  4A4G A;  3OS1 A;  4MDW A;  2CS7 A;  3RKY A;  3CMA T;  1VQK A;  2X4X A;  2WSF E;  2DZC A;  4FL6 A;  5I21 A;  1VQN A;  3QDR B;  4PLL A;  5A0D A;  2DZ9 A;  2LQK A;  3QZ9 B;  5J39 A;  3V8L A;  1VQP A;  1YIT T;  2XID A;  2LVM A;  3H6Z A;  4J83 A;  5GMK m;  4JJN K;  2GF7 A;  2K4Y A;  4CI0 C;  4ME7 A;  2DIG A;  1YJW A;  1HXD A;  1UGR B;  3OYK A;  4LDX A;  2K2V A;  3SWN C;  4M78 B;  2JOY A;  1OZ2 A;  2DEQ A;  2KY9 A;  4TVR A;  5FLX E;  5IT9 E;  1YJN A;  3GIB A;  2RJF A;  4F7U G;  1N8R U;  3MP1 A;  1HK9 A;  4Y28 E;  3I56 T;  1RL2 A;  3RKX A;  4C92 B;  4XTV A;  4QW2 A;  3WXM B;  5D6W A;  1VIF A;  4Y91 A;  1N9S A;  4F7U A;  1YI2 A;  3MP6 A;  3I55 A;  3OYH A;  1KD1 U;  4HCZ A;  2DAQ A;  3PMI A;  4PJO F;  2CZ1 B;  3LLR A;  2AHJ B;  3A8O B;  2MI6 A;  2OTL T;  4JLG A;  3LGF A;  3OYC A;  2K3X A;  3KUF A;  1ZQ1 A;  3OMC A;  1Y7X A;  4OB1 B;  4FU6 A;  1ZHI A;  2VC8 A;  4C5G A;  3GP8 A;  2RI3 A;  4A4F A;  3LYI A;  2LTO A;  3RUX A;  3CME A;  3OSV A;  2X4W A;  2ZGW A;  2XD0 A;  3N5B B;  5I2M A;  4C8Q C;  2A7Y A;  3OYL A;  2VXF A;  3V7S A;  4C0F A;  4IUT A;  2KK4 A;  1FXX A;  3UT1 A;  3QBY A;  3ZEH A;  3MO8 A;  4IUU A;  3JB9 I;  4OB2 B;  1Q86 U;  4M7D A;  3JCM V;  1XOV A;  1K73 U;  4X9D A;  5D6X A;  3TRE A;  3CCE T;  1M5Q 1;  2XI9 A;  2XDD A;  3CCU T;  2DD5 A;  1X75 C;  4F7U F;  5GAN j;  2H3J A;  2QQB A;  5EG2 A;  1N8R C;  4J7F A;  2QEX T;  1VQ4 T;  3QG1 A;  2OTJ A;  5CKD A;  1BI0 A;  2DJZ A;  5C6S A;  3JCM Q;  4Z02 A;  4C8Q E;  1K9M U;  3J81 E;  4PL6 A;  1KD1 C;  1B34 B;  1YCY A;  2JUF A;  3ZFJ A;  1ZBX A;  2EQK A;  3CCQ T;  4M7A G;  1BKB A;  4ZGE B;  4OVA A;  1I4K 1;  1VQN T;  4E7J A;  1VQP T;  1QP2 A;  4QVZ A;  4EMK C;  2D6F A;  2JZ2 A;  2L3R A;  2X4J A;  3GNF B;  1BI2 A;  2KSS A;  3QPH A;  4E7I A;  3SWN B;  5LJ3 j;  4M7A A;  2HNI A;  3EFS A;  5I2S A;  4C0Z A;  1UGS B;  4CRI A;  2DIQ A;  4II1 A;  2DO3 A;  2L89 A;  5A2Q E;  3OYN A;  4VUB A;  2EJG A;  3L2Z A;  4JS5 A;  3OYY A;  2ZCF B;  3CD6 T;  5FRO A;  3X24 B;  4M78 G;  2DXC A;  4L59 A;  2E12 A;  4LDU A;  4BE2 A;  4ZGJ B;  1Q86 C;  3LX7 A;  2P0K A;  2DVE A;  2R5M A;  1YI2 T;  5CR2 A;  1KQ1 A;  3M9Q A;  3I55 T;  2V8J A;  5GMK l;  1K73 C;  4C92 G;  4X34 A;  5DLO A;  4M78 A;  4HCB A;  3NTH A;  2D9T A;  4RMO A;  3VUB A;  4MDX A;  4XAX B;  2FHD A;  2ZPE B;  4BE1 A;  2F5T X;  4M77 G;  3QHS A;  3GOX A;  2ZPB B;  1G5V A;  3M56 A;  3WVE B;  2E5Q A;  4JLI A;  4C92 A;  4HCC A;  3HFN A;  4LDW A;  1VQ9 A;  1N9R A;  2EWN A;  4XTU A;  1Y07 A;  2DKG A;  3CME T;  2DD4 A;  3HHT B;  4C8Q B;  3F70 A;  4UC4 A;  1GXI E;  3X26 B;  5GAM d;  2PU9 B;  3OYE A;  2M1H A;  3S3O A;  4LDY A;  4N4H A;  4QQD A;  4M7A F;  3MCA B;  4MMK A;  4GY5 A;  4R55 A;  1U8R A;  4JRP A;  2D0Q B;  1UB4 A;  1Y96 B;  3MEA A;  4C0G A;  4ZN1 A;  3M53 A;  1YJ9 A;  1VQ7 A;  3AHU A;  1YHQ A;  4MZT A;  2P0P A;  2YHT A;  2C06 A;  5GAN d;  3RER A;  2XHC A;  3SDZ A;  4BY6 C;  5GAN e;  2K5L A;  2A3L A;  1M8V A;  4NL3 A;  2K5I A;  5LL6 S;  2PVG B;  3JCM d;  2CKK A;  3WVD B;  2R58 A;  3EFR A;  4XK8 E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...