1I5XA

Hiv-1 gp41 core
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
61
structure length
61
Chain Sequence
IVQQQNNLLRAIEAQQHLLQLTVWGIKQLQAASGGRGGWMEWDREINNYTSLIHSLIEESQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural and functional analysis of interhelical interactions in the human immunodeficiency virus type 1 gp41 envelope glycoprotein by alanine-scanning mutagenesis.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Viral protein
molecule keywords TRANSMEMBRANE GLYCOPROTEIN (GP41)
total genus 27
structure length 61
sequence length 61
ec nomenclature
pdb deposition date 2001-03-01
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.210 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 1i5xA00
1K34A 3CP1A 4JF3A 5KA6A 2M7WA 1F23A 1I5XA 3GWOA 1EBOA 3CYOA 4N23A 2X7RB 5KA5A 1DLBA 2P6JA 1I5YA 5CMUA 3B8MA 4FK5C 5HFMA 4JPRA 1DF4A 2EBOA 1DF5A 1QCEA 1MOFA 2EZOA 5H9CA 3B77A 1JQ0A 2MK3A 3B8NA 5CN0A 4FIPC 1QR8A 5HFLA 4E2LA 3M99B 4JGSA 1Y66A 1Y4MA 3MHHC 1QBZA 2EZPA 2LP7A 1MG1A 4G2KA 3MHSC 1JPXA 2OT5A 1QR9A 3H01A 1K33A 1SZTA 4FJCC 3K9AA 4N21A 3P30A 3WFVA 1ENVA
chains in the Genus database with same CATH superfamily
2BTQB 5DECA 4G28B 3UT5A 2PTMA 4DR2O 4NB5A 1KECA 2W6JG 2EILC 5FNVA 2F4VO 4MW3A 2JGDA 3APQA 4LF8O 2M6YA 5IE9A 5IJ9B 4N21A 4TUYB 4LF6O 4LF4O 4DYLA 1R3IC 4DR5B 4LF6B 1K73W 4HYOA 3TETA 3IC7A 2VQFB 1I5YA 1PL0A 3DXRA 4J7KA 4PA3A 5J2UB 4JTDB 4MTGA 3TK1A 5EZYB 2XNDG 3ICXA 1EN5A 1BZKA 2HJFC 1Y67A 5B1AB 2P7TC 1FJGO 1VQ6V 4HAMA 1XNQO 4KHPO 4FFBA 4DW1A 2YI8A 1LUWA 4I55B 1EN4A 3WU2Z 3AG7A 1Q86W 4ICGA 2WAMA 4Z1VA 4J11A 4IGGA 3A0RA 5LA6B 2AHYA 4NKGB 4K8XA 4DR6O 4DUZB 1HNZO 3ABKC 4B3SO 1PNMA 4PI2A 1GK9A 1VQMV 4DO2A 1ORQC 4UCRA 3CMEV 2P4VA 4ZOLB 3ZHUA 2NN4A 5CBFA 1TUBA 4JAVA 2EINC 4C7UA 1OCCB 4ABMA 4I0XA 4K8ZA 1LUVA 3EFFK 3CC7V 3FAVB 2IBZH 4O4HB 4DR4O 1W0KG 3OM3B 1KUQA 4X89A 4JYCA 3RYHA 1FD9A 1MSDA 4KUMA 1RSOA 4EEQA 5LA6A 4PA4A 3B8MA 3C3TA 2ZM6B 1WPXA 1XNRO 1IXMA 1N4CA 3ZHVA 3B8NA 4JAAA 4U7NA 5LMUB 1PM9A 4GKKB 3RYIB 3OE7G 2OTJV 5GW7A 1YJ9V 2B1IA 2HP8A 2A9HA 1GN6A 2X7RB 4O4IB 3CCMV 1XHZA 2YICA 1KD1W 2QGNA 1JVMA 4JYYA 2P4KA 1M57B 2EIJC 4UXNA 2UUBO 4WFHA 4DRXA 4JI1O 5H2FZ 1L0NH 4YY3O 3HKCA 4X65B 1BHAA 4X64B 2Q67A 1HNWO 2QWRB 4X62O 2DWEC 2EIJB 2UXDO 1FFTB 4FZ1A 4JI4O 5B1BC 1Z5WA 4LFAO 1VF5B 1WA8B 1VMGA 2QM4A 1X59A 3G67A 5F2VO 2XAJA 2GTSA 4IIJA 3HKEA 1AR4A 2B1GA 3UKMA 2RCVA 5LP6B 5EC2C 4WBNA 4DR5O 1Q7YW 4RQEA 3GVMA 2W0XA 1XL6A 2JVDA 1ZL8A 1R3KC 3C90A 3TXSA 3OR6C 1THZA 3UO2A 3OGIB 4LFBO 1FS0G 3MAQA 1US6A 5LOVA 1QVFU 3ETEA 1XREA 1VQOV 1VQ7V 3STLC 1Q5OA 2F1MA 4NXNO 2YIAA 1YVWA 4TQFA 1GTOA 1OCZB 2ZINA 4MVQA 1P7GA 3F7YC 1MSWD 4H37A 4EB6B 5L3BA 3JARB 4JI1B 3B09A 5KMGA 2QWPB 1KP3A 4GLXA 1HNXB 2LW7A 5JQGB 1PKXA 4I9WA 2Y69C 2CH7A 2DN9A 3AEIA 1SQPH 3ABKB 4I4TA 4IYHA 3K0DA 4FFBB 3ZMUA 5J2UA 1GN4A 1MZEA 3SYAA 1H2GA 1N0JA 4LF9B 3KCXA 2NLJC 3G6EV 4B3TO 4LR3A 3LSSA 1S77D 1WAZA 4DR7O 3LNMB 2CTWA 1DLBA 1O9GA 2GBOA 4DR7B 3SJAC 3K57A 5KHJA 4JI6B 4CH5A 1PL4A 3E86A 3S3WA 1R73A 1VARA 3K04A 1NH2D 3BHPA 1ENVA 1Y74A 5K1XA 3A2FA 3CP1A 3ZBHA 4ZBMA 4BIUA 1AP6A 3CYOA 1A32A 3QO8A 2DQ0A 2WPDG 2ZIOA 3L73H 2XAQA 3BVOA 3K0GA 5C8YA 5JJJB 5L3CA 4H0LB 3SYOA 4G27B 5JQGA 3X2QC 3CRMA 1N32O 1SESA 4ZOLA 4H33A 1SS3A 3T4DA 4CBCA 3K59A 2YEVA 2EILB 3D36A 5J2TB 2XTAA 3RYCB 2PF4E 1TVKB 4K35A 4DV5B 1R3JC 3CPWU 5HFMA 1W59A 1Y76A 1RSOB 4LF5B 1K5QA 5CN0A 1XQ8A 3U0ZA 3OUFA 5BMVA 3D36C 4X1YB 3UCSC 1XOUA 3R66A 3ZS8C 2YXLA 1H2MA 3CMAV 2IJIA 2WWWA 4WFAV 4U3JA 2Y4TA 1BT8A 3CRQA 4RAIA 5KA5A 1BL8A 1GH6A 4NXNB 2BSKB 1K92A 1R1BA 3F5WC 3Q4HA 4NTYA 5LP6C 1EZVH 1GKFA 1I0HA 2RJZA 5B5EZ 2Y48A 2F93B 1E79G 4YIPA 4H44B 3J80N 3BEHA 2AXTZ 2OTLV 5D5QA 4TV9A 2PI4A 1FXVA 1MNGA 2ZQMA 3DC5A 4I50B 1SQXH 4GKKO 3JAKA 2CDYA 3LDEA 2GHYA 1NVPB 5LHHA 3OD4A 4JZGA 3OT7A 5CB4B 4B7EA 3K5NA 1VQLV 2IJJA 2KQXA 1AJQA 3W7TA 1GM7A 5FPRA 1WB7A 2CGNA 3AG3C 4MVZA 3T1CA 2PI5A 3D8CA 3ZRWA 4K0KB 4JI7B 1GM8A 2XT9A 3JYCA 3CSXA 4FFKA 2OIEA 3JSLA 1CXZB 1HWYA 1O9HA 4XDKA 2DMXA 1PNLA 2DW4A 1XDCA 4YIOA 2ZT9B 2LW1A 1JX9A 1NKDA 2FL4A 5GONB 4O2AA 5FL7G 4PV1B 1T5EA 4O2BA 4MVSA 4PDLA 3ZRVA 1NH2B 4ZHQB 3RYFA 2ZE5A 1ZTEA 1SZXA 5KHIA 4CC6A 2VS0A 2W6IG 4IT5A 4B3TB 4LCUC 3THOA 1KU9A 2E76B 1KBHA 3N27A 2WLLA 4OXSA 4K0KO 2VRZA 1HNXO 2K1EA 3J81N 4X66B 4JPRA 1D5NA 2F95B 5AG2A 3K08A 5CA3A 3B40A 4IHJB 3A0BZ 1M90W 2ZXWB 1LNQA 1AJPA 3T1HB 4P9OA 2WLMA 3BY6A 1NI8A 1FXKC 4LF4B 3JD2A 2QA4V 5EZYA 4QE7A 1S5LZ 2Z0AA 3CWBH 4B3MO 4PJ0Z 3SR2C 5FNVB 4LWSB 3ABUA 3RYFB 3T4ZA 1B06A 1XMQB 1QLEB 1WN7A 3HKCB 2WLIA 2LGQA 3GB7C 2ZNJA 3CJHB 4UVAA 4JF3A 2M7WA 1JA8A 4I55A 1XBLA 3UO3A 5LMNO 5K1PA 2EIKB 1EM1A 2UXXA 2Q0OC 1Y76B 2PYJA 1U97A 3RW0A 4GT1A 2ZE6A 1JPXA 2ADPA 1FYJA 1WLEA 4GX2A 1H2NA 4MTXA 2CGOA 4TSFG 5JJNB 4AQYB 3TJTA 5KUKA 2WLKA 2JS5A 4WFBV 3T1YO 4LF5O 3CCEV 3LUTB 1G6UA 4YHHO 3OEEG 2QM8A 3RVZA 3N2KB 1HNWB 2F23A 2UXCB 1IXBA 4NTWA 1J95A 2P06A 4XBFA 4EFEA 3OTOB 4DV1O 2LJ2A 5BY1A 2F43G 1VIBA 5CA1B 3ABLC 2BOCC 3SYQA 1I5XA 3A0HZ 1JJ2U 1PD3A 3L70H 4RUFA 2QSAA 1M56C 4ZI7B 1DF5A 4HBNA 1RM1B 3ZHTA 4DV5O 3KKYA 4UB6Z 1Y66A 3E8GA 4X1IB 1BCCH 3W7SA 4FLUA 1P4RA 1PPJH 5IY5B 1PNKA 1F4MA 2IU3A 3H1LH 3PJSK 2P5OA 5JWPA 1KKCA 1GRJA 3BRCA 2NR5A 2Q7GA 1XMOO 4NVPA 3OW2U 3B77A 4PDRA 4UCOA 4TV9B 4WCEV 1SETA 2PGGA 4LF9O 4DR4B 4CH3A 1F51A 3L74H 2QTSA 2Q7HA 1QNMA 2X6CA 3CRCA 5EK0A 1M57C 1V9PA 2R9AA 4O4IA 3VQXA 4X1KB 2IH3C 2OT5A 1FXHA 1NU1H 1YDXA 2QDOA 1YF2A 3HB3B 3OTOO 5DN6G 2ILMA 4DK0A 3E8BA 3GWKC 2EINB 4UVCA 3ZEDA 4DR1B 3B2EE 4UCUA 4IYIA 1OV9A 4X8AA 1WNSA 3BA8A 4D6TH 2YS8A 5BMVB 1CPYA 2PUSA 1L8DA 3HKEB 4FLXA 1Q81W 4I0XB 1WP8A 4O4HA 1VEWA 1Q3EA 1B3QA 3WB1A 4QPKA 2DOSA 4WBNB 2P90A 2QJ1A 2OCCC 3OAAG 5LXTB 3FB6C 4R6ZA 2WA4A 4X1KA 1R6KA 3U11A 1VQPV 1YITV 4DXWA 1JFFB 2ZCEA 2EULA 4I4TB 3CCVV 1AVMA 3JSNA 4X9QA 2ETNA 1FFXA 1ZX3A 2CE4A 4JI3O 3Q4HB 2IH1C 1Z2GA 2VQFO 1YJWV 3L9DA 3TGUH 5CBGA 2Q8VA 1F4NA 1QBZA 2YIBA 4G2KA 1N33B 5FPOA 2XOKG 4TQDA 1NTMH 4MVUA 4EB6A 3K5OA 1L1FA 3OMIB 1D5AA 2LO1A 2HVJC 1AI6A 1SERA 3JATB 3CJHA 3OMNB 2UUCO 2R70A 4BIOA 2PZSA 4JYAB 1S0VA 4DV6B 5LXTA 1UJWB 1QU7A 3ZHSA 5IWAO 3ETGA 5B3SC 3N2KA 4QNHB 5JH7A 4TT3G 1HR0B 3APOA 3IFXA 3H1HH 1Q6HA 4HNAA 2R9RB 5ITZB 1NT2B 5CA0B 4IIJB 1Y6XA 2DJVA 4FM0A 1DF4A 2Y69B 3AG3B 5JJEB 3ZRWB 4DUZO 3WG7C 1GN2A 1ZLZA 2JJ2G 3F5TA 4LFCB 4PELA 3W7WA 3CCUV 2WA3A 4ZI7A 5LGTA 3AK3A 2ODMA 1N32B 3AG2C 4UV9A 3OGCC 2D3OW 2YIDA 4JI2O 4AI8A 1K4CC 2DYSC 3IAYA 3EXAA 2ITCC 3JATA 4ASUG 1CEZA 1FAFA 4X88A 2AHZA 1FXKA 3G4SV 1OCRC 3CE2A 4LFCO 4X1IA 3CHXA 5EIBC 4UUJC 1YHQV 3RYCA 4ZKIA 1MZFA 2QEXV 2QWOB 2O57A 5KHGA 5KLVH 1IVSA 2EBOA 3FX7A 2BE3A 4JYBA 2Q0AA 5HFLA 1MMMA 3JCZA 4BR6A 2B5UA 4MT8A 3ZRSA 1FJGB 4KHPB 3T2MA 1NVPD 1AI7A 4MVRA 4I50A 2YDEA 5JCOC 5B1OA 1SQFA 3AG4B 4J9YB 3CEIA 2FMLA 4DUYO 1FXKB 1YCIA 1YIJV 2HG5C 2VWJA 4JV5B 1HDJA 4WFGA 1EN6A 4LC1A 3JARA 2ARHA 1VQ8V 2Q73A 2QWQB 1VP7A 1YXBA 1AJNA 2ZR3A 1VF6C 5IJ0B 2CH7B 1IBMO 2QWNB 4X20A 4Q6GA 4D7SA 2AGAA 4JI0B 4F4LA 2F4VB 3ASNC 2FB5A 1NTZH 3U10A 3ZJZA 2HHHO 1DK1A 2QKCA 4O4JB 1QQCA 5A9GA 4YY3B 1K34A 4UB8Z 5CB4A 2XUMA 1SQQH 1AI5A 2CAZC 4JV5O 1N33O 3QO5A 1NBMG 4W4KA 4YXWG 2CTPA 1JFFA 2QKSA 3IJ4A 3I55V 1UFIA 3C3SA 3K9SA 3WB2A 4KP4A 2AW9A 3DTUB 5CA1A 2ZKOA 2H94A 2IJHA 3CB2A 4JTCB 1YTFB 4WF9V 4GKJO 2JDIG 2GUZA 2HJDA 2L35A 2RQ6A 2FTKA 4MVMA 3SGIA 2BOBC 4X65O 3SYPA 5IT9N 1K3EA 1TUBB 3MHSC 1M93A 4HZ3A 4JI5O 1AILA 1V55B 5E79Z 2HLDG 5IY5C 1IBLB 2A3QA 5H6RA 5B66Z 2OYQA 4UCTA 3HPLC 3MDSA 5CBHA 4UCVA 3AG1C 1AROP 2KKWA 5D5PA 2LP7A 2B9ZA 1XNQB 1VQNV 4PA9A 4PI0A 5BR8O 4LNUB 3JAWA 2WLJA 4FMTA 1EBOA 3F7VC 3DC6A 3FAVA 3LSQA 1NTKH 3LDDA 2JRIA 3A8TA 4QJFB 2EJ7A 5KMGB 4HNAB 2RNBA 1H2LA 1I7FA 1JJOA 3RFRA 4JGSA 3RBZA 4F6EA 1K8AW 5LHGA 2GV9A 3R65A 3HKDB 1IURA 2ZR2A 1TA8A 1KB9F 1Q43A 4XDLA 2WLIB 1HP8A 4LBEC 2P6JA 2L6LA 3ML0A 2H8PC 3RYIA 2QTOA 2ATKC 4FZ0A 3VQWA 4P9PA 4E2LA 1RP3B 5LYJA 1Y74B 2VQEB 4OPAA 3CCRV 4P30A 4FLYA 1AB3A 3ABTA 1YZBA 3UQ8A 2WLNA 1Q6UA 1URFA 4DV1B 4TUYA 3HKDA 4ZIBA 3JAWB 5GTHZ 4NTXA 1J5EB 4P2ZA 2JIZG 4LP8A 1YTFD 3MHHC 1H2KA 1YJNV 2E5LO 1BMFG 1V54C 4MW8A 5C8YB 3OR7C 3STZC 3CC2V 4DR1O 2N04A 3O65A 2V7QG 1BS3A 4YJ2A 4B7KA 3JALA 1K4DC 4FLTA 5IJ0A 1Y4MA 1XMQO 1F7YA 2ZD9A 2YUAA 1J5EO 3JD1A 4PA7A 5J2TA 1V54B 5KX5B 2JGUA 1IBMB 3K3WA 1UPGA 1COWG 3WB0A 4TV8B 1XILA 4FLWA 4B3RB 1G8MA 1XEQA 5CA0A 1TGOA 3E35A 1KP2A 2ZIMA 3HR0A 4AILC 4W4LA 5B1AC 3K5LA 3CRRA 4R50A 1WP7A 2UUAB 2RMKB 1XL4A 2UUBB 3H1KH 3P30A 1QVGU 4UV8A 4MSWC 4YJ3B 1VQ5V 1NJIW 5LHIA 4NXMB 4KL1A 3ASOC 4F6RB 2ZXWC 5ITZA 5KHKA 4J42A 2UXDB 4J9ZB 3ZX6A 3CRAA 2GSMB 1LR1A 1N36B 5KX5A 1OCZC 4DV2O 3ABMB 2DWDC 1SA0B 3ETQA 1RPRA 4GX0A 4CH6A 4LF7B 4FLZA 3CCLV 3JCUZ 1BHBA 5FLXN 4FM2A 4JI2B 1YSCA 3TCUA 4O4LA 3AG2B 4L8JA 4QPJA 1QHTA 1GO3F 2NNUA 1IX9A 4JI6O 4A5UB 2FKXA 4FK5C 1FPOA 4CH4A 1QLEC 2XASA 3RN4A 5IDJA 1SC5B 4QE9A 4KFMA 1G4YB 1W0JG 5IWAB 3CS5A 2A7WA 3W7XA 5EBMC 2Y4UA 4R7CA 1SZTA 3K03A 1WA8A 5JCOA 3RGBA 1IBLO 4LH7A 2ZM6O 1JR9A 1N36O 3JASA 4MTFA 3G80A 4J7ZA 3DXRB 5KAIZ 3ZRXA 2BTOA 1N0NA 3K58A 4O2BB 1EZJA 1JMKC 4DV4O 4OPHA 4FJCC 2AZ0A 2KB1A 1SA0A 4BW9A 2Q68A 4GKJB 2OCCB 4DV6O 3JD3A 3FD9A 3CCJV 3CXHF 4DW0A 1GMGA 2CTRA 3JD4A 3AG4C 1NR1A 2Q7EA 4YHHB 5LOVB 3ABLB 4J7JA 1E1RG 5LYJB 1JCHA 4LFAB 4LFBB 2UUCB 4CS2A 5H6QA 3SJQC 3H1JH 5DM6V 5KA6A 3SPIA 3GWOA 1G1XB 5EYPB 3ZN0A 4UFZA 3MD0A 2UU9B 2IM9A 2CK3G 4DV4B 1R6TA 3RWRD 1KQSU 2UU9O 3JASB 1OHHG 2X0LA 4B08A 1OZ0A 4EKWA 4DV7B 1QLNA 2K9PA 4WFFA 3ZMSA 1MG1A 1W2BU 3TXQA 2ZDIA 4XDJA 3H01A 3RVYA 1N8RW 5IYZB 4FM1A 1VQ4V 1SKVA 3UT5B 1NQTA 4X66O 4JI4B 3FB7C 2EIKC 1MA1A 2R72A 2CUGA 3J7AU 1Q8IA 1K7DA 2HR3A 2EIMB 4QGPA 1OCCC 1P84F 2JEUA 4DV0O 4JTAB 3SJCC 4DRXB 2DYSB 2VQEO 5EIBD 3WG7B 1PP9H 4R8CA 3BABA 4DUYB 1H38A 2JJ1G 1KKDA 2HFEC 2WSSG 3FKSG 4GYCB 3SPGA 5LMUO 2YEVB 3ZCCA 1NR7A 3ABMC 4PA6A 3SYCA 4F6RA 3D3IA 4DR3O 2A06H 3N2GA 1H8EG 5IYCO 4U3FH 4TOIA 2IU0A 5EC1C 2HVKC 2PYLA 4YJ3A 1IBKO 4BAYA 4O2AB 2V1DA 4FVMA 5JVDA 1SQBH 2FYUH 3FB5C 4I9QA 2H3OA 1HR0O 3S3XA 5TISZ 1OCRB 1Z5VA 4NXMO 1AR5A 4TWKA 4B3SB 2Q69A 1JOYA 4CS3A 4DR2B 2MW2B 2QR4A 3QG5A 4JASA 2HKOA 2N05A 3O9OA 4FPPA 1R6NA 3WFVA 3ZMTA 2JS3A 1ZL8B 4B3RO 4GUNA 1EFRG 4PDVA 4UCSA 1OCOB 4J80A 4DV3B 4CS4A 2Y0PA 2X6BA 2IJKA 5BZBA 1AI4A 3K79A 4EFBA 1Q82W 2GTAA 4CZZA 2UXBB 1L0LH 4GX5A 2DYRB 4O4LB 3H1IH 1SF9A 3M99B 2KSDA 3OTFA 3E8HA 1VF7A 3EHBB 1K5SA 5L3FA 2XHBA 3E22A 3SPCA 5JH7B 4GCZA 3BAAA 2X6AA 1NS1A 5JVDB 3SDLA 2UXCO 2RN9A 2Z5UA 5B1BB 1HW7A 2QKAA 1ZWIC 1M9NA 3E89A 4KXRA 1QCEA 1R3LC 4I5SA 5BXZA 5C93A 3JD0A 5B3SB 2DYRC 2ADQB 3AK1A 2BTQA 4JI3B 1XI1A 1S3JA 3SPJA 5GONA 4JAUA 3L71H 3T1YB 1IZ3A 3IC9A 1H8HG 3ZHRA 4AQYO 4J41A 5EYPA 1DGSA 4ZHQA 3JAMN 1BQ0A 3CD6V 1Q90D 4Z1MG 1VQ9V 3P3PA 2QM7A 4X64O 3G71V 2D2CB 3VBBA 2YIBD 1RM1C 2EZPA 4LNUA 2F66C 1MABG 2XAHA 1K33A 5LMNB 1VF6A 5GTIZ 3FFQA 1S72V 2E5LB 2E3CA 3QNEA 1BGYH 3D3QA 4CC5A 4TV8A 1CP9A 5L3DA 3BPZA 2E75B 2ZE8A 2MK3A 4IHJA 5L3GA 5L3EA 3ASOB 3M7MX 2JEXA 4RQFA 1N34O 1ZUQA 4DV7O 2DQ3A 2YXYA 1S76D 4PHZA 4AHCA 2YXHA 4X20B 2UXNA 3KCYA 3BA9A 3E83A 1B6QA 4GZRB 5H5NA 1TVKA 4JI5B 1V55C 5LP6A 3E2EA 2Q9LA 1JQ0A 3AK2A 4DR3B 1H2SB 3OFNG 3DGEA 5LL6Y 1U96A 4LH6A 2OWOA 2Z3YA 3UM7A 4BIZA 3FYIB 2EZOA 1S5JA 3RYHB 4RWUA 1WJZA 2A0LA 5LGUA 2UUAO 4OX9B 1GN3A 1VQKV 2AZ2A 3QF7A 4I7ZB 2P67A 1XHXA 4OX9O 2BSKA 3ZIAG 2HEPA 3FB8C 3IGAC 4U3JB 4OGQB 4L87A 4JI7O 4DR6B 3JAKB 4O4JA 3NXSA 2P22C 1KMIZ 4BW5A 1X4TA 5KUMA 5EBWC 4LF7O 2EJRA 4RO2A 3DSQA 3OUSA 1WB8A 1AP5A 2JGDB 3G6BA 3ASNB 1ROPA 1NZ6A 3CX5F 4NYKA 5IJ9A 5LBQA 3K5MA 1I08A 4IL6Z 2A79B 3SPHA 4QIWF 3RT3C 2N74A 3QTCA 2ZE7A 1YEWA 3X2QB 2DE0X 2LQTA 1S5HC 2GUZB 1DTOA 2W0FC 4NR1A 2ZNIA 1XMOB 3W7UA 1M1KW 3I56V 4MTOA 5KAFZ 1E1QG 2LFRA 3H9VA 3K9AA 3P32A 1KC8W 2CTQA 4LF8B 4RUEA 4MVOA 4JI0O 1PV0A 5CMUA 4Z2WA 1B04A 3E22B 2C2AA 2UXBO 2WLHA 1GM9A 1QR8A 4FIPC 2VWKA 3VOUA 2YC0A 3L75H 3CCSV 5IYDO 1I94O 2ZDIC 4PDMA 3M8AA 2V4DA 2EIMC 1I94B 3ZMZA 4Q20A 3AG1B 1RPOA 3CCQV 2XAFA 3EVKA 5A2QN 3T1HO 1TUEB 2G38A 1M5IA 2OIGA 3LDCA 5H9CA 3ETDA 4MS2A 2WLLB 2Q4PA 2KG7B 4H13B 4K3AA 3OMAB 4DK1A 1P49A 4X1YA 2BCCH 3CXCU 4JI8B 3BCCH 5BR8B 1K97A 4U7OA 5KHHA 1F23A 3NR7A 2YI9A 5DEDA 4B3MB 3ZMVA 1ZAUA 5LGNA 3ZN1A 2XAGA 1MOFA 2GDSA 1BSMA 1SQGA 3K06A 3L72H 1XNRB 1XUQA 4J10A 2Q6AA 1ZSPA 1QR9A 3KZIZ 3QVNA 3P3NA 1BE3H 3JALB 1OJHA 2KG7A 3OEHG 4DV0B 1SQVH 2ITDC 4LWSA 2RDCA 2YSUB 1TAEA 4JZ2A 2QE7G 3HKBA 3N2GB 4DV3O 1Q6IA 4YJ2B 3VQVA 1FKAO 5IYBO 5E1AC 2LGWA 3FYEB 2Q5ZA 3KG2A 1IDSA 4JI8O 1K9MW 1SRYA 4E4EA 2Y0IA 1M56B 3I5DA 4UVBA 1N34B 1KYOF 1GAXA 2OCHA 3B4SA 3BFRA 1HNZB 1M4UA 4N23A 5B1NA 3VQYA 3QO7A 1AR1B 3CC4V 5EBLC 3ZHQA 1WPBA 1OCOC 4GX1A 1YI2V 2EX3A 1BQZA 3HKBB 2LFSA 5IYZA 2E74B 1IBKB 4FLVA 3LNNA 4JYAO 4BWAA 2HHHB 3SJBC 2R9IA 4PD4F 1RFYA 3LSUA 4D7TA 4X62B 4WFEA 2JK5C 3PN1A 1D2DA 2IW5A 1FFXB 5J9PC 1P7BA 3E8FA 2PY5A 4DV2B
chains in the Genus database with same CATH topology
3ABMC 2ZR3A 4PA6A 3SYCA 4G28B 1JX9A 4MVSA 4PDLA 3ZRVA 3D3IA 1NH2B 1H8EG 1KECA 5IYCO 2W6JG 2EILC 2IU0A 5EC1C 2HVKC 4MW3A 4F4LA 4BAYA 2W6IG 4LCUC 2V1DA 3ASNC 3ZJZA 4N21A 3FB5C 1K34A 1R3IC 1K73W 4HYOA 3TETA 2WLLA 3IC7A 4OXSA 1AI5A 1OCRB 1I5YA 4TWKA 2K1EA 1PL0A 4JPRA 4PA3A 4JTDB 4MTGA 3TK1A 2Q69A 3K08A 5CA3A 3QO5A 1JOYA 1NBMG 4YXWG 2XNDG 1M90W 2ZXWB 4JASA 2HKOA 2HJFC 4FPPA 1LNQA 2QKSA 5B1AB 1R6NA 1AJPA 2P7TC 3WFVA 3ZMTA 3I55V 4P9OA 2WLMA 1VQ6V 3BY6A 4KP4A 3DTUB 1EFRG 4PDVA 2H94A 1OCOB 4HAMA 2IJHA 2X6BA 2IJKA 1FXKC 1AI4A 4JTCB 5BZBA 1YTFB 3K79A 3JD2A 1Q82W 4CZZA 4WF9V 2QA4V 2JDIG 4QE7A 4GX5A 2DYRB 1Q86W 2WAMA 2FTKA 3M99B 4MVMA 2BOBC 3ABUA 3E8HA 3A0RA 3T4ZA 3SYPA 3EHBB 1K3EA 1K5SA 3MHSC 2AHYA 5L3FA 1QLEB 2WLIA 4HZ3A 3ABKC 3GB7C 1PNMA 4UVAA 3SPCA 4GCZA 1GK9A 4JF3A 1VQMV 2M7WA 4DO2A 1V55B 2X6AA 2HLDG 5IY5C 1ORQC 5B1BB 2Z5UA 5H6RA 3CMEV 1ZWIC 3HPLC 1M9NA 3E89A 2EIKB 2UXXA 5CBFA 1QCEA 4JAVA 1R3LC 2EINC 4I5SA 1OCCB 5CBHA 3CC7V 3EFFK 5C93A 3AG1C 1AROP 3JD0A 5B3SB 2DYRC 1W0KG 3OM3B 3RW0A 4GT1A 2LP7A 1JPXA 1VQNV 4PA9A 4X89A 4JYCA 1WLEA 4GX2A 1S3JA 3SPJA 4MTXA 2WLJA 4TSFG 4JAUA 4FMTA 5KUKA 4KUMA 1EBOA 1H8HG 2WLKA 3F7VC 3LSQA 4WFBV 4PA4A 3LDDA 3B8MA 3CCEV 3LUTB 1WPXA 4QJFB 3OEEG 2QM8A 4Z1MG 1IXMA 3CD6V 1VQ9V 3RVZA 3B8NA 2QM7A 3G71V 4U7NA 4JGSA 3RBZA 3VBBA 1K8AW 5LHGA 1RM1C 2EZPA 3R65A 1J95A 4XBFA 2ZR2A 3OE7G 2OTJV 2XAHA 1MABG 5GW7A 1K33A 1YJ9V 2B1IA 2F43G 4XDLA 2A9HA 3ABLC 2BOCC 2WLIB 1S72V 3SYQA 1I5XA 2X7RB 3QNEA 1JJ2U 4LBEC 1PD3A 2P6JA 1CP9A 4RUFA 5L3DA 3CCMV 1M56C 3ML0A 2H8PC 1DF5A 1KD1W 1JVMA 2QTOA 2ATKC 2MK3A 1RM1B 5L3GA 1M57B 4P9PA 3ASOB 4E2LA 5L3EA 2JEXA 4RQFA 2EIJC 1Y66A 3E8GA 4UXNA 4WFHA 3W7SA 2DQ3A 3CCRV 1P4RA 4P30A 1S76D 5IY5B 2UXNA 1BHAA 1PNKA 1F4MA 2Q67A 2IU3A 3ABTA 3E83A 3PJSK 2WLNA 1B6QA 2DWEC 2EIJB 1V55C 3E2EA 1FFTB 5B1BC 4P2ZA 3OW2U 3B77A 1JQ0A 2JIZG 4PDRA 4WCEV 1SETA 3OFNG 4LP8A 3DGEA 1YTFD 2XAJA 3MHHC 1YJNV 1BMFG 1V54C 2Z3YA 3UM7A 1F51A 4BIZA 4MW8A 3FYIB 3OR7C 2EZOA 3STZC 3UKMA 2B1GA 3CC2V 2X6CA 2A0LA 5EK0A 5LGUA 1M57C 2V7QG 1VQKV 5EC2C 2P67A 1Q7YW 3ZIAG 4RQEA 1XL6A 3FB8C 3IGAC 1R3KC 1K4DC 4L87A 3OR6C 1Y4MA 2ZD9A 2IH3C 3NXSA 1THZA 2OT5A 3JD1A 4PA7A 1FXHA 3HB3B 4BW5A 1V54B 5KUMA 1FS0G 5EBWC 5DN6G 2EJRA 4RO2A 3K3WA 3OUSA 3E8BA 1COWG 3ETEA 1QVFU 1VQOV 3ASNB 1ROPA 2EINB 4UVCA 1VQ7V 1G8MA 3STLC 3E35A 1KP2A 5LBQA 2A79B 5B1AC 3SPHA 4QIWF 1GTOA 1OCZB 4R50A 4X8AA 4MVQA 3F7YC 1MSWD 4H37A 1XL4A 5L3BA 3P30A 1QVGU 1CPYA 4UV8A 1KP3A 4MSWC 1VQ5V 1Q81W 1NJIW 5LHIA 3X2QB 3ASOC 1PKXA 4I9WA 2ZXWC 2Y69C 1S5HC 4J9ZB 4QPKA 1DTOA 3AEIA 2GSMB 2W0FC 3ABKB 2P90A 1OCZC 3ABMB 2DWDC 2OCCC 3OAAG 3W7UA 3FB6C 1M1KW 1RPRA 3K0DA 4R6ZA 4MTOA 3ZMUA 3I56V 4GX0A 1E1QG 2LFRA 3CCLV 1BHBA 3SYAA 1H2GA 3K9AA 3P32A 2NLJC 3G6EV 1R6KA 1KC8W 1VQPV 3LSSA 4RUEA 1S77D 1YSCA 3LNMB 3TCUA 3AG2B 4DXWA 1YITV 4QPJA 4MVOA 1DLBA 2NNUA 1GO3F 5CMUA 4FK5C 3CCVV 1QLEC 2XASA 2C2AA 5IDJA 2IH1C 2WLHA 4QE9A 1YJWV 1GM9A 1QR8A 3E86A 4FIPC 1G4YB 4KFMA 1W0JG 5CBGA 3VOUA 1R73A 1F4NA 3K04A 1QBZA 4G2KA 3W7XA 5EBMC 5IYDO 3CCSV 4R7CA 2ZDIC 1SZTA 1NH2D 3K03A 2XOKG 4PDMA 1ENVA 4MVUA 2EIMC 3CP1A 4ZBMA 4BIUA 3ZMZA 4Q20A 1L1FA 3CYOA 3OMIB 2HVJC 1SERA 1AI6A 3AG1B 1RPOA 2DQ0A 2WPDG 2XAFA 3QO8A 4MTFA 3CCQV 2XAQA 1TUEB 3K0GA 3OMNB 5L3CA 3SYOA 4G27B 3LDCA 3ZRXA 5H9CA 3X2QC 3ETDA 4MS2A 2WLLB 1SESA 3OMAB 1EZJA 4H33A 3T4DA 1S0VA 4CBCA 4FJCC 2YEVA 3CXCU 2KB1A 2EILB 2Q68A 3D36A 1UJWB 2OCCB 3ETGA 1K97A 3JD3A 4U7OA 1F23A 5B3SC 4QNHB 4TT3G 3CCJV 3IFXA 2R9RB 3ZMVA 1GMGA 5LGNA 1R3JC 3ZN1A 3CPWU 2XAGA 5HFMA 3JD4A 1DF4A 2Y69B 1MOFA 3AG3B 1NR1A 3AG4C 3ZRWB 3K06A 1K5QA 5CN0A 3ABLB 1E1RG 1JCHA 3WG7C 3OUFA 2JJ2G 4PELA 3W7WA 2Q6AA 3CCUV 1QR9A 5LGTA 3CMAV 5H6QA 3AG2C 4UV9A 3SJQC 5DM6V 3OGCC 5KA6A 2D3OW 2IJIA 2WWWA 4WFAV 3OEHG 3GWOA 2ITDC 4RAIA 3SPIA 5KA5A 2YSUB 2QE7G 3ZN0A 1K4CC 1BL8A 3MD0A 2DYSC 3FYEB 2CK3G 5E1AC 1K92A 3F5WC 5IYBO 2ITCC 1KQSU 3KG2A 1OHHG 1GKFA 2X0LA 4ASUG 1OZ0A 4EKWA 1K9MW 1QLNA 1SRYA 4WFFA 3ZMSA 1MG1A 2Y48A 1CEZA 1M56B 4X88A 1W2BU 1E79G 2ZDIA 4UVBA 4XDJA 3H01A 3RVYA 1N8RW 2AHZA 1FXKA 3G4SV 1OCRC 1VQ4V 1NQTA 3BEHA 4N23A 2OTLV 4UUJC 5B1NA 3FB7C 1YHQV 2PI4A 2EIKC 3QO7A 4ZKIA 1AR1B 1FXVA 2ZQMA 2QEXV 3CC4V 2EBOA 1K7DA 5EBLC 2HR3A 4JYBA 2EIMB 1OCOC 3LDEA 5HFLA 4GX1A 1YI2V 2GHYA 3JCZA 1OCCC 1NVPB 2B5UA 2JEUA 4MT8A 3ZRSA 2LFSA 5LHHA 4JTAB 2DYSB 1VQLV 2IJJA 3T2MA 1NVPD 3WG7B 1AI7A 1AJQA 4MVRA 4R8CA 3W7TA 2R9IA 1GM7A 5B1OA 1H38A 3AG3C 3AG4B 4J9YB 2JJ1G 4MVZA 3T1CA 1FXKB 2PI5A 1KKDA 2HFEC 3ZRWA 4WFEA 1YIJV 1GM8A 2JK5C 3JYCA 2HG5C 2WSSG 3FKSG 1HWYA 4WFGA 4LC1A 2IW5A 4XDKA 1PNLA 2DW4A 3SPGA 5J9PC 1VQ8V 1P7BA 3E8FA 2YEVB 1NKDA 3ZCCA 1AJNA 5FL7G 1NR7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1K34 A;  3CP1 A;  4JF3 A;  5KA6 A;  2M7W A;  1F23 A;  1I5X A;  3GWO A;  1EBO A;  3CYO A;  4N23 A;  2X7R B;  5KA5 A;  1DLB A;  2P6J A;  1I5Y A;  5CMU A;  3B8M A;  4FK5 C;  5HFM A;  4JPR A;  1DF4 A;  2EBO A;  1DF5 A;  1QCE A;  1MOF A;  2EZO A;  5H9C A;  3B77 A;  1JQ0 A;  2MK3 A;  3B8N A;  5CN0 A;  4FIP C;  1QR8 A;  5HFL A;  4E2L A;  3M99 B;  4JGS A;  1Y66 A;  1Y4M A;  3MHH C;  1QBZ A;  2EZP A;  2LP7 A;  1MG1 A;  4G2K A;  3MHS C;  1JPX A;  2OT5 A;  1QR9 A;  3H01 A;  1K33 A;  1SZT A;  4FJC C;  3K9A A;  4N21 A;  3P30 A;  3WFV A;  1ENV A; 
#chains in the Genus database with same CATH topology
 2BTQ B;  5DEC A;  4G28 B;  3UT5 A;  2PTM A;  4DR2 O;  4NB5 A;  1KEC A;  2W6J G;  2EIL C;  5FNV A;  2F4V O;  4MW3 A;  2JGD A;  3APQ A;  4LF8 O;  2M6Y A;  5IE9 A;  5IJ9 B;  4N21 A;  4TUY B;  4LF6 O;  4LF4 O;  4DYL A;  1R3I C;  4DR5 B;  4LF6 B;  1K73 W;  4HYO A;  3TET A;  3IC7 A;  2VQF B;  1I5Y A;  1PL0 A;  3DXR A;  4J7K A;  4PA3 A;  5J2U B;  4JTD B;  4MTG A;  3TK1 A;  5EZY B;  2XND G;  3ICX A;  1EN5 A;  1BZK A;  2HJF C;  1Y67 A;  5B1A B;  2P7T C;  1FJG O;  1VQ6 V;  4HAM A;  1XNQ O;  4KHP O;  4FFB A;  4DW1 A;  2YI8 A;  1LUW A;  4I55 B;  1EN4 A;  3WU2 Z;  3AG7 A;  1Q86 W;  4ICG A;  2WAM A;  4Z1V A;  4J11 A;  4IGG A;  3A0R A;  5LA6 B;  2AHY A;  4NKG B;  4K8X A;  4DR6 O;  4DUZ B;  1HNZ O;  3ABK C;  4B3S O;  1PNM A;  4PI2 A;  1GK9 A;  1VQM V;  4DO2 A;  1ORQ C;  4UCR A;  3CME V;  2P4V A;  4ZOL B;  3ZHU A;  2NN4 A;  5CBF A;  1TUB A;  4JAV A;  2EIN C;  4C7U A;  1OCC B;  4ABM A;  4I0X A;  4K8Z A;  1LUV A;  3EFF K;  3CC7 V;  3FAV B;  2IBZ H;  4O4H B;  4DR4 O;  1W0K G;  3OM3 B;  1KUQ A;  4X89 A;  4JYC A;  3RYH A;  1FD9 A;  1MSD A;  4KUM A;  1RSO A;  4EEQ A;  5LA6 A;  4PA4 A;  3B8M A;  3C3T A;  2ZM6 B;  1WPX A;  1XNR O;  1IXM A;  1N4C A;  3ZHV A;  3B8N A;  4JAA A;  4U7N A;  5LMU B;  1PM9 A;  4GKK B;  3RYI B;  3OE7 G;  2OTJ V;  5GW7 A;  1YJ9 V;  2B1I A;  2HP8 A;  2A9H A;  1GN6 A;  2X7R B;  4O4I B;  3CCM V;  1XHZ A;  2YIC A;  1KD1 W;  2QGN A;  1JVM A;  4JYY A;  2P4K A;  1M57 B;  2EIJ C;  4UXN A;  2UUB O;  4WFH A;  4DRX A;  4JI1 O;  5H2F Z;  1L0N H;  4YY3 O;  3HKC A;  4X65 B;  1BHA A;  4X64 B;  2Q67 A;  1HNW O;  2QWR B;  4X62 O;  2DWE C;  2EIJ B;  2UXD O;  1FFT B;  4FZ1 A;  4JI4 O;  5B1B C;  1Z5W A;  4LFA O;  1VF5 B;  1WA8 B;  1VMG A;  2QM4 A;  1X59 A;  3G67 A;  5F2V O;  2XAJ A;  2GTS A;  4IIJ A;  3HKE A;  1AR4 A;  2B1G A;  3UKM A;  2RCV A;  5LP6 B;  5EC2 C;  4WBN A;  4DR5 O;  1Q7Y W;  4RQE A;  3GVM A;  2W0X A;  1XL6 A;  2JVD A;  1ZL8 A;  1R3K C;  3C90 A;  3TXS A;  3OR6 C;  1THZ A;  3UO2 A;  3OGI B;  4LFB O;  1FS0 G;  3MAQ A;  1US6 A;  5LOV A;  1QVF U;  3ETE A;  1XRE A;  1VQO V;  1VQ7 V;  3STL C;  1Q5O A;  2F1M A;  4NXN O;  2YIA A;  1YVW A;  4TQF A;  1GTO A;  1OCZ B;  2ZIN A;  4MVQ A;  1P7G A;  3F7Y C;  1MSW D;  4H37 A;  4EB6 B;  5L3B A;  3JAR B;  4JI1 B;  3B09 A;  5KMG A;  2QWP B;  1KP3 A;  4GLX A;  1HNX B;  2LW7 A;  5JQG B;  1PKX A;  4I9W A;  2Y69 C;  2CH7 A;  2DN9 A;  3AEI A;  1SQP H;  3ABK B;  4I4T A;  4IYH A;  3K0D A;  4FFB B;  3ZMU A;  5J2U A;  1GN4 A;  1MZE A;  3SYA A;  1H2G A;  1N0J A;  4LF9 B;  3KCX A;  2NLJ C;  3G6E V;  4B3T O;  4LR3 A;  3LSS A;  1S77 D;  1WAZ A;  4DR7 O;  3LNM B;  2CTW A;  1DLB A;  1O9G A;  2GBO A;  4DR7 B;  3SJA C;  3K57 A;  5KHJ A;  4JI6 B;  4CH5 A;  1PL4 A;  3E86 A;  3S3W A;  1R73 A;  1VAR A;  3K04 A;  1NH2 D;  3BHP A;  1ENV A;  1Y74 A;  5K1X A;  3A2F A;  3CP1 A;  3ZBH A;  4ZBM A;  4BIU A;  1AP6 A;  3CYO A;  1A32 A;  3QO8 A;  2DQ0 A;  2WPD G;  2ZIO A;  3L73 H;  2XAQ A;  3BVO A;  3K0G A;  5C8Y A;  5JJJ B;  5L3C A;  4H0L B;  3SYO A;  4G27 B;  5JQG A;  3X2Q C;  3CRM A;  1N32 O;  1SES A;  4ZOL A;  4H33 A;  1SS3 A;  3T4D A;  4CBC A;  3K59 A;  2YEV A;  2EIL B;  3D36 A;  5J2T B;  2XTA A;  3RYC B;  2PF4 E;  1TVK B;  4K35 A;  4DV5 B;  1R3J C;  3CPW U;  5HFM A;  1W59 A;  1Y76 A;  1RSO B;  4LF5 B;  1K5Q A;  5CN0 A;  1XQ8 A;  3U0Z A;  3OUF A;  5BMV A;  3D36 C;  4X1Y B;  3UCS C;  1XOU A;  3R66 A;  3ZS8 C;  2YXL A;  1H2M A;  3CMA V;  2IJI A;  2WWW A;  4WFA V;  4U3J A;  2Y4T A;  1BT8 A;  3CRQ A;  4RAI A;  5KA5 A;  1BL8 A;  1GH6 A;  4NXN B;  2BSK B;  1K92 A;  1R1B A;  3F5W C;  3Q4H A;  4NTY A;  5LP6 C;  1EZV H;  1GKF A;  1I0H A;  2RJZ A;  5B5E Z;  2Y48 A;  2F93 B;  1E79 G;  4YIP A;  4H44 B;  3J80 N;  3BEH A;  2AXT Z;  2OTL V;  5D5Q A;  4TV9 A;  2PI4 A;  1FXV A;  1MNG A;  2ZQM A;  3DC5 A;  4I50 B;  1SQX H;  4GKK O;  3JAK A;  2CDY A;  3LDE A;  2GHY A;  1NVP B;  5LHH A;  3OD4 A;  4JZG A;  3OT7 A;  5CB4 B;  4B7E A;  3K5N A;  1VQL V;  2IJJ A;  2KQX A;  1AJQ A;  3W7T A;  1GM7 A;  5FPR A;  1WB7 A;  2CGN A;  3AG3 C;  4MVZ A;  3T1C A;  2PI5 A;  3D8C A;  3ZRW A;  4K0K B;  4JI7 B;  1GM8 A;  2XT9 A;  3JYC A;  3CSX A;  4FFK A;  2OIE A;  3JSL A;  1CXZ B;  1HWY A;  1O9H A;  4XDK A;  2DMX A;  1PNL A;  2DW4 A;  1XDC A;  4YIO A;  2ZT9 B;  2LW1 A;  1JX9 A;  1NKD A;  2FL4 A;  5GON B;  4O2A A;  5FL7 G;  4PV1 B;  1T5E A;  4O2B A;  4MVS A;  4PDL A;  3ZRV A;  1NH2 B;  4ZHQ B;  3RYF A;  2ZE5 A;  1ZTE A;  1SZX A;  5KHI A;  4CC6 A;  2VS0 A;  2W6I G;  4IT5 A;  4B3T B;  4LCU C;  3THO A;  1KU9 A;  2E76 B;  1KBH A;  3N27 A;  2WLL A;  4OXS A;  4K0K O;  2VRZ A;  1HNX O;  2K1E A;  3J81 N;  4X66 B;  4JPR A;  1D5N A;  2F95 B;  5AG2 A;  3K08 A;  5CA3 A;  3B40 A;  4IHJ B;  3A0B Z;  1M90 W;  2ZXW B;  1LNQ A;  1AJP A;  3T1H B;  4P9O A;  2WLM A;  3BY6 A;  1NI8 A;  1FXK C;  4LF4 B;  3JD2 A;  2QA4 V;  5EZY A;  4QE7 A;  1S5L Z;  2Z0A A;  3CWB H;  4B3M O;  4PJ0 Z;  3SR2 C;  5FNV B;  4LWS B;  3ABU A;  3RYF B;  3T4Z A;  1B06 A;  1XMQ B;  1QLE B;  1WN7 A;  3HKC B;  2WLI A;  2LGQ A;  3GB7 C;  2ZNJ A;  3CJH B;  4UVA A;  4JF3 A;  2M7W A;  1JA8 A;  4I55 A;  1XBL A;  3UO3 A;  5LMN O;  5K1P A;  2EIK B;  1EM1 A;  2UXX A;  2Q0O C;  1Y76 B;  2PYJ A;  1U97 A;  3RW0 A;  4GT1 A;  2ZE6 A;  1JPX A;  2ADP A;  1FYJ A;  1WLE A;  4GX2 A;  1H2N A;  4MTX A;  2CGO A;  4TSF G;  5JJN B;  4AQY B;  3TJT A;  5KUK A;  2WLK A;  2JS5 A;  4WFB V;  3T1Y O;  4LF5 O;  3CCE V;  3LUT B;  1G6U A;  4YHH O;  3OEE G;  2QM8 A;  3RVZ A;  3N2K B;  1HNW B;  2F23 A;  2UXC B;  1IXB A;  4NTW A;  1J95 A;  2P06 A;  4XBF A;  4EFE A;  3OTO B;  4DV1 O;  2LJ2 A;  5BY1 A;  2F43 G;  1VIB A;  5CA1 B;  3ABL C;  2BOC C;  3SYQ A;  1I5X A;  3A0H Z;  1JJ2 U;  1PD3 A;  3L70 H;  4RUF A;  2QSA A;  1M56 C;  4ZI7 B;  1DF5 A;  4HBN A;  1RM1 B;  3ZHT A;  4DV5 O;  3KKY A;  4UB6 Z;  1Y66 A;  3E8G A;  4X1I B;  1BCC H;  3W7S A;  4FLU A;  1P4R A;  1PPJ H;  5IY5 B;  1PNK A;  1F4M A;  2IU3 A;  3H1L H;  3PJS K;  2P5O A;  5JWP A;  1KKC A;  1GRJ A;  3BRC A;  2NR5 A;  2Q7G A;  1XMO O;  4NVP A;  3OW2 U;  3B77 A;  4PDR A;  4UCO A;  4TV9 B;  4WCE V;  1SET A;  2PGG A;  4LF9 O;  4DR4 B;  4CH3 A;  1F51 A;  3L74 H;  2QTS A;  2Q7H A;  1QNM A;  2X6C A;  3CRC A;  5EK0 A;  1M57 C;  1V9P A;  2R9A A;  4O4I A;  3VQX A;  4X1K B;  2IH3 C;  2OT5 A;  1FXH A;  1NU1 H;  1YDX A;  2QDO A;  1YF2 A;  3HB3 B;  3OTO O;  5DN6 G;  2ILM A;  4DK0 A;  3E8B A;  3GWK C;  2EIN B;  4UVC A;  3ZED A;  4DR1 B;  3B2E E;  4UCU A;  4IYI A;  1OV9 A;  4X8A A;  1WNS A;  3BA8 A;  4D6T H;  2YS8 A;  5BMV B;  1CPY A;  2PUS A;  1L8D A;  3HKE B;  4FLX A;  1Q81 W;  4I0X B;  1WP8 A;  4O4H A;  1VEW A;  1Q3E A;  1B3Q A;  3WB1 A;  4QPK A;  2DOS A;  4WBN B;  2P90 A;  2QJ1 A;  2OCC C;  3OAA G;  5LXT B;  3FB6 C;  4R6Z A;  2WA4 A;  4X1K A;  1R6K A;  3U11 A;  1VQP V;  1YIT V;  4DXW A;  1JFF B;  2ZCE A;  2EUL A;  4I4T B;  3CCV V;  1AVM A;  3JSN A;  4X9Q A;  2ETN A;  1FFX A;  1ZX3 A;  2CE4 A;  4JI3 O;  3Q4H B;  2IH1 C;  1Z2G A;  2VQF O;  1YJW V;  3L9D A;  3TGU H;  5CBG A;  2Q8V A;  1F4N A;  1QBZ A;  2YIB A;  4G2K A;  1N33 B;  5FPO A;  2XOK G;  4TQD A;  1NTM H;  4MVU A;  4EB6 A;  3K5O A;  1L1F A;  3OMI B;  1D5A A;  2LO1 A;  2HVJ C;  1AI6 A;  1SER A;  3JAT B;  3CJH A;  3OMN B;  2UUC O;  2R70 A;  4BIO A;  2PZS A;  4JYA B;  1S0V A;  4DV6 B;  5LXT A;  1UJW B;  1QU7 A;  3ZHS A;  5IWA O;  3ETG A;  5B3S C;  3N2K A;  4QNH B;  5JH7 A;  4TT3 G;  1HR0 B;  3APO A;  3IFX A;  3H1H H;  1Q6H A;  4HNA A;  2R9R B;  5ITZ B;  1NT2 B;  5CA0 B;  4IIJ B;  1Y6X A;  2DJV A;  4FM0 A;  1DF4 A;  2Y69 B;  3AG3 B;  5JJE B;  3ZRW B;  4DUZ O;  3WG7 C;  1GN2 A;  1ZLZ A;  2JJ2 G;  3F5T A;  4LFC B;  4PEL A;  3W7W A;  3CCU V;  2WA3 A;  4ZI7 A;  5LGT A;  3AK3 A;  2ODM A;  1N32 B;  3AG2 C;  4UV9 A;  3OGC C;  2D3O W;  2YID A;  4JI2 O;  4AI8 A;  1K4C C;  2DYS C;  3IAY A;  3EXA A;  2ITC C;  3JAT A;  4ASU G;  1CEZ A;  1FAF A;  4X88 A;  2AHZ A;  1FXK A;  3G4S V;  1OCR C;  3CE2 A;  4LFC O;  4X1I A;  3CHX A;  5EIB C;  4UUJ C;  1YHQ V;  3RYC A;  4ZKI A;  1MZF A;  2QEX V;  2QWO B;  2O57 A;  5KHG A;  5KLV H;  1IVS A;  2EBO A;  3FX7 A;  2BE3 A;  4JYB A;  2Q0A A;  5HFL A;  1MMM A;  3JCZ A;  4BR6 A;  2B5U A;  4MT8 A;  3ZRS A;  1FJG B;  4KHP B;  3T2M A;  1NVP D;  1AI7 A;  4MVR A;  4I50 A;  2YDE A;  5JCO C;  5B1O A;  1SQF A;  3AG4 B;  4J9Y B;  3CEI A;  2FML A;  4DUY O;  1FXK B;  1YCI A;  1YIJ V;  2HG5 C;  2VWJ A;  4JV5 B;  1HDJ A;  4WFG A;  1EN6 A;  4LC1 A;  3JAR A;  2ARH A;  1VQ8 V;  2Q73 A;  2QWQ B;  1VP7 A;  1YXB A;  1AJN A;  2ZR3 A;  1VF6 C;  5IJ0 B;  2CH7 B;  1IBM O;  2QWN B;  4X20 A;  4Q6G A;  4D7S A;  2AGA A;  4JI0 B;  4F4L A;  2F4V B;  3ASN C;  2FB5 A;  1NTZ H;  3U10 A;  3ZJZ A;  2HHH O;  1DK1 A;  2QKC A;  4O4J B;  1QQC A;  5A9G A;  4YY3 B;  1K34 A;  4UB8 Z;  5CB4 A;  2XUM A;  1SQQ H;  1AI5 A;  2CAZ C;  4JV5 O;  1N33 O;  3QO5 A;  1NBM G;  4W4K A;  4YXW G;  2CTP A;  1JFF A;  2QKS A;  3IJ4 A;  3I55 V;  1UFI A;  3C3S A;  3K9S A;  3WB2 A;  4KP4 A;  2AW9 A;  3DTU B;  5CA1 A;  2ZKO A;  2H94 A;  2IJH A;  3CB2 A;  4JTC B;  1YTF B;  4WF9 V;  4GKJ O;  2JDI G;  2GUZ A;  2HJD A;  2L35 A;  2RQ6 A;  2FTK A;  4MVM A;  3SGI A;  2BOB C;  4X65 O;  3SYP A;  5IT9 N;  1K3E A;  1TUB B;  3MHS C;  1M93 A;  4HZ3 A;  4JI5 O;  1AIL A;  1V55 B;  5E79 Z;  2HLD G;  5IY5 C;  1IBL B;  2A3Q A;  5H6R A;  5B66 Z;  2OYQ A;  4UCT A;  3HPL C;  3MDS A;  5CBH A;  4UCV A;  3AG1 C;  1ARO P;  2KKW A;  5D5P A;  2LP7 A;  2B9Z A;  1XNQ B;  1VQN V;  4PA9 A;  4PI0 A;  5BR8 O;  4LNU B;  3JAW A;  2WLJ A;  4FMT A;  1EBO A;  3F7V C;  3DC6 A;  3FAV A;  3LSQ A;  1NTK H;  3LDD A;  2JRI A;  3A8T A;  4QJF B;  2EJ7 A;  5KMG B;  4HNA B;  2RNB A;  1H2L A;  1I7F A;  1JJO A;  3RFR A;  4JGS A;  3RBZ A;  4F6E A;  1K8A W;  5LHG A;  2GV9 A;  3R65 A;  3HKD B;  1IUR A;  2ZR2 A;  1TA8 A;  1KB9 F;  1Q43 A;  4XDL A;  2WLI B;  1HP8 A;  4LBE C;  2P6J A;  2L6L A;  3ML0 A;  2H8P C;  3RYI A;  2QTO A;  2ATK C;  4FZ0 A;  3VQW A;  4P9P A;  4E2L A;  1RP3 B;  5LYJ A;  1Y74 B;  2VQE B;  4OPA A;  3CCR V;  4P30 A;  4FLY A;  1AB3 A;  3ABT A;  1YZB A;  3UQ8 A;  2WLN A;  1Q6U A;  1URF A;  4DV1 B;  4TUY A;  3HKD A;  4ZIB A;  3JAW B;  5GTH Z;  4NTX A;  1J5E B;  4P2Z A;  2JIZ G;  4LP8 A;  1YTF D;  3MHH C;  1H2K A;  1YJN V;  2E5L O;  1BMF G;  1V54 C;  4MW8 A;  5C8Y B;  3OR7 C;  3STZ C;  3CC2 V;  4DR1 O;  2N04 A;  3O65 A;  2V7Q G;  1BS3 A;  4YJ2 A;  4B7K A;  3JAL A;  1K4D C;  4FLT A;  5IJ0 A;  1Y4M A;  1XMQ O;  1F7Y A;  2ZD9 A;  2YUA A;  1J5E O;  3JD1 A;  4PA7 A;  5J2T A;  1V54 B;  5KX5 B;  2JGU A;  1IBM B;  3K3W A;  1UPG A;  1COW G;  3WB0 A;  4TV8 B;  1XIL A;  4FLW A;  4B3R B;  1G8M A;  1XEQ A;  5CA0 A;  1TGO A;  3E35 A;  1KP2 A;  2ZIM A;  3HR0 A;  4AIL C;  4W4L A;  5B1A C;  3K5L A;  3CRR A;  4R50 A;  1WP7 A;  2UUA B;  2RMK B;  1XL4 A;  2UUB B;  3H1K H;  3P30 A;  1QVG U;  4UV8 A;  4MSW C;  4YJ3 B;  1VQ5 V;  1NJI W;  5LHI A;  4NXM B;  4KL1 A;  3ASO C;  4F6R B;  2ZXW C;  5ITZ A;  5KHK A;  4J42 A;  2UXD B;  4J9Z B;  3ZX6 A;  3CRA A;  2GSM B;  1LR1 A;  1N36 B;  5KX5 A;  1OCZ C;  4DV2 O;  3ABM B;  2DWD C;  1SA0 B;  3ETQ A;  1RPR A;  4GX0 A;  4CH6 A;  4LF7 B;  4FLZ A;  3CCL V;  3JCU Z;  1BHB A;  5FLX N;  4FM2 A;  4JI2 B;  1YSC A;  3TCU A;  4O4L A;  3AG2 B;  4L8J A;  4QPJ A;  1QHT A;  1GO3 F;  2NNU A;  1IX9 A;  4JI6 O;  4A5U B;  2FKX A;  4FK5 C;  1FPO A;  4CH4 A;  1QLE C;  2XAS A;  3RN4 A;  5IDJ A;  1SC5 B;  4QE9 A;  4KFM A;  1G4Y B;  1W0J G;  5IWA B;  3CS5 A;  2A7W A;  3W7X A;  5EBM C;  2Y4U A;  4R7C A;  1SZT A;  3K03 A;  1WA8 A;  5JCO A;  3RGB A;  1IBL O;  4LH7 A;  2ZM6 O;  1JR9 A;  1N36 O;  3JAS A;  4MTF A;  3G80 A;  4J7Z A;  3DXR B;  5KAI Z;  3ZRX A;  2BTO A;  1N0N A;  3K58 A;  4O2B B;  1EZJ A;  1JMK C;  4DV4 O;  4OPH A;  4FJC C;  2AZ0 A;  2KB1 A;  1SA0 A;  4BW9 A;  2Q68 A;  4GKJ B;  2OCC B;  4DV6 O;  3JD3 A;  3FD9 A;  3CCJ V;  3CXH F;  4DW0 A;  1GMG A;  2CTR A;  3JD4 A;  3AG4 C;  1NR1 A;  2Q7E A;  4YHH B;  5LOV B;  3ABL B;  4J7J A;  1E1R G;  5LYJ B;  1JCH A;  4LFA B;  4LFB B;  2UUC B;  4CS2 A;  5H6Q A;  3SJQ C;  3H1J H;  5DM6 V;  5KA6 A;  3SPI A;  3GWO A;  1G1X B;  5EYP B;  3ZN0 A;  4UFZ A;  3MD0 A;  2UU9 B;  2IM9 A;  2CK3 G;  4DV4 B;  1R6T A;  3RWR D;  1KQS U;  2UU9 O;  3JAS B;  1OHH G;  2X0L A;  4B08 A;  1OZ0 A;  4EKW A;  4DV7 B;  1QLN A;  2K9P A;  4WFF A;  3ZMS A;  1MG1 A;  1W2B U;  3TXQ A;  2ZDI A;  4XDJ A;  3H01 A;  3RVY A;  1N8R W;  5IYZ B;  4FM1 A;  1VQ4 V;  1SKV A;  3UT5 B;  1NQT A;  4X66 O;  4JI4 B;  3FB7 C;  2EIK C;  1MA1 A;  2R72 A;  2CUG A;  3J7A U;  1Q8I A;  1K7D A;  2HR3 A;  2EIM B;  4QGP A;  1OCC C;  1P84 F;  2JEU A;  4DV0 O;  4JTA B;  3SJC C;  4DRX B;  2DYS B;  2VQE O;  5EIB D;  3WG7 B;  1PP9 H;  4R8C A;  3BAB A;  4DUY B;  1H38 A;  2JJ1 G;  1KKD A;  2HFE C;  2WSS G;  3FKS G;  4GYC B;  3SPG A;  5LMU O;  2YEV B;  3ZCC A;  1NR7 A;  3ABM C;  4PA6 A;  3SYC A;  4F6R A;  3D3I A;  4DR3 O;  2A06 H;  3N2G A;  1H8E G;  5IYC O;  4U3F H;  4TOI A;  2IU0 A;  5EC1 C;  2HVK C;  2PYL A;  4YJ3 A;  1IBK O;  4BAY A;  4O2A B;  2V1D A;  4FVM A;  5JVD A;  1SQB H;  2FYU H;  3FB5 C;  4I9Q A;  2H3O A;  1HR0 O;  3S3X A;  5TIS Z;  1OCR B;  1Z5V A;  4NXM O;  1AR5 A;  4TWK A;  4B3S B;  2Q69 A;  1JOY A;  4CS3 A;  4DR2 B;  2MW2 B;  2QR4 A;  3QG5 A;  4JAS A;  2HKO A;  2N05 A;  3O9O A;  4FPP A;  1R6N A;  3WFV A;  3ZMT A;  2JS3 A;  1ZL8 B;  4B3R O;  4GUN A;  1EFR G;  4PDV A;  4UCS A;  1OCO B;  4J80 A;  4DV3 B;  4CS4 A;  2Y0P A;  2X6B A;  2IJK A;  5BZB A;  1AI4 A;  3K79 A;  4EFB A;  1Q82 W;  2GTA A;  4CZZ A;  2UXB B;  1L0L H;  4GX5 A;  2DYR B;  4O4L B;  3H1I H;  1SF9 A;  3M99 B;  2KSD A;  3OTF A;  3E8H A;  1VF7 A;  3EHB B;  1K5S A;  5L3F A;  2XHB A;  3E22 A;  3SPC A;  5JH7 B;  4GCZ A;  3BAA A;  2X6A A;  1NS1 A;  5JVD B;  3SDL A;  2UXC O;  2RN9 A;  2Z5U A;  5B1B B;  1HW7 A;  2QKA A;  1ZWI C;  1M9N A;  3E89 A;  4KXR A;  1QCE A;  1R3L C;  4I5S A;  5BXZ A;  5C93 A;  3JD0 A;  5B3S B;  2DYR C;  2ADQ B;  3AK1 A;  2BTQ A;  4JI3 B;  1XI1 A;  1S3J A;  3SPJ A;  5GON A;  4JAU A;  3L71 H;  3T1Y B;  1IZ3 A;  3IC9 A;  1H8H G;  3ZHR A;  4AQY O;  4J41 A;  5EYP A;  1DGS A;  4ZHQ A;  3JAM N;  1BQ0 A;  3CD6 V;  1Q90 D;  4Z1M G;  1VQ9 V;  3P3P A;  2QM7 A;  4X64 O;  3G71 V;  2D2C B;  3VBB A;  2YIB D;  1RM1 C;  2EZP A;  4LNU A;  2F66 C;  1MAB G;  2XAH A;  1K33 A;  5LMN B;  1VF6 A;  5GTI Z;  3FFQ A;  1S72 V;  2E5L B;  2E3C A;  3QNE A;  1BGY H;  3D3Q A;  4CC5 A;  4TV8 A;  1CP9 A;  5L3D A;  3BPZ A;  2E75 B;  2ZE8 A;  2MK3 A;  4IHJ A;  5L3G A;  5L3E A;  3ASO B;  3M7M X;  2JEX A;  4RQF A;  1N34 O;  1ZUQ A;  4DV7 O;  2DQ3 A;  2YXY A;  1S76 D;  4PHZ A;  4AHC A;  2YXH A;  4X20 B;  2UXN A;  3KCY A;  3BA9 A;  3E83 A;  1B6Q A;  4GZR B;  5H5N A;  1TVK A;  4JI5 B;  1V55 C;  5LP6 A;  3E2E A;  2Q9L A;  1JQ0 A;  3AK2 A;  4DR3 B;  1H2S B;  3OFN G;  3DGE A;  5LL6 Y;  1U96 A;  4LH6 A;  2OWO A;  2Z3Y A;  3UM7 A;  4BIZ A;  3FYI B;  2EZO A;  1S5J A;  3RYH B;  4RWU A;  1WJZ A;  2A0L A;  5LGU A;  2UUA O;  4OX9 B;  1GN3 A;  1VQK V;  2AZ2 A;  3QF7 A;  4I7Z B;  2P67 A;  1XHX A;  4OX9 O;  2BSK A;  3ZIA G;  2HEP A;  3FB8 C;  3IGA C;  4U3J B;  4OGQ B;  4L87 A;  4JI7 O;  4DR6 B;  3JAK B;  4O4J A;  3NXS A;  2P22 C;  1KMI Z;  4BW5 A;  1X4T A;  5KUM A;  5EBW C;  4LF7 O;  2EJR A;  4RO2 A;  3DSQ A;  3OUS A;  1WB8 A;  1AP5 A;  2JGD B;  3G6B A;  3ASN B;  1ROP A;  1NZ6 A;  3CX5 F;  4NYK A;  5IJ9 A;  5LBQ A;  3K5M A;  1I08 A;  4IL6 Z;  2A79 B;  3SPH A;  4QIW F;  3RT3 C;  2N74 A;  3QTC A;  2ZE7 A;  1YEW A;  3X2Q B;  2DE0 X;  2LQT A;  1S5H C;  2GUZ B;  1DTO A;  2W0F C;  4NR1 A;  2ZNI A;  1XMO B;  3W7U A;  1M1K W;  3I56 V;  4MTO A;  5KAF Z;  1E1Q G;  2LFR A;  3H9V A;  3K9A A;  3P32 A;  1KC8 W;  2CTQ A;  4LF8 B;  4RUE A;  4MVO A;  4JI0 O;  1PV0 A;  5CMU A;  4Z2W A;  1B04 A;  3E22 B;  2C2A A;  2UXB O;  2WLH A;  1GM9 A;  1QR8 A;  4FIP C;  2VWK A;  3VOU A;  2YC0 A;  3L75 H;  3CCS V;  5IYD O;  1I94 O;  2ZDI C;  4PDM A;  3M8A A;  2V4D A;  2EIM C;  1I94 B;  3ZMZ A;  4Q20 A;  3AG1 B;  1RPO A;  3CCQ V;  2XAF A;  3EVK A;  5A2Q N;  3T1H O;  1TUE B;  2G38 A;  1M5I A;  2OIG A;  3LDC A;  5H9C A;  3ETD A;  4MS2 A;  2WLL B;  2Q4P A;  2KG7 B;  4H13 B;  4K3A A;  3OMA B;  4DK1 A;  1P49 A;  4X1Y A;  2BCC H;  3CXC U;  4JI8 B;  3BCC H;  5BR8 B;  1K97 A;  4U7O A;  5KHH A;  1F23 A;  3NR7 A;  2YI9 A;  5DED A;  4B3M B;  3ZMV A;  1ZAU A;  5LGN A;  3ZN1 A;  2XAG A;  1MOF A;  2GDS A;  1BSM A;  1SQG A;  3K06 A;  3L72 H;  1XNR B;  1XUQ A;  4J10 A;  2Q6A A;  1ZSP A;  1QR9 A;  3KZI Z;  3QVN A;  3P3N A;  1BE3 H;  3JAL B;  1OJH A;  2KG7 A;  3OEH G;  4DV0 B;  1SQV H;  2ITD C;  4LWS A;  2RDC A;  2YSU B;  1TAE A;  4JZ2 A;  2QE7 G;  3HKB A;  3N2G B;  4DV3 O;  1Q6I A;  4YJ2 B;  3VQV A;  1FKA O;  5IYB O;  5E1A C;  2LGW A;  3FYE B;  2Q5Z A;  3KG2 A;  1IDS A;  4JI8 O;  1K9M W;  1SRY A;  4E4E A;  2Y0I A;  1M56 B;  3I5D A;  4UVB A;  1N34 B;  1KYO F;  1GAX A;  2OCH A;  3B4S A;  3BFR A;  1HNZ B;  1M4U A;  4N23 A;  5B1N A;  3VQY A;  3QO7 A;  1AR1 B;  3CC4 V;  5EBL C;  3ZHQ A;  1WPB A;  1OCO C;  4GX1 A;  1YI2 V;  2EX3 A;  1BQZ A;  3HKB B;  2LFS A;  5IYZ A;  2E74 B;  1IBK B;  4FLV A;  3LNN A;  4JYA O;  4BWA A;  2HHH B;  3SJB C;  2R9I A;  4PD4 F;  1RFY A;  3LSU A;  4D7T A;  4X62 B;  4WFE A;  2JK5 C;  3PN1 A;  1D2D A;  2IW5 A;  1FFX B;  5J9P C;  1P7B A;  3E8F A;  2PY5 A;  4DV2 B; 
#chains in the Genus database with same CATH homology
 3ABM C;  2ZR3 A;  4PA6 A;  3SYC A;  4G28 B;  1JX9 A;  4MVS A;  4PDL A;  3ZRV A;  3D3I A;  1NH2 B;  1H8E G;  1KEC A;  5IYC O;  2W6J G;  2EIL C;  2IU0 A;  5EC1 C;  2HVK C;  4MW3 A;  4F4L A;  4BAY A;  2W6I G;  4LCU C;  2V1D A;  3ASN C;  3ZJZ A;  4N21 A;  3FB5 C;  1K34 A;  1R3I C;  1K73 W;  4HYO A;  3TET A;  2WLL A;  3IC7 A;  4OXS A;  1AI5 A;  1OCR B;  1I5Y A;  4TWK A;  2K1E A;  1PL0 A;  4JPR A;  4PA3 A;  4JTD B;  4MTG A;  3TK1 A;  2Q69 A;  3K08 A;  5CA3 A;  3QO5 A;  1JOY A;  1NBM G;  4YXW G;  2XND G;  1M90 W;  2ZXW B;  4JAS A;  2HKO A;  2HJF C;  4FPP A;  1LNQ A;  2QKS A;  5B1A B;  1R6N A;  1AJP A;  2P7T C;  3WFV A;  3ZMT A;  3I55 V;  4P9O A;  2WLM A;  1VQ6 V;  3BY6 A;  4KP4 A;  3DTU B;  1EFR G;  4PDV A;  2H94 A;  1OCO B;  4HAM A;  2IJH A;  2X6B A;  2IJK A;  1FXK C;  1AI4 A;  4JTC B;  5BZB A;  1YTF B;  3K79 A;  3JD2 A;  1Q82 W;  4CZZ A;  4WF9 V;  2QA4 V;  2JDI G;  4QE7 A;  4GX5 A;  2DYR B;  1Q86 W;  2WAM A;  2FTK A;  3M99 B;  4MVM A;  2BOB C;  3ABU A;  3E8H A;  3A0R A;  3T4Z A;  3SYP A;  3EHB B;  1K3E A;  1K5S A;  3MHS C;  2AHY A;  5L3F A;  1QLE B;  2WLI A;  4HZ3 A;  3ABK C;  3GB7 C;  1PNM A;  4UVA A;  3SPC A;  4GCZ A;  1GK9 A;  4JF3 A;  1VQM V;  2M7W A;  4DO2 A;  1V55 B;  2X6A A;  2HLD G;  5IY5 C;  1ORQ C;  5B1B B;  2Z5U A;  5H6R A;  3CME V;  1ZWI C;  3HPL C;  1M9N A;  3E89 A;  2EIK B;  2UXX A;  5CBF A;  1QCE A;  4JAV A;  1R3L C;  2EIN C;  4I5S A;  1OCC B;  5CBH A;  3CC7 V;  3EFF K;  5C93 A;  3AG1 C;  1ARO P;  3JD0 A;  5B3S B;  2DYR C;  1W0K G;  3OM3 B;  3RW0 A;  4GT1 A;  2LP7 A;  1JPX A;  1VQN V;  4PA9 A;  4X89 A;  4JYC A;  1WLE A;  4GX2 A;  1S3J A;  3SPJ A;  4MTX A;  2WLJ A;  4TSF G;  4JAU A;  4FMT A;  5KUK A;  4KUM A;  1EBO A;  1H8H G;  2WLK A;  3F7V C;  3LSQ A;  4WFB V;  4PA4 A;  3LDD A;  3B8M A;  3CCE V;  3LUT B;  1WPX A;  4QJF B;  3OEE G;  2QM8 A;  4Z1M G;  1IXM A;  3CD6 V;  1VQ9 V;  3RVZ A;  3B8N A;  2QM7 A;  3G71 V;  4U7N A;  4JGS A;  3RBZ A;  3VBB A;  1K8A W;  5LHG A;  1RM1 C;  2EZP A;  3R65 A;  1J95 A;  4XBF A;  2ZR2 A;  3OE7 G;  2OTJ V;  2XAH A;  1MAB G;  5GW7 A;  1K33 A;  1YJ9 V;  2B1I A;  2F43 G;  4XDL A;  2A9H A;  3ABL C;  2BOC C;  2WLI B;  1S72 V;  3SYQ A;  1I5X A;  2X7R B;  3QNE A;  1JJ2 U;  4LBE C;  1PD3 A;  2P6J A;  1CP9 A;  4RUF A;  5L3D A;  3CCM V;  1M56 C;  3ML0 A;  2H8P C;  1DF5 A;  1KD1 W;  1JVM A;  2QTO A;  2ATK C;  2MK3 A;  1RM1 B;  5L3G A;  1M57 B;  4P9P A;  3ASO B;  4E2L A;  5L3E A;  2JEX A;  4RQF A;  2EIJ C;  1Y66 A;  3E8G A;  4UXN A;  4WFH A;  3W7S A;  2DQ3 A;  3CCR V;  1P4R A;  4P30 A;  1S76 D;  5IY5 B;  2UXN A;  1BHA A;  1PNK A;  1F4M A;  2Q67 A;  2IU3 A;  3ABT A;  3E83 A;  3PJS K;  2WLN A;  1B6Q A;  2DWE C;  2EIJ B;  1V55 C;  3E2E A;  1FFT B;  5B1B C;  4P2Z A;  3OW2 U;  3B77 A;  1JQ0 A;  2JIZ G;  4PDR A;  4WCE V;  1SET A;  3OFN G;  4LP8 A;  3DGE A;  1YTF D;  2XAJ A;  3MHH C;  1YJN V;  1BMF G;  1V54 C;  2Z3Y A;  3UM7 A;  1F51 A;  4BIZ A;  4MW8 A;  3FYI B;  3OR7 C;  2EZO A;  3STZ C;  3UKM A;  2B1G A;  3CC2 V;  2X6C A;  2A0L A;  5EK0 A;  5LGU A;  1M57 C;  2V7Q G;  1VQK V;  5EC2 C;  2P67 A;  1Q7Y W;  3ZIA G;  4RQE A;  1XL6 A;  3FB8 C;  3IGA C;  1R3K C;  1K4D C;  4L87 A;  3OR6 C;  1Y4M A;  2ZD9 A;  2IH3 C;  3NXS A;  1THZ A;  2OT5 A;  3JD1 A;  4PA7 A;  1FXH A;  3HB3 B;  4BW5 A;  1V54 B;  5KUM A;  1FS0 G;  5EBW C;  5DN6 G;  2EJR A;  4RO2 A;  3K3W A;  3OUS A;  3E8B A;  1COW G;  3ETE A;  1QVF U;  1VQO V;  3ASN B;  1ROP A;  2EIN B;  4UVC A;  1VQ7 V;  1G8M A;  3STL C;  3E35 A;  1KP2 A;  5LBQ A;  2A79 B;  5B1A C;  3SPH A;  4QIW F;  1GTO A;  1OCZ B;  4R50 A;  4X8A A;  4MVQ A;  3F7Y C;  1MSW D;  4H37 A;  1XL4 A;  5L3B A;  3P30 A;  1QVG U;  1CPY A;  4UV8 A;  1KP3 A;  4MSW C;  1VQ5 V;  1Q81 W;  1NJI W;  5LHI A;  3X2Q B;  3ASO C;  1PKX A;  4I9W A;  2ZXW C;  2Y69 C;  1S5H C;  4J9Z B;  4QPK A;  1DTO A;  3AEI A;  2GSM B;  2W0F C;  3ABK B;  2P90 A;  1OCZ C;  3ABM B;  2DWD C;  2OCC C;  3OAA G;  3W7U A;  3FB6 C;  1M1K W;  1RPR A;  3K0D A;  4R6Z A;  4MTO A;  3ZMU A;  3I56 V;  4GX0 A;  1E1Q G;  2LFR A;  3CCL V;  1BHB A;  3SYA A;  1H2G A;  3K9A A;  3P32 A;  2NLJ C;  3G6E V;  1R6K A;  1KC8 W;  1VQP V;  3LSS A;  4RUE A;  1S77 D;  1YSC A;  3LNM B;  3TCU A;  3AG2 B;  4DXW A;  1YIT V;  4QPJ A;  4MVO A;  1DLB A;  2NNU A;  1GO3 F;  5CMU A;  4FK5 C;  3CCV V;  1QLE C;  2XAS A;  2C2A A;  5IDJ A;  2IH1 C;  2WLH A;  4QE9 A;  1YJW V;  1GM9 A;  1QR8 A;  3E86 A;  4FIP C;  1G4Y B;  4KFM A;  1W0J G;  5CBG A;  3VOU A;  1R73 A;  1F4N A;  3K04 A;  1QBZ A;  4G2K A;  3W7X A;  5EBM C;  5IYD O;  3CCS V;  4R7C A;  2ZDI C;  1SZT A;  1NH2 D;  3K03 A;  2XOK G;  4PDM A;  1ENV A;  4MVU A;  2EIM C;  3CP1 A;  4ZBM A;  4BIU A;  3ZMZ A;  4Q20 A;  1L1F A;  3CYO A;  3OMI B;  2HVJ C;  1SER A;  1AI6 A;  3AG1 B;  1RPO A;  2DQ0 A;  2WPD G;  2XAF A;  3QO8 A;  4MTF A;  3CCQ V;  2XAQ A;  1TUE B;  3K0G A;  3OMN B;  5L3C A;  3SYO A;  4G27 B;  3LDC A;  3ZRX A;  5H9C A;  3X2Q C;  3ETD A;  4MS2 A;  2WLL B;  1SES A;  3OMA B;  1EZJ A;  4H33 A;  3T4D A;  1S0V A;  4CBC A;  4FJC C;  2YEV A;  3CXC U;  2KB1 A;  2EIL B;  2Q68 A;  3D36 A;  1UJW B;  2OCC B;  3ETG A;  1K97 A;  3JD3 A;  4U7O A;  1F23 A;  5B3S C;  4QNH B;  4TT3 G;  3CCJ V;  3IFX A;  2R9R B;  3ZMV A;  1GMG A;  5LGN A;  1R3J C;  3ZN1 A;  3CPW U;  2XAG A;  5HFM A;  3JD4 A;  1DF4 A;  2Y69 B;  1MOF A;  3AG3 B;  1NR1 A;  3AG4 C;  3ZRW B;  3K06 A;  1K5Q A;  5CN0 A;  3ABL B;  1E1R G;  1JCH A;  3WG7 C;  3OUF A;  2JJ2 G;  4PEL A;  3W7W A;  2Q6A A;  3CCU V;  1QR9 A;  5LGT A;  3CMA V;  5H6Q A;  3AG2 C;  4UV9 A;  3SJQ C;  5DM6 V;  3OGC C;  5KA6 A;  2D3O W;  2IJI A;  2WWW A;  4WFA V;  3OEH G;  3GWO A;  2ITD C;  4RAI A;  3SPI A;  5KA5 A;  2YSU B;  2QE7 G;  3ZN0 A;  1K4C C;  1BL8 A;  3MD0 A;  2DYS C;  3FYE B;  2CK3 G;  5E1A C;  1K92 A;  3F5W C;  5IYB O;  2ITC C;  1KQS U;  3KG2 A;  1OHH G;  1GKF A;  2X0L A;  4ASU G;  1OZ0 A;  4EKW A;  1K9M W;  1QLN A;  1SRY A;  4WFF A;  3ZMS A;  1MG1 A;  2Y48 A;  1CEZ A;  1M56 B;  4X88 A;  1W2B U;  1E79 G;  2ZDI A;  4UVB A;  4XDJ A;  3H01 A;  3RVY A;  1N8R W;  2AHZ A;  1FXK A;  3G4S V;  1OCR C;  1VQ4 V;  1NQT A;  3BEH A;  4N23 A;  2OTL V;  4UUJ C;  5B1N A;  3FB7 C;  1YHQ V;  2PI4 A;  2EIK C;  3QO7 A;  4ZKI A;  1AR1 B;  1FXV A;  2ZQM A;  2QEX V;  3CC4 V;  2EBO A;  1K7D A;  5EBL C;  2HR3 A;  4JYB A;  2EIM B;  1OCO C;  3LDE A;  5HFL A;  4GX1 A;  1YI2 V;  2GHY A;  3JCZ A;  1OCC C;  1NVP B;  2B5U A;  2JEU A;  4MT8 A;  3ZRS A;  2LFS A;  5LHH A;  4JTA B;  2DYS B;  1VQL V;  2IJJ A;  3T2M A;  1NVP D;  3WG7 B;  1AI7 A;  1AJQ A;  4MVR A;  4R8C A;  3W7T A;  2R9I A;  1GM7 A;  5B1O A;  1H38 A;  3AG3 C;  3AG4 B;  4J9Y B;  2JJ1 G;  4MVZ A;  3T1C A;  1FXK B;  2PI5 A;  1KKD A;  2HFE C;  3ZRW A;  4WFE A;  1YIJ V;  1GM8 A;  2JK5 C;  3JYC A;  2HG5 C;  2WSS G;  3FKS G;  1HWY A;  4WFG A;  4LC1 A;  2IW5 A;  4XDK A;  1PNL A;  2DW4 A;  3SPG A;  5J9P C;  1VQ8 V;  1P7B A;  3E8F A;  2YEV B;  1NKD A;  3ZCC A;  1AJN A;  5FL7 G;  1NR7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...