1I5XA

Hiv-1 gp41 core
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
61
structure length
61
Chain Sequence
IVQQQNNLLRAIEAQQHLLQLTVWGIKQLQAASGGRGGWMEWDREINNYTSLIHSLIEESQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural and functional analysis of interhelical interactions in the human immunodeficiency virus type 1 gp41 envelope glycoprotein by alanine-scanning mutagenesis.
pubmed doi rcsb
molecule keywords TRANSMEMBRANE GLYCOPROTEIN (GP41)
molecule tags Viral protein
source organism Human immunodeficiency virus 1
total genus 27
structure length 61
sequence length 61
ec nomenclature
pdb deposition date 2001-03-01
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.210 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 1i5xA00
5H9CA 1QCEA 2LP7A 1QR9A 4FJCC 1JPXA 1MG1A 1I5YA 4JGSA 3MHSC 5CMUA 5HFMA 5KA6A 2MK3A 4N23A 3GWOA 1QR8A 1Y4MA 2OT5A 1DF5A 3B8NA 1QBZA 2EBOA 4JF3A 3CP1A 3M99B 3WFVA 4E2LA 3P30A 5KA5A 3CYOA 1MOFA 3MHHC 1I5XA 3B8MA 4FIPC 2EZPA 1Y66A 1EBOA 1DF4A 4N21A 3K9AA 1K34A 3B77A 4JPRA 5HFLA 1SZTA 4G2KA 5CN0A 1DLBA 1F23A 2EZOA 4FK5C 1JQ0A 2M7WA 2X7RB 3H01A 1ENVA 1K33A 2P6JA
chains in the Genus database with same CATH superfamily
3CRQA 3T1HO 3ASNB 2E75B 2W6JG 2XAJA 1KBHA 4X65B 5IWAB 5E79Z 3BHPA 3JSLA 2M6YA 1UFIA 1KP2A 2P90A 1LNQA 3RYIA 4JI2O 4MVZA 1WA8B 2WA4A 2YS8A 4IT5A 3WB2A 1P84F 2HVKC 2BTOA 1PL4A 1X4TA 1SQXH 2VQFO 2QWOB 5GONB 3CRRA 4FLVA 1DF5A 1S5HC 4OXSA 4JAAA 4E2LA 3AK1A 3UM7A 4FZ0A 2DOSA 2ATKC 2IJKA 2Z5UA 1WB8A 4RWUA 4GZRB 4RQFA 2LFSA 2YXYA 1NR7A 4EFEA 4MW8A 1NU1H 3T1HB 4DR1O 3F7VC 2EZOA 3H01A 1M56B 5H9CA 1GN6A 5K1XA 3AG2C 1YJ9V 3ZN0A 4WBNB 1K4DC 1RPRA 4DK1A 2PI4A 4JI2B 4U7OA 2PYJA 1OCOB 1Y74A 5KUMA 3SYAA 5IYZB 2RJZA 3KKYA 1K34A 2VQFB 1CPYA 1BE3H 1XBLA 1FXKA 3DXRA 4K3AA 3JAKA 1XREA 1FXHA 2X7RB 3IAYA 1GTOA 5DN6G 3OGCC 4XBFA 4JTDB 3SPCA 4ASUG 1Q8IA 1AJPA 4Q6GA 4PI0A 2ITCC 2GBOA 4DR1B 3SDLA 3K04A 4LWSB 5C93A 1U97A 5IDJA 1F23A 4MVRA 5LYJB 1QNMA 1JCHA 2A9HA 1K33A 2BCCH 4FM1A 4NKGB 4DUYO 2F1MA 4BWAA 3W7TA 5LHHA 5KMGB 3W7WA 4H0LB 2OIEA 3ABMB 1Q6IA 1CP9A 3BPZA 1KB9F 3G6EV 4UCRA 4DYLA 5BZBA 1H38A 4JYYA 3LNNA 2DE0X 1L8DA 2JRIA 3CCVV 2EIKB 4X88A 1VF6A 2X6CA 4H33A 3WG7C 2XAFA 5EBLC 1YCIA 3A0HZ 3EXAA 1LUWA 1EM1A 4O4IA 1AR4A 4DUYB 3CEIA 5IJ0A 2A79B 3GVMA 5BY1A 4JTCB 4I9QA 4A5UB 2WLMA 1QLEC 3P3NA 5LOVA 2ITDC 3LNMB 2BSKA 5FLXN 3D3QA 4YIOA 2P4KA 1WP7A 3OFNG 1B3QA 2WLLA 3S3WA 4ZOLA 3ZRXA 4UV8A 4UVBA 2PF4E 2BOBC 2L35A 4I5SA 1Q86W 1WNSA 3ZIAG 1Q43A 4I0XA 3M7MX 3CPWU 2KG7A 4TT3G 4FLWA 1U96A 3RWRD 2YEVB 3Q4HB 5B66Z 3IC7A 4DV1O 4TUYB 3F7YC 1IZ3A 2ZQMA 3W7UA 2AW9A 2PZSA 2P06A 4W4LA 4LFAO 3HPLC 2HFEC 3JASB 4BAYA 2NNUA 1VARA 3QVNA 3SJAC 2GSMB 1TGOA 1JFFB 2W6IG 3OTFA 4JI0O 1K97A 4PELA 3E89A 4FVMA 1HNXB 2GHYA 2CTWA 5LP6A 4MTOA 3ABLB 4LFBB 5TISZ 3ZMZA 1QVGU 3E86A 2UXBB 4YJ2B 1R3IC 4DV1B 1EN4A 4LF9O 1AP5A 3JCZA 2Y0PA 3P30A 3ML0A 1SESA 5KHKA 4LFAB 5CA3A 1Q6HA 4O2BB 1WA8A 1S0VA 2Q8VA 4R7CA 4X62O 4DR6O 3AK3A 4P9PA 4DV4B 3ZHVA 5EBMC 2Q67A 4X64O 3R65A 1XNQO 2D2CB 2Y4TA 3TCUA 1TA8A 1N36O 4JI0B 4QIWF 2HJFC 3ASNC 4HBNA 1M4UA 5EZYB 2WWWA 5JCOC 1BS3A 3OE7G 1P4RA 2WLKA 4LF9B 1H8HG 2JEXA 3RVYA 2WA3A 4WBNA 1FYJA 1VIBA 1ZTEA 5E1AC 1VQLV 3JAWB 5EIBD 4X62B 4DRXA 1SQFA 3JD0A 1AJQA 1JJOA 2CTRA 4LF8O 4IYIA 3CXCU 4X64B 1XNQB 3BVOA 2QDOA 3K0DA 1BSMA 1NTKH 4FLUA 1N36B 2LW7A 1M5IA 2Q68A 1B6QA 1IX9A 4FZ1A 1I08A 1QHTA 4J11A 2WLHA 4UB8Z 1NTZH 2G38A 1MMMA 4JF3A 4B3RO 4ZHQA 1M56C 1D2DA 4PV1B 3CSXA 3H1LH 4G28B 4YHHO 2Y4UA 5LYJA 2ADPA 3BY6A 1JQ0A 2IBZH 1H2KA 5LA6B 4JI3B 4MSWC 3ETEA 4DR4B 2ZIMA 4JZ2A 4CS2A 4LF8B 4J7JA 4YJ3B 4H37A 1M57B 1AILA 1IVSA 2YICA 3K9AA 4NYKA 2LFRA 2DMXA 2ILMA 1BHBA 3K5OA 4MVQA 1QCEA 5H5NA 4B3RB 1TVKB 2QWPB 3TXSA 1IBLO 1PP9H 3RT3C 4KFMA 4YHHB 4QE7A 2GUZB 1AI4A 2QWRB 5JJNB 1K4CC 4LH6A 2DQ0A 3ABMC 4U3JB 2Q0AA 5JVDA 1WN7A 1LR1A 2OTLV 3CHXA 2P5OA 4O4LB 2EILC 5H6QA 2OT5A 3SPJA 2DWEC 1IBKB 1GM9A 1EN6A 3CRMA 3BFRA 4H13B 4I55B 3E22A 1KKCA 4WFHA 1BGYH 1SZTA 3G6BA 2EIKC 1IBMO 5LBQA 1IBLB 2BTQB 1EN5A 2JJ2G 3E2EA 2O57A 3C90A 4BW5A 5FL7G 1XOUA 4RUEA 1VQ5V 3Q4HA 2EIMB 3WG7B 4XDLA 2YXHA 2YIBA 1QBZA 3APOA 5GTHZ 3E8FA 3HKEA 4B3TO 3BRCA 1SQBH 2F66C 1W2BU 1OCZB 1DLBA 3C3TA 1LUVA 2X6AA 3W7SA 1WPBA 3CCSV 3JD4A 2K9PA 2QM4A 4ZI7A 1XL6A 4QPJA 1JFFA 2CTPA 4LR3A 4B08A 4QJFB 1ZWIC 2YUAA 1GH6A 1JOYA 3STZC 1AROP 5CBHA 4BR6A 2QKAA 5K1PA 4DV5O 4FIPC 2WPDG 3H1JH 4Z1VA 2CUGA 1MNGA 3K58A 4GX1A 2VWJA 2GTAA 4IYHA 1IURA 2DYRB 2OCCB 3KCYA 4YJ2A 3L70H 2YIDA 4J7KA 1KC8W 1TAEA 2ZNIA 5CA1A 5LMUO 5GW7A 3CJHA 1R6KA 1URFA 1BZKA 5KAFZ 3THOA 1SF9A 1F4MA 3JARB 1NKDA 4TV8A 3L75H 4ICGA 1PL0A 5BMVA 2XUMA 5JH7B 1WAZA 2A0LA 3ABLC 2RCVA 1K3EA 4DV5B 1KKDA 1S77D 2PI5A 1H2NA 1WPXA 5EZYA 1YITV 3HKDB 4X9QA 2AZ2A 1Y67A 1WB7A 4UVCA 2YC0A 4JGSA 1EFRG 1M9NA 1N32O 4LFCO 4LBEC 2HG5C 3VQXA 2PYLA 2EINC 3ZRSA 2V7QG 2OCHA 3C3SA 5ITZA 2Q7GA 3UT5A 2VQEB 1YI2V 3QO7A 3WFVA 3N27A 1XQ8A 4PA7A 4X20B 1H2MA 3E35A 1BT8A 1YZBA 4IHJB 4MTXA 1N4CA 3JALB 2R72A 2XTAA 2Q73A 4J41A 3D36C 3KCXA 3GB7C 5IJ9B 3E8BA 3FB7C 5L3GA 1MZFA 3G4SV 3STLC 3I5DA 4UCSA 5F2VO 3OT7A 1VQ8V 5D5QA 3EVKA 2ARHA 4TOIA 1MSDA 2A3QA 5LA6A 1N32B 4X1IB 4O2AA 4LFCB 2XASA 2ZE7A 4QPKA 4WFFA 1BMFG 1Q5OA 1A32A 1SZXA 1SERA 3ABKB 3CYOA 4Z2WA 5FNVB 3HR0A 1QU7A 2XOKG 3AG1B 2ZT9B 3PN1A 3ZMVA 4X66O 2CTQA 2LJ2A 2QEXV 3O65A 4DK0A 2EJRA 2FMLA 4P30A 2R9IA 1W59A 3AEIA 4IL6Z 3T1YO 4I9WA 3B40A 4GUNA 2KQXA 2ETNA 2GV9A 4J42A 4F6RB 3UO3A 2QM7A 4EB6B 3JATA 2P7TC 1E1RG 1HWYA 4TSFG 1SRYA 4K8XA 1PNKA 3ABUA 3FKSG 3A0RA 4FLXA 2YIBD 1M57C 1FKAO 2ZDIC 2V4DA 2Q6AA 4DV3O 5FPRA 4B3SO 5DECA 2UUAB 4X66B 1FFXB 3U11A 1B06A 4I4TB 4L8JA 3K5MA 1JR9A 5J2TB 5AG2A 4O4JA 1SKVA 5CN0A 3ZMSA 2BTQA 3T1YB 4HAMA 4IIJB 2LGQA 1OV9A 2KSDA 1ENVA 3BABA 1R3KC 1MG1A 1K92A 5CA0B 3FYEB 3B4SA 4PA4A 5IYBO 4NVPA 4FM2A 1R3LC 2EBOA 3P32A 5CB4B 1SQVH 2LGWA 5B1AB 4J9ZB 5JWPA 2N04A 4HZ3A 1M93A 2D3OW 2B9ZA 2ZE5A 3P3PA 4DV3B 4B3SB 4JI8O 1SA0A 5KX5B 2HR3A 2EILB 1AJNA 4MT8A 5KHGA 2ZXWB 2Q5ZA 1BHAA 3CRCA 1Q7YW 5KLVH 1G8MA 3HB3B 1ORQC 4B7EA 2WLIB 2A06H 4J7ZA 3R66A 3DGEA 2AGAA 2JJ1G 2ZD9A 2QKCA 3I56V 1NH2B 2EIMC 2XNDG 4FFKA 3FAVA 3N2GA 1KU9A 4BW9A 2YIAA 1YJWV 1OCZC 5L3DA 4JI5O 3CRAA 4UFZA 4MVMA 2AHYA 2OIGA 2B1IA 4JI8B 2ZINA 1H8EG 2DJVA 1HNXO 2E74B 4L87A 1PM9A 2AXTZ 4JI7O 4LFBO 4E4EA 2CDYA 2PGGA 2Q9LA 2CH7B 2DYRC 1R3JC 4DUZO 2OCCC 1XUQA 5B3SB 2UXBO 4U3FH 1V55B 4LF7O 3ETQA 3K0GA 2Q0OC 5HFLA 2JGDA 5JQGA 5EK0A 1S3JA 1RSOB 4JI5B 3SJCC 4PA3A 2YSUB 2PY5A 4IGGA 1T5EA 3APQA 3FB5C 3K06A 5L3FA 1VQ4V 4FFBB 4DV4O 5H2FZ 2OTJV 4UVAA 4CH4A 1J5EO 2EIJB 1Z5VA 1NZ6A 3CC4V 4AILC 1NT2B 4GT1A 4AQYO 4OX9O 2H8PC 2NR5A 4JI7B 3RBZA 3B09A 1H2LA 1MABG 4FLTA 5KHJA 3GWKC 4DUZB 4IHJA 1DTOA 3IGAC 3RN4A 3JALA 1UJWB 5JCOA 4Q20A 2QWQB 5L3EA 1Y76B 4LF7B 4UXNA 3ZRWB 4X1YB 4EEQA 1US6A 3N2KB 4R6ZA 5LGNA 1OJHA 1B04A 1YVWA 1XMOO 3OW2U 2FB5A 2HVJC 4MS2A 1SQQH 4CC5A 1J5EB 1N33O 4DR3B 5GONA 5KAIZ 2F93B 3AG7A 1I5YA 3CCRV 3G80A 3ZX6A 1W0JG 1RM1B 2CAZC 3BEHA 2JS3A 3CCQV 2EINB 4AQYB 1PNLA 4OX9B 3O9OA 2YI9A 1PPJH 4B3MO 1I5XA 1NQTA 1V54C 3HKBB 4I50B 3LSUA 3ZHQA 1AB3A 1R73A 5J9PC 3A0BZ 1S72V 3TGUH 2WLNA 3L72H 4QGPA 5IYZA 4NTWA 4JI3O 3E8GA 1XMOB 2EX3A 1GN2A 4DR4O 4RAIA 2KB1A 1XMQO 1N33B 1J95A 1ROPA 3RYHB 4WF9V 3ABKC 1COWG 1Q3EA 3AG1C 1BQ0A 3F5TA 3JD1A 1K5QA 4K0KB 5JJEB 1VQ7V 4B3MB 2HHHO 5B1BB 2QTSA 4G27B 5LXTB 2Y69B 4I4TA 1R1BA 1TUBB 1ZL8B 2KKWA 4DV7O 1DK1A 4LWSA 4IIJA 2E76B 4OGQB 2AHZA 5LHIA 3BA8A 1FJGO 5CA0A 1QR9A 5A2QN 3TXQA 2VRZA 3MHSC 4HNAB 4OPAA 5CB4A 2R9AA 5KMGA 1XMQB 5GTIZ 1QLNA 4NR1A 2W0XA 1QQCA 1DF4A 3LDCA 4F4LA 4GCZA 1IBKO 1X59A 2QKSA 2E5LB 4U7NA 1N34O 2HHHB 3SJQC 3ZEDA 3ASOB 3IFXA 3CCLV 4KXRA 4LC1A 4DV7B 1UPGA 2FL4A 5B1OA 3CD6V 3X2QB 1NVPB 3ZHSA 5EBWC 2YDEA 5D5PA 4QNHB 1KMIZ 1FJGB 1AR1B 5B1AC 2LO1A 4HYOA 2IM9A 4P2ZA 5IYDO 2HP8A 2ZXWC 3G67A 2UUCO 3K08A 3CWBH 1N34B 1Y74B 1L1FA 5FPOA 1FXKB 3DXRB 3JAKB 3L71H 4GX2A 1YJNV 2YEVA 3H1KH 4TUYA 1XNRB 4YIPA 1YTFB 3VQYA 2P4VA 1S76D 4CZZA 1SETA 4WFBV 3T2MA 3JASA 4FK5C 4PDMA 2YXLA 1GO3F 2UU9O 4FJCC 2UUCB 3TK1A 2XAQA 3OR6C 3OMNB 3ZRVA 1QVFU 2LW1A 1Q81W 1G6UA 4ZIBA 3CCJV 1GK9A 1SS3A 1P7GA 4JYAO 3CXHF 5EC1C 2HLDG 5B3SC 1F51A 1V55C 2ZE8A 4JI1O 5L3CA 5BR8B 2Y48A 4PDRA 1L0LH 1AVMA 1TUEB 1HP8A 1Y76A 3K3WA 4P9OA 3ZRWA 2F4VO 1L0NH 3N2KA 3E8HA 4K35A 4O2BA 3T4DA 2VS0A 3QO5A 2R9RB 1V9PA 3FD9A 4LF6O 2Q7HA 5LMNO 2P22C 1JJ2U 2UU9B 2RN9A 2EIJC 4O4IB 5IJ0B 1P7BA 3OUFA 1KECA 3LDDA 2VQEO 1MZEA 2B5UA 1O9HA 4JYAB 1ZSPA 2CGOA 3IC9A 3G71V 4UUJC 3B8MA 5KHHA 1NI8A 2BSKB 4KP4A 4AI8A 4JI1B 4DV6O 4O4HB 1M90W 4GKKO 1HNWO 1GN3A 2WLLB 1YIJV 1HR0O 3VQVA 1FXVA 3JD2A 2FYUH 4KL1A 3OMIB 3E83A 3D36A 1XHXA 4DR5B 1N0JA 2LP7A 2F4VB 3JAWA 4N23A 1Z2GA 4I0XB 1RFYA 4WFGA 2Z3YA 2JK5C 4NB5A 3SPHA 4LF6B 5LMNB 4TV9B 3OM3B 1RM1C 1XEQA 4N21A 2QTOA 3RYHA 2IW5A 3UQ8A 1S5JA 1K8AW 4RQEA 2JS5A 3NXSA 1IXBA 1JPXA 1VEWA 2DQ3A 1V54B 4GKKB 4DV6B 1HNWB 4NTXA 1HR0B 4XDKA 2JIZG 4R50A 5LP6B 1OZ0A 2WSSG 4J10A 1YHQV 5L3BA 4PJ0Z 4HNAA 4UCUA 4I7ZB 1NH2D 4PHZA 4GKJO 4X89A 2MK3A 1GAXA 1K9MW 4YJ3A 2IJIA 2ZDIA 3MDSA 1F7YA 1I7FA 1JA8A 5B1BC 1OCCC 2UUAO 3B77A 4JPRA 2ZIOA 2Y69C 3QO8A 1AI7A 3OEHG 2UUBO 4MTGA 3I55V 1TVKA 4LF5O 1BQZA 2QM8A 4Z1MG 1R6NA 2HJDA 1E1QG 3AG4B 2GUZA 4NXMO 2EJ7A 5JJJB 3BA9A 2ZE6A 2IH3C 2L6LA 3LSSA 5C8YB 4U3JA 4GKJB 1ZAUA 4X1KB 1VF7A 1EZVH 1Y6XA 3D3IA 4O4LA 2F23A 3H1HH 3HKCB 3CE2A 3W7XA 3ASOC 4EFBA 4DRXB 4ZKIA 4I55A 3FYIB 2UUBB 5H6RA 4PDLA 2UXCO 2AZ0A 4LF5B 3F5WC 4EKWA 3X2QC 3B2EE 1Q90D 4NXMB 1AR5A 3OUSA 1QR8A 2E3CA 2C2AA 5A9GA 3ZCCA 4GX5A 4ZHQB 5IYCO 4OPHA 1THZA 4DV0O 3KG2A 1I94O 4JYCA 3A2FA 3K5NA 1BCCH 1JMKC 2WAMA 3FX7A 1SQGA 3K59A 2PUSA 3ZHUA 1HW7A 3CCUV 4FM0A 1FXKC 4TWKA 4J80A 4MVOA 4TQDA 3H1IH 5IY5B 1AI5A 2IJJA 3DC6A 2DN9A 1FFTB 5CBFA 1MSWD 2UXCB 2IH1C 4FPPA 4CH5A 2RDCA 4KUMA 3RYCB 4D7SA 2UXDO 4LCUC 2QJ1A 1XDCA 3MAQA 3J7AU 3DTUB 5HFMA 5EIBC 2QSAA 1K7DA 3CC7V 1CXZB 4DV0B 3EFFK 3RW0A 1I94B 4LNUB 3K5LA 4BIZA 4JI6O 2DYSB 4D7TA 3TJTA 3JARA 4C7UA 3SPIA 1NTMH 3CMEV 3OD4A 3JD3A 1Q6UA 2N05A 1VQKV 2NN4A 1MA1A 4JAUA 4FLZA 1VQ9V 4TQFA 5JH7A 1M1KW 1R6TA 1JX9A 4FMTA 5JVDB 4YXWG 4JV5O 4CH3A 1OHHG 4CS3A 3PJSK 3ZHTA 3KZIZ 4LH7A 5KA5A 4O4HA 1MOFA 3HKDA 3VQWA 3JYCA 1NBMG 2QGNA 5BXZA 2UXDB 5J2UB 3E22B 2UXNA 4PI2A 1SC5B 2Q7EA 5LHGA 1VQNV 1OCRB 4DW1A 1VF6C 3BAAA 3OAAG 1GRJA 4WFEA 4JI4O 4JI6B 3QTCA 3UKMA 2ZR3A 4DR3O 3DC5A 4TV9A 1GM7A 2R70A 4QE9A 2CE4A 3SYCA 4XDJA 3HKEB 4PA6A 1Z5WA 4H44B 2UXXA 3VOUA 1AI6A 2H94A 1Q82W 4JV5B 1VQ6V 3CS5A 2P67A 4ZI7B 4X20A 1WJZA 3NR7A 4MTFA 3ETGA 5LGTA 4X8AA 4LP8A 4PDVA 5IJ9A 5EYPB 1FD9A 2IU3A 4CBCA 1NJIW 3AG3B 3ZN1A 3CCMV 3QG5A 3L73H 3CMAV 1NVPD 4JI4B 2X0LA 4X1IA 3J80N 3FFQA 4DR7O 1IDSA 2F43G 3RVZA 2QWNB 3EHBB 1EZJA 2JVDA 1Y4MA 3FB8C 5CA1B 4JTAB 5FNVA 2GTSA 3CJHB 1H2GA 3SYQA 1H2SB 1YSCA 2V1DA 4K0KO 4PA9A 2CGNA 4LF4O 4F6EA 3U0ZA 4BIOA 2WLJA 4TV8B 1SQPH 4UV9A 1XHZA 2QE7G 3A8TA 5BMVB 3AK2A 2B1GA 1K73W 5LP6C 3RYFB 2RQ6A 1FAFA 3T4ZA 1GKFA 2NLJC 3S3XA 4F6RA 1HNZO 1YXBA 4EB6A 3K03A 3ABTA 2ZNJA 2GDSA 5C8YA 1Y66A 4DR7B 4X1KA 3OR7C 1XI1A 1ZUQA 2M7WA 4KHPO 1YTFD 1NR1A 3HKCA 1ZLZA 2E5LO 2K1EA 4GLXA 4GX0A 2JGUA 2Y0IA 1FFXA 1OCCB 1HDJA 4BIUA 1FS0G 4DR6B 4LF4B 3MHHC 5J2TA 3L74H 4W4KA 3LSQA 1YDXA 2H3OA 2ZM6O 4CH6A 2XHBA 2X6BA 4ABMA 2ZKOA 3AG4C 5ITZB 3CC2V 3UT5B 2W0FC 4YY3O 3J81N 1ZX3A 1XILA 1KUQA 1HNZB 1YF2A 5KA6A 1WP8A 3TETA 1GM8A 2QR4A 4UCOA 1G1XB 3WU2Z 2BOCC 4WFAV 2IU0A 3D8CA 3DSQA 4DW0A 2Q69A 4KHPB 2Z0AA 4CC6A 3RYIB 5KX5A 3AG2B 1OCOC 1DGSA 1JVMA 5IE9A 1PKXA 1GMGA 1D5NA 1PNMA 5B1NA 1VMGA 4DO2A 2FKXA 2PTMA 4O2AB 1O9GA 3OMAB 3ZJZA 2ODMA 3QNEA 2WLIA 3ZHRA 3CP1A 4UCVA 2ZM6B 2JEUA 3QF7A 4JZGA 2IJHA 1N8RW 4MVUA 1GN4A 3SJBC 3RYCA 4YY3B 1XNRO 3SR2C 2EULA 3M8AA 3OGIB 2JDIG 2BE3A 4PD4F 4D6TH 1P49A 4G2KA 2HEPA 2DW4A 2XT9A 4UCTA 4LNUA 4MW3A 3ZMUA 5CBGA 1K5SA 1VF5B 2ZCEA 3JATB 2HKOA 1I0HA 1W0KG 3SYPA 5IY5C 4MVSA 3WB0A 2QA4V 3K79A 2ADQB 1BL8A 1G4YB 2LQTA 4JASA 4DV2O 2CH7A 5BR8O 1VQPV 4WCEV 4JAVA 5J2UA 1PV0A 1AP6A 2VWKA 1VP7A 1F4NA 3ETDA 3LUTB 4O4JB 4B7KA 1RSOA 1RPOA 1XL4A 2DYSC 3RFRA 4FFBA 2N74A 4DR2O 5KUKA 4K8ZA 1KYOF 3JSNA 2YI8A 4ZBMA 4RO2A 1VQMV 4UB6Z 3VBBA 3JAMN 3K57A 4AHCA 1NS1A 3OEEG 3U10A 4DV2B 4JYBA 1QLEB 1S5LZ 1SA0B 5EC2C 1KD1W 5CMUA 3CX5F 1CEZA 5EYPA 4DR5O 1D5AA 1OCRC 4DXWA 2CK3G 4X1YA 1IBMB 1YEWA 1KQSU 3ZMTA 2MW2B 4DR2B 3FAVB 3N2GB 2DWDC 3SPGA 2OWOA 3SYOA 3ZS8C 3ZBHA 3FB6C 5KHIA 4B3TB 3OTOO 4NXNO 4I50A 5LOVB 3HKBA 1N0NA 1VQOV 2EZPA 5LGUA 1E79G 4ZOLB 4J9YB 3H9VA 4R8CA 3AG3C 3RYFA 2F95B 4NTYA 3IJ4A 3GWOA 4CS4A 3B8NA 2KG7B 4GYCB 1KP3A 3M99B 2FTKA 3T1CA 1WLEA 5DM6V 3JCUZ 3WB1A 5DEDA 2A7WA 4X65O 5IWAO 3CB2A 2XAGA 5LL6Y 2JGDB 5JQGB 5LMUB 1IXMA 5B5EZ 3OTOB 4RUFA 4NXNB 3UCSC 5LXTA 3RGBA 3UO2A 2RNBA 4FLYA 1TUBA 2XAHA 2ZR2A 2RMKB 1ZL8A 3MD0A 2Q4PA 3CCEV 1EBOA 3BCCH 1RP3B 3L9DA 1PD3A 2OYQA 3SGIA 3K9SA 3ICXA 3LDEA 5IT9N 1FPOA 2P6JA
chains in the Genus database with same CATH topology
4BW5A 5FL7G 5J9PC 3DTUB 3ASNB 5HFMA 4RUEA 1VQ5V 2W6JG 2XAJA 1S72V 1K7DA 2EIMB 3WG7B 4XDLA 3CC7V 1QBZA 2WLNA 3EFFK 3RW0A 4BIZA 3E8FA 3E8GA 4RAIA 2DYSB 1KP2A 2P90A 2KB1A 1LNQA 3SPIA 4MVZA 1J95A 1W2BU 3CMEV 1OCZB 1ROPA 3JD3A 1DLBA 2HVKC 1VQKV 4JAUA 4WF9V 3ABKC 2X6AA 3W7SA 1VQ9V 3CCSV 1M1KW 1COWG 3JD4A 3AG1C 1JX9A 1XL6A 4FMTA 4QPJA 4YXWG 3JD1A 1K5QA 4QJFB 1VQ7V 1ZWIC 1OHHG 5B1BB 3PJSK 4G27B 1DF5A 1JOYA 3STZC 1S5HC 4OXSA 2Y69B 1AROP 5CBHA 4E2LA 5KA5A 3UM7A 1MOFA 4RQFA 2IJKA 2ATKC 2Z5UA 4FIPC 3JYCA 2WPDG 1NBMG 2LFSA 1NR7A 2UXNA 4GX1A 4MW8A 5LHGA 1VQNV 2AHZA 2DYRB 1OCRB 3F7VC 5LHIA 2OCCB 2EZOA 3H01A 1M56B 3OAAG 5H9CA 1QR9A 1KC8W 3MHSC 4WFEA 3AG2C 1YJ9V 3ZN0A 5GW7A 3UKMA 1K4DC 1RPRA 2ZR3A 2PI4A 1R6KA 1QLNA 1GM7A 4U7OA 4QE9A 1OCOB 3SYCA 5KUMA 3SYAA 4XDJA 4PA6A 1DF4A 3LDCA 1K34A 4F4LA 1F4MA 2UXXA 1CPYA 1NKDA 4GCZA 2QKSA 3VOUA 1AI6A 2H94A 4U7NA 1Q82W 1FXKA 1PL0A 1VQ6V 1FXHA 2X7RB 1GTOA 2P67A 3SJQC 2A0LA 3ASOB 5DN6G 3ABLC 3OGCC 3IFXA 4XBFA 1K3EA 4MTFA 3ETGA 4JTDB 3CCLV 3SPCA 5LGTA 4ASUG 1KKDA 1AJPA 4LC1A 1S77D 4X8AA 4LP8A 4PDVA 2PI5A 2ITCC 5B1OA 1WPXA 3CD6V 2IU3A 3X2QB 4CBCA 1NVPB 5EBWC 1NJIW 1YITV 3AG3B 4QNHB 3ZN1A 3CCMV 3K04A 5C93A 1AR1B 5IDJA 1F23A 4MVRA 3CMAV 1NVPD 5B1AC 2X0LA 1JCHA 2A9HA 1K33A 4HYOA 4P2ZA 4UVCA 4JGSA 5IYDO 1EFRG 2F43G 3RVZA 3EHBB 1M9NA 1EZJA 1Y4MA 3FB8C 4JTAB 2ZXWC 3W7TA 4LBEC 2HG5C 5LHHA 3W7WA 1H2GA 3SYQA 3K08A 1YSCA 2V1DA 3ABMB 1CP9A 2EINC 3ZRSA 4PA9A 2V7QG 2WLJA 3G6EV 1L1FA 4UV9A 1YI2V 2QE7G 5BZBA 1FXKB 3QO7A 3WFVA 1H38A 2B1GA 1K73W 4PA7A 3E35A 4GX2A 1YJNV 3T4ZA 4MTXA 2YEVA 1GKFA 2NLJC 3GB7C 3CCVV 2EIKB 4X88A 3K03A 3ABTA 3E8BA 3FB7C 2X6CA 5L3GA 4H33A 3G4SV 1Y66A 3WG7C 1YTFB 2XAFA 3STLC 1S76D 4CZZA 5EBLC 1SETA 4WFBV 1VQ8V 3T2MA 3OR7C 4FK5C 4PDMA 2A79B 2M7WA 1GO3F 1YTFD 2XASA 4FJCC 1NR1A 4QPKA 4WFFA 3TK1A 2XAQA 2K1EA 3OR6C 4GX0A 3OMNB 1BMFG 4JTCB 3ZRVA 1QVFU 2WLMA 1QLEC 1OCCB 1Q81W 4BIUA 2ITDC 1FS0G 3LNMB 1SERA 3ABKB 3CYOA 3MHHC 3CCJV 1GK9A 2XOKG 3AG1B 3OFNG 2WLLA 3ZMVA 3LSQA 5EC1C 2HLDG 3ZRXA 2QEXV 4UV8A 2X6BA 5B3SC 3AG4C 4UVBA 1F51A 1V55C 5L3CA 3CC2V 2EJRA 2W0FC 2Y48A 2BOBC 4PDRA 4I5SA 1Q86W 3ZIAG 2R9IA 1TUEB 3AEIA 4P30A 5KA6A 3CPWU 3TETA 1GM8A 3K3WA 4I9WA 4TT3G 4P9OA 2YEVB 3ZRWA 3IC7A 3E8HA 2QM7A 3F7YC 2BOCC 4WFAV 3T4DA 2P7TC 3QO5A 1E1RG 1HWYA 2IU0A 2R9RB 2ZQMA 3W7UA 2Q69A 4TSFG 1SRYA 1JJ2U 1PNKA 3ABUA 2EIJC 3AG2B 1OCOC 3FKSG 1JVMA 3A0RA 3HPLC 2HFEC 1M57C 1PKXA 2ZDIC 4BAYA 1GMGA 1PNMA 2NNUA 1P7BA 5B1NA 3OUFA 1KECA 2Q6AA 4DO2A 3LDDA 2GSMB 2W6IG 3OMAB 3ZJZA 2B5UA 3QNEA 2WLIA 3CP1A 2JEUA 3G71V 1K97A 2IJHA 4PELA 1N8RW 3E89A 4UUJC 3B8MA 2D3OW 4MVUA 4KP4A 1M90W 2GHYA 2WLLB 3ABLB 4MTOA 1YIJV 5CN0A 1FXVA 3JD2A 3ZMSA 3ZMZA 3OMIB 4HAMA 3E83A 2JDIG 1QVGU 3D36A 1ENVA 4G2KA 3E86A 2LP7A 1R3KC 1MG1A 2DW4A 1K92A 1R3IC 3FYEB 4N23A 4PA4A 5IYBO 3JCZA 4WFGA 1R3LC 2Z3YA 2EBOA 2JK5C 4MW3A 3P32A 3SPHA 3ZMUA 5CBGA 1K5SA 3ML0A 3P30A 1SESA 3OM3B 5B1AB 5CA3A 4J9ZB 1RM1C 4HZ3A 1S0VA 4N21A 4R7CA 2QTOA 2HKOA 1W0KG 3SYPA 2IW5A 5IY5C 4MVSA 4P9PA 2QA4V 1K8AW 3K79A 2HR3A 2EILB 1AJNA 4RQEA 4MT8A 5EBMC 2ZXWB 1BHAA 1BL8A 1G4YB 2Q67A 3NXSA 3R65A 1Q7YW 3TCUA 1JPXA 1G8MA 4JASA 3HB3B 1ORQC 2DQ3A 1V54B 1VQPV 4WCEV 2WLIB 4QIWF 2HJFC 4JAVA 3DGEA 2JJ1G 3ASNC 2ZD9A 4XDKA 2JIZG 3I56V 1F4NA 4R50A 2WWWA 2EIMC 1NH2B 3ETDA 3LUTB 2XNDG 3OE7G 1RPOA 1P4RA 2WLKA 1OZ0A 2WSSG 1YHQV 5L3BA 1XL4A 2DYSC 1H8HG 2JEXA 1YJWV 3RVYA 1NH2D 5KUKA 1OCZC 4X89A 2MK3A 5L3DA 5E1AC 1VQLV 1K9MW 2IJIA 4MVMA 2AHYA 2ZDIA 4ZBMA 4RO2A 2B1IA 1VQMV 3VBBA 3JD0A 1AJQA 5B1BC 1OCCC 3B77A 4JPRA 3CXCU 2Y69C 3K0DA 3OEEG 3QO8A 1H8EG 1AI7A 3OEHG 2Q68A 4JYBA 1QLEB 4L87A 1B6QA 5EC2C 1KD1W 4MTGA 3I55V 5CMUA 2QM8A 2WLHA 1CEZA 2DYRC 1R3JC 4Z1MG 1OCRC 4DXWA 2OCCC 4JF3A 1R6NA 1E1QG 2CK3G 5B3SB 1M56C 3AG4B 1V55B 2IH3C 3K0GA 5HFLA 3LSSA 4G28B 1KQSU 3ZMTA 3BY6A 5EK0A 1S3JA 4PA3A 1JQ0A 2YSUB 2DWDC 3SPGA 3SYOA 3FB6C 3FB5C 3K06A 3D3IA 5L3FA 1VQ4V 4MSWC 3ETEA 2OTJV 4UVAA 3W7XA 2EIJB 3ASOC 4H37A 4ZKIA 3CC4V 1M57B 1VQOV 2EZPA 5LGUA 1E79G 4GT1A 3K9AA 3FYIB 2H8PC 5H6RA 4PDLA 3RBZA 2LFRA 3F5WC 4J9YB 1MABG 4R8CA 3X2QC 4EKWA 1BHBA 3AG3C 4MVQA 1QCEA 1DTOA 3IGAC 1UJWB 3OUSA 4Q20A 3GWOA 1QR8A 3B8NA 5L3EA 1KP3A 4KFMA 2C2AA 3M99B 2FTKA 3T1CA 3ZCCA 4GX5A 4QE7A 4UXNA 1WLEA 3ZRWB 5DM6V 1AI4A 5IYCO 4R6ZA 1THZA 3KG2A 5LGNA 1K4CC 2XAGA 4JYCA 3OW2U 2DQ0A 3ABMC 2HVJC 4MS2A 1IXMA 2WAMA 2OTLV 4RUFA 1I5YA 3CCRV 1W0JG 1RM1B 2EILC 3BEHA 5H6QA 3CCQV 2OT5A 3SPJA 3CCUV 2EINB 1FXKC 4MVOA 4TWKA 5IY5B 2DWEC 1PNLA 1AI5A 1GM9A 2IJJA 2XAHA 2ZR2A 1FFTB 5CBFA 1MSWD 2IH1C 3MD0A 4FPPA 1I5XA 1NQTA 1V54C 3CCEV 4WFHA 1EBOA 4KUMA 1SZTA 1R73A 1PD3A 2EIKC 4LCUC 5LBQA 3LDEA 2JJ2G 2P6JA 3E2EA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5H9C A;  1QCE A;  2LP7 A;  1QR9 A;  4FJC C;  1JPX A;  1MG1 A;  1I5Y A;  4JGS A;  3MHS C;  5CMU A;  5HFM A;  5KA6 A;  2MK3 A;  4N23 A;  3GWO A;  1QR8 A;  1Y4M A;  2OT5 A;  1DF5 A;  3B8N A;  1QBZ A;  2EBO A;  4JF3 A;  3CP1 A;  3M99 B;  3WFV A;  4E2L A;  3P30 A;  5KA5 A;  3CYO A;  1MOF A;  3MHH C;  1I5X A;  3B8M A;  4FIP C;  2EZP A;  1Y66 A;  1EBO A;  1DF4 A;  4N21 A;  3K9A A;  1K34 A;  3B77 A;  4JPR A;  5HFL A;  1SZT A;  4G2K A;  5CN0 A;  1DLB A;  1F23 A;  2EZO A;  4FK5 C;  1JQ0 A;  2M7W A;  2X7R B;  3H01 A;  1ENV A;  1K33 A;  2P6J A; 
#chains in the Genus database with same CATH topology
 3CRQ A;  3T1H O;  3ASN B;  2E75 B;  2W6J G;  2XAJ A;  1KBH A;  4X65 B;  5IWA B;  5E79 Z;  3BHP A;  3JSL A;  2M6Y A;  1UFI A;  1KP2 A;  2P90 A;  1LNQ A;  3RYI A;  4JI2 O;  4MVZ A;  1WA8 B;  2WA4 A;  2YS8 A;  4IT5 A;  3WB2 A;  1P84 F;  2HVK C;  2BTO A;  1PL4 A;  1X4T A;  1SQX H;  2VQF O;  2QWO B;  5GON B;  3CRR A;  4FLV A;  1DF5 A;  1S5H C;  4OXS A;  4JAA A;  4E2L A;  3AK1 A;  3UM7 A;  4FZ0 A;  2DOS A;  2ATK C;  2IJK A;  2Z5U A;  1WB8 A;  4RWU A;  4GZR B;  4RQF A;  2LFS A;  2YXY A;  1NR7 A;  4EFE A;  4MW8 A;  1NU1 H;  3T1H B;  4DR1 O;  3F7V C;  2EZO A;  3H01 A;  1M56 B;  5H9C A;  1GN6 A;  5K1X A;  3AG2 C;  1YJ9 V;  3ZN0 A;  4WBN B;  1K4D C;  1RPR A;  4DK1 A;  2PI4 A;  4JI2 B;  4U7O A;  2PYJ A;  1OCO B;  1Y74 A;  5KUM A;  3SYA A;  5IYZ B;  2RJZ A;  3KKY A;  1K34 A;  2VQF B;  1CPY A;  1BE3 H;  1XBL A;  1FXK A;  3DXR A;  4K3A A;  3JAK A;  1XRE A;  1FXH A;  2X7R B;  3IAY A;  1GTO A;  5DN6 G;  3OGC C;  4XBF A;  4JTD B;  3SPC A;  4ASU G;  1Q8I A;  1AJP A;  4Q6G A;  4PI0 A;  2ITC C;  2GBO A;  4DR1 B;  3SDL A;  3K04 A;  4LWS B;  5C93 A;  1U97 A;  5IDJ A;  1F23 A;  4MVR A;  5LYJ B;  1QNM A;  1JCH A;  2A9H A;  1K33 A;  2BCC H;  4FM1 A;  4NKG B;  4DUY O;  2F1M A;  4BWA A;  3W7T A;  5LHH A;  5KMG B;  3W7W A;  4H0L B;  2OIE A;  3ABM B;  1Q6I A;  1CP9 A;  3BPZ A;  1KB9 F;  3G6E V;  4UCR A;  4DYL A;  5BZB A;  1H38 A;  4JYY A;  3LNN A;  2DE0 X;  1L8D A;  2JRI A;  3CCV V;  2EIK B;  4X88 A;  1VF6 A;  2X6C A;  4H33 A;  3WG7 C;  2XAF A;  5EBL C;  1YCI A;  3A0H Z;  3EXA A;  1LUW A;  1EM1 A;  4O4I A;  1AR4 A;  4DUY B;  3CEI A;  5IJ0 A;  2A79 B;  3GVM A;  5BY1 A;  4JTC B;  4I9Q A;  4A5U B;  2WLM A;  1QLE C;  3P3N A;  5LOV A;  2ITD C;  3LNM B;  2BSK A;  5FLX N;  3D3Q A;  4YIO A;  2P4K A;  1WP7 A;  3OFN G;  1B3Q A;  2WLL A;  3S3W A;  4ZOL A;  3ZRX A;  4UV8 A;  4UVB A;  2PF4 E;  2BOB C;  2L35 A;  4I5S A;  1Q86 W;  1WNS A;  3ZIA G;  1Q43 A;  4I0X A;  3M7M X;  3CPW U;  2KG7 A;  4TT3 G;  4FLW A;  1U96 A;  3RWR D;  2YEV B;  3Q4H B;  5B66 Z;  3IC7 A;  4DV1 O;  4TUY B;  3F7Y C;  1IZ3 A;  2ZQM A;  3W7U A;  2AW9 A;  2PZS A;  2P06 A;  4W4L A;  4LFA O;  3HPL C;  2HFE C;  3JAS B;  4BAY A;  2NNU A;  1VAR A;  3QVN A;  3SJA C;  2GSM B;  1TGO A;  1JFF B;  2W6I G;  3OTF A;  4JI0 O;  1K97 A;  4PEL A;  3E89 A;  4FVM A;  1HNX B;  2GHY A;  2CTW A;  5LP6 A;  4MTO A;  3ABL B;  4LFB B;  5TIS Z;  3ZMZ A;  1QVG U;  3E86 A;  2UXB B;  4YJ2 B;  1R3I C;  4DV1 B;  1EN4 A;  4LF9 O;  1AP5 A;  3JCZ A;  2Y0P A;  3P30 A;  3ML0 A;  1SES A;  5KHK A;  4LFA B;  5CA3 A;  1Q6H A;  4O2B B;  1WA8 A;  1S0V A;  2Q8V A;  4R7C A;  4X62 O;  4DR6 O;  3AK3 A;  4P9P A;  4DV4 B;  3ZHV A;  5EBM C;  2Q67 A;  4X64 O;  3R65 A;  1XNQ O;  2D2C B;  2Y4T A;  3TCU A;  1TA8 A;  1N36 O;  4JI0 B;  4QIW F;  2HJF C;  3ASN C;  4HBN A;  1M4U A;  5EZY B;  2WWW A;  5JCO C;  1BS3 A;  3OE7 G;  1P4R A;  2WLK A;  4LF9 B;  1H8H G;  2JEX A;  3RVY A;  2WA3 A;  4WBN A;  1FYJ A;  1VIB A;  1ZTE A;  5E1A C;  1VQL V;  3JAW B;  5EIB D;  4X62 B;  4DRX A;  1SQF A;  3JD0 A;  1AJQ A;  1JJO A;  2CTR A;  4LF8 O;  4IYI A;  3CXC U;  4X64 B;  1XNQ B;  3BVO A;  2QDO A;  3K0D A;  1BSM A;  1NTK H;  4FLU A;  1N36 B;  2LW7 A;  1M5I A;  2Q68 A;  1B6Q A;  1IX9 A;  4FZ1 A;  1I08 A;  1QHT A;  4J11 A;  2WLH A;  4UB8 Z;  1NTZ H;  2G38 A;  1MMM A;  4JF3 A;  4B3R O;  4ZHQ A;  1M56 C;  1D2D A;  4PV1 B;  3CSX A;  3H1L H;  4G28 B;  4YHH O;  2Y4U A;  5LYJ A;  2ADP A;  3BY6 A;  1JQ0 A;  2IBZ H;  1H2K A;  5LA6 B;  4JI3 B;  4MSW C;  3ETE A;  4DR4 B;  2ZIM A;  4JZ2 A;  4CS2 A;  4LF8 B;  4J7J A;  4YJ3 B;  4H37 A;  1M57 B;  1AIL A;  1IVS A;  2YIC A;  3K9A A;  4NYK A;  2LFR A;  2DMX A;  2ILM A;  1BHB A;  3K5O A;  4MVQ A;  1QCE A;  5H5N A;  4B3R B;  1TVK B;  2QWP B;  3TXS A;  1IBL O;  1PP9 H;  3RT3 C;  4KFM A;  4YHH B;  4QE7 A;  2GUZ B;  1AI4 A;  2QWR B;  5JJN B;  1K4C C;  4LH6 A;  2DQ0 A;  3ABM C;  4U3J B;  2Q0A A;  5JVD A;  1WN7 A;  1LR1 A;  2OTL V;  3CHX A;  2P5O A;  4O4L B;  2EIL C;  5H6Q A;  2OT5 A;  3SPJ A;  2DWE C;  1IBK B;  1GM9 A;  1EN6 A;  3CRM A;  3BFR A;  4H13 B;  4I55 B;  3E22 A;  1KKC A;  4WFH A;  1BGY H;  1SZT A;  3G6B A;  2EIK C;  1IBM O;  5LBQ A;  1IBL B;  2BTQ B;  1EN5 A;  2JJ2 G;  3E2E A;  2O57 A;  3C90 A;  4BW5 A;  5FL7 G;  1XOU A;  4RUE A;  1VQ5 V;  3Q4H A;  2EIM B;  3WG7 B;  4XDL A;  2YXH A;  2YIB A;  1QBZ A;  3APO A;  5GTH Z;  3E8F A;  3HKE A;  4B3T O;  3BRC A;  1SQB H;  2F66 C;  1W2B U;  1OCZ B;  1DLB A;  3C3T A;  1LUV A;  2X6A A;  3W7S A;  1WPB A;  3CCS V;  3JD4 A;  2K9P A;  2QM4 A;  4ZI7 A;  1XL6 A;  4QPJ A;  1JFF A;  2CTP A;  4LR3 A;  4B08 A;  4QJF B;  1ZWI C;  2YUA A;  1GH6 A;  1JOY A;  3STZ C;  1ARO P;  5CBH A;  4BR6 A;  2QKA A;  5K1P A;  4DV5 O;  4FIP C;  2WPD G;  3H1J H;  4Z1V A;  2CUG A;  1MNG A;  3K58 A;  4GX1 A;  2VWJ A;  2GTA A;  4IYH A;  1IUR A;  2DYR B;  2OCC B;  3KCY A;  4YJ2 A;  3L70 H;  2YID A;  4J7K A;  1KC8 W;  1TAE A;  2ZNI A;  5CA1 A;  5LMU O;  5GW7 A;  3CJH A;  1R6K A;  1URF A;  1BZK A;  5KAF Z;  3THO A;  1SF9 A;  1F4M A;  3JAR B;  1NKD A;  4TV8 A;  3L75 H;  4ICG A;  1PL0 A;  5BMV A;  2XUM A;  5JH7 B;  1WAZ A;  2A0L A;  3ABL C;  2RCV A;  1K3E A;  4DV5 B;  1KKD A;  1S77 D;  2PI5 A;  1H2N A;  1WPX A;  5EZY A;  1YIT V;  3HKD B;  4X9Q A;  2AZ2 A;  1Y67 A;  1WB7 A;  4UVC A;  2YC0 A;  4JGS A;  1EFR G;  1M9N A;  1N32 O;  4LFC O;  4LBE C;  2HG5 C;  3VQX A;  2PYL A;  2EIN C;  3ZRS A;  2V7Q G;  2OCH A;  3C3S A;  5ITZ A;  2Q7G A;  3UT5 A;  2VQE B;  1YI2 V;  3QO7 A;  3WFV A;  3N27 A;  1XQ8 A;  4PA7 A;  4X20 B;  1H2M A;  3E35 A;  1BT8 A;  1YZB A;  4IHJ B;  4MTX A;  1N4C A;  3JAL B;  2R72 A;  2XTA A;  2Q73 A;  4J41 A;  3D36 C;  3KCX A;  3GB7 C;  5IJ9 B;  3E8B A;  3FB7 C;  5L3G A;  1MZF A;  3G4S V;  3STL C;  3I5D A;  4UCS A;  5F2V O;  3OT7 A;  1VQ8 V;  5D5Q A;  3EVK A;  2ARH A;  4TOI A;  1MSD A;  2A3Q A;  5LA6 A;  1N32 B;  4X1I B;  4O2A A;  4LFC B;  2XAS A;  2ZE7 A;  4QPK A;  4WFF A;  1BMF G;  1Q5O A;  1A32 A;  1SZX A;  1SER A;  3ABK B;  3CYO A;  4Z2W A;  5FNV B;  3HR0 A;  1QU7 A;  2XOK G;  3AG1 B;  2ZT9 B;  3PN1 A;  3ZMV A;  4X66 O;  2CTQ A;  2LJ2 A;  2QEX V;  3O65 A;  4DK0 A;  2EJR A;  2FML A;  4P30 A;  2R9I A;  1W59 A;  3AEI A;  4IL6 Z;  3T1Y O;  4I9W A;  3B40 A;  4GUN A;  2KQX A;  2ETN A;  2GV9 A;  4J42 A;  4F6R B;  3UO3 A;  2QM7 A;  4EB6 B;  3JAT A;  2P7T C;  1E1R G;  1HWY A;  4TSF G;  1SRY A;  4K8X A;  1PNK A;  3ABU A;  3FKS G;  3A0R A;  4FLX A;  2YIB D;  1M57 C;  1FKA O;  2ZDI C;  2V4D A;  2Q6A A;  4DV3 O;  5FPR A;  4B3S O;  5DEC A;  2UUA B;  4X66 B;  1FFX B;  3U11 A;  1B06 A;  4I4T B;  4L8J A;  3K5M A;  1JR9 A;  5J2T B;  5AG2 A;  4O4J A;  1SKV A;  5CN0 A;  3ZMS A;  2BTQ A;  3T1Y B;  4HAM A;  4IIJ B;  2LGQ A;  1OV9 A;  2KSD A;  1ENV A;  3BAB A;  1R3K C;  1MG1 A;  1K92 A;  5CA0 B;  3FYE B;  3B4S A;  4PA4 A;  5IYB O;  4NVP A;  4FM2 A;  1R3L C;  2EBO A;  3P32 A;  5CB4 B;  1SQV H;  2LGW A;  5B1A B;  4J9Z B;  5JWP A;  2N04 A;  4HZ3 A;  1M93 A;  2D3O W;  2B9Z A;  2ZE5 A;  3P3P A;  4DV3 B;  4B3S B;  4JI8 O;  1SA0 A;  5KX5 B;  2HR3 A;  2EIL B;  1AJN A;  4MT8 A;  5KHG A;  2ZXW B;  2Q5Z A;  1BHA A;  3CRC A;  1Q7Y W;  5KLV H;  1G8M A;  3HB3 B;  1ORQ C;  4B7E A;  2WLI B;  2A06 H;  4J7Z A;  3R66 A;  3DGE A;  2AGA A;  2JJ1 G;  2ZD9 A;  2QKC A;  3I56 V;  1NH2 B;  2EIM C;  2XND G;  4FFK A;  3FAV A;  3N2G A;  1KU9 A;  4BW9 A;  2YIA A;  1YJW V;  1OCZ C;  5L3D A;  4JI5 O;  3CRA A;  4UFZ A;  4MVM A;  2AHY A;  2OIG A;  2B1I A;  4JI8 B;  2ZIN A;  1H8E G;  2DJV A;  1HNX O;  2E74 B;  4L87 A;  1PM9 A;  2AXT Z;  4JI7 O;  4LFB O;  4E4E A;  2CDY A;  2PGG A;  2Q9L A;  2CH7 B;  2DYR C;  1R3J C;  4DUZ O;  2OCC C;  1XUQ A;  5B3S B;  2UXB O;  4U3F H;  1V55 B;  4LF7 O;  3ETQ A;  3K0G A;  2Q0O C;  5HFL A;  2JGD A;  5JQG A;  5EK0 A;  1S3J A;  1RSO B;  4JI5 B;  3SJC C;  4PA3 A;  2YSU B;  2PY5 A;  4IGG A;  1T5E A;  3APQ A;  3FB5 C;  3K06 A;  5L3F A;  1VQ4 V;  4FFB B;  4DV4 O;  5H2F Z;  2OTJ V;  4UVA A;  4CH4 A;  1J5E O;  2EIJ B;  1Z5V A;  1NZ6 A;  3CC4 V;  4AIL C;  1NT2 B;  4GT1 A;  4AQY O;  4OX9 O;  2H8P C;  2NR5 A;  4JI7 B;  3RBZ A;  3B09 A;  1H2L A;  1MAB G;  4FLT A;  5KHJ A;  3GWK C;  4DUZ B;  4IHJ A;  1DTO A;  3IGA C;  3RN4 A;  3JAL A;  1UJW B;  5JCO A;  4Q20 A;  2QWQ B;  5L3E A;  1Y76 B;  4LF7 B;  4UXN A;  3ZRW B;  4X1Y B;  4EEQ A;  1US6 A;  3N2K B;  4R6Z A;  5LGN A;  1OJH A;  1B04 A;  1YVW A;  1XMO O;  3OW2 U;  2FB5 A;  2HVJ C;  4MS2 A;  1SQQ H;  4CC5 A;  1J5E B;  1N33 O;  4DR3 B;  5GON A;  5KAI Z;  2F93 B;  3AG7 A;  1I5Y A;  3CCR V;  3G80 A;  3ZX6 A;  1W0J G;  1RM1 B;  2CAZ C;  3BEH A;  2JS3 A;  3CCQ V;  2EIN B;  4AQY B;  1PNL A;  4OX9 B;  3O9O A;  2YI9 A;  1PPJ H;  4B3M O;  1I5X A;  1NQT A;  1V54 C;  3HKB B;  4I50 B;  3LSU A;  3ZHQ A;  1AB3 A;  1R73 A;  5J9P C;  3A0B Z;  1S72 V;  3TGU H;  2WLN A;  3L72 H;  4QGP A;  5IYZ A;  4NTW A;  4JI3 O;  3E8G A;  1XMO B;  2EX3 A;  1GN2 A;  4DR4 O;  4RAI A;  2KB1 A;  1XMQ O;  1N33 B;  1J95 A;  1ROP A;  3RYH B;  4WF9 V;  3ABK C;  1COW G;  1Q3E A;  3AG1 C;  1BQ0 A;  3F5T A;  3JD1 A;  1K5Q A;  4K0K B;  5JJE B;  1VQ7 V;  4B3M B;  2HHH O;  5B1B B;  2QTS A;  4G27 B;  5LXT B;  2Y69 B;  4I4T A;  1R1B A;  1TUB B;  1ZL8 B;  2KKW A;  4DV7 O;  1DK1 A;  4LWS A;  4IIJ A;  2E76 B;  4OGQ B;  2AHZ A;  5LHI A;  3BA8 A;  1FJG O;  5CA0 A;  1QR9 A;  5A2Q N;  3TXQ A;  2VRZ A;  3MHS C;  4HNA B;  4OPA A;  5CB4 A;  2R9A A;  5KMG A;  1XMQ B;  5GTI Z;  1QLN A;  4NR1 A;  2W0X A;  1QQC A;  1DF4 A;  3LDC A;  4F4L A;  4GCZ A;  1IBK O;  1X59 A;  2QKS A;  2E5L B;  4U7N A;  1N34 O;  2HHH B;  3SJQ C;  3ZED A;  3ASO B;  3IFX A;  3CCL V;  4KXR A;  4LC1 A;  4DV7 B;  1UPG A;  2FL4 A;  5B1O A;  3CD6 V;  3X2Q B;  1NVP B;  3ZHS A;  5EBW C;  2YDE A;  5D5P A;  4QNH B;  1KMI Z;  1FJG B;  1AR1 B;  5B1A C;  2LO1 A;  4HYO A;  2IM9 A;  4P2Z A;  5IYD O;  2HP8 A;  2ZXW C;  3G67 A;  2UUC O;  3K08 A;  3CWB H;  1N34 B;  1Y74 B;  1L1F A;  5FPO A;  1FXK B;  3DXR B;  3JAK B;  3L71 H;  4GX2 A;  1YJN V;  2YEV A;  3H1K H;  4TUY A;  1XNR B;  4YIP A;  1YTF B;  3VQY A;  2P4V A;  1S76 D;  4CZZ A;  1SET A;  4WFB V;  3T2M A;  3JAS A;  4FK5 C;  4PDM A;  2YXL A;  1GO3 F;  2UU9 O;  4FJC C;  2UUC B;  3TK1 A;  2XAQ A;  3OR6 C;  3OMN B;  3ZRV A;  1QVF U;  2LW1 A;  1Q81 W;  1G6U A;  4ZIB A;  3CCJ V;  1GK9 A;  1SS3 A;  1P7G A;  4JYA O;  3CXH F;  5EC1 C;  2HLD G;  5B3S C;  1F51 A;  1V55 C;  2ZE8 A;  4JI1 O;  5L3C A;  5BR8 B;  2Y48 A;  4PDR A;  1L0L H;  1AVM A;  1TUE B;  1HP8 A;  1Y76 A;  3K3W A;  4P9O A;  3ZRW A;  2F4V O;  1L0N H;  3N2K A;  3E8H A;  4K35 A;  4O2B A;  3T4D A;  2VS0 A;  3QO5 A;  2R9R B;  1V9P A;  3FD9 A;  4LF6 O;  2Q7H A;  5LMN O;  2P22 C;  1JJ2 U;  2UU9 B;  2RN9 A;  2EIJ C;  4O4I B;  5IJ0 B;  1P7B A;  3OUF A;  1KEC A;  3LDD A;  2VQE O;  1MZE A;  2B5U A;  1O9H A;  4JYA B;  1ZSP A;  2CGO A;  3IC9 A;  3G71 V;  4UUJ C;  3B8M A;  5KHH A;  1NI8 A;  2BSK B;  4KP4 A;  4AI8 A;  4JI1 B;  4DV6 O;  4O4H B;  1M90 W;  4GKK O;  1HNW O;  1GN3 A;  2WLL B;  1YIJ V;  1HR0 O;  3VQV A;  1FXV A;  3JD2 A;  2FYU H;  4KL1 A;  3OMI B;  3E83 A;  3D36 A;  1XHX A;  4DR5 B;  1N0J A;  2LP7 A;  2F4V B;  3JAW A;  4N23 A;  1Z2G A;  4I0X B;  1RFY A;  4WFG A;  2Z3Y A;  2JK5 C;  4NB5 A;  3SPH A;  4LF6 B;  5LMN B;  4TV9 B;  3OM3 B;  1RM1 C;  1XEQ A;  4N21 A;  2QTO A;  3RYH A;  2IW5 A;  3UQ8 A;  1S5J A;  1K8A W;  4RQE A;  2JS5 A;  3NXS A;  1IXB A;  1JPX A;  1VEW A;  2DQ3 A;  1V54 B;  4GKK B;  4DV6 B;  1HNW B;  4NTX A;  1HR0 B;  4XDK A;  2JIZ G;  4R50 A;  5LP6 B;  1OZ0 A;  2WSS G;  4J10 A;  1YHQ V;  5L3B A;  4PJ0 Z;  4HNA A;  4UCU A;  4I7Z B;  1NH2 D;  4PHZ A;  4GKJ O;  4X89 A;  2MK3 A;  1GAX A;  1K9M W;  4YJ3 A;  2IJI A;  2ZDI A;  3MDS A;  1F7Y A;  1I7F A;  1JA8 A;  5B1B C;  1OCC C;  2UUA O;  3B77 A;  4JPR A;  2ZIO A;  2Y69 C;  3QO8 A;  1AI7 A;  3OEH G;  2UUB O;  4MTG A;  3I55 V;  1TVK A;  4LF5 O;  1BQZ A;  2QM8 A;  4Z1M G;  1R6N A;  2HJD A;  1E1Q G;  3AG4 B;  2GUZ A;  4NXM O;  2EJ7 A;  5JJJ B;  3BA9 A;  2ZE6 A;  2IH3 C;  2L6L A;  3LSS A;  5C8Y B;  4U3J A;  4GKJ B;  1ZAU A;  4X1K B;  1VF7 A;  1EZV H;  1Y6X A;  3D3I A;  4O4L A;  2F23 A;  3H1H H;  3HKC B;  3CE2 A;  3W7X A;  3ASO C;  4EFB A;  4DRX B;  4ZKI A;  4I55 A;  3FYI B;  2UUB B;  5H6R A;  4PDL A;  2UXC O;  2AZ0 A;  4LF5 B;  3F5W C;  4EKW A;  3X2Q C;  3B2E E;  1Q90 D;  4NXM B;  1AR5 A;  3OUS A;  1QR8 A;  2E3C A;  2C2A A;  5A9G A;  3ZCC A;  4GX5 A;  4ZHQ B;  5IYC O;  4OPH A;  1THZ A;  4DV0 O;  3KG2 A;  1I94 O;  4JYC A;  3A2F A;  3K5N A;  1BCC H;  1JMK C;  2WAM A;  3FX7 A;  1SQG A;  3K59 A;  2PUS A;  3ZHU A;  1HW7 A;  3CCU V;  4FM0 A;  1FXK C;  4TWK A;  4J80 A;  4MVO A;  4TQD A;  3H1I H;  5IY5 B;  1AI5 A;  2IJJ A;  3DC6 A;  2DN9 A;  1FFT B;  5CBF A;  1MSW D;  2UXC B;  2IH1 C;  4FPP A;  4CH5 A;  2RDC A;  4KUM A;  3RYC B;  4D7S A;  2UXD O;  4LCU C;  2QJ1 A;  1XDC A;  3MAQ A;  3J7A U;  3DTU B;  5HFM A;  5EIB C;  2QSA A;  1K7D A;  3CC7 V;  1CXZ B;  4DV0 B;  3EFF K;  3RW0 A;  1I94 B;  4LNU B;  3K5L A;  4BIZ A;  4JI6 O;  2DYS B;  4D7T A;  3TJT A;  3JAR A;  4C7U A;  3SPI A;  1NTM H;  3CME V;  3OD4 A;  3JD3 A;  1Q6U A;  2N05 A;  1VQK V;  2NN4 A;  1MA1 A;  4JAU A;  4FLZ A;  1VQ9 V;  4TQF A;  5JH7 A;  1M1K W;  1R6T A;  1JX9 A;  4FMT A;  5JVD B;  4YXW G;  4JV5 O;  4CH3 A;  1OHH G;  4CS3 A;  3PJS K;  3ZHT A;  3KZI Z;  4LH7 A;  5KA5 A;  4O4H A;  1MOF A;  3HKD A;  3VQW A;  3JYC A;  1NBM G;  2QGN A;  5BXZ A;  2UXD B;  5J2U B;  3E22 B;  2UXN A;  4PI2 A;  1SC5 B;  2Q7E A;  5LHG A;  1VQN V;  1OCR B;  4DW1 A;  1VF6 C;  3BAA A;  3OAA G;  1GRJ A;  4WFE A;  4JI4 O;  4JI6 B;  3QTC A;  3UKM A;  2ZR3 A;  4DR3 O;  3DC5 A;  4TV9 A;  1GM7 A;  2R70 A;  4QE9 A;  2CE4 A;  3SYC A;  4XDJ A;  3HKE B;  4PA6 A;  1Z5W A;  4H44 B;  2UXX A;  3VOU A;  1AI6 A;  2H94 A;  1Q82 W;  4JV5 B;  1VQ6 V;  3CS5 A;  2P67 A;  4ZI7 B;  4X20 A;  1WJZ A;  3NR7 A;  4MTF A;  3ETG A;  5LGT A;  4X8A A;  4LP8 A;  4PDV A;  5IJ9 A;  5EYP B;  1FD9 A;  2IU3 A;  4CBC A;  1NJI W;  3AG3 B;  3ZN1 A;  3CCM V;  3QG5 A;  3L73 H;  3CMA V;  1NVP D;  4JI4 B;  2X0L A;  4X1I A;  3J80 N;  3FFQ A;  4DR7 O;  1IDS A;  2F43 G;  3RVZ A;  2QWN B;  3EHB B;  1EZJ A;  2JVD A;  1Y4M A;  3FB8 C;  5CA1 B;  4JTA B;  5FNV A;  2GTS A;  3CJH B;  1H2G A;  3SYQ A;  1H2S B;  1YSC A;  2V1D A;  4K0K O;  4PA9 A;  2CGN A;  4LF4 O;  4F6E A;  3U0Z A;  4BIO A;  2WLJ A;  4TV8 B;  1SQP H;  4UV9 A;  1XHZ A;  2QE7 G;  3A8T A;  5BMV B;  3AK2 A;  2B1G A;  1K73 W;  5LP6 C;  3RYF B;  2RQ6 A;  1FAF A;  3T4Z A;  1GKF A;  2NLJ C;  3S3X A;  4F6R A;  1HNZ O;  1YXB A;  4EB6 A;  3K03 A;  3ABT A;  2ZNJ A;  2GDS A;  5C8Y A;  1Y66 A;  4DR7 B;  4X1K A;  3OR7 C;  1XI1 A;  1ZUQ A;  2M7W A;  4KHP O;  1YTF D;  1NR1 A;  3HKC A;  1ZLZ A;  2E5L O;  2K1E A;  4GLX A;  4GX0 A;  2JGU A;  2Y0I A;  1FFX A;  1OCC B;  1HDJ A;  4BIU A;  1FS0 G;  4DR6 B;  4LF4 B;  3MHH C;  5J2T A;  3L74 H;  4W4K A;  3LSQ A;  1YDX A;  2H3O A;  2ZM6 O;  4CH6 A;  2XHB A;  2X6B A;  4ABM A;  2ZKO A;  3AG4 C;  5ITZ B;  3CC2 V;  3UT5 B;  2W0F C;  4YY3 O;  3J81 N;  1ZX3 A;  1XIL A;  1KUQ A;  1HNZ B;  1YF2 A;  5KA6 A;  1WP8 A;  3TET A;  1GM8 A;  2QR4 A;  4UCO A;  1G1X B;  3WU2 Z;  2BOC C;  4WFA V;  2IU0 A;  3D8C A;  3DSQ A;  4DW0 A;  2Q69 A;  4KHP B;  2Z0A A;  4CC6 A;  3RYI B;  5KX5 A;  3AG2 B;  1OCO C;  1DGS A;  1JVM A;  5IE9 A;  1PKX A;  1GMG A;  1D5N A;  1PNM A;  5B1N A;  1VMG A;  4DO2 A;  2FKX A;  2PTM A;  4O2A B;  1O9G A;  3OMA B;  3ZJZ A;  2ODM A;  3QNE A;  2WLI A;  3ZHR A;  3CP1 A;  4UCV A;  2ZM6 B;  2JEU A;  3QF7 A;  4JZG A;  2IJH A;  1N8R W;  4MVU A;  1GN4 A;  3SJB C;  3RYC A;  4YY3 B;  1XNR O;  3SR2 C;  2EUL A;  3M8A A;  3OGI B;  2JDI G;  2BE3 A;  4PD4 F;  4D6T H;  1P49 A;  4G2K A;  2HEP A;  2DW4 A;  2XT9 A;  4UCT A;  4LNU A;  4MW3 A;  3ZMU A;  5CBG A;  1K5S A;  1VF5 B;  2ZCE A;  3JAT B;  2HKO A;  1I0H A;  1W0K G;  3SYP A;  5IY5 C;  4MVS A;  3WB0 A;  2QA4 V;  3K79 A;  2ADQ B;  1BL8 A;  1G4Y B;  2LQT A;  4JAS A;  4DV2 O;  2CH7 A;  5BR8 O;  1VQP V;  4WCE V;  4JAV A;  5J2U A;  1PV0 A;  1AP6 A;  2VWK A;  1VP7 A;  1F4N A;  3ETD A;  3LUT B;  4O4J B;  4B7K A;  1RSO A;  1RPO A;  1XL4 A;  2DYS C;  3RFR A;  4FFB A;  2N74 A;  4DR2 O;  5KUK A;  4K8Z A;  1KYO F;  3JSN A;  2YI8 A;  4ZBM A;  4RO2 A;  1VQM V;  4UB6 Z;  3VBB A;  3JAM N;  3K57 A;  4AHC A;  1NS1 A;  3OEE G;  3U10 A;  4DV2 B;  4JYB A;  1QLE B;  1S5L Z;  1SA0 B;  5EC2 C;  1KD1 W;  5CMU A;  3CX5 F;  1CEZ A;  5EYP A;  4DR5 O;  1D5A A;  1OCR C;  4DXW A;  2CK3 G;  4X1Y A;  1IBM B;  1YEW A;  1KQS U;  3ZMT A;  2MW2 B;  4DR2 B;  3FAV B;  3N2G B;  2DWD C;  3SPG A;  2OWO A;  3SYO A;  3ZS8 C;  3ZBH A;  3FB6 C;  5KHI A;  4B3T B;  3OTO O;  4NXN O;  4I50 A;  5LOV B;  3HKB A;  1N0N A;  1VQO V;  2EZP A;  5LGU A;  1E79 G;  4ZOL B;  4J9Y B;  3H9V A;  4R8C A;  3AG3 C;  3RYF A;  2F95 B;  4NTY A;  3IJ4 A;  3GWO A;  4CS4 A;  3B8N A;  2KG7 B;  4GYC B;  1KP3 A;  3M99 B;  2FTK A;  3T1C A;  1WLE A;  5DM6 V;  3JCU Z;  3WB1 A;  5DED A;  2A7W A;  4X65 O;  5IWA O;  3CB2 A;  2XAG A;  5LL6 Y;  2JGD B;  5JQG B;  5LMU B;  1IXM A;  5B5E Z;  3OTO B;  4RUF A;  4NXN B;  3UCS C;  5LXT A;  3RGB A;  3UO2 A;  2RNB A;  4FLY A;  1TUB A;  2XAH A;  2ZR2 A;  2RMK B;  1ZL8 A;  3MD0 A;  2Q4P A;  3CCE V;  1EBO A;  3BCC H;  1RP3 B;  3L9D A;  1PD3 A;  2OYQ A;  3SGI A;  3K9S A;  3ICX A;  3LDE A;  5IT9 N;  1FPO A;  2P6J A; 
#chains in the Genus database with same CATH homology
 4BW5 A;  5FL7 G;  5J9P C;  3DTU B;  3ASN B;  5HFM A;  4RUE A;  1VQ5 V;  2W6J G;  2XAJ A;  1S72 V;  1K7D A;  2EIM B;  3WG7 B;  4XDL A;  3CC7 V;  1QBZ A;  2WLN A;  3EFF K;  3RW0 A;  4BIZ A;  3E8F A;  3E8G A;  4RAI A;  2DYS B;  1KP2 A;  2P90 A;  2KB1 A;  1LNQ A;  3SPI A;  4MVZ A;  1J95 A;  1W2B U;  3CME V;  1OCZ B;  1ROP A;  3JD3 A;  1DLB A;  2HVK C;  1VQK V;  4JAU A;  4WF9 V;  3ABK C;  2X6A A;  3W7S A;  1VQ9 V;  3CCS V;  1M1K W;  1COW G;  3JD4 A;  3AG1 C;  1JX9 A;  1XL6 A;  4FMT A;  4QPJ A;  4YXW G;  3JD1 A;  1K5Q A;  4QJF B;  1VQ7 V;  1ZWI C;  1OHH G;  5B1B B;  3PJS K;  4G27 B;  1DF5 A;  1JOY A;  3STZ C;  1S5H C;  4OXS A;  2Y69 B;  1ARO P;  5CBH A;  4E2L A;  5KA5 A;  3UM7 A;  1MOF A;  4RQF A;  2IJK A;  2ATK C;  2Z5U A;  4FIP C;  3JYC A;  2WPD G;  1NBM G;  2LFS A;  1NR7 A;  2UXN A;  4GX1 A;  4MW8 A;  5LHG A;  1VQN V;  2AHZ A;  2DYR B;  1OCR B;  3F7V C;  5LHI A;  2OCC B;  2EZO A;  3H01 A;  1M56 B;  3OAA G;  5H9C A;  1QR9 A;  1KC8 W;  3MHS C;  4WFE A;  3AG2 C;  1YJ9 V;  3ZN0 A;  5GW7 A;  3UKM A;  1K4D C;  1RPR A;  2ZR3 A;  2PI4 A;  1R6K A;  1QLN A;  1GM7 A;  4U7O A;  4QE9 A;  1OCO B;  3SYC A;  5KUM A;  3SYA A;  4XDJ A;  4PA6 A;  1DF4 A;  3LDC A;  1K34 A;  4F4L A;  1F4M A;  2UXX A;  1CPY A;  1NKD A;  4GCZ A;  2QKS A;  3VOU A;  1AI6 A;  2H94 A;  4U7N A;  1Q82 W;  1FXK A;  1PL0 A;  1VQ6 V;  1FXH A;  2X7R B;  1GTO A;  2P67 A;  3SJQ C;  2A0L A;  3ASO B;  5DN6 G;  3ABL C;  3OGC C;  3IFX A;  4XBF A;  1K3E A;  4MTF A;  3ETG A;  4JTD B;  3CCL V;  3SPC A;  5LGT A;  4ASU G;  1KKD A;  1AJP A;  4LC1 A;  1S77 D;  4X8A A;  4LP8 A;  4PDV A;  2PI5 A;  2ITC C;  5B1O A;  1WPX A;  3CD6 V;  2IU3 A;  3X2Q B;  4CBC A;  1NVP B;  5EBW C;  1NJI W;  1YIT V;  3AG3 B;  4QNH B;  3ZN1 A;  3CCM V;  3K04 A;  5C93 A;  1AR1 B;  5IDJ A;  1F23 A;  4MVR A;  3CMA V;  1NVP D;  5B1A C;  2X0L A;  1JCH A;  2A9H A;  1K33 A;  4HYO A;  4P2Z A;  4UVC A;  4JGS A;  5IYD O;  1EFR G;  2F43 G;  3RVZ A;  3EHB B;  1M9N A;  1EZJ A;  1Y4M A;  3FB8 C;  4JTA B;  2ZXW C;  3W7T A;  4LBE C;  2HG5 C;  5LHH A;  3W7W A;  1H2G A;  3SYQ A;  3K08 A;  1YSC A;  2V1D A;  3ABM B;  1CP9 A;  2EIN C;  3ZRS A;  4PA9 A;  2V7Q G;  2WLJ A;  3G6E V;  1L1F A;  4UV9 A;  1YI2 V;  2QE7 G;  5BZB A;  1FXK B;  3QO7 A;  3WFV A;  1H38 A;  2B1G A;  1K73 W;  4PA7 A;  3E35 A;  4GX2 A;  1YJN V;  3T4Z A;  4MTX A;  2YEV A;  1GKF A;  2NLJ C;  3GB7 C;  3CCV V;  2EIK B;  4X88 A;  3K03 A;  3ABT A;  3E8B A;  3FB7 C;  2X6C A;  5L3G A;  4H33 A;  3G4S V;  1Y66 A;  3WG7 C;  1YTF B;  2XAF A;  3STL C;  1S76 D;  4CZZ A;  5EBL C;  1SET A;  4WFB V;  1VQ8 V;  3T2M A;  3OR7 C;  4FK5 C;  4PDM A;  2A79 B;  2M7W A;  1GO3 F;  1YTF D;  2XAS A;  4FJC C;  1NR1 A;  4QPK A;  4WFF A;  3TK1 A;  2XAQ A;  2K1E A;  3OR6 C;  4GX0 A;  3OMN B;  1BMF G;  4JTC B;  3ZRV A;  1QVF U;  2WLM A;  1QLE C;  1OCC B;  1Q81 W;  4BIU A;  2ITD C;  1FS0 G;  3LNM B;  1SER A;  3ABK B;  3CYO A;  3MHH C;  3CCJ V;  1GK9 A;  2XOK G;  3AG1 B;  3OFN G;  2WLL A;  3ZMV A;  3LSQ A;  5EC1 C;  2HLD G;  3ZRX A;  2QEX V;  4UV8 A;  2X6B A;  5B3S C;  3AG4 C;  4UVB A;  1F51 A;  1V55 C;  5L3C A;  3CC2 V;  2EJR A;  2W0F C;  2Y48 A;  2BOB C;  4PDR A;  4I5S A;  1Q86 W;  3ZIA G;  2R9I A;  1TUE B;  3AEI A;  4P30 A;  5KA6 A;  3CPW U;  3TET A;  1GM8 A;  3K3W A;  4I9W A;  4TT3 G;  4P9O A;  2YEV B;  3ZRW A;  3IC7 A;  3E8H A;  2QM7 A;  3F7Y C;  2BOC C;  4WFA V;  3T4D A;  2P7T C;  3QO5 A;  1E1R G;  1HWY A;  2IU0 A;  2R9R B;  2ZQM A;  3W7U A;  2Q69 A;  4TSF G;  1SRY A;  1JJ2 U;  1PNK A;  3ABU A;  2EIJ C;  3AG2 B;  1OCO C;  3FKS G;  1JVM A;  3A0R A;  3HPL C;  2HFE C;  1M57 C;  1PKX A;  2ZDI C;  4BAY A;  1GMG A;  1PNM A;  2NNU A;  1P7B A;  5B1N A;  3OUF A;  1KEC A;  2Q6A A;  4DO2 A;  3LDD A;  2GSM B;  2W6I G;  3OMA B;  3ZJZ A;  2B5U A;  3QNE A;  2WLI A;  3CP1 A;  2JEU A;  3G71 V;  1K97 A;  2IJH A;  4PEL A;  1N8R W;  3E89 A;  4UUJ C;  3B8M A;  2D3O W;  4MVU A;  4KP4 A;  1M90 W;  2GHY A;  2WLL B;  3ABL B;  4MTO A;  1YIJ V;  5CN0 A;  1FXV A;  3JD2 A;  3ZMS A;  3ZMZ A;  3OMI B;  4HAM A;  3E83 A;  2JDI G;  1QVG U;  3D36 A;  1ENV A;  4G2K A;  3E86 A;  2LP7 A;  1R3K C;  1MG1 A;  2DW4 A;  1K92 A;  1R3I C;  3FYE B;  4N23 A;  4PA4 A;  5IYB O;  3JCZ A;  4WFG A;  1R3L C;  2Z3Y A;  2EBO A;  2JK5 C;  4MW3 A;  3P32 A;  3SPH A;  3ZMU A;  5CBG A;  1K5S A;  3ML0 A;  3P30 A;  1SES A;  3OM3 B;  5B1A B;  5CA3 A;  4J9Z B;  1RM1 C;  4HZ3 A;  1S0V A;  4N21 A;  4R7C A;  2QTO A;  2HKO A;  1W0K G;  3SYP A;  2IW5 A;  5IY5 C;  4MVS A;  4P9P A;  2QA4 V;  1K8A W;  3K79 A;  2HR3 A;  2EIL B;  1AJN A;  4RQE A;  4MT8 A;  5EBM C;  2ZXW B;  1BHA A;  1BL8 A;  1G4Y B;  2Q67 A;  3NXS A;  3R65 A;  1Q7Y W;  3TCU A;  1JPX A;  1G8M A;  4JAS A;  3HB3 B;  1ORQ C;  2DQ3 A;  1V54 B;  1VQP V;  4WCE V;  2WLI B;  4QIW F;  2HJF C;  4JAV A;  3DGE A;  2JJ1 G;  3ASN C;  2ZD9 A;  4XDK A;  2JIZ G;  3I56 V;  1F4N A;  4R50 A;  2WWW A;  2EIM C;  1NH2 B;  3ETD A;  3LUT B;  2XND G;  3OE7 G;  1RPO A;  1P4R A;  2WLK A;  1OZ0 A;  2WSS G;  1YHQ V;  5L3B A;  1XL4 A;  2DYS C;  1H8H G;  2JEX A;  1YJW V;  3RVY A;  1NH2 D;  5KUK A;  1OCZ C;  4X89 A;  2MK3 A;  5L3D A;  5E1A C;  1VQL V;  1K9M W;  2IJI A;  4MVM A;  2AHY A;  2ZDI A;  4ZBM A;  4RO2 A;  2B1I A;  1VQM V;  3VBB A;  3JD0 A;  1AJQ A;  5B1B C;  1OCC C;  3B77 A;  4JPR A;  3CXC U;  2Y69 C;  3K0D A;  3OEE G;  3QO8 A;  1H8E G;  1AI7 A;  3OEH G;  2Q68 A;  4JYB A;  1QLE B;  4L87 A;  1B6Q A;  5EC2 C;  1KD1 W;  4MTG A;  3I55 V;  5CMU A;  2QM8 A;  2WLH A;  1CEZ A;  2DYR C;  1R3J C;  4Z1M G;  1OCR C;  4DXW A;  2OCC C;  4JF3 A;  1R6N A;  1E1Q G;  2CK3 G;  5B3S B;  1M56 C;  3AG4 B;  1V55 B;  2IH3 C;  3K0G A;  5HFL A;  3LSS A;  4G28 B;  1KQS U;  3ZMT A;  3BY6 A;  5EK0 A;  1S3J A;  4PA3 A;  1JQ0 A;  2YSU B;  2DWD C;  3SPG A;  3SYO A;  3FB6 C;  3FB5 C;  3K06 A;  3D3I A;  5L3F A;  1VQ4 V;  4MSW C;  3ETE A;  2OTJ V;  4UVA A;  3W7X A;  2EIJ B;  3ASO C;  4H37 A;  4ZKI A;  3CC4 V;  1M57 B;  1VQO V;  2EZP A;  5LGU A;  1E79 G;  4GT1 A;  3K9A A;  3FYI B;  2H8P C;  5H6R A;  4PDL A;  3RBZ A;  2LFR A;  3F5W C;  4J9Y B;  1MAB G;  4R8C A;  3X2Q C;  4EKW A;  1BHB A;  3AG3 C;  4MVQ A;  1QCE A;  1DTO A;  3IGA C;  1UJW B;  3OUS A;  4Q20 A;  3GWO A;  1QR8 A;  3B8N A;  5L3E A;  1KP3 A;  4KFM A;  2C2A A;  3M99 B;  2FTK A;  3T1C A;  3ZCC A;  4GX5 A;  4QE7 A;  4UXN A;  1WLE A;  3ZRW B;  5DM6 V;  1AI4 A;  5IYC O;  4R6Z A;  1THZ A;  3KG2 A;  5LGN A;  1K4C C;  2XAG A;  4JYC A;  3OW2 U;  2DQ0 A;  3ABM C;  2HVJ C;  4MS2 A;  1IXM A;  2WAM A;  2OTL V;  4RUF A;  1I5Y A;  3CCR V;  1W0J G;  1RM1 B;  2EIL C;  3BEH A;  5H6Q A;  3CCQ V;  2OT5 A;  3SPJ A;  3CCU V;  2EIN B;  1FXK C;  4MVO A;  4TWK A;  5IY5 B;  2DWE C;  1PNL A;  1AI5 A;  1GM9 A;  2IJJ A;  2XAH A;  2ZR2 A;  1FFT B;  5CBF A;  1MSW D;  2IH1 C;  3MD0 A;  4FPP A;  1I5X A;  1NQT A;  1V54 C;  3CCE V;  4WFH A;  1EBO A;  4KUM A;  1SZT A;  1R73 A;  1PD3 A;  2EIK C;  4LCU C;  5LBQ A;  3LDE A;  2JJ2 G;  2P6J A;  3E2E A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...