1I5XA

Hiv-1 gp41 core
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
61
structure length
61
Chain Sequence
IVQQQNNLLRAIEAQQHLLQLTVWGIKQLQAASGGRGGWMEWDREINNYTSLIHSLIEESQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords TRANSMEMBRANE GLYCOPROTEIN (GP41)
publication title Structural and functional analysis of interhelical interactions in the human immunodeficiency virus type 1 gp41 envelope glycoprotein by alanine-scanning mutagenesis.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Viral protein
total genus 27
structure length 61
sequence length 61
ec nomenclature
pdb deposition date 2001-03-01
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.210 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 1i5xA00
3B8MA 4JF3A 1QCEA 5HFLA 1F23A 1ENVA 2EZPA 4FIPC 4N23A 3MHSC 1EBOA 3CP1A 4FK5C 2EBOA 3P30A 5H9CA 1DF4A 1K33A 3B8NA 3M99B 3WFVA 1I5YA 2M7WA 1JPXA 4JGSA 4E2LA 1QR8A 1SZTA 1MG1A 2LP7A 5CMUA 5KA6A 4N21A 5CN0A 1DLBA 5HFMA 1QBZA 1Y4MA 1DF5A 3CYOA 1I5XA 2X7RB 4JPRA 2EZOA 5KA5A 3H01A 1QR9A 1K34A 2OT5A 3B77A 3GWOA 4FJCC 3K9AA 3MHHC 4G2KA 2P6JA 2MK3A 1JQ0A 1Y66A 1MOFA
chains in the Genus database with same CATH superfamily
3RYCB 4DV7O 4PA3A 3N2KA 3QO5A 1SQGA 4MTOA 5GTIZ 1M1KW 4O4JA 1X4TA 5KHIA 3ABUA 5LA6A 4CZZA 1GAXA 2PTMA 4W4KA 1EFRG 2YXYA 4KHPB 3CCJV 2QWQB 1NR1A 3AG3C 3OT7A 5IJ0A 3STLC 1Z5WA 1S76D 1S72V 1HDJA 5JH7A 5IWAO 2R9RB 3LSQA 1IBKB 1Y74B 4DV1O 1RPRA 2JEUA 5FPOA 2E75B 4QE9A 3CWBH 4TUYB 2DYSB 1PNKA 4WFEA 3CCRV 1L8DA 3IC9A 1WA8B 1N34O 4HNAB 4O2AA 4DV3O 2BE3A 3E35A 2QWNB 3QF7A 3J80N 3E2EA 3OE7G 2PZSA 3H9VA 1GMGA 4GKKB 2GHYA 4IIJA 1OCZC 4H33A 3D36A 4TOIA 4FFBB 4K3AA 4UCRA 2G38A 1R1BA 2JJ1G 4FIPC 3P3NA 4HYOA 2ZR3A 3HB3B 4I9QA 2JRIA 4K0KB 4A5UB 1FKAO 3ABTA 4B08A 4B3MO 1BE3H 1YJWV 2FTKA 1G1XB 4PELA 1P49A 1PL0A 4RAIA 2H3OA 2HFEC 5KMGB 4B7KA 4MT8A 1DK1A 2XNDG 4DV2B 1K7DA 5CA0A 2PGGA 1VF6C 1OZ0A 1QLEC 5E1AC 1BGYH 2ZNIA 5D5QA 2H8PC 4P9OA 1XEQA 2EILB 1EN6A 3DSQA 3HKCB 4LF5O 1CPYA 3B8MA 1QCEA 4MVQA 2CUGA 4D6TH 4J80A 4DR2O 3ZX6A 4DR3B 1AJQA 2F1MA 2Q5ZA 2OCCC 1OCCB 4NR1A 3QNEA 2E74B 4TWKA 3ASOC 1Q8IA 4W4LA 4CS4A 1OCRC 2ZINA 5IJ9A 4O4IA 5LOVA 5EZYA 4X9QA 4UCUA 5DEDA 2WLIB 4LCUC 3UCSC 2YEVA 1BCCH 1WB7A 5CA1A 3OTOB 1IBLO 1KMIZ 5KUKA 1K73W 5JVDA 3CC7V 1B06A 2ZM6B 1KB9F 1KKCA 1Q86W 3CRMA 2ILMA 2B1IA 2QSAA 4UB6Z 4F6RB 1N0NA 3K57A 4ABMA 1AVMA 1KBHA 4MVSA 2EIMC 3W7WA 1N32O 2Q4PA 4JTAB 2VWJA 2F4VB 4DW0A 3QO7A 2ZD9A 1FFTB 1ROPA 1FS0G 2QJ1A 3W7UA 3CCSV 1GM9A 2UUAO 3ZHQA 3CJHB 3L75H 2EJ7A 4UCTA 2UXBB 1V54C 2JGDA 5LYJA 4X66B 2KB1A 3ABKB 4LR3A 1F4NA 3CEIA 4YHHO 1AI5A 2XUMA 3ZMZA 2IJJA 3SYOA 2KSDA 4QE7A 2Z3YA 4EKWA 2X6BA 3H1LH 5GONA 2A0LA 2P22C 1W0JG 1D5AA 1MNGA 4PA6A 4QPKA 1XNRO 1BQZA 4IHJB 4LF4B 1HNXB 4PV1B 2NNUA 3K5OA 1RP3B 5C8YB 2CGNA 4MS2A 4NTXA 1XILA 3JD3A 2QTOA 4ASUG 3DC5A 1A32A 1NS1A 4PA9A 3K06A 2CE4A 4WFAV 2OIEA 1QHTA 3K3WA 4I50B 2XTAA 4JI4O 1MOFA 3JARB 5JJEB 4WFFA 1AILA 2ITDC 4X1YB 1DF4A 1FYJA 1GTOA 2HHHO 3E83A 1IDSA 2LP7A 2Q8VA 1N33B 2DN9A 3T1YB 1Q43A 1JFFB 5FLXN 4LH6A 1QU7A 2QGNA 4YJ3A 3JATB 1PD3A 3MHHC 1R6KA 2B5UA 4DR7B 4JV5O 2LW1A 3P30A 3AK2A 3SR2C 4DUZO 5CB4B 1H38A 1VQMV 1I7FA 4NYKA 3X2QB 1Q6UA 4TV8B 4QIWF 1V55B 4LF7O 1I0HA 1YSCA 2QWOB 5B3SC 4MW8A 3ZEDA 4NXMB 5ITZB 2XAGA 4JI3O 3ICXA 3RYIB 4DK1A 1IX9A 2KKWA 4FK5C 5LHIA 4UV8A 3ETGA 5IYCO 3VQYA 3FB5C 1VQNV 3RN4A 3CCLV 1Y4MA 4LFAB 2EIJC 2YS8A 2HLDG 1GN2A 3K79A 4JI5O 1PV0A 2BSKB 2QE7G 1KC8W 3OD4A 4JF3A 5B1OA 2RMKB 2GUZA 1VARA 3WB1A 1GN4A 1OCCC 3BEHA 1NBMG 2CH7B 1BZKA 2KQXA 2LFSA 4ZKIA 3LUTB 2EULA 4NXNB 3ZRWB 2B9ZA 2KG7B 1KUQA 4DW1A 2ZIMA 1ZLZA 4X20A 2GDSA 3F5WC 4B3SB 3FX7A 3LNNA 3E8GA 4DRXB 3TGUH 4K35A 3FD9A 1DGSA 1F7YA 1KU9A 3C90A 1D2DA 4JI8B 4I55A 2HEPA 3L74H 4GCZA 4ZBMA 1GK9A 1I94O 2CGOA 4HAMA 2QWPB 2HJDA 3ZHUA 1CEZA 1N4CA 4LP8A 3C3SA 3T1CA 1DTOA 1MA1A 3ABKC 1XMOO 1D5NA 1FFXA 2EINC 4PHZA 2Q67A 4RO2A 4X62B 4H44B 5KHKA 3JCZA 2X0LA 2QDOA 3JALA 2DWEC 3FB8C 4XBFA 2E76B 2XASA 4TV9A 1B04A 3AG3B 2DWDC 4IGGA 4UUJC 3FYIB 2A06H 1HNWO 1FXHA 3SPGA 1Y76B 2ZNJA 4JAUA 1AI4A 2Q7HA 1GN6A 3G67A 1SQFA 4JASA 2UUBB 2BTQA 3D3IA 5L3DA 5EYPB 3H1HH 4OXSA 2PF4E 4MVZA 2RJZA 4ICGA 1IBMB 4DYLA 1SS3A 4WBNA 5IYZB 3BAAA 1BMFG 4YY3B 2VQEB 3LDDA 2YXLA 3IC7A 4FLWA 3OUFA 1TUBA 1SQQH 2JS5A 4DK0A 4DO2A 1XNQO 3APOA 4O2BB 4CBCA 3T1HO 1OCZB 3HKBB 3LNMB 4DR5B 4OGQB 3SDLA 1YIJV 3FFQA 1M56B 2K1EA 4Z1VA 3NR7A 4FZ0A 4JI7B 3RBZA 4LF6B 2DW4A 3X2QC 4DXWA 2DMXA 5TISZ 3JAWA 4QGPA 3SGIA 3K5NA 5K1PA 2QM4A 1AROP 3OGIB 5IY5C 1U96A 3OUSA 4J11A 4JTCB 2PY5A 4JI2O 2IJKA 1URFA 3AG2B 3UT5A 4GX5A 3OEEG 1AR4A 1GM8A 3W7XA 1JOYA 1MMMA 4KUMA 4F6EA 3JD2A 2AXTZ 4QPJA 3E22B 3AG1B 5LGNA 4JPRA 1OHHG 3H1IH 3AG4B 2AW9A 3MDSA 4MSWC 2GTAA 4B3TO 1K34A 3CCQV 2HVKC 1US6A 3OMAB 2UXCB 2WLNA 3RYFB 4O4HB 3O9OA 3FAVB 3UM7A 3N2GA 2E5LB 1N36B 2P4VA 3ASOB 4DUYB 4DV7B 2UUCO 3CSXA 4HBNA 4DV0O 4LF9O 2AZ0A 1M57C 4CS3A 1JJOA 1JA8A 1YVWA 3HR0A 4XDKA 5JCOC 1NZ6A 5B1BC 2QWRB 3ETEA 1NJIW 2EIKB 3UO3A 2ZT9B 3DGEA 4IT5A 1K33A 3G6BA 2NR5A 3Q4HB 2ZE8A 1K9MW 2HR3A 4LNUB 4CC5A 4AQYB 2P90A 4LF8B 1RM1C 1YTFB 4WF9V 3LDCA 4GT1A 1IZ3A 1L0NH 1R73A 4BIOA 4RWUA 5C93A 5LP6A 5BR8B 1S0VA 4PD4F 4LFBB 2BTOA 2VQFO 2CTPA 4KP4A 5H9CA 1V54B 3UO2A 2R70A 3H1KH 1FXKA 5CMUA 4WFBV 4MVRA 1P4RA 1N34B 3AEIA 4DV4B 4DV3B 4FLZA 4FMTA 3ZBHA 1JVMA 3K9SA 1X59A 3MAQA 2ZCEA 3CB2A 5H5NA 3IAYA 2AZ2A 3N2KB 4IL6Z 5EIBD 4GLXA 3VQXA 3RT3C 4X65O 2A79B 2QM7A 4O4JB 4DR4O 3E8FA 2JEXA 5LA6B 2E3CA 3CRAA 4JZGA 1WPXA 1J95A 5KA6A 3L72H 1LNQA 2EJRA 1HNZB 3FYEB 1GO3F 1AR5A 2P67A 4DR1B 5IJ0B 3S3WA 4LFCB 2R9AA 5IE9A 2ZXWC 3M7MX 3ABMB 4TUYA 3OR6C 3CD6V 1SQVH 4JYAO 5JH7B 1RPOA 4EFBA 2R72A 1YITV 1ZSPA 3WG7B 2W6JG 3CRRA 4FM2A 1KYOF 5LMUB 4YIOA 2OWOA 1ZL8A 1TAEA 4O2AB 2LJ2A 4PDVA 4XDLA 2PYJA 1M56C 1NTZH 2HKOA 4KHPO 1QR8A 1JX9A 4IIJB 2X6CA 2XAFA 4BR6A 3H01A 1R3JC 5B3SB 3O65A 4PI0A 3AG2C 2VWKA 3JAKA 4KL1A 2XHBA 1MSWD 1Q6IA 1ZTEA 1IBLB 3OFNG 2D3OW 4P30A 2AGAA 1HWYA 3AG1C 3FB6C 2EIJB 3AG4C 4CH3A 2QTSA 1N0JA 1VP7A 1AI6A 3ASNC 3A8TA 1ZAUA 5CA0B 1RFYA 2EBOA 4X1IA 1LUWA 4G27B 3RFRA 1PM9A 3JSNA 1XMQB 3GB7C 1NQTA 4GKKO 1AB3A 1GN3A 2ZE5A 1EN5A 2YDEA 2C2AA 1K5QA 3BVOA 3HKEA 2JS3A 3ZRXA 4OPHA 1TGOA 3SPIA 3CRQA 4BAYA 5JQGA 3EXAA 4JAAA 1HW7A 4YHHB 4L8JA 4X64B 5KHJA 1XHXA 3K0GA 2JGUA 4K0KO 1XQ8A 2EIKC 2WLLA 3K08A 2LGQA 3G80A 2M7WA 4GUNA 5IJ9B 3E8BA 2WLHA 4O4IB 5LOVB 5EZYB 4X89A 1E79G 2R9IA 2YEVB 3BHPA 5CA1B 5JVDB 4EB6A 1HP8A 3UQ8A 1R3LC 1SQXH 1BS3A 3ABLB 2FB5A 1BHBA 1QNMA 5JJNB 1VQ6V 2OTJV 2F95B 2EINB 1Q3EA 5KA5A 4DR3O 2UXDB 2P6JA 1XBLA 2JGDB 3HKDA 5GW7A 5LYJB 1PP9H 5D5PA 3TXQA 1G8MA 3LSUA 2W0XA 4MVUA 3ZJZA 1BQ0A 3OTOO 3VQWA 4FFKA 1WNSA 3CCEV 4AILC 5GTHZ 4PA4A 1SRYA 2IJHA 1JR9A 4LF7B 4I5SA 2JVDA 2RNBA 2BCCH 3ABMC 4OX9B 3EHBB 4KFMA 2L35A 5DN6G 5KX5A 5EIBC 2F4VO 3WG7C 3ZIAG 1Q81W 5L3CA 5L3FA 2A9HA 5KAFZ 3IJ4A 3KZIZ 4NVPA 2UXBO 3VQVA 4X66O 1CXZB 1GRJA 5KAIZ 4GZRB 4O4LA 5FNVA 5HFLA 1KD1W 3ZS8C 1WPBA 2FKXA 4X8AA 1H2LA 1FXVA 2DOSA 3SYQA 1M90W 4ZOLA 2HVJC 5A9GA 3D36C 3KCYA 1YXBA 4YJ3B 3RWRD 5IY5B 3I55V 1SF9A 1HNXO 3B77A 1CP9A 1E1RG 3W7TA 1WN7A 2MK3A 3E89A 5J2UB 2Q7GA 5J2TB 1P7BA 4DV5B 1S3JA 4JYYA 2UU9B 2JK5C 4JI0B 3JD4A 1I5YA 3CXCU 3BY6A 2A7WA 1MG1A 3B40A 4DV6B 5BZBA 4ZHQA 4EEQA 1NH2D 4PA7A 3DXRA 1SQBH 2VRZA 4D7SA 3G6EV 1OCOC 2P5OA 1K92A 2Q6AA 4UFZA 3T4ZA 3G71V 3JASA 3ZN0A 3C3TA 1N33O 3CC2V 3T1YO 2P7TC 4I0XA 2WA3A 1I94B 2F66C 1WJZA 2CH7A 4MVMA 3SYAA 5LXTB 4R6ZA 4IYHA 2XAHA 3ZHSA 2GUZB 4DR7O 1M57B 4ZI7A 4FLVA 1UFIA 3OM3B 4I4TA 4GYCB 5B1BB 5B5EZ 1K8AW 1XOUA 4Z1MG 3CXHF 3F7VC 1S5HC 1K5SA 1LR1A 3S3XA 3VBBA 5CN0A 2QM8A 1Q7YW 3QG5A 5KUMA 4LWSA 1RM1B 1Q6HA 4X20B 3WU2Z 2PI5A 4U3JB 2ZDIA 3K58A 1YF2A 3ABLC 1YZBA 3JD1A 4FLTA 4B7EA 4LFAO 4ZIBA 4G28B 3L71H 3SJQC 2OYQA 3M99B 4GX0A 3CMEV 2Y48A 3KG2A 1SC5B 1VF5B 1ORQC 3D3QA 4GKJB 4I55B 3RYHB 2ZQMA 4RUFA 2DYRB 1F51A 4U7OA 3T4DA 1FFXB 2Q0OC 5CBHA 3ETQA 2IH1C 3CYOA 4BWAA 1PPJH 4PI2A 1BT8A 2EZOA 4B3SO 3GWKC 2RN9A 4TV9B 2QKCA 2ODMA 5BMVA 1H8HG 2ZXWB 4JI1B 1FJGB 2EX3A 4FZ1A 4N23A 4FLUA 3MHSC 1S77D 3CRCA 3CHXA 3HPLC 2BTQB 1TVKA 3JYCA 4JI8O 5H6RA 2F23A 4TT3G 2V1DA 5LMNB 3TETA 1GH6A 1VQPV 2JDIG 4WBNB 4PDRA 2Y4TA 2Q9LA 4FLXA 1SA0A 1IVSA 4J7JA 4RQEA 1R3KC 3ETDA 3F7YC 3MD0A 4YJ2A 4X62O 2Q7EA 1T5EA 1TUBB 3IFXA 4FLYA 4JI6B 3R65A 4X1KA 1SQPH 2DE0X 1P7GA 1COWG 2CAZC 4B3RO 4U3FH 5DM6V 1JJ2U 4TQFA 1RSOB 1Z5VA 3TJTA 2UUBO 3JAWB 1H8EG 3QVNA 3U0ZA 3G4SV 2YICA 2ZE7A 4UV9A 1VF6A 1IBMO 3CCMV 3UT5B 1HR0O 3GWOA 3BPZA 2WLJA 3QO8A 4YY3O 3ASNB 2W6IG 2VQEO 3K0DA 3FAVA 1EZJA 4J41A 4MTXA 1NVPD 3J7AU 1IXMA 3T2MA 5CBFA 4N21A 1DLBA 3E86A 3IGAC 4CH6A 5FPRA 1GKFA 1QVFU 4NB5A 4AI8A 3K9AA 1YDXA 4JI7O 4LF6O 3N2GB 2Q69A 2BOBC 5LGUA 4TSFG 3RVYA 2M6YA 3M8AA 1JMKC 3B2EE 3ZHVA 1O9HA 3H1JH 1H2SB 2F93B 1XI1A 2CTRA 1OV9A 5IWAB 3A0RA 3OMNB 1W2BU 4MVOA 1JQ0A 4DV1B 3CCUV 5A2QN 1KP2A 1ZX3A 3SYPA 2Y69B 3F5TA 3RYCA 4WFHA 3K5LA 3L73H 2UXCO 1K3EA 1VQ8V 2OIGA 4UVBA 4UCOA 5LHHA 2E5LO 2DYRC 1N36O 2W0FC 2PYLA 1MSDA 3EVKA 2N74A 4QJFB 1MABG 2UXXA 4JTDB 4DUYO 1G4YB 1I08A 3CP1A 1FXKB 2NN4A 4I7ZB 2RQ6A 2QKAA 4R7CA 1Y74A 5L3GA 4K8XA 4B3MB 1PKXA 4YXWG 4DR6O 3CCVV 1J5EO 3RW0A 2LFRA 4AQYO 1Q90D 5EBMC 4C7UA 4LF8O 5LBQA 2VS0A 4PDLA 1SZXA 1WA8A 4NKGB 1SZTA 4UXNA 4JYBA 4HNAA 5BR8O 5B1AC 1YHQV 4LFBO 1YEWA 5EC1C 4H37A 2P4KA 3JAMN 2X6AA 5B66Z 2HG5C 1ZUQA 1SETA 1FPOA 2EZPA 4FFBA 1VQ7V 4DV4O 4LF5B 5LL6Y 4F4LA 4MTGA 4PDMA 4DR2B 5DECA 4Z2WA 4CH4A 1NI8A 2GBOA 5KHHA 2Y0IA 1ZL8B 2ADPA 1K97A 1K4DC 2ITCC 4K8ZA 3ML0A 1OJHA 2V4DA 4JYCA 4RUEA 2IH3C 2P06A 3WB2A 2FYUH 2WAMA 1THZA 1IBKO 1EZVH 1HNZO 1AI7A 5KMGA 3I5DA 3DTUB 4IYIA 3SPCA 5CA3A 4DR1O 3K5MA 1XHZA 1TA8A 4LFCO 4FM0A 1JCHA 2WA4A 4PJ0Z 2MW2B 4UVAA 2YIDA 3JAKB 1VQ9V 4I9WA 1NTKH 2B1GA 1P84F 2DQ3A 1N32B 1OCOB 3HKCA 1XL4A 1Z2GA 5B1NA 2NLJC 1M9NA 2O57A 5LMUO 2K9PA 1VQ4V 2UUAB 2YXHA 1IURA 3FB7C 1N8RW 3KCXA 3BA9A 1YI2V 5L3EA 2YUAA 2FMLA 2WLIA 1YJNV 4X1IB 3TXSA 3A2FA 2WSSG 2QR4A 1IXBA 2ZKOA 3HKEB 1U97A 1XNRB 5EBWC 3ZMTA 5JQGB 3SYCA 4F6RA 3B09A 4QNHB 2WWWA 2FL4A 1M4UA 1H2MA 4U7NA 3KKYA 3OEHG 2WLLB 3DC6A 4DV2O 1F23A 2ATKC 3ZRVA 1M5IA 5LGTA 1VF7A 2Y69C 3CJHA 3L9DA 3WFVA 4JI4B 2D2CB 2PUSA 4R8CA 2ADQB 1XREA 4CC6A 2HHHB 5LP6C 4EB6B 2Q0AA 4L87A 3APQA 2XAJA 3BABA 1XMQO 3BCCH 4LC1A 4EFEA 4MW3A 1VQOV 5JJJB 1QVGU 1FXKC 5K1XA 1SESA 2V7QG 2Y0PA 3L70H 4FPPA 4IHJA 5C8YA 4KXRA 1YCIA 4JV5B 1I5XA 4X64O 2PI4A 3BA8A 4J9ZB 3STZC 2CTQA 4J9YB 4DUZB 4D7TA 3BFRA 1WB8A 1QLNA 1SKVA 1AP5A 4YIPA 2UXNA 5GONB 3SPHA 3HKDB 3TK1A 4WCEV 2ZM6O 3OMIB 4I50A 2LGWA 2GSMB 4WFGA 3RGBA 3JARA 3QTCA 5KHGA 3CC4V 4JI3B 4UB8Z 3CMAV 2CK3G 2Q73A 4J10A 4X1YA 2AHZA 5H2FZ 3ZRSA 4UVCA 5BY1A 2N04A 3JSLA 2A3QA 4Q20A 4NTYA 2DQ0A 2DYSC 1JFFA 2L6LA 1YJ9V 2IU0A 5KX5B 1PNLA 1MZEA 4JI5B 3JATA 1WLEA 2YIAA 1EBOA 3R66A 4LH7A 1AP6A 4AHCA 3SPJA 4H13B 4J7KA 5EK0A 3LSSA 5CB4A 2YIBD 2UXDO 1B3QA 1BSMA 1S5JA 4TV8A 1QR9A 4O4LB 1VQLV 4LF4O 5FNVB 2HJFC 4G2KA 1R6NA 2WPDG 2JJ2G 5ITZA 2ZE6A 2YIBA 1EN4A 3RYIA 3B4SA 5J2UA 2DJVA 5J2TA 5EC2C 3AK3A 2GV9A 4ZOLB 2HP8A 3OR7C 4OX9O 2CTWA 1VQ5V 1AJNA 3NXSA 2QA4V 2RDCA 2OT5A 3TCUA 3GVMA 3K59A 2RCVA 2BSKA 1XDCA 2BOCC 3CPWU 3ZCCA 2Q68A 3FKSG 2F43G 3RVZA 1NKDA 5L3BA 4MTFA 4ZHQB 1KQSU 2XOKG 5IT9N 3BRCA 5IYDO 3E8HA 5LXTA 5IDJA 3DXRB 1MZFA 2EILC 4BIUA 1XMOB 2XAQA 3JASB 1VEWA 3ZRWA 3J81N 2KG7A 3AK1A 1Q5OA 4XDJA 4I0XB 4J42A 5FL7G 5EBLC 1NH2B 2Z0AA 1NU1H 4FVMA 4R50A 5JCOA 1WP8A 5KLVH 1PNMA 5JWPA 2ARHA 1H2GA 3A0HZ 4NXMO 4E2LA 2LW7A 1BL8A 4DRXA 1SERA 4ZI7B 3I56V 4JAVA 1HNWB 1NR7A 4DV5O 1UPGA 3ZMVA 3PN1A 4BIZA 2UU9O 4I4TB 4GX1A 4JI0O 2LQTA 1KP3A 1WAZA 5CBGA 1FAFA 3N27A 4U3JA 1ZWIC 4LBEC 4DV6O 1F4MA 1E1QG 5E79Z 1AR1B 1NT2B 1VIBA 2XT9A 1Y67A 1WP7A 4LWSB 5AG2A 5HFMA 3OGCC 3A0BZ 3ZMSA 4X88A 3OAAG 3RYHA 4Q6GA 2ZR2A 1BHAA 2IU3A 3CX5F 1W0KG 1XNQB 5F2VO 1H2KA 2WLMA 3T1HB 3OTFA 4NXNO 2CDYA 2OTLV 3U11A 1Y76A 1TUEB 2ETNA 3JALB 1VMGA 4GX2A 3W7SA 3SJCC 5EYPA 4JI2B 4FM1A 4B3RB 4JZ2A 2Y4UA 5IYZA 2ZIOA 1QBZA 1R3IC 2OCHA 1AJPA 5B1AB 1H2NA 2Z5UA 5BMVB 2IM9A 3SJAC 2N05A 1G6UA 4O2BA 2IJIA 4BW5A 4UCSA 3WB0A 2AHYA 3HKBA 4B3TB 3JCUZ 4CH5A 1HR0B 1FD9A 1XUQA 2YC0A 1TVKB 4GKJO 1V9PA 3UKMA 2LO1A 4OPAA 1PL4A 3ZN1A 1DF5A 4RQFA 1K4CC 2YI9A 1VQKV 2JIZG 2YI8A 1L0LH 2UUCB 2YSUB 1L1FA 1SA0B 4DV0B 4LF9B 1O9GA 4YJ2B 1QQCA 2WLKA 3CS5A 3VOUA 3JD0A 1RSOA 4X1KB 4J7ZA 3ZHRA 4TQDA 1V55C 5J9PC 4JI1O 1FJGO 4HZ3A 3E22A 2H94A 2IW5A 2IBZH 1XL6A 3ZMUA 1M93A 1Y6XA 1ENVA 3RYFA 4O4HA 4P9PA 1Q82W 1KECA 4P2ZA 5LMNO 1JPXA 3P32A 3K03A 2VQFB 1QLEB 2X7RB 4NTWA 4DR5O 1B6QA 3AG7A 1S5LZ 1Y66A 4H0LB 4JI6O 5IYBO 3CE2A 1KKDA 1GM7A 2OCCB 3B8NA 3EFFK 4E4EA 2QKSA 1YTFD 1OCRB 3SJBC 3Q4HA 3P3PA 1NVPB 1UJWB 4X65B 4LNUA 3THOA 4DR4B 3OW2U 5H6QA 4UCVA 5LHGA 1LUVA 1NTMH 2GTSA 4CS2A 3ZHTA 4DR6B 1J5EB 3K04A 4JGSA 1R6TA 3PJSK 3U10A 4JYAB 5BXZA 4BW9A 2EIMB 2ZDIC 5LP6B 3D8CA 2QEXV 1EM1A 3LDEA 4FJCC 1W59A
chains in the Genus database with same CATH topology
1P7BA 1S3JA 4PA3A 2JK5C 3JD4A 2WSSG 3QO5A 1Q7YW 1BMFG 1I5YA 3CXCU 4MTOA 3BY6A 3LDDA 3IC7A 1MG1A 1M1KW 5EBWC 3ABUA 3ZMTA 3OUFA 5BZBA 3SYCA 4CZZA 4QNHB 2WWWA 4DO2A 1EFRG 1NH2D 3CCJV 4CBCA 1OCZB 4U7NA 4PA7A 3G6EV 1OCOC 3OEHG 1NR1A 3LNMB 2WLLB 1K92A 2Q6AA 3T4ZA 3AG3C 3G71V 1F23A 2ATKC 3STLC 3ZN0A 3ZRVA 3CC2V 1YIJV 5LGTA 1S72V 2P7TC 1S76D 2Y69C 1M56B 2K1EA 3WFVA 3RBZA 2DW4A 2R9RB 3X2QC 3LSQA 4MVMA 3SYAA 4DXWA 4R8CA 4R6ZA 1AROP 5IY5C 1RPRA 4L87A 2XAHA 3OUSA 2XAJA 4JTCB 2JEUA 1M57B 4QE9A 2IJKA 2DYSB 3AG2B 1PNKA 4WFEA 3CCRV 3OM3B 4GX5A 3OEEG 4LC1A 5B1BB 4MW3A 1VQOV 1GM8A 1QVGU 1K8AW 1FXKC 4Z1MG 3F7VC 1SESA 1S5HC 3W7XA 2V7QG 1K5SA 4FPPA 1JOYA 3E35A 4KUMA 3JD2A 3VBBA 4QPJA 5CN0A 3E2EA 3AG1B 1I5XA 3OE7G 2PI4A 2QM8A 4J9ZB 5LGNA 4JPRA 1OHHG 3STZC 5KUMA 4J9YB 1RM1B 3AG4B 1GMGA 1QLNA 4MSWC 2GHYA 2UXNA 1OCZC 1K34A 3SPHA 4H33A 3TK1A 3CCQV 2HVKC 3D36A 3OMAB 4WCEV 2PI5A 3OMIB 2WLNA 2ZDIA 2GSMB 3ABLC 3UM7A 4WFGA 2JJ1G 3JD1A 4FIPC 4G28B 3SJQC 3M99B 3CC4V 4HYOA 3CMAV 2CK3G 2ZR3A 3HB3B 4GX0A 3CMEV 3ASOB 2Y48A 3KG2A 1ORQC 3ABTA 2AHZA 3ZRSA 1YJWV 2FTKA 1M57C 4UVCA 4PELA 4Q20A 2DQ0A 2ZQMA 2DYSC 4RUFA 1PL0A 1YJ9V 2DYRB 4XDKA 4RAIA 2IU0A 2HFEC 1PNLA 5B1BC 3ETEA 1NJIW 1F51A 4U7OA 3T4DA 2EIKB 1WLEA 1EBOA 4MT8A 3DGEA 1K33A 2XNDG 1K9MW 1K7DA 3SPJA 2HR3A 5CBHA 5EK0A 3LSSA 2P90A 1OZ0A 2IH1C 3CYOA 1QLEC 5E1AC 1RM1C 2H8PC 4P9OA 1YTFB 4WF9V 2EZOA 3LDCA 4GT1A 1R73A 1QR9A 2EILB 1VQLV 5C93A 2HJFC 4G2KA 1R6NA 2WPDG 1S0VA 2JJ2G 1CPYA 1H8HG 2ZXWB 3B8MA 1QCEA 4MVQA 4N23A 1S77D 3MHSC 1AJQA 4KP4A 5H9CA 2OCCC 1OCCB 1V54B 3QNEA 5EC2C 4TWKA 3ASOC 3HPLC 1OCRC 1FXKA 5CMUA 3JYCA 4WFBV 4MVRA 1P4RA 5H6RA 3AEIA 4TT3G 3OR7C 2V1DA 1VQ5V 1AJNA 3TETA 4FMTA 3NXSA 2QA4V 1VQPV 1JVMA 2WLIB 4LCUC 2YEVA 2JDIG 2OT5A 3TCUA 4PDRA 5KUKA 2BOCC 1K73W 3CPWU 3ZCCA 2Q68A 3FKSG 3CC7V 4RQEA 2A79B 2QM7A 1R3KC 1Q86W 3ETDA 3F7YC 3MD0A 3E8FA 2F43G 2JEXA 3RVZA 1NKDA 5L3BA 2B1IA 4MTFA 3IFXA 1KQSU 2XOKG 3R65A 1WPXA 1J95A 5KA6A 5IYDO 4MVSA 1LNQA 2EIMC 3E8HA 2EJRA 3W7WA 3FYEB 1GO3F 5IDJA 4JTAB 2EILC 4BIUA 2P67A 3QO7A 2ZD9A 1FFTB 2XAQA 1ROPA 1COWG 1FS0G 3ZRWA 3W7UA 2ZXWC 4XDJA 3CCSV 1GM9A 3ABMB 5DM6V 1JJ2U 3OR6C 5FL7G 3CD6V 5EBLC 1NH2B 1RPOA 1V54C 4R50A 1YITV 1PNMA 3WG7B 1H8EG 2KB1A 3ABKB 2W6JG 1H2GA 4E2LA 1F4NA 3G4SV 1BL8A 1AI5A 1SERA 4UV9A 4JAVA 3ZMZA 3I56V 2IJJA 3SYOA 4QE7A 1NR7A 3CCMV 2Z3YA 3ZMVA 4BIZA 4EKWA 4GX1A 3GWOA 2WLJA 3QO8A 2X6BA 3ASNB 2A0LA 1KP3A 5CBGA 2W6IG 1W0JG 4PA6A 4QPKA 1ZWIC 4LBEC 4PDVA 3K0DA 4XDLA 1F4MA 1E1QG 1EZJA 2NNUA 1M56C 1AR1B 4MTXA 4MS2A 2HKOA 1NVPD 1IXMA 3JD3A 3T2MA 1QR8A 5CBFA 1JX9A 2QTOA 4ASUG 4N21A 1DLBA 5HFMA 3E86A 3OGCC 2X6CA 3IGAC 4PA9A 2XAFA 3K06A 4WFAV 3H01A 1GKFA 1R3JC 1QVFU 5B3SB 3K3WA 3ZMSA 4X88A 3OAAG 3AG2C 3K9AA 2ZR2A 1BHAA 2IU3A 1MOFA 2Q69A 1W0KG 2BOBC 1MSWD 4WFFA 2WLMA 2ITDC 5LGUA 1DF4A 1GTOA 4TSFG 3RVYA 3E83A 3OFNG 2D3OW 4P30A 2OTLV 2LP7A 1HWYA 3AG1C 3FB6C 1TUEB 2EIJB 3AG4C 4GX2A 3W7SA 1AI6A 3A0RA 3ASNC 1PD3A 3OMNB 3MHHC 1W2BU 4MVOA 1JQ0A 3CCUV 1KP2A 1R6KA 2B5UA 2EBOA 3P30A 4G27B 3SYPA 2Y69B 4WFHA 1H38A 3GB7C 1VQMV 1NQTA 2C2AA 3X2QB 1K5QA 4QIWF 1K3EA 1V55B 1QBZA 1R3IC 1AJPA 5B1AB 1VQ8V 3ZRXA 1YSCA 5B3SC 4MW8A 3SPIA 2Z5UA 4UVBA 2XAGA 4BAYA 5LHHA 2DYRC 2W0FC 2IJIA 4BW5A 1MABG 2UXXA 3K0GA 4JTDB 4QJFB 1G4YB 2AHYA 2EIKC 2WLLA 3CP1A 3K08A 1FXKB 4FK5C 2M7WA 3UKMA 3E8BA 5LHIA 2WLHA 4UV8A 3ETGA 5IYCO 4X89A 3ZN1A 1E79G 3FB5C 2R9IA 1VQNV 3CCLV 1Y4MA 1DF5A 2EIJC 2YEVB 2HLDG 4RQFA 3K79A 1K4CC 4R7CA 2QE7G 5L3GA 1KC8W 1VQKV 2JIZG 2YSUB 4JF3A 5B1OA 1L1FA 1R3LC 1PKXA 4YXWG 3CCVV 3RW0A 2LFRA 3ABLB 2WLKA 5EBMC 3VOUA 1BHBA 3JD0A 1OCCC 3BEHA 5LBQA 1NBMG 1VQ6V 2OTJV 4PDLA 1SZTA 4UXNA 2EINB 1V55C 4JYBA 5B1AC 1YHQV 5EC1C 5J9PC 2LFSA 4ZKIA 3LUTB 4H37A 3ZRWB 5KA5A 4HZ3A 2H94A 2IW5A 2X6AA 1XL6A 3ZMUA 2P6JA 3F5WC 5GW7A 2HG5C 1SETA 1ENVA 2EZPA 1Q82W 4P9PA 1VQ7V 1KECA 1G8MA 4F4LA 4P2ZA 3E8GA 1JPXA 4MTGA 4PDMA 3P32A 4MVUA 3ZJZA 3K03A 1QLEB 3CCEV 2X7RB 4PA4A 1B6QA 1SRYA 2IJHA 1K97A 1K4DC 4I5SA 2ITCC 4GCZA 1Y66A 1GK9A 3ML0A 4ZBMA 3ABMC 3EHBB 4HAMA 4JYCA 4RUEA 2IH3C 5IYBO 2WAMA 1KKDA 4KFMA 1CEZA 1GM7A 1THZA 5DN6G 4LP8A 2OCCB 1AI7A 3B8NA 3T1CA 1DTOA 3EFFK 3WG7C 3ZIAG 3ABKC 1Q81W 2QKSA 3DTUB 3SPCA 1YTFD 1OCRB 2EINC 5L3CA 5L3FA 5CA3A 2A9HA 2Q67A 4RO2A 1JCHA 1UJWB 1NVPB 3OW2U 3JCZA 2X0LA 4UVAA 5H6QA 2DWEC 3FB8C 1VQ9V 4XBFA 4I9WA 5LHGA 2B1GA 2XASA 2DQ3A 1OCOB 5HFLA 1KD1W 1XL4A 3AG3B 5B1NA 2DWDC 2NLJC 1M9NA 4UUJC 3FYIB 1FXHA 4X8AA 3SPGA 1VQ4V 3K04A 4JGSA 4JAUA 3PJSK 1FXVA 3SYQA 1AI4A 3FB7C 1M90W 1N8RW 4JASA 2EIMB 2HVJC 3D3IA 5L3DA 2ZDIC 5IY5B 1YI2V 4OXSA 2QEXV 3I55V 3B77A 1CP9A 3LDEA 4MVZA 1E1RG 4FJCC 5L3EA 3W7TA 2MK3A 3E89A 2WLIA 1YJNV
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3B8M A;  4JF3 A;  1QCE A;  5HFL A;  1F23 A;  1ENV A;  2EZP A;  4FIP C;  4N23 A;  3MHS C;  1EBO A;  3CP1 A;  4FK5 C;  2EBO A;  3P30 A;  5H9C A;  1DF4 A;  1K33 A;  3B8N A;  3M99 B;  3WFV A;  1I5Y A;  2M7W A;  1JPX A;  4JGS A;  4E2L A;  1QR8 A;  1SZT A;  1MG1 A;  2LP7 A;  5CMU A;  5KA6 A;  4N21 A;  5CN0 A;  1DLB A;  5HFM A;  1QBZ A;  1Y4M A;  1DF5 A;  3CYO A;  1I5X A;  2X7R B;  4JPR A;  2EZO A;  5KA5 A;  3H01 A;  1QR9 A;  1K34 A;  2OT5 A;  3B77 A;  3GWO A;  4FJC C;  3K9A A;  3MHH C;  4G2K A;  2P6J A;  2MK3 A;  1JQ0 A;  1Y66 A;  1MOF A; 
#chains in the Genus database with same CATH topology
 3RYC B;  4DV7 O;  4PA3 A;  3N2K A;  3QO5 A;  1SQG A;  4MTO A;  5GTI Z;  1M1K W;  4O4J A;  1X4T A;  5KHI A;  3ABU A;  5LA6 A;  4CZZ A;  1GAX A;  2PTM A;  4W4K A;  1EFR G;  2YXY A;  4KHP B;  3CCJ V;  2QWQ B;  1NR1 A;  3AG3 C;  3OT7 A;  5IJ0 A;  3STL C;  1Z5W A;  1S76 D;  1S72 V;  1HDJ A;  5JH7 A;  5IWA O;  2R9R B;  3LSQ A;  1IBK B;  1Y74 B;  4DV1 O;  1RPR A;  2JEU A;  5FPO A;  2E75 B;  4QE9 A;  3CWB H;  4TUY B;  2DYS B;  1PNK A;  4WFE A;  3CCR V;  1L8D A;  3IC9 A;  1WA8 B;  1N34 O;  4HNA B;  4O2A A;  4DV3 O;  2BE3 A;  3E35 A;  2QWN B;  3QF7 A;  3J80 N;  3E2E A;  3OE7 G;  2PZS A;  3H9V A;  1GMG A;  4GKK B;  2GHY A;  4IIJ A;  1OCZ C;  4H33 A;  3D36 A;  4TOI A;  4FFB B;  4K3A A;  4UCR A;  2G38 A;  1R1B A;  2JJ1 G;  4FIP C;  3P3N A;  4HYO A;  2ZR3 A;  3HB3 B;  4I9Q A;  2JRI A;  4K0K B;  4A5U B;  1FKA O;  3ABT A;  4B08 A;  4B3M O;  1BE3 H;  1YJW V;  2FTK A;  1G1X B;  4PEL A;  1P49 A;  1PL0 A;  4RAI A;  2H3O A;  2HFE C;  5KMG B;  4B7K A;  4MT8 A;  1DK1 A;  2XND G;  4DV2 B;  1K7D A;  5CA0 A;  2PGG A;  1VF6 C;  1OZ0 A;  1QLE C;  5E1A C;  1BGY H;  2ZNI A;  5D5Q A;  2H8P C;  4P9O A;  1XEQ A;  2EIL B;  1EN6 A;  3DSQ A;  3HKC B;  4LF5 O;  1CPY A;  3B8M A;  1QCE A;  4MVQ A;  2CUG A;  4D6T H;  4J80 A;  4DR2 O;  3ZX6 A;  4DR3 B;  1AJQ A;  2F1M A;  2Q5Z A;  2OCC C;  1OCC B;  4NR1 A;  3QNE A;  2E74 B;  4TWK A;  3ASO C;  1Q8I A;  4W4L A;  4CS4 A;  1OCR C;  2ZIN A;  5IJ9 A;  4O4I A;  5LOV A;  5EZY A;  4X9Q A;  4UCU A;  5DED A;  2WLI B;  4LCU C;  3UCS C;  2YEV A;  1BCC H;  1WB7 A;  5CA1 A;  3OTO B;  1IBL O;  1KMI Z;  5KUK A;  1K73 W;  5JVD A;  3CC7 V;  1B06 A;  2ZM6 B;  1KB9 F;  1KKC A;  1Q86 W;  3CRM A;  2ILM A;  2B1I A;  2QSA A;  4UB6 Z;  4F6R B;  1N0N A;  3K57 A;  4ABM A;  1AVM A;  1KBH A;  4MVS A;  2EIM C;  3W7W A;  1N32 O;  2Q4P A;  4JTA B;  2VWJ A;  2F4V B;  4DW0 A;  3QO7 A;  2ZD9 A;  1FFT B;  1ROP A;  1FS0 G;  2QJ1 A;  3W7U A;  3CCS V;  1GM9 A;  2UUA O;  3ZHQ A;  3CJH B;  3L75 H;  2EJ7 A;  4UCT A;  2UXB B;  1V54 C;  2JGD A;  5LYJ A;  4X66 B;  2KB1 A;  3ABK B;  4LR3 A;  1F4N A;  3CEI A;  4YHH O;  1AI5 A;  2XUM A;  3ZMZ A;  2IJJ A;  3SYO A;  2KSD A;  4QE7 A;  2Z3Y A;  4EKW A;  2X6B A;  3H1L H;  5GON A;  2A0L A;  2P22 C;  1W0J G;  1D5A A;  1MNG A;  4PA6 A;  4QPK A;  1XNR O;  1BQZ A;  4IHJ B;  4LF4 B;  1HNX B;  4PV1 B;  2NNU A;  3K5O A;  1RP3 B;  5C8Y B;  2CGN A;  4MS2 A;  4NTX A;  1XIL A;  3JD3 A;  2QTO A;  4ASU G;  3DC5 A;  1A32 A;  1NS1 A;  4PA9 A;  3K06 A;  2CE4 A;  4WFA V;  2OIE A;  1QHT A;  3K3W A;  4I50 B;  2XTA A;  4JI4 O;  1MOF A;  3JAR B;  5JJE B;  4WFF A;  1AIL A;  2ITD C;  4X1Y B;  1DF4 A;  1FYJ A;  1GTO A;  2HHH O;  3E83 A;  1IDS A;  2LP7 A;  2Q8V A;  1N33 B;  2DN9 A;  3T1Y B;  1Q43 A;  1JFF B;  5FLX N;  4LH6 A;  1QU7 A;  2QGN A;  4YJ3 A;  3JAT B;  1PD3 A;  3MHH C;  1R6K A;  2B5U A;  4DR7 B;  4JV5 O;  2LW1 A;  3P30 A;  3AK2 A;  3SR2 C;  4DUZ O;  5CB4 B;  1H38 A;  1VQM V;  1I7F A;  4NYK A;  3X2Q B;  1Q6U A;  4TV8 B;  4QIW F;  1V55 B;  4LF7 O;  1I0H A;  1YSC A;  2QWO B;  5B3S C;  4MW8 A;  3ZED A;  4NXM B;  5ITZ B;  2XAG A;  4JI3 O;  3ICX A;  3RYI B;  4DK1 A;  1IX9 A;  2KKW A;  4FK5 C;  5LHI A;  4UV8 A;  3ETG A;  5IYC O;  3VQY A;  3FB5 C;  1VQN V;  3RN4 A;  3CCL V;  1Y4M A;  4LFA B;  2EIJ C;  2YS8 A;  2HLD G;  1GN2 A;  3K79 A;  4JI5 O;  1PV0 A;  2BSK B;  2QE7 G;  1KC8 W;  3OD4 A;  4JF3 A;  5B1O A;  2RMK B;  2GUZ A;  1VAR A;  3WB1 A;  1GN4 A;  1OCC C;  3BEH A;  1NBM G;  2CH7 B;  1BZK A;  2KQX A;  2LFS A;  4ZKI A;  3LUT B;  2EUL A;  4NXN B;  3ZRW B;  2B9Z A;  2KG7 B;  1KUQ A;  4DW1 A;  2ZIM A;  1ZLZ A;  4X20 A;  2GDS A;  3F5W C;  4B3S B;  3FX7 A;  3LNN A;  3E8G A;  4DRX B;  3TGU H;  4K35 A;  3FD9 A;  1DGS A;  1F7Y A;  1KU9 A;  3C90 A;  1D2D A;  4JI8 B;  4I55 A;  2HEP A;  3L74 H;  4GCZ A;  4ZBM A;  1GK9 A;  1I94 O;  2CGO A;  4HAM A;  2QWP B;  2HJD A;  3ZHU A;  1CEZ A;  1N4C A;  4LP8 A;  3C3S A;  3T1C A;  1DTO A;  1MA1 A;  3ABK C;  1XMO O;  1D5N A;  1FFX A;  2EIN C;  4PHZ A;  2Q67 A;  4RO2 A;  4X62 B;  4H44 B;  5KHK A;  3JCZ A;  2X0L A;  2QDO A;  3JAL A;  2DWE C;  3FB8 C;  4XBF A;  2E76 B;  2XAS A;  4TV9 A;  1B04 A;  3AG3 B;  2DWD C;  4IGG A;  4UUJ C;  3FYI B;  2A06 H;  1HNW O;  1FXH A;  3SPG A;  1Y76 B;  2ZNJ A;  4JAU A;  1AI4 A;  2Q7H A;  1GN6 A;  3G67 A;  1SQF A;  4JAS A;  2UUB B;  2BTQ A;  3D3I A;  5L3D A;  5EYP B;  3H1H H;  4OXS A;  2PF4 E;  4MVZ A;  2RJZ A;  4ICG A;  1IBM B;  4DYL A;  1SS3 A;  4WBN A;  5IYZ B;  3BAA A;  1BMF G;  4YY3 B;  2VQE B;  3LDD A;  2YXL A;  3IC7 A;  4FLW A;  3OUF A;  1TUB A;  1SQQ H;  2JS5 A;  4DK0 A;  4DO2 A;  1XNQ O;  3APO A;  4O2B B;  4CBC A;  3T1H O;  1OCZ B;  3HKB B;  3LNM B;  4DR5 B;  4OGQ B;  3SDL A;  1YIJ V;  3FFQ A;  1M56 B;  2K1E A;  4Z1V A;  3NR7 A;  4FZ0 A;  4JI7 B;  3RBZ A;  4LF6 B;  2DW4 A;  3X2Q C;  4DXW A;  2DMX A;  5TIS Z;  3JAW A;  4QGP A;  3SGI A;  3K5N A;  5K1P A;  2QM4 A;  1ARO P;  3OGI B;  5IY5 C;  1U96 A;  3OUS A;  4J11 A;  4JTC B;  2PY5 A;  4JI2 O;  2IJK A;  1URF A;  3AG2 B;  3UT5 A;  4GX5 A;  3OEE G;  1AR4 A;  1GM8 A;  3W7X A;  1JOY A;  1MMM A;  4KUM A;  4F6E A;  3JD2 A;  2AXT Z;  4QPJ A;  3E22 B;  3AG1 B;  5LGN A;  4JPR A;  1OHH G;  3H1I H;  3AG4 B;  2AW9 A;  3MDS A;  4MSW C;  2GTA A;  4B3T O;  1K34 A;  3CCQ V;  2HVK C;  1US6 A;  3OMA B;  2UXC B;  2WLN A;  3RYF B;  4O4H B;  3O9O A;  3FAV B;  3UM7 A;  3N2G A;  2E5L B;  1N36 B;  2P4V A;  3ASO B;  4DUY B;  4DV7 B;  2UUC O;  3CSX A;  4HBN A;  4DV0 O;  4LF9 O;  2AZ0 A;  1M57 C;  4CS3 A;  1JJO A;  1JA8 A;  1YVW A;  3HR0 A;  4XDK A;  5JCO C;  1NZ6 A;  5B1B C;  2QWR B;  3ETE A;  1NJI W;  2EIK B;  3UO3 A;  2ZT9 B;  3DGE A;  4IT5 A;  1K33 A;  3G6B A;  2NR5 A;  3Q4H B;  2ZE8 A;  1K9M W;  2HR3 A;  4LNU B;  4CC5 A;  4AQY B;  2P90 A;  4LF8 B;  1RM1 C;  1YTF B;  4WF9 V;  3LDC A;  4GT1 A;  1IZ3 A;  1L0N H;  1R73 A;  4BIO A;  4RWU A;  5C93 A;  5LP6 A;  5BR8 B;  1S0V A;  4PD4 F;  4LFB B;  2BTO A;  2VQF O;  2CTP A;  4KP4 A;  5H9C A;  1V54 B;  3UO2 A;  2R70 A;  3H1K H;  1FXK A;  5CMU A;  4WFB V;  4MVR A;  1P4R A;  1N34 B;  3AEI A;  4DV4 B;  4DV3 B;  4FLZ A;  4FMT A;  3ZBH A;  1JVM A;  3K9S A;  1X59 A;  3MAQ A;  2ZCE A;  3CB2 A;  5H5N A;  3IAY A;  2AZ2 A;  3N2K B;  4IL6 Z;  5EIB D;  4GLX A;  3VQX A;  3RT3 C;  4X65 O;  2A79 B;  2QM7 A;  4O4J B;  4DR4 O;  3E8F A;  2JEX A;  5LA6 B;  2E3C A;  3CRA A;  4JZG A;  1WPX A;  1J95 A;  5KA6 A;  3L72 H;  1LNQ A;  2EJR A;  1HNZ B;  3FYE B;  1GO3 F;  1AR5 A;  2P67 A;  4DR1 B;  5IJ0 B;  3S3W A;  4LFC B;  2R9A A;  5IE9 A;  2ZXW C;  3M7M X;  3ABM B;  4TUY A;  3OR6 C;  3CD6 V;  1SQV H;  4JYA O;  5JH7 B;  1RPO A;  4EFB A;  2R72 A;  1YIT V;  1ZSP A;  3WG7 B;  2W6J G;  3CRR A;  4FM2 A;  1KYO F;  5LMU B;  4YIO A;  2OWO A;  1ZL8 A;  1TAE A;  4O2A B;  2LJ2 A;  4PDV A;  4XDL A;  2PYJ A;  1M56 C;  1NTZ H;  2HKO A;  4KHP O;  1QR8 A;  1JX9 A;  4IIJ B;  2X6C A;  2XAF A;  4BR6 A;  3H01 A;  1R3J C;  5B3S B;  3O65 A;  4PI0 A;  3AG2 C;  2VWK A;  3JAK A;  4KL1 A;  2XHB A;  1MSW D;  1Q6I A;  1ZTE A;  1IBL B;  3OFN G;  2D3O W;  4P30 A;  2AGA A;  1HWY A;  3AG1 C;  3FB6 C;  2EIJ B;  3AG4 C;  4CH3 A;  2QTS A;  1N0J A;  1VP7 A;  1AI6 A;  3ASN C;  3A8T A;  1ZAU A;  5CA0 B;  1RFY A;  2EBO A;  4X1I A;  1LUW A;  4G27 B;  3RFR A;  1PM9 A;  3JSN A;  1XMQ B;  3GB7 C;  1NQT A;  4GKK O;  1AB3 A;  1GN3 A;  2ZE5 A;  1EN5 A;  2YDE A;  2C2A A;  1K5Q A;  3BVO A;  3HKE A;  2JS3 A;  3ZRX A;  4OPH A;  1TGO A;  3SPI A;  3CRQ A;  4BAY A;  5JQG A;  3EXA A;  4JAA A;  1HW7 A;  4YHH B;  4L8J A;  4X64 B;  5KHJ A;  1XHX A;  3K0G A;  2JGU A;  4K0K O;  1XQ8 A;  2EIK C;  2WLL A;  3K08 A;  2LGQ A;  3G80 A;  2M7W A;  4GUN A;  5IJ9 B;  3E8B A;  2WLH A;  4O4I B;  5LOV B;  5EZY B;  4X89 A;  1E79 G;  2R9I A;  2YEV B;  3BHP A;  5CA1 B;  5JVD B;  4EB6 A;  1HP8 A;  3UQ8 A;  1R3L C;  1SQX H;  1BS3 A;  3ABL B;  2FB5 A;  1BHB A;  1QNM A;  5JJN B;  1VQ6 V;  2OTJ V;  2F95 B;  2EIN B;  1Q3E A;  5KA5 A;  4DR3 O;  2UXD B;  2P6J A;  1XBL A;  2JGD B;  3HKD A;  5GW7 A;  5LYJ B;  1PP9 H;  5D5P A;  3TXQ A;  1G8M A;  3LSU A;  2W0X A;  4MVU A;  3ZJZ A;  1BQ0 A;  3OTO O;  3VQW A;  4FFK A;  1WNS A;  3CCE V;  4AIL C;  5GTH Z;  4PA4 A;  1SRY A;  2IJH A;  1JR9 A;  4LF7 B;  4I5S A;  2JVD A;  2RNB A;  2BCC H;  3ABM C;  4OX9 B;  3EHB B;  4KFM A;  2L35 A;  5DN6 G;  5KX5 A;  5EIB C;  2F4V O;  3WG7 C;  3ZIA G;  1Q81 W;  5L3C A;  5L3F A;  2A9H A;  5KAF Z;  3IJ4 A;  3KZI Z;  4NVP A;  2UXB O;  3VQV A;  4X66 O;  1CXZ B;  1GRJ A;  5KAI Z;  4GZR B;  4O4L A;  5FNV A;  5HFL A;  1KD1 W;  3ZS8 C;  1WPB A;  2FKX A;  4X8A A;  1H2L A;  1FXV A;  2DOS A;  3SYQ A;  1M90 W;  4ZOL A;  2HVJ C;  5A9G A;  3D36 C;  3KCY A;  1YXB A;  4YJ3 B;  3RWR D;  5IY5 B;  3I55 V;  1SF9 A;  1HNX O;  3B77 A;  1CP9 A;  1E1R G;  3W7T A;  1WN7 A;  2MK3 A;  3E89 A;  5J2U B;  2Q7G A;  5J2T B;  1P7B A;  4DV5 B;  1S3J A;  4JYY A;  2UU9 B;  2JK5 C;  4JI0 B;  3JD4 A;  1I5Y A;  3CXC U;  3BY6 A;  2A7W A;  1MG1 A;  3B40 A;  4DV6 B;  5BZB A;  4ZHQ A;  4EEQ A;  1NH2 D;  4PA7 A;  3DXR A;  1SQB H;  2VRZ A;  4D7S A;  3G6E V;  1OCO C;  2P5O A;  1K92 A;  2Q6A A;  4UFZ A;  3T4Z A;  3G71 V;  3JAS A;  3ZN0 A;  3C3T A;  1N33 O;  3CC2 V;  3T1Y O;  2P7T C;  4I0X A;  2WA3 A;  1I94 B;  2F66 C;  1WJZ A;  2CH7 A;  4MVM A;  3SYA A;  5LXT B;  4R6Z A;  4IYH A;  2XAH A;  3ZHS A;  2GUZ B;  4DR7 O;  1M57 B;  4ZI7 A;  4FLV A;  1UFI A;  3OM3 B;  4I4T A;  4GYC B;  5B1B B;  5B5E Z;  1K8A W;  1XOU A;  4Z1M G;  3CXH F;  3F7V C;  1S5H C;  1K5S A;  1LR1 A;  3S3X A;  3VBB A;  5CN0 A;  2QM8 A;  1Q7Y W;  3QG5 A;  5KUM A;  4LWS A;  1RM1 B;  1Q6H A;  4X20 B;  3WU2 Z;  2PI5 A;  4U3J B;  2ZDI A;  3K58 A;  1YF2 A;  3ABL C;  1YZB A;  3JD1 A;  4FLT A;  4B7E A;  4LFA O;  4ZIB A;  4G28 B;  3L71 H;  3SJQ C;  2OYQ A;  3M99 B;  4GX0 A;  3CME V;  2Y48 A;  3KG2 A;  1SC5 B;  1VF5 B;  1ORQ C;  3D3Q A;  4GKJ B;  4I55 B;  3RYH B;  2ZQM A;  4RUF A;  2DYR B;  1F51 A;  4U7O A;  3T4D A;  1FFX B;  2Q0O C;  5CBH A;  3ETQ A;  2IH1 C;  3CYO A;  4BWA A;  1PPJ H;  4PI2 A;  1BT8 A;  2EZO A;  4B3S O;  3GWK C;  2RN9 A;  4TV9 B;  2QKC A;  2ODM A;  5BMV A;  1H8H G;  2ZXW B;  4JI1 B;  1FJG B;  2EX3 A;  4FZ1 A;  4N23 A;  4FLU A;  3MHS C;  1S77 D;  3CRC A;  3CHX A;  3HPL C;  2BTQ B;  1TVK A;  3JYC A;  4JI8 O;  5H6R A;  2F23 A;  4TT3 G;  2V1D A;  5LMN B;  3TET A;  1GH6 A;  1VQP V;  2JDI G;  4WBN B;  4PDR A;  2Y4T A;  2Q9L A;  4FLX A;  1SA0 A;  1IVS A;  4J7J A;  4RQE A;  1R3K C;  3ETD A;  3F7Y C;  3MD0 A;  4YJ2 A;  4X62 O;  2Q7E A;  1T5E A;  1TUB B;  3IFX A;  4FLY A;  4JI6 B;  3R65 A;  4X1K A;  1SQP H;  2DE0 X;  1P7G A;  1COW G;  2CAZ C;  4B3R O;  4U3F H;  5DM6 V;  1JJ2 U;  4TQF A;  1RSO B;  1Z5V A;  3TJT A;  2UUB O;  3JAW B;  1H8E G;  3QVN A;  3U0Z A;  3G4S V;  2YIC A;  2ZE7 A;  4UV9 A;  1VF6 A;  1IBM O;  3CCM V;  3UT5 B;  1HR0 O;  3GWO A;  3BPZ A;  2WLJ A;  3QO8 A;  4YY3 O;  3ASN B;  2W6I G;  2VQE O;  3K0D A;  3FAV A;  1EZJ A;  4J41 A;  4MTX A;  1NVP D;  3J7A U;  1IXM A;  3T2M A;  5CBF A;  4N21 A;  1DLB A;  3E86 A;  3IGA C;  4CH6 A;  5FPR A;  1GKF A;  1QVF U;  4NB5 A;  4AI8 A;  3K9A A;  1YDX A;  4JI7 O;  4LF6 O;  3N2G B;  2Q69 A;  2BOB C;  5LGU A;  4TSF G;  3RVY A;  2M6Y A;  3M8A A;  1JMK C;  3B2E E;  3ZHV A;  1O9H A;  3H1J H;  1H2S B;  2F93 B;  1XI1 A;  2CTR A;  1OV9 A;  5IWA B;  3A0R A;  3OMN B;  1W2B U;  4MVO A;  1JQ0 A;  4DV1 B;  3CCU V;  5A2Q N;  1KP2 A;  1ZX3 A;  3SYP A;  2Y69 B;  3F5T A;  3RYC A;  4WFH A;  3K5L A;  3L73 H;  2UXC O;  1K3E A;  1VQ8 V;  2OIG A;  4UVB A;  4UCO A;  5LHH A;  2E5L O;  2DYR C;  1N36 O;  2W0F C;  2PYL A;  1MSD A;  3EVK A;  2N74 A;  4QJF B;  1MAB G;  2UXX A;  4JTD B;  4DUY O;  1G4Y B;  1I08 A;  3CP1 A;  1FXK B;  2NN4 A;  4I7Z B;  2RQ6 A;  2QKA A;  4R7C A;  1Y74 A;  5L3G A;  4K8X A;  4B3M B;  1PKX A;  4YXW G;  4DR6 O;  3CCV V;  1J5E O;  3RW0 A;  2LFR A;  4AQY O;  1Q90 D;  5EBM C;  4C7U A;  4LF8 O;  5LBQ A;  2VS0 A;  4PDL A;  1SZX A;  1WA8 A;  4NKG B;  1SZT A;  4UXN A;  4JYB A;  4HNA A;  5BR8 O;  5B1A C;  1YHQ V;  4LFB O;  1YEW A;  5EC1 C;  4H37 A;  2P4K A;  3JAM N;  2X6A A;  5B66 Z;  2HG5 C;  1ZUQ A;  1SET A;  1FPO A;  2EZP A;  4FFB A;  1VQ7 V;  4DV4 O;  4LF5 B;  5LL6 Y;  4F4L A;  4MTG A;  4PDM A;  4DR2 B;  5DEC A;  4Z2W A;  4CH4 A;  1NI8 A;  2GBO A;  5KHH A;  2Y0I A;  1ZL8 B;  2ADP A;  1K97 A;  1K4D C;  2ITC C;  4K8Z A;  3ML0 A;  1OJH A;  2V4D A;  4JYC A;  4RUE A;  2IH3 C;  2P06 A;  3WB2 A;  2FYU H;  2WAM A;  1THZ A;  1IBK O;  1EZV H;  1HNZ O;  1AI7 A;  5KMG A;  3I5D A;  3DTU B;  4IYI A;  3SPC A;  5CA3 A;  4DR1 O;  3K5M A;  1XHZ A;  1TA8 A;  4LFC O;  4FM0 A;  1JCH A;  2WA4 A;  4PJ0 Z;  2MW2 B;  4UVA A;  2YID A;  3JAK B;  1VQ9 V;  4I9W A;  1NTK H;  2B1G A;  1P84 F;  2DQ3 A;  1N32 B;  1OCO B;  3HKC A;  1XL4 A;  1Z2G A;  5B1N A;  2NLJ C;  1M9N A;  2O57 A;  5LMU O;  2K9P A;  1VQ4 V;  2UUA B;  2YXH A;  1IUR A;  3FB7 C;  1N8R W;  3KCX A;  3BA9 A;  1YI2 V;  5L3E A;  2YUA A;  2FML A;  2WLI A;  1YJN V;  4X1I B;  3TXS A;  3A2F A;  2WSS G;  2QR4 A;  1IXB A;  2ZKO A;  3HKE B;  1U97 A;  1XNR B;  5EBW C;  3ZMT A;  5JQG B;  3SYC A;  4F6R A;  3B09 A;  4QNH B;  2WWW A;  2FL4 A;  1M4U A;  1H2M A;  4U7N A;  3KKY A;  3OEH G;  2WLL B;  3DC6 A;  4DV2 O;  1F23 A;  2ATK C;  3ZRV A;  1M5I A;  5LGT A;  1VF7 A;  2Y69 C;  3CJH A;  3L9D A;  3WFV A;  4JI4 B;  2D2C B;  2PUS A;  4R8C A;  2ADQ B;  1XRE A;  4CC6 A;  2HHH B;  5LP6 C;  4EB6 B;  2Q0A A;  4L87 A;  3APQ A;  2XAJ A;  3BAB A;  1XMQ O;  3BCC H;  4LC1 A;  4EFE A;  4MW3 A;  1VQO V;  5JJJ B;  1QVG U;  1FXK C;  5K1X A;  1SES A;  2V7Q G;  2Y0P A;  3L70 H;  4FPP A;  4IHJ A;  5C8Y A;  4KXR A;  1YCI A;  4JV5 B;  1I5X A;  4X64 O;  2PI4 A;  3BA8 A;  4J9Z B;  3STZ C;  2CTQ A;  4J9Y B;  4DUZ B;  4D7T A;  3BFR A;  1WB8 A;  1QLN A;  1SKV A;  1AP5 A;  4YIP A;  2UXN A;  5GON B;  3SPH A;  3HKD B;  3TK1 A;  4WCE V;  2ZM6 O;  3OMI B;  4I50 A;  2LGW A;  2GSM B;  4WFG A;  3RGB A;  3JAR A;  3QTC A;  5KHG A;  3CC4 V;  4JI3 B;  4UB8 Z;  3CMA V;  2CK3 G;  2Q73 A;  4J10 A;  4X1Y A;  2AHZ A;  5H2F Z;  3ZRS A;  4UVC A;  5BY1 A;  2N04 A;  3JSL A;  2A3Q A;  4Q20 A;  4NTY A;  2DQ0 A;  2DYS C;  1JFF A;  2L6L A;  1YJ9 V;  2IU0 A;  5KX5 B;  1PNL A;  1MZE A;  4JI5 B;  3JAT A;  1WLE A;  2YIA A;  1EBO A;  3R66 A;  4LH7 A;  1AP6 A;  4AHC A;  3SPJ A;  4H13 B;  4J7K A;  5EK0 A;  3LSS A;  5CB4 A;  2YIB D;  2UXD O;  1B3Q A;  1BSM A;  1S5J A;  4TV8 A;  1QR9 A;  4O4L B;  1VQL V;  4LF4 O;  5FNV B;  2HJF C;  4G2K A;  1R6N A;  2WPD G;  2JJ2 G;  5ITZ A;  2ZE6 A;  2YIB A;  1EN4 A;  3RYI A;  3B4S A;  5J2U A;  2DJV A;  5J2T A;  5EC2 C;  3AK3 A;  2GV9 A;  4ZOL B;  2HP8 A;  3OR7 C;  4OX9 O;  2CTW A;  1VQ5 V;  1AJN A;  3NXS A;  2QA4 V;  2RDC A;  2OT5 A;  3TCU A;  3GVM A;  3K59 A;  2RCV A;  2BSK A;  1XDC A;  2BOC C;  3CPW U;  3ZCC A;  2Q68 A;  3FKS G;  2F43 G;  3RVZ A;  1NKD A;  5L3B A;  4MTF A;  4ZHQ B;  1KQS U;  2XOK G;  5IT9 N;  3BRC A;  5IYD O;  3E8H A;  5LXT A;  5IDJ A;  3DXR B;  1MZF A;  2EIL C;  4BIU A;  1XMO B;  2XAQ A;  3JAS B;  1VEW A;  3ZRW A;  3J81 N;  2KG7 A;  3AK1 A;  1Q5O A;  4XDJ A;  4I0X B;  4J42 A;  5FL7 G;  5EBL C;  1NH2 B;  2Z0A A;  1NU1 H;  4FVM A;  4R50 A;  5JCO A;  1WP8 A;  5KLV H;  1PNM A;  5JWP A;  2ARH A;  1H2G A;  3A0H Z;  4NXM O;  4E2L A;  2LW7 A;  1BL8 A;  4DRX A;  1SER A;  4ZI7 B;  3I56 V;  4JAV A;  1HNW B;  1NR7 A;  4DV5 O;  1UPG A;  3ZMV A;  3PN1 A;  4BIZ A;  2UU9 O;  4I4T B;  4GX1 A;  4JI0 O;  2LQT A;  1KP3 A;  1WAZ A;  5CBG A;  1FAF A;  3N27 A;  4U3J A;  1ZWI C;  4LBE C;  4DV6 O;  1F4M A;  1E1Q G;  5E79 Z;  1AR1 B;  1NT2 B;  1VIB A;  2XT9 A;  1Y67 A;  1WP7 A;  4LWS B;  5AG2 A;  5HFM A;  3OGC C;  3A0B Z;  3ZMS A;  4X88 A;  3OAA G;  3RYH A;  4Q6G A;  2ZR2 A;  1BHA A;  2IU3 A;  3CX5 F;  1W0K G;  1XNQ B;  5F2V O;  1H2K A;  2WLM A;  3T1H B;  3OTF A;  4NXN O;  2CDY A;  2OTL V;  3U11 A;  1Y76 A;  1TUE B;  2ETN A;  3JAL B;  1VMG A;  4GX2 A;  3W7S A;  3SJC C;  5EYP A;  4JI2 B;  4FM1 A;  4B3R B;  4JZ2 A;  2Y4U A;  5IYZ A;  2ZIO A;  1QBZ A;  1R3I C;  2OCH A;  1AJP A;  5B1A B;  1H2N A;  2Z5U A;  5BMV B;  2IM9 A;  3SJA C;  2N05 A;  1G6U A;  4O2B A;  2IJI A;  4BW5 A;  4UCS A;  3WB0 A;  2AHY A;  3HKB A;  4B3T B;  3JCU Z;  4CH5 A;  1HR0 B;  1FD9 A;  1XUQ A;  2YC0 A;  1TVK B;  4GKJ O;  1V9P A;  3UKM A;  2LO1 A;  4OPA A;  1PL4 A;  3ZN1 A;  1DF5 A;  4RQF A;  1K4C C;  2YI9 A;  1VQK V;  2JIZ G;  2YI8 A;  1L0L H;  2UUC B;  2YSU B;  1L1F A;  1SA0 B;  4DV0 B;  4LF9 B;  1O9G A;  4YJ2 B;  1QQC A;  2WLK A;  3CS5 A;  3VOU A;  3JD0 A;  1RSO A;  4X1K B;  4J7Z A;  3ZHR A;  4TQD A;  1V55 C;  5J9P C;  4JI1 O;  1FJG O;  4HZ3 A;  3E22 A;  2H94 A;  2IW5 A;  2IBZ H;  1XL6 A;  3ZMU A;  1M93 A;  1Y6X A;  1ENV A;  3RYF A;  4O4H A;  4P9P A;  1Q82 W;  1KEC A;  4P2Z A;  5LMN O;  1JPX A;  3P32 A;  3K03 A;  2VQF B;  1QLE B;  2X7R B;  4NTW A;  4DR5 O;  1B6Q A;  3AG7 A;  1S5L Z;  1Y66 A;  4H0L B;  4JI6 O;  5IYB O;  3CE2 A;  1KKD A;  1GM7 A;  2OCC B;  3B8N A;  3EFF K;  4E4E A;  2QKS A;  1YTF D;  1OCR B;  3SJB C;  3Q4H A;  3P3P A;  1NVP B;  1UJW B;  4X65 B;  4LNU A;  3THO A;  4DR4 B;  3OW2 U;  5H6Q A;  4UCV A;  5LHG A;  1LUV A;  1NTM H;  2GTS A;  4CS2 A;  3ZHT A;  4DR6 B;  1J5E B;  3K04 A;  4JGS A;  1R6T A;  3PJS K;  3U10 A;  4JYA B;  5BXZ A;  4BW9 A;  2EIM B;  2ZDI C;  5LP6 B;  3D8C A;  2QEX V;  1EM1 A;  3LDE A;  4FJC C;  1W59 A; 
#chains in the Genus database with same CATH homology
 1P7B A;  1S3J A;  4PA3 A;  2JK5 C;  3JD4 A;  2WSS G;  3QO5 A;  1Q7Y W;  1BMF G;  1I5Y A;  3CXC U;  4MTO A;  3BY6 A;  3LDD A;  3IC7 A;  1MG1 A;  1M1K W;  5EBW C;  3ABU A;  3ZMT A;  3OUF A;  5BZB A;  3SYC A;  4CZZ A;  4QNH B;  2WWW A;  4DO2 A;  1EFR G;  1NH2 D;  3CCJ V;  4CBC A;  1OCZ B;  4U7N A;  4PA7 A;  3G6E V;  1OCO C;  3OEH G;  1NR1 A;  3LNM B;  2WLL B;  1K92 A;  2Q6A A;  3T4Z A;  3AG3 C;  3G71 V;  1F23 A;  2ATK C;  3STL C;  3ZN0 A;  3ZRV A;  3CC2 V;  1YIJ V;  5LGT A;  1S72 V;  2P7T C;  1S76 D;  2Y69 C;  1M56 B;  2K1E A;  3WFV A;  3RBZ A;  2DW4 A;  2R9R B;  3X2Q C;  3LSQ A;  4MVM A;  3SYA A;  4DXW A;  4R8C A;  4R6Z A;  1ARO P;  5IY5 C;  1RPR A;  4L87 A;  2XAH A;  3OUS A;  2XAJ A;  4JTC B;  2JEU A;  1M57 B;  4QE9 A;  2IJK A;  2DYS B;  3AG2 B;  1PNK A;  4WFE A;  3CCR V;  3OM3 B;  4GX5 A;  3OEE G;  4LC1 A;  5B1B B;  4MW3 A;  1VQO V;  1GM8 A;  1QVG U;  1K8A W;  1FXK C;  4Z1M G;  3F7V C;  1SES A;  1S5H C;  3W7X A;  2V7Q G;  1K5S A;  4FPP A;  1JOY A;  3E35 A;  4KUM A;  3JD2 A;  3VBB A;  4QPJ A;  5CN0 A;  3E2E A;  3AG1 B;  1I5X A;  3OE7 G;  2PI4 A;  2QM8 A;  4J9Z B;  5LGN A;  4JPR A;  1OHH G;  3STZ C;  5KUM A;  4J9Y B;  1RM1 B;  3AG4 B;  1GMG A;  1QLN A;  4MSW C;  2GHY A;  2UXN A;  1OCZ C;  1K34 A;  3SPH A;  4H33 A;  3TK1 A;  3CCQ V;  2HVK C;  3D36 A;  3OMA B;  4WCE V;  2PI5 A;  3OMI B;  2WLN A;  2ZDI A;  2GSM B;  3ABL C;  3UM7 A;  4WFG A;  2JJ1 G;  3JD1 A;  4FIP C;  4G28 B;  3SJQ C;  3M99 B;  3CC4 V;  4HYO A;  3CMA V;  2CK3 G;  2ZR3 A;  3HB3 B;  4GX0 A;  3CME V;  3ASO B;  2Y48 A;  3KG2 A;  1ORQ C;  3ABT A;  2AHZ A;  3ZRS A;  1YJW V;  2FTK A;  1M57 C;  4UVC A;  4PEL A;  4Q20 A;  2DQ0 A;  2ZQM A;  2DYS C;  4RUF A;  1PL0 A;  1YJ9 V;  2DYR B;  4XDK A;  4RAI A;  2IU0 A;  2HFE C;  1PNL A;  5B1B C;  3ETE A;  1NJI W;  1F51 A;  4U7O A;  3T4D A;  2EIK B;  1WLE A;  1EBO A;  4MT8 A;  3DGE A;  1K33 A;  2XND G;  1K9M W;  1K7D A;  3SPJ A;  2HR3 A;  5CBH A;  5EK0 A;  3LSS A;  2P90 A;  1OZ0 A;  2IH1 C;  3CYO A;  1QLE C;  5E1A C;  1RM1 C;  2H8P C;  4P9O A;  1YTF B;  4WF9 V;  2EZO A;  3LDC A;  4GT1 A;  1R73 A;  1QR9 A;  2EIL B;  1VQL V;  5C93 A;  2HJF C;  4G2K A;  1R6N A;  2WPD G;  1S0V A;  2JJ2 G;  1CPY A;  1H8H G;  2ZXW B;  3B8M A;  1QCE A;  4MVQ A;  4N23 A;  1S77 D;  3MHS C;  1AJQ A;  4KP4 A;  5H9C A;  2OCC C;  1OCC B;  1V54 B;  3QNE A;  5EC2 C;  4TWK A;  3ASO C;  3HPL C;  1OCR C;  1FXK A;  5CMU A;  3JYC A;  4WFB V;  4MVR A;  1P4R A;  5H6R A;  3AEI A;  4TT3 G;  3OR7 C;  2V1D A;  1VQ5 V;  1AJN A;  3TET A;  4FMT A;  3NXS A;  2QA4 V;  1VQP V;  1JVM A;  2WLI B;  4LCU C;  2YEV A;  2JDI G;  2OT5 A;  3TCU A;  4PDR A;  5KUK A;  2BOC C;  1K73 W;  3CPW U;  3ZCC A;  2Q68 A;  3FKS G;  3CC7 V;  4RQE A;  2A79 B;  2QM7 A;  1R3K C;  1Q86 W;  3ETD A;  3F7Y C;  3MD0 A;  3E8F A;  2F43 G;  2JEX A;  3RVZ A;  1NKD A;  5L3B A;  2B1I A;  4MTF A;  3IFX A;  1KQS U;  2XOK G;  3R65 A;  1WPX A;  1J95 A;  5KA6 A;  5IYD O;  4MVS A;  1LNQ A;  2EIM C;  3E8H A;  2EJR A;  3W7W A;  3FYE B;  1GO3 F;  5IDJ A;  4JTA B;  2EIL C;  4BIU A;  2P67 A;  3QO7 A;  2ZD9 A;  1FFT B;  2XAQ A;  1ROP A;  1COW G;  1FS0 G;  3ZRW A;  3W7U A;  2ZXW C;  4XDJ A;  3CCS V;  1GM9 A;  3ABM B;  5DM6 V;  1JJ2 U;  3OR6 C;  5FL7 G;  3CD6 V;  5EBL C;  1NH2 B;  1RPO A;  1V54 C;  4R50 A;  1YIT V;  1PNM A;  3WG7 B;  1H8E G;  2KB1 A;  3ABK B;  2W6J G;  1H2G A;  4E2L A;  1F4N A;  3G4S V;  1BL8 A;  1AI5 A;  1SER A;  4UV9 A;  4JAV A;  3ZMZ A;  3I56 V;  2IJJ A;  3SYO A;  4QE7 A;  1NR7 A;  3CCM V;  2Z3Y A;  3ZMV A;  4BIZ A;  4EKW A;  4GX1 A;  3GWO A;  2WLJ A;  3QO8 A;  2X6B A;  3ASN B;  2A0L A;  1KP3 A;  5CBG A;  2W6I G;  1W0J G;  4PA6 A;  4QPK A;  1ZWI C;  4LBE C;  4PDV A;  3K0D A;  4XDL A;  1F4M A;  1E1Q G;  1EZJ A;  2NNU A;  1M56 C;  1AR1 B;  4MTX A;  4MS2 A;  2HKO A;  1NVP D;  1IXM A;  3JD3 A;  3T2M A;  1QR8 A;  5CBF A;  1JX9 A;  2QTO A;  4ASU G;  4N21 A;  1DLB A;  5HFM A;  3E86 A;  3OGC C;  2X6C A;  3IGA C;  4PA9 A;  2XAF A;  3K06 A;  4WFA V;  3H01 A;  1GKF A;  1R3J C;  1QVF U;  5B3S B;  3K3W A;  3ZMS A;  4X88 A;  3OAA G;  3AG2 C;  3K9A A;  2ZR2 A;  1BHA A;  2IU3 A;  1MOF A;  2Q69 A;  1W0K G;  2BOB C;  1MSW D;  4WFF A;  2WLM A;  2ITD C;  5LGU A;  1DF4 A;  1GTO A;  4TSF G;  3RVY A;  3E83 A;  3OFN G;  2D3O W;  4P30 A;  2OTL V;  2LP7 A;  1HWY A;  3AG1 C;  3FB6 C;  1TUE B;  2EIJ B;  3AG4 C;  4GX2 A;  3W7S A;  1AI6 A;  3A0R A;  3ASN C;  1PD3 A;  3OMN B;  3MHH C;  1W2B U;  4MVO A;  1JQ0 A;  3CCU V;  1KP2 A;  1R6K A;  2B5U A;  2EBO A;  3P30 A;  4G27 B;  3SYP A;  2Y69 B;  4WFH A;  1H38 A;  3GB7 C;  1VQM V;  1NQT A;  2C2A A;  3X2Q B;  1K5Q A;  4QIW F;  1K3E A;  1V55 B;  1QBZ A;  1R3I C;  1AJP A;  5B1A B;  1VQ8 V;  3ZRX A;  1YSC A;  5B3S C;  4MW8 A;  3SPI A;  2Z5U A;  4UVB A;  2XAG A;  4BAY A;  5LHH A;  2DYR C;  2W0F C;  2IJI A;  4BW5 A;  1MAB G;  2UXX A;  3K0G A;  4JTD B;  4QJF B;  1G4Y B;  2AHY A;  2EIK C;  2WLL A;  3CP1 A;  3K08 A;  1FXK B;  4FK5 C;  2M7W A;  3UKM A;  3E8B A;  5LHI A;  2WLH A;  4UV8 A;  3ETG A;  5IYC O;  4X89 A;  3ZN1 A;  1E79 G;  3FB5 C;  2R9I A;  1VQN V;  3CCL V;  1Y4M A;  1DF5 A;  2EIJ C;  2YEV B;  2HLD G;  4RQF A;  3K79 A;  1K4C C;  4R7C A;  2QE7 G;  5L3G A;  1KC8 W;  1VQK V;  2JIZ G;  2YSU B;  4JF3 A;  5B1O A;  1L1F A;  1R3L C;  1PKX A;  4YXW G;  3CCV V;  3RW0 A;  2LFR A;  3ABL B;  2WLK A;  5EBM C;  3VOU A;  1BHB A;  3JD0 A;  1OCC C;  3BEH A;  5LBQ A;  1NBM G;  1VQ6 V;  2OTJ V;  4PDL A;  1SZT A;  4UXN A;  2EIN B;  1V55 C;  4JYB A;  5B1A C;  1YHQ V;  5EC1 C;  5J9P C;  2LFS A;  4ZKI A;  3LUT B;  4H37 A;  3ZRW B;  5KA5 A;  4HZ3 A;  2H94 A;  2IW5 A;  2X6A A;  1XL6 A;  3ZMU A;  2P6J A;  3F5W C;  5GW7 A;  2HG5 C;  1SET A;  1ENV A;  2EZP A;  1Q82 W;  4P9P A;  1VQ7 V;  1KEC A;  1G8M A;  4F4L A;  4P2Z A;  3E8G A;  1JPX A;  4MTG A;  4PDM A;  3P32 A;  4MVU A;  3ZJZ A;  3K03 A;  1QLE B;  3CCE V;  2X7R B;  4PA4 A;  1B6Q A;  1SRY A;  2IJH A;  1K97 A;  1K4D C;  4I5S A;  2ITC C;  4GCZ A;  1Y66 A;  1GK9 A;  3ML0 A;  4ZBM A;  3ABM C;  3EHB B;  4HAM A;  4JYC A;  4RUE A;  2IH3 C;  5IYB O;  2WAM A;  1KKD A;  4KFM A;  1CEZ A;  1GM7 A;  1THZ A;  5DN6 G;  4LP8 A;  2OCC B;  1AI7 A;  3B8N A;  3T1C A;  1DTO A;  3EFF K;  3WG7 C;  3ZIA G;  3ABK C;  1Q81 W;  2QKS A;  3DTU B;  3SPC A;  1YTF D;  1OCR B;  2EIN C;  5L3C A;  5L3F A;  5CA3 A;  2A9H A;  2Q67 A;  4RO2 A;  1JCH A;  1UJW B;  1NVP B;  3OW2 U;  3JCZ A;  2X0L A;  4UVA A;  5H6Q A;  2DWE C;  3FB8 C;  1VQ9 V;  4XBF A;  4I9W A;  5LHG A;  2B1G A;  2XAS A;  2DQ3 A;  1OCO B;  5HFL A;  1KD1 W;  1XL4 A;  3AG3 B;  5B1N A;  2DWD C;  2NLJ C;  1M9N A;  4UUJ C;  3FYI B;  1FXH A;  4X8A A;  3SPG A;  1VQ4 V;  3K04 A;  4JGS A;  4JAU A;  3PJS K;  1FXV A;  3SYQ A;  1AI4 A;  3FB7 C;  1M90 W;  1N8R W;  4JAS A;  2EIM B;  2HVJ C;  3D3I A;  5L3D A;  2ZDI C;  5IY5 B;  1YI2 V;  4OXS A;  2QEX V;  3I55 V;  3B77 A;  1CP9 A;  3LDE A;  4MVZ A;  1E1R G;  4FJC C;  5L3E A;  3W7T A;  2MK3 A;  3E89 A;  2WLI A;  1YJN V; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...