1I6AA

Crystal structure of the oxidized form of oxyr
Total Genus 62
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
62
sequence length
212
structure length
212
Chain Sequence
ETMSGPLHIGLIPTVGPYLLPHIIPMLHQTFPKLEMYLHEAQTHQLLAQLDSGKLDAVILALVKESEAFIEVPLFDEPMLLAIYEDHPWANREAVPMADLAGEKLLMLEDGHCLRDQAMGFCFEAGADEDTHFRATSLETLRNMVAAGSGITLLPALAVPPERKRDGVVYLPAIKPEPRRTIGLVYRPGSPLRSRYEQLAEAIRARMDGHFD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis of the redox switch in the OxyR transcription factor.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transcription
molecule keywords HYDROGEN PEROXIDE-INDUCIBLE GENES ACTIVATOR
total genus 62
structure length 212
sequence length 212
ec nomenclature
pdb deposition date 2001-03-02
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 1i6aA01
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 1i6aA02
4I1DA 2I6EA 4MLQA 1VFDA 3TMGA 4RXLA 3UA8A 2REJA 3OEKA 1HSLA 4ZEBA 5H8QB 3G3FA 2XXXA 3B6WA 4KD5A 5AA2B 2NWJA 3S2VA 2OWTA 3K00A 5DVFA 4F22A 4KYDA 2ZNTA 1OQHA 2X7PA 3U94A 4FJPA 3DLNA 4LVQA 2DQVA 4ND9A 4O3CA 3KOSA 4R74A 1DTZA 3SETA 4H8IA 1IXCA 3OENA 4LQ5A 5K2XA 1GVCA 1HSJA 3VVEA 3FXUA 5KZTA 2Z22A 2Z8EA 3K1NA 5BWJA 3Q29A 2F5XA 3FJMA 2H99A 2VHAA 4JDFA 1MH4A 3MUQA 3N26A 1MH3A 1MQDA 1H44A 3E9XA 5I84A 1S50A 4LZ5A 3S9NC 1JW5A 3DM0A 4RJZA 3T22A 2Y84A 3L6GA 5EHSA 5CI5A 4XTCQ 2VD3A 3C33A 3G3JA 2GHBA 2FNCA 5FHMA 4PFTA 4ZEKA 3I3VA 2NUVA 4F3SA 4EQ9A 3WAFA 1B7UA 1LAGE 2UVJA 1Y3NA 4KR5A 2O7UA 1LFHA 2P0SA 4QSEA 1II5A 3V83A 4C0RA 2VD2A 2LAOA 4ESXA 1B3GA 2GRVA 3A3UA 4K3FA 4MLVA 3E3KA 1SW1A 5AA2A 2XD3A 3IO4A 4R9FA 3QIMA 3W9WA 3ODBA 1VR5A 4RK2A 4NTLA 5CMCA 3KN8A 3N5LA 3FV2A 4OXVA 1FTKA 3SERA 3T66A 4NF4B 4QSCA 3ONMA 3VLUA 1TT1A 2Q9TA 4GFRA 1YPNA 5TPAA 3OXNA 4MF3A 1FCKA 2Y7KA 2ZYOA 4H5FA 1Y1ZA 5CRYA 1BP5A 2ESNA 2XXQA 1ZJLA 3H6WA 3K4UA 4GIZA 3V89B 1ZLQA 4QFNA 1ZMGA 3OO8A 1S9TA 4GF8A 4JBZA 4XXUA 2IA4A 3TDJA 2ZXTA 1NH7A 4OFOA 4U2RA 1B1HA 4G68C 1B3HA 1Y3QA 2R71A 4BLAA 4NMYA 2OK2A 1LFIA 1UTBA 1VE4A 4R6HA 2B3BA 2DSFA 5DVIA 4POWA 4ELQA 5IKBA 5LOMA 4F29A 3PMVA 1SW4A 3JV9A 4H6DA 4OFLA 3A09A 5H8NA 3U72A 2D5WA 3IL1B 4U21A 1R6ZA 3DP4A 3BFUA 4I62A 5A5XA 1D4NA 1FTJA 3K1MA 4WXJA 3RUMA 3TCFA 2F6GA 2DOJA 2UVGA 3SEXA 2OWSA 3Q25A 4LATA 2ONKE 1MRPA 1MXYA 4FEBA 4Q0CA 2V3QA 1OMPA 2PYYA 1EZ9A 4G8HA 2DWJA 4ELRA 4RY1A 4R2BA 4IGTA 1O64A 2XX7A 5JTYA 1EU8A 3JZJA 4E0WA 2QS4A 2ANJA 3FVOA 3MPKA 5H8HA 5JK4A 4OQOA 4POXA 3RTFB 4EXKA 5EYFA 2X26A 1B5JA 1IXHA 1TFAA 1URDA 3G7WA 5A5XB 4LZ7A 1P1QA 2XXWA 4GXSB 1A99A 3SDFA 1S7YA 1B1XA 4QFKA 4ZZEA 4M1VA 1L5TA 2AIXA 1Y4CA 2V84A 4PP0A 2XXVA 1BTJA 2RCAA 2VOZA 4G68A 4NWDA 1MPCA 3C32A 5CBRA 3N6TA 4GL8A 4GL0A 5CMKA 3THIA 3IORA 2DWHA 4KI0E 3K2DA 1JVYA 3VVDA 1B3EA 4HS7A 1EZOA 2OCUA 4XKRA 4YB7A 4RYAA 2UVIA 3KGCA 4TQUQ 4YKJA 3SEVA 4FATA 4ZEDA 4BDOA 4GVOA 4F1YA 1P1NA 3PMWA 5CC2A 4IO3A 3EF7A 2REGA 3K1PA 1IITA 4FECA 1URGA 4O3BA 4YKPA 5F1QA 5I56B 3CFXA 1MPDA 4OVJA 1PBPA 3WAEA 1B51A 4RPNA 3SESA 2B3FA 3LUYA 4GQOA 5L9SA 3BFTA 3S9MC 4OEVA 3RPWA 3B6QA 3C4MA 4H65A 4KFQA 3E4RA 4JSDA 4OFJA 4OWDA 1DTGA 3FJGA 1FW0A 3C9HA 4U4SA 3TODA 1MXXA 3GBAA 5EHMA 3SEUA 3QUJA 4ELPA 1BKAA 4ELOA 1TXFA 5B70A 4QRZA 4L17A 1F9BA 2PT1A 3RT8A 3ZKKA 3MBPA 3O6IA 2Q2CA 3VE1B 3PD9A 2XXPA 1LCTA 2D3IA 3TELA 3MW0A 1H43A 1JW1A 1KWHA 1MDQA 3MJNA 1QVSA 2ABHA 3IK6B 3K02A 2NOOA 1B3FA 2DP8A 2F7CA 2P2AA 3RGYA 4DCYA 1FQEA 3MVZA 2OBGA 3UN6A 1O63A 4X1BA 5KCJA 1LLSA 1FQCA 1FTLA 5TPAB 5I58A 3PGFA 3OSQA 5FTHA 1XT8A 1OLAA 3M3KA 5ELVA 4FE8A 3U1OA 4AB5A 1B2HA 3IB1A 1DOTA 3EHUA 1PC3A 3H7MA 4N13A 3MP8A 4ZEIA 1PB9A 2F36A 1GR2A 4U22A 4PE5B 4DXUA 1MY2A 4BDRA 3TZAA 5H8QA 5DTBA 4G68B 3VVFA 1ZBMA 1I6BA 1XVXA 1JEUA 3HO7A 3IOWA 1JETA 3V5AA 1H45A 1LBBA 3LSFB 3MZ9A 3PD8A 1OVTA 1R1NA 1VSOA 3OEMA 3K6XA 4U1ZA 2RF1A 1TWYA 2F35A 4FORA 1P1WA 2ALUA 1NL5A 3C34A 1USYE 5I2KB 5DEXB 1Q35A 3USDA 4PFUA 4LZ8A 4F1UA 4F19A 1PB8A 4WEDA 3HCQA 3KN7A 4I8CA 4F1VA 3MAMA 3TFLA 3LSXA 1IIWA 1LAFE 3F11A 1AMFA 4P0IA 5TU0A 1P1OA 2AL5A 4NF8A 3EHSA 4X48A 4BDNA 5JTYB 1XOCA 2G93A 1Y20A 1Y3PA 4LQ2A 4LUBA 5CMBA 3VDFA 1T0KA 4H67A 5TP9A 3W9VA 1SVXB 2G29A 5FHOA 4EQ7A 4IB2A 3PPQA 1UQWA 1B4ZA 3CSGA 2R6GE 5I59A 4PETA 3TKDA 2VGQA 1DPPA 3K0VA 2V93A 3U8QA 5I56A 3PUVE 1Z7NE 2PT2A 4MFIA 3FATA 1POY1 1QULA 3GBBA 4ZZAA 1GTKA 1PEBA 2A5TB 2H9BA 2YJPA 2I3WA 2PVUA 3ZS6A 5ICQA 1SI1A 2Q88A 4MBPA 3S4UA 4NF4A 3KJ7A 1EH3A 1UTHA 3LBSA 5K2YA 3UK4A 5J1DA 4C1TA 5B7DA 1LSTA 1PDAA 3Q28A 1UTBB 2OJTA 1FTMA 3KEIA 4H8JA 1FQAA 4JSOA 4DXBA 2DE2A 1MY0A 2DWAA 3N6UA 4NF8B 5AA2D 4NWCA 2M8CA 4TOZA 2IEEA 3O29A 5AA4A 1SQYA 3CVGA 3SKPA 3UIFA 1VFEA 2X7QA 1OVBA 3H03A 5DVJA 1LGBC 3G3HA 1WODA 2HZLA 2QJEA 4WKMA 3ZKLA 4R6KA 2I48A 1B9JA 1SYIA 2UYFA 3KSJA 1MQGA 4ZDMA 3D4GA 3FZVA 3RNNA 1MXZA 5AA1A 1ZTYA 1ELJA 2BJJX 1FQDA 3KFMA 3M8UA 3Q27A 4NF6B 3PUWE 1AH5A 4H0WA 4QHQA 4F39A 4YKKA 2P1SA 4GD5A 4IO4A 3RT6B 1N7XA 2I4BA 1YTVA 4LA9A 4OEUA 4GOTA 4R2FA 5CMMA 3OO6A 5I2NB 3RQTA 4P11A 3S9LC 4PFWA 2Z23A 5H8FB 3EHTA 1MDP1 5M2VA 3JYRA 1AOVA 2QRYA 1TFDA 1NFTA 1MPBA 3TTNA 4EDPA 1I69A 4ISUA 1US5A 4ZECA 1NKXA 3I5OA 2ZYMA 5TP9B 4G2ZA 3PUYE 3VLVA 4YU0A 5HBCA 2DE4A 4HCYA 2Z8FA 1IXGA 2HAUA 3V8XB 3HHFA 4DXCA 1JQFA 3OMBA 2XD2A 4YZZA 4JXIA 5H8NB 4M4GA 3TTKA 5DYHA 1FQFA 2V25A 5JEIA 4RK9A 2QS3A 4F31B 3CFLA 2B65A 3IOUA 3G3KA 4FEDA 4G8NA 4NEDA 1US4A 4BDMA 3EQ1A 1USYH 2D21A 2AYSA 1LFGA 1LB8A 3PPRA 2ZNSA 4R9GA 5ICTA 3MZ1A 2E1SA 3QAXA 3T93B 4OZ9A 3PV0E 1BIYA 4DCXA 2Y7WA 3CG3A 4OERA 3VXBA 2O7IA 4X9TA 2QL3A 1MY1A 3ILUB 1J1NA 3OD7A 1A40A 4R75A 2O84X 4YMBA 2Y7PA 3MVXA 3O9PA 3D4CA 1ATGA 4YMAA 2WKYA 4EUOA 3O28A 3HPIA 1UTHB 3B7DA 1HSEA 1ZIUA 2O6AA 2HZKA 3P7IA 1N3WA 2FYIA 1PB7A 3CFZA 3MP1A 3QK6A 4G4PA 2F6PA 3K6VA 4YB5A 2DWIA 3DP6A 3GXAA 1N04A 1P99A 1OIBA 3FVKA 1M5DA 1XHYA 4IGRA 4N6PA 1QUKA 4ZE8A 3SEWA 3UGWA 4UA8A 3PUZE 4X1DA 3FXQA 4OTEA 1SBPA 1B40A 3GLBA 1Q1KA 2DE3A 4R72A 2V3TA 3O6GA 1IZ1A 3B6TA 5L8DA 3VLWA 1FQBA 2Q2AA 2I58A 4IO6A 1XVYA 1AIVA 1P1UA 4F3PA 1B05A 3DELB 4JWYA 4ECFA 1D3KA 5AA4B 5BUUA 4ZS9A 2F7AA 2HAVA 3R7XA 3ZSFA 3N94A 1H3DA 3E13X 4PQJA 3G3IA 3M3LA 2HEUA 3IJOB 1DPEA 3A3CA 3MP6A 3U92A 1EZPA 3SEYA 2A5TA 1IUDA 2ONSA 3O2AA 4KYEA 3TQLA 2XXRA 2H4IA 2XXUA 3T96B 4HW8A 5ISUA 3FIRA 2GH9A 4DIGA 1R9QA 3FGSA 5KDTB 3O66A 1N3XA 4IY5A 3RLFE 1PBQA 2QMWA 3GZGA 2XXHA 3HSTA 2O68A 4IO7A 4OETA 4QFLA 3QYTA 1MQJA 1R9LA 1IEJA 2NXOA 2O51A 2RCBA 1XS5A 1ANFA 2QS2A 3EPEA 1QUIA 2DS9A 3M3FA 4XKNA 5DT6A 5F7VA 2QMXA 1B5IA 4GWOA 4C1UA 1O7TA 4H1XA 2Q8JA 1FTOA 1BLFA 3MPLA 4NF5B 3TPAA 2QPQA 4RNSA 3UORA 1DSNA 3TAJA 4DZ1A 4Z7EA 2PMSA 2A5SA 3EN3A 5AA3A 3LR1A 2V3UA 4QSDA 2I0CA 3S9EA 4NF5A 3TYHA 4YB6A 1RYXA 1A54A 4YKIA 3CRBA 4EF2A 1GGGA 3H06B 4NF6A 4Q30B 2F34A 4U23A 4F2QA 1LAXA 3K6WA 3QSLA 4XKQA 4YICA 1M5FA 5DEXA 1RKMA 1B7ZA 3IOVA 2OLBA 1B0HA 3UP9A 5KDTA 2F8DA 3IOTA 3KOTA 1SDXA 1MQIA 2ZYNA 4I9DA 1CB6A 4EF1A 4Z0IA 1LB9A 2GHAA 4OESA 3U93A 2HCAA 1M5BA 3O6HA 3T9HB 1DMBA 1JNFA 1MM7A 2UVHA 3O97A 4KCCA 1MM6A 3TEPA 2GFEA 3IJXB 4P0GA 4R73A 1MXVA 1MG1A 1N7WA 2VP1A 1NH8A 3FD3A 1MXUA 1LAHE 3K01A 1AL3A 2HXWA 3FASA 3RY3A 2YLNA 2XX8A 4KYSA 1I6AA 1N84A 2HFBA 3FV1A 1M5CA 1OLCA 3H6TA 3LSLA 4G77A 5I58B 4DLDA 1URSA 4F3GA 3HN0A 2XXIA 3H3GA 2DXRA 4TLMB 3MVWA 5I59B 3PUXE 3RN8A 4KCDA 1B7HA 4F2OA 1IQ7A 2DXYA 2HQ0A 3C31A 3IAZA 1NNKA 3RTWB 4OHNA 2RKMA 1N0TA 4JWOA 1WDNA 1YAEA 2F7BA 4IO2A 1ZKBA 3KN3A 1B6HA 1QUJA 3G3GA 3K6UA 1B5HA 1SI0A 3L6HA 5L9MA 2E0SA 4G8MA 2Z8DA 3FVGA 4H5GA 2DYXA 4KHZE 1OQGA 2F97A 1LCFA 1Y9UA 1UIUA 4N07A 2Y7IA 1CE2A 1NNPA 1Y1MA 2XXYA 3H6UA 5ITOA 3VV5A 3PMXA 5IAIA 2Y7RA 3TQWA 2ONRA 1MQHA 3ILTB 3VXCA 2QSXA 3CIJA 5AE4A 2NVUB 1XC1A 3FXRA 2UYEA 2O1LA 1A55A 4ZEFA 4FAJA 5I57B 2PBWA 5H8SA 2XXTA 4GLIA 4OMBA 3IO6A 1SW2A 4EQBA 2H25A 4NE4A 4UACA 2THIA 1SW5A 4GRKA 1ZU0A 3BKIB 4LP2B 1JVXA 1Z7ME 2I49A 3HHGA 2CZLA 2QS1A 3R26A 5H8HB 3T9UA 3Q26A 1NMUA 4F3BA 1POTA 4QFOA 3CI8A 3OELA 3QUFA 4HCWA 3TTRA 4ZE9A 4RA1A 5ITPA 4OYVA 3QXMA 5L9OA 3CR9A 3R6UA 1MY4A 5HM4B 3PU5A 3LC8A 3MZBA 5FTIA 4ESWA 3IB0A 3C35A 3VFJA 4DDDA 5I57A 4JB7A 3TCGA 1B4HA 4O3AA 1IXIA 4THIA 3H4ZA 5HPQA 1YCJA 3TTLA 4KQPA 4FIMA 2O69A 4XKPA 1Y4TA 2DVZA 1LBCA 2OZZA 3MC2A 5H8FA 1JEVA 1B32A 4BDLA 1SYHA 1MY3A 3OOAA 3TCHA 4F18A 1QKAA 5CBSA 3TUSA 2YPNA 3KZGA 2UXAA 4Q5TA 1M5EA 3DP8A 1QKBA 1A8FA 2CMOA 3MVYA 1D9YA 4IO5A 3KBRA 4TLLB 2RC9A 2RINA 1RYOA 3FJ7A 2H98A 2ZNUA 3MQ9A 4R6YA 1QW0A 3KG2A 4JWXA 3TTMA 2W7YA 3PPOA 5KCJB 1WVJA 4IY6A 1MS7A 2I3VA 2XHDA 3I6VA 3T9VA 4AB6A 1B52A 2H5YA 4ONYA 4QF9A 4LONB 3IX1A 4KPTA 1B3LA 2O1MA 4AQ4A 2R9JA 3OO9A 4MH5A 3OSRA 5I2NA 1B0LA 3BBRA 3KSXA 3W15C 1D9VA 3CG1A 3H6VA 3IB2A 3IR1A 3MWBA 2DVCA 4U1OA 1GV8A 2AL4A 3FVNA 3KJTA 4HTGA 4YAHX 5FHNA 4PFYA 3LSWA 1JW4A 3PPNA 4U4XA 1B58A 4Q8RA 4DE8A 4E0XA 1SD3A 1UIVA 2Q89A 1N76A 1B46A 2FA7A 2RC7A 3AXFA 3CSBA 3FUZA 2F78A 2ZYKA 2I0BA 3ECRA 2KLFA 3C36A 2PX1A 2ZMBA 4RPOA 4WEPA 4EXLA 1NNTA 3OO7A 1NNFA 1MXWA 2I4CA 4GXAA 1A7LA 2RC8A 1A8EA 1QJMA 4OENA 3PPPA 4XIGQ 5CM6A 1I6QA 3T9XB 4BDQA 5I2KA 2XX9A 1H76A 4QFPA 3HV1A
chains in the Genus database with same CATH superfamily
2DDKA 4I1DA 4RXLA 3UA8A 5ET7A 5H8QB 3B6WA 1BK4A 5DVFA 4F22A 4FJPA 4LVQA 2DQVA 4R74A 4H8IA 1GVCA 3OENA 1HSJA 2KR0A 3FXUA 5KZTA 5BWJA 2F5XA 1H44A 5CI5A 4OVPA 4ZEKA 2FNCA 2NUVA 4LN5A 3WAFA 1Y3NA 4P3LA 2P0SA 3V83A 1B3GA 2FIXA 1SW1A 5AA2A 3IO4A 4RK2A 5CMCA 5ESYA 3N5LA 3VLUA 1TT1A 1YPNA 3OXNA 1FCKA 4GIZA 3V89B 4XFEA 1ZLQA 1ZMGA 3OO8A 3TDJA 1B1HA 1B3HA 2CZIA 4NMYA 1LFIA 3GYYA 4R6HA 4POWA 4ELQA 3HFUA 3U72A 1D9QA 3IL1B 4U21A 3DP4A 3K1MA 2ONKE 1MRPA 2DWJA 5EQ7A 4ELRA 3JZJA 4NN3A 4PAIA 1QGXA 5EYFA 1P1QA 1FSAA 1S7YA 4M1VA 1FPEA 4PP0A 1BTJA 2VOZA 1MPCA 3C32A 3N6TA 2DWHA 2WEFA 3NOHA 1EZOA 3SEVA 4YB7A 4RYAA 2UVIA 1P1NA 3PMWA 4IO3A 2WX9A 3EF7A 4OVJA 1PBPA 3SESA 3S9MC 3RPWA 3B6QA 4X8RA 4KFQA 4OFJA 4U4SA 4MEVA 3TODA 1MXXA 3SEUA 4L17A 2VPNA 3RT8A 3O6IA 2HXRA 3MW0A 1MDQA 3MJNA 3IK6B 3K02A 2DP8A 2F7CA 1FQEA 3UN6A 2OBGA 2ZZWA 4OVTA 5I58A 1FTLA 3PGFA 1XT8A 3M3KA 4FE8A 3EHUA 1PC3A 4N13A 3MP8A 1MY2A 3TZAA 4N8YA 2FBPA 3VVFA 1H45A 1LBBA 4PBQA 3OEMA 2ALUA 5DEXB 4LZ8A 3IFAA 4N81A 3RPLB 1PB8A 4WEDA 3HCQA 4I8CA 3MAMA 3TFLA 3LSXA 1LAFE 1IIWA 4P0IA 5TU0A 4NF8A 4X48A 4BDNA 4LUBA 1FPBA 4GBVA 4PETA 3TKDA 2VGQA 3K0VA 2V93A 1GTKA 2WYKA 2I3WA 1K9YA 4PDHA 2Q88A 2FHYA 2BJIA 5B7DA 3KEIA 1FTMA 3N6UA 5AA2D 4NWCA 2IEEA 4N6KA 2X7QA 2HZLA 1SYIA 3KSJA 3TMGA 3KFMA 4NF6B 3PUWE 4YKKA 2I4BA 1YTVA 4OEUA 4R2FA 5I2NB 3RQTA 2ZZXA 2Z23A 5M2VA 2QRYA 1TFDA 1NFTA 1MPBA 4EDPA 4G61A 2XWKA 5TP9B 5HBCA 1IXGA 5IZ1A 4M4GA 3TTKA 1CNQA 2XWIA 1US4A 4BDMA 1USYH 1LB8A 5ICTA 2E1SA 5LDZA 3VXBA 2QVRA 1G0HA 1A40A 4YMAA 2WKYA 3HPIA 1UTHB 3B7DA 3TQWA 4P47A 2QVUA 1N3WA 3CFZA 4PGNA 4BDRA 3GXAA 4IGRA 4ZE8A 3SEWA 4X1DA 3FXQA 2Y5KA 1Q1KA 3O6GA 4IO6A 1XVYA 2P3VA 4F3PA 1XI6A 4ZS9A 4PDDA 1H3DA 4PQJA 1NUWA 3SEYA 2A5TA 1IUDA 2ONSA 3O2AA 4IY5A 3RLFE 1PBQA 3M3FA 3QMFA 4N17A 4GWOA 1FTOA 3MPLA 4Z7EA 2PMSA 5AA3A 4MX6A 1RYXA 4YKIA 3CRBA 5DEXA 2MKZA 1B7ZA 3IOVA 2OLBA 1B0HA 3KOTA 1SDXA 3E78A 3T9HB 3TEPA 1JNFA 1MM6A 1MXVA 5AA4A 4AS5A 2YLNA 4KYSA 1I6AA 3FV1A 3H6TA 5I58B 4F3GA 2QFLA 2XXIA 1IQ7A 3RTWB 2DXYA 4JWOA 1WDNA 2F7BA 1NV4A 4MHFA 1ZKBA 2Z8DA 3FVGA 4KHZE 1Y9UA 4N07A 1CE2A 1Y1MA 5IAIA 2Y7RA 1MQHA 2QSXA 3CIJA 2O1LA 5H8SA 4GLIA 3IO6A 4EQBA 4UACA 4RJZA 1JVXA 3T9UA 4F3BA 1EYJA 1NMUA 1POTA 3OELA 4RA1A 5ITPA 2F3BA 3CR9A 3LC8A 4ESWA 3C35A 3VFJA 3TCGA 1B4HA 4KQPA 1K9ZA 4I40A 3TUSA 1NV6A 3KZGA 1A8FA 4IO5A 1D9YA 4GWZA 2RINA 2H98A 3KG2A 3TTMA 4PAFA 4AB6A 2H5YA 4LONB 4O94A 5IGAA 3A29A 5I2NA 1B0LA 3BBRA 2AL4A 4FBPA 4PFYA 3LSWA 3PPNA 1SD3A 4IR8A 1N76A 3JYRA 2CZHA 3ECRA 4WEPA 3C36A 3S9NC 2I4CA 5CM6A 1I6QA 4BDQA 1FBCA 2F3DA 5I3SA 2I6EA 4MLQA 4ZEBA 4KD5A 3S2VA 2ZNTA 4ND9A 4O3CA 1IXCA 3FBPA 2H99A 1MQDA 5I84A 1JW5A 3T22A 3L6GA 2FIEA 4XTCQ 3C33A 3G3JA 3I3VA 4KR5A 4C0RA 4ESXA 3A3UA 3E3KA 4R9FA 1IMDA 1KZ8A 4OXVA 3FV2A 4QSCA 2R8TA 3ONMA 5TPAA 1YZ0A 1EYKA 2ZYOA 3H6WA 1ZJLA 4H45A 4QFNA 1S9TA 4GF8A 4XXUA 1Y3QA 4BLAA 1IMCA 1UTBA 5DVIA 4F29A 3PMVA 3JV9A 4H6DA 3A09A 1R6ZA 2UVGA 3SEXA 4N15A 4LATA 5IZ3A 1FPLA 2PYYA 3D1RA 4R2BA 4IGTA 1O64A 5JTYA 5IZZA 4E0WA 2QS4A 3FVOA 1FPJA 4O7IA 4EXKA 1B5JA 1URDA 3G7WA 5A5XB 2XXWA 1B1XA 4QFKA 4ZZEA 2AIXA 2V84A 2RCAA 4NWDA 5CBRA 4GL0A 5CMKA 1JVYA 3VVDA 1B3EA 2OCUA 4FATA 4GBWA 4F1YA 2KQZA 4YKPA 5F1QA 3ISPA 4RPNA 2B3FA 4GQOA 1DCUA 4H65A 4JSDA 3E4RA 1FW0A 3GBAA 4ELOA 4QRZA 3T0JA 3ZKKA 3B50A 4HE2A 2Q2CA 3VE1B 3PTYA 1LCTA 5DW8A 1H43A 1QVSA 2P2AA 4DCYA 1LLSA 1FQCA 4MAGA 3IB1A 1DOTA 5I7IA 3H7MA 5DTBA 1ZBMA 1XVXA 3HO7A 3V5AA 5I2KB 3KN7A 1NUYA 4UABA 3RYDA 1FBFA 2G93A 4LQ2A 1Y3PA 4H67A 5TP9A 4EQ7A 3PPQA 1UQWA 1B4ZA 3CSGA 4OVRA 3U8QA 5I56A 3PUVE 3GBBA 1POY1 4ZZAA 2XWVA 1SI1A 3LBSA 1IMEA 5K2YA 2OJTA 4DXBA 3O29A 1SQYA 3CVGA 3UIFA 3G3HA 2QJEA 5ET8A 1MXZA 1NV7A 2P1SA 4IO4A 4P11A 5H8FB 3TTNA 3PUYE 1NI9A 2DE4A 4HCYA 3V8XB 3OMBA 4OVSA 4JXIA 5DYHA 5JEIA 2QS3A 4PFBA 3RPLA 2B65A 2PCRA 4NEDA 4R9GA 3T93B 4OZ9A 2Y7WA 3CG3A 2OWZA 1LBYA 4X9TA 4N8GA 1INPA 2O84X 3O9PA 1ATGA 5J16A 4EUOA 4PE5B 1ZIUA 1PB7A 4YB5A 3DP6A 1N04A 1P99A 4N6PA 4H46A 1XHYA 4UA8A 4OTEA 1B40A 3VLWA 4R72A 2V3TA 5EQ8A 1IMBA 2Q2AA 1D3KA 5AA4B 5F24A 2F7AA 3ZSFA 3G3IA 5EYGA 2H4IA 2XXUA 3T96B 3FIRA 1R9QA 4OETA 1IEJA 1XS5A 1ANFA 2QS2A 5F7VA 5DT6A 4C1UA 2Q8JA 4NF5B 2QPQA 4RNSA 1DSNA 2WYPA 4QSDA 2V3UA 2I0CA 1A54A 4NF6A 4Q30B 2VPOA 1LAXA 4XKQA 5EQ9A 1M5FA 3UP9A 3IOTA 4EF1A 4Z0IA 1LB9A 1MM7A 3O97A 3IJXB 1MG1A 3K01A 1LAHE 3RY3A 1N84A 2PFYA 5FBPA 1M5CA 1OLCA 4DLDA 4MJOA 2DXRA 4TLMB 3MVWA 3PUXE 4OHNA 4IO2A 1QUJA 1B5HA 1SI0A 3L6HA 4H5GA 3LUZA 1LCFA 1FJ9A 1FTAA 3VV5A 3PMXA 3EKIA 3VXCA 4O8MA 4MMPA 1XC1A 2NVUB 4ZEFA 5A5LA 4NQ8A 3BKIB 3HHGA 1Z7ME 2B4MA 2CZLA 3CI8A 3QUFA 3QXMA 3R6UA 5HM4B 4P9KA 4JB7A 1IXIA 4N4UA 5HPQA 2O69A 1NUXA 4MNIA 1Y4TA 1MY3A 3OOAA 3TCHA 1QKAA 5CBSA 2UXAA 4Q5TA 1QKBA 3KBRA 3FJ7A 2ZNUA 5EYHA 4JWXA 5KCJB 4IY6A 1MS7A 2XHDA 4ONYA 2O1MA 4GWSA 2R9JA 4MH5A 1DBZA 1D9VA 3CG1A 3H6VA 3MWBA 4E0XA 1B46A 4WXJA 3FUZA 1FBHA 2ZYKA 1MXWA 4OENA 4EXLA 1A8EA 1QJMA 4QFPA 1VFDA 2REJA 1HSLA 2WBBA 3G3FA 2XXXA 2NWJA 2OWTA 4KYDA 1OQHA 3U94A 2XA5A 3DLNA 1DTZA 3VVEA 5ET5A 3FJMA 2VHAA 2XWOA 3MUQA 3N26A 1MH3A 3E9XA 1FPDA 4LZ5A 3DM0A 1G0IA 2Y84A 2GQ1A 2VD3A 1LBWA 5FHMA 4PFTA 4F3SA 1B7UA 1LAGE 2PFZA 2UVJA 1SPIA 1LFHA 5I5PA 1II5A 2VD2A 4K3FA 4MLVA 2XD3A 5EQAA 3ODBA 3SERA 3T66A 4NF4B 2Y7KA 4H5FA 1Y1ZA 2ESNA 3K4UA 4U2RA 4OFOA 4G68C 1VE4A 2DSFA 5IKBA 1FPKA 5LOMA 5H8NA 1IMAA 4OFLA 4PE3A 2D5WA 4GWWA 3BFUA 1NV2A 3TCFA 3RUMA 2F6GA 3KC1A 2OWSA 4GX4A 4FEBA 2WBDA 4Q0CA 1OMPA 1EZ9A 4OANA 4I3EA 4PFIA 1EU8A 2ANJA 5H8HA 4OQOA 3FXBA 4HXVA 2X26A 1TFAA 4GXSB 1A99A 1Y4CA 2CEYA 2XXVA 4G68A 4GL8A 3THIA 3IORA 4KI0E 4NGUA 4HS7A 3KGCA 4TQUQ 4ZEDA 4BDOA 4GVOA 1AWBA 2REGA 4FECA 1URGA 3CFXA 1MPDA 1B51A 3LUYA 3IFCA 1DTGA 5EHMA 4OVQA 2PT1A 3MBPA 3PD9A 2XXPA 2D3IA 3TELA 1KWHA 2ABHA 2NOOA 1B3FA 3RGYA 3MVZA 1O63A 4X1BA 5KCJA 5TPAB 3OSQA 1PB9A 2F36A 1GR2A 4G68B 3IOWA 1I6BA 4NX1A 1JEUA 1JETA 3PD8A 1R1NA 3K6XA 2RF1A 2F35A 1P1WA 4F1UA 4F19A 1AMFA 3VDFA 1T0KA 1KA1A 5FHOA 1DPPA 1QULA 4MNPA 2A5TB 2YJPA 2PVUA 3S4UA 1UTHA 4P8BA 4C1TA 1LSTA 3Q28A 4JSOA 2DE2A 1MY0A 2DWAA 4TOZA 2M8CA 3SKPA 1VFEA 3H03A 4ZDMA 2I48A 2UYFA 3D4GA 5AA1A 1ELJA 1ZTYA 1N7XA 4NAPA 5LTCA 4PFWA 3EHTA 1MDP1 1AOVA 1I69A 4G2ZA 3VLVA 4YU0A 2Z8FA 4DXCA 1JQFA 1FPFA 5H8NB 1FBEA 4RK9A 3CFLA 4XEQA 3IOUA 3EQ1A 1LFGA 3PPRA 2QVVA 4DCXA 3PV0E 1BIYA 3MYUA 2O7IA 3OD7A 1J1NA 3MVXA 3O28A 3TTLA 2FYIA 3MP1A 3QK6A 2DWIA 3FVKA 3PUZE 1SBPA 5L8DA 1IZ1A 3B6TA 1FQBA 4GX6A 1B05A 4JWYA 2Y5LA 4N6DA 2HAVA 2HEUA 1DPEA 3A3CA 1EZPA 3TQLA 2XXRA 5ISUA 3GZGA 4XKRA 3HSTA 2O68A 4QFLA 3QYTA 1R9LA 2O51A 2RCBA 3EPEA 4PF6A 5A5XA 1QUIA 2DS9A 1B5IA 4JVDA 3TPAA 3UORA 4DZ1A 3TAJA 2A5SA 3EN3A 4YB6A 4EF2A 4GX3A 1GGGA 3H06B 4U23A 3K6WA 1RKMA 2F8DA 3SZPA 4I9DA 1MQIA 4NHBA 3KC0A 4OESA 2HCAA 1M5BA 3O6HA 1DMBA 2UVHA 3CHGA 4KCCA 2GFEA 4P0GA 4R73A 1N7WA 2VP1A 1NH8A 1MXUA 1AL3A 2HXWA 2XX8A 4G77A 2HFBA 3LSLA 1URSA 2JJKA 3HN0A 5I59B 1VDWA 3RN8A 4KCDA 3C31A 3IAZA 2ZZVA 1N0TA 1YXIA 3KN3A 3G3GA 3K6UA 5L9MA 4G8MA 1Q9DA 1NNPA 2Q74A 3ILTB 1IMFA 3FXRA 2PBWA 1SW2A 4NE4A 2THIA 1SW5A 4GRKA 1ZU0A 5H8HB 2QS1A 4GWXA 3R26A 4QFOA 1NV0A 3TTRA 4ZE9A 1MY4A 3B8BA 3PU5A 5I57A 3MZBA 5FTIA 5IM2A 3IB0A 4P1EA 1NV3A 4THIA 4I3YA 4PCDA 1LBCA 2OZZA 1B32A 1SYHA 4F18A 4MIJA 1M5EA 2CMOA 3MVYA 4TLLB 2RC9A 1RYOA 1RDXA 1QW0A 3PPOA 3T9VA 2I3VA 1B52A 4AQ4A 3OO9A 3OSRA 3IB2A 3KJTA 4QBAA 1JW4A 1FBGA 1B58A 4DE8A 1UIVA 3ZS6A 4EQ9A 3CSBA 2F78A 2I0BA 4RPOA 2KLFA 1NNTA 1NNFA 4GXAA 3PPPA 4XIGQ 2XX9A 4MNCA 1H76A 4PBHA 2VT5A 3OEKA 5AA2B 3K00A 2CEXA 2X7PA 3KOSA 3SETA 4LQ5A 5K2XA 2Z22A 2Z8EA 3K1NA 3Q29A 1LEVA 3E79A 4JDFA 1MH4A 4AS4A 1S50A 4DI4B 1FBDA 5EHSA 2GHBA 4X04A 2O7UA 4QSEA 4NF0A 2LAOA 2FVZA 4P56A 2GRVA 3QIMA 3W9WA 1VR5A 4NTLA 3KN8A 1FTKA 2HPGA 2Q9TA 4GFRA 1LBXA 4MF3A 5CRYA 1BP5A 2XXQA 4JBZA 2IA4A 2ZXTA 1NH7A 2R71A 3T1BA 2OK2A 1EYIA 2B3BA 1SW4A 3U65A 4PF8A 4I62A 1D4NA 1FTJA 3BIGA 2DOJA 3Q25A 1MXYA 2V3QA 3LV0A 4G8HA 4RY1A 2XX7A 3MPKA 5JK4A 2Q8MA 4POXA 3RTFB 1IXHA 4LZ7A 3SDFA 1L5TA 3K2DA 3KBZA 4YKJA 5ET6A 1FPIA 5CC2A 2L5VA 3K1PA 1IITA 4O3BA 5I56B 3WAEA 5L9SA 3BFTA 4OEVA 3C4MA 4OWDA 3FJGA 1LBVA 3C9HA 4ELPA 3QUJA 1BKAA 1TXFA 1F9BA 3ROJA 4PAKA 1JW1A 4PFRA 4KXPA 5FTHA 1OLAA 3U1OA 4AB5A 1B2HA 4ZEIA 4U22A 5H8QA 2HHMA 3LSFB 3MZ9A 1OVTA 1VSOA 4N91A 4U1ZA 1TWYA 4FORA 3C34A 1NL5A 1USYE 3USDA 1Q35A 4PFUA 4F1VA 3F11A 1P1OA 2AL5A 1FPGA 3EHSA 4QXDA 5JTYB 1XOCA 1Y20A 5CMBA 3W9VA 1SVXB 2G29A 4IB2A 2R6GE 5I59A 1Z7NE 2PT2A 4O7MA 4MFIA 3FATA 1PEBA 2H9BA 4MBPA 4NF4A 3KJ7A 1EH3A 3UK4A 5J1DA 1PDAA 1UTBB 3BIHA 4H8JA 1FQAA 4NF8B 5DVJA 1OVBA 1LGBC 1WODA 3ZKLA 4WKMA 2V4CA 4R6KA 1B9JA 4GWYA 1MQGA 3FZVA 3RNNA 3M8UA 5ELVA 1FQDA 2BJJX 3Q27A 4JVCA 4QHQA 4H0WA 1AH5A 4F39A 4GD5A 4OA4A 3RT6B 4LA9A 5CMMA 4GOTA 3OO6A 2P3NA 3S9LC 1YYZA 4DI3D 2XXKA 1NV1A 4ISUA 1US5A 4ZECA 1NKXA 3I5OA 2ZYMA 1LBZA 2HAUA 3HHFA 2XD2A 4YZZA 1FQFA 2V25A 4F31B 4PC9A 4PTKA 4G8NA 3G3KA 4FEDA 2D21A 2AYSA 2ZNSA 3MZ1A 3QAXA 4OERA 2QL3A 1MY1A 3ILUB 4R75A 4YMBA 2Y7PA 3D4CA 3P7IA 1HSEA 2O6AA 4GWUA 2HZKA 4G4PA 3MSTA 2F6PA 3K6VA 5ICQA 1OIBA 3UGWA 1M5DA 1QUKA 3GLBA 2DE3A 1AIVA 2I58A 1P1UA 3DELB 4ECFA 5BUUA 1FRPA 3R7XA 3N94A 3E13X 3M3LA 3IJOB 3U92A 3MP6A 4KYEA 2CZKA 4HW8A 2GH9A 4DIGA 3FGSA 5KDTB 3O66A 1N3XA 2QMWA 4IO7A 2XXHA 5B70A 1MQJA 2NXOA 4XKNA 2QMXA 1O7TA 4H1XA 1BLFA 3LR1A 3S9EA 4NF5A 4XF5A 3TYHA 1NV5A 4F2QA 2F34A 1JP4A 3QSLA 4YICA 5KDTA 2ZYNA 1CB6A 2GHAA 3U93A 4P1LA 1DK4A 3FD3A 3FASA 5T3JA 3H3GA 1B7HA 4F2OA 2HQ0A 1NNKA 2RKMA 1YAEA 1B6HA 2E0SA 2DYXA 1OQGA 2F97A 1UIUA 2Y7IA 3H6UA 5ITOA 2XXYA 1FJ6A 2ONRA 5AE4A 4JVIA 4FAJA 2UYEA 1A55A 4HE1A 5I57B 2XXTA 4OMBA 2H25A 4LP2B 2I49A 3Q26A 1KA0A 4HCWA 4OYVA 5L9OA 1RDYA 5IZ3B 4DDDA 4O3AA 1RDZA 3H4ZA 1YCJA 4NG7A 4FIMA 4XKPA 2DVZA 3MC2A 5H8FA 1JEVA 4BDLA 4HE0A 1FBPA 2YPNA 3DP8A 3MQ9A 4R6YA 2OX3A 2W7YA 1WVJA 3I6VA 4QF9A 1NUZA 3IX1A 1B3LA 4KPTA 3KSXA 3W15C 1GV8A 4U1OA 3IR1A 2DVCA 4PGPA 2B4LA 3FVNA 4HTGA 4YAHX 5FHNA 4U4XA 4Q8RA 2Q89A 4MCOA 3AXFA 2RC7A 4DXUA 2FA7A 2PX1A 2ZMBA 3OO7A 1A7LA 2RC8A 5I2KA 3T9XB 3HV1A
chains in the Genus database with same CATH topology
4I1DA 2I6EA 4MLQA 1VFDA 3TMGA 4RXLA 3UA8A 2REJA 3OEKA 1HSLA 4ZEBA 5H8QB 3G3FA 2XXXA 3B6WA 4KD5A 5AA2B 2NWJA 3S2VA 2OWTA 3K00A 5DVFA 4F22A 4KYDA 2ZNTA 1OQHA 2X7PA 3U94A 4FJPA 3DLNA 4LVQA 2DQVA 4ND9A 4O3CA 3KOSA 4R74A 1DTZA 3SETA 4H8IA 1IXCA 3OENA 4LQ5A 5K2XA 1GVCA 1HSJA 3VVEA 3FXUA 5KZTA 2Z22A 2Z8EA 3K1NA 5BWJA 3Q29A 2F5XA 3FJMA 2H99A 2VHAA 4JDFA 1MH4A 3MUQA 3N26A 1MH3A 1MQDA 1H44A 3E9XA 5I84A 1S50A 4LZ5A 3S9NC 1JW5A 3DM0A 4RJZA 3T22A 2Y84A 3L6GA 5EHSA 5CI5A 4XTCQ 2VD3A 3C33A 3G3JA 2GHBA 2FNCA 5FHMA 4PFTA 4ZEKA 3I3VA 2NUVA 4F3SA 4EQ9A 3WAFA 1B7UA 1LAGE 2UVJA 1Y3NA 4KR5A 2O7UA 1LFHA 2P0SA 4QSEA 1II5A 3V83A 4C0RA 2VD2A 2LAOA 4ESXA 1B3GA 2GRVA 3A3UA 4K3FA 4MLVA 3E3KA 1SW1A 5AA2A 2XD3A 3IO4A 4R9FA 3QIMA 3W9WA 3ODBA 1VR5A 4RK2A 4NTLA 5CMCA 3KN8A 3N5LA 3FV2A 4OXVA 1FTKA 3SERA 3T66A 4NF4B 4QSCA 3ONMA 3VLUA 1TT1A 2Q9TA 4GFRA 1YPNA 5TPAA 3OXNA 4MF3A 1FCKA 2Y7KA 2ZYOA 4H5FA 1Y1ZA 5CRYA 1BP5A 2ESNA 2XXQA 1ZJLA 3H6WA 3K4UA 4GIZA 3V89B 1ZLQA 4QFNA 1ZMGA 3OO8A 1S9TA 4GF8A 4JBZA 4XXUA 2IA4A 3TDJA 2ZXTA 1NH7A 4OFOA 4U2RA 1B1HA 4G68C 1B3HA 1Y3QA 2R71A 4BLAA 4NMYA 2OK2A 1LFIA 1UTBA 1VE4A 4R6HA 2B3BA 2DSFA 5DVIA 4POWA 4ELQA 5IKBA 5LOMA 4F29A 3PMVA 1SW4A 3JV9A 4H6DA 4OFLA 3A09A 5H8NA 3U72A 2D5WA 3IL1B 4U21A 1R6ZA 3DP4A 3BFUA 4I62A 5A5XA 1D4NA 1FTJA 3K1MA 4WXJA 3RUMA 3TCFA 2F6GA 2DOJA 2UVGA 3SEXA 2OWSA 3Q25A 4LATA 2ONKE 1MRPA 1MXYA 4FEBA 4Q0CA 2V3QA 1OMPA 2PYYA 1EZ9A 4G8HA 2DWJA 4ELRA 4RY1A 4R2BA 4IGTA 1O64A 2XX7A 5JTYA 1EU8A 3JZJA 4E0WA 2QS4A 2ANJA 3FVOA 3MPKA 5H8HA 5JK4A 4OQOA 4POXA 3RTFB 4EXKA 5EYFA 2X26A 1B5JA 1IXHA 1TFAA 1URDA 3G7WA 5A5XB 4LZ7A 1P1QA 2XXWA 4GXSB 1A99A 3SDFA 1S7YA 1B1XA 4QFKA 4ZZEA 4M1VA 1L5TA 2AIXA 1Y4CA 2V84A 4PP0A 2XXVA 1BTJA 2RCAA 2VOZA 4G68A 4NWDA 1MPCA 3C32A 5CBRA 3N6TA 4GL8A 4GL0A 5CMKA 3THIA 3IORA 2DWHA 4KI0E 3K2DA 1JVYA 3VVDA 1B3EA 4HS7A 1EZOA 2OCUA 4XKRA 4YB7A 4RYAA 2UVIA 3KGCA 4TQUQ 4YKJA 3SEVA 4FATA 4ZEDA 4BDOA 4GVOA 4F1YA 1P1NA 3PMWA 5CC2A 4IO3A 3EF7A 2REGA 3K1PA 1IITA 4FECA 1URGA 4O3BA 4YKPA 5F1QA 5I56B 3CFXA 1MPDA 4OVJA 1PBPA 3WAEA 1B51A 4RPNA 3SESA 2B3FA 3LUYA 4GQOA 5L9SA 3BFTA 3S9MC 4OEVA 3RPWA 3B6QA 3C4MA 4H65A 4KFQA 3E4RA 4JSDA 4OFJA 4OWDA 1DTGA 3FJGA 1FW0A 3C9HA 4U4SA 3TODA 1MXXA 3GBAA 5EHMA 3SEUA 3QUJA 4ELPA 1BKAA 4ELOA 1TXFA 5B70A 4QRZA 4L17A 1F9BA 2PT1A 3RT8A 3ZKKA 3MBPA 3O6IA 2Q2CA 3VE1B 3PD9A 2XXPA 1LCTA 2D3IA 3TELA 3MW0A 1H43A 1JW1A 1KWHA 1MDQA 3MJNA 1QVSA 2ABHA 3IK6B 3K02A 2NOOA 1B3FA 2DP8A 2F7CA 2P2AA 3RGYA 4DCYA 1FQEA 3MVZA 2OBGA 3UN6A 1O63A 4X1BA 5KCJA 1LLSA 1FQCA 1FTLA 5TPAB 5I58A 3PGFA 3OSQA 5FTHA 1XT8A 1OLAA 3M3KA 5ELVA 4FE8A 3U1OA 4AB5A 1B2HA 3IB1A 1DOTA 3EHUA 1PC3A 3H7MA 4N13A 3MP8A 4ZEIA 1PB9A 2F36A 1GR2A 4U22A 4PE5B 4DXUA 1MY2A 4BDRA 3TZAA 5H8QA 5DTBA 4G68B 3VVFA 1ZBMA 1I6BA 1XVXA 1JEUA 3HO7A 3IOWA 1JETA 3V5AA 1H45A 1LBBA 3LSFB 3MZ9A 3PD8A 1OVTA 1R1NA 1VSOA 3OEMA 3K6XA 4U1ZA 2RF1A 1TWYA 2F35A 4FORA 1P1WA 2ALUA 1NL5A 3C34A 1USYE 5I2KB 5DEXB 1Q35A 3USDA 4PFUA 4LZ8A 4F1UA 4F19A 1PB8A 4WEDA 3HCQA 3KN7A 4I8CA 4F1VA 3MAMA 3TFLA 3LSXA 1IIWA 1LAFE 3F11A 1AMFA 4P0IA 5TU0A 1P1OA 2AL5A 4NF8A 3EHSA 4X48A 4BDNA 5JTYB 1XOCA 2G93A 1Y20A 1Y3PA 4LQ2A 4LUBA 5CMBA 3VDFA 1T0KA 4H67A 5TP9A 3W9VA 1SVXB 2G29A 5FHOA 4EQ7A 4IB2A 3PPQA 1UQWA 1B4ZA 3CSGA 2R6GE 5I59A 4PETA 3TKDA 2VGQA 1DPPA 3K0VA 2V93A 3U8QA 5I56A 3PUVE 1Z7NE 2PT2A 4MFIA 3FATA 1POY1 1QULA 3GBBA 4ZZAA 1GTKA 1PEBA 2A5TB 2H9BA 2YJPA 2I3WA 2PVUA 3ZS6A 5ICQA 1SI1A 2Q88A 4MBPA 3S4UA 4NF4A 3KJ7A 1EH3A 1UTHA 3LBSA 5K2YA 3UK4A 5J1DA 4C1TA 5B7DA 1LSTA 1PDAA 3Q28A 1UTBB 2OJTA 1FTMA 3KEIA 4H8JA 1FQAA 4JSOA 4DXBA 2DE2A 1MY0A 2DWAA 3N6UA 4NF8B 5AA2D 4NWCA 2M8CA 4TOZA 2IEEA 3O29A 5AA4A 1SQYA 3CVGA 3SKPA 3UIFA 1VFEA 2X7QA 1OVBA 3H03A 5DVJA 1LGBC 3G3HA 1WODA 2HZLA 2QJEA 4WKMA 3ZKLA 4R6KA 2I48A 1B9JA 1SYIA 2UYFA 3KSJA 1MQGA 4ZDMA 3D4GA 3FZVA 3RNNA 1MXZA 5AA1A 1ZTYA 1ELJA 2BJJX 1FQDA 3KFMA 3M8UA 3Q27A 4NF6B 3PUWE 1AH5A 4H0WA 4QHQA 4F39A 4YKKA 2P1SA 4GD5A 4IO4A 3RT6B 1N7XA 2I4BA 1YTVA 4LA9A 4OEUA 4GOTA 4R2FA 5CMMA 3OO6A 5I2NB 3RQTA 4P11A 3S9LC 4PFWA 2Z23A 5H8FB 3EHTA 1MDP1 5M2VA 3JYRA 1AOVA 2QRYA 1TFDA 1NFTA 1MPBA 3TTNA 4EDPA 1I69A 4ISUA 1US5A 4ZECA 1NKXA 3I5OA 2ZYMA 5TP9B 4G2ZA 3PUYE 3VLVA 4YU0A 5HBCA 2DE4A 4HCYA 2Z8FA 1IXGA 2HAUA 3V8XB 3HHFA 4DXCA 1JQFA 3OMBA 2XD2A 4YZZA 4JXIA 5H8NB 4M4GA 3TTKA 5DYHA 1FQFA 2V25A 5JEIA 4RK9A 2QS3A 4F31B 3CFLA 2B65A 3IOUA 3G3KA 4FEDA 4G8NA 4NEDA 1US4A 4BDMA 3EQ1A 1USYH 2D21A 2AYSA 1LFGA 1LB8A 3PPRA 2ZNSA 4R9GA 5ICTA 3MZ1A 2E1SA 3QAXA 3T93B 4OZ9A 3PV0E 1BIYA 4DCXA 2Y7WA 3CG3A 4OERA 3VXBA 2O7IA 4X9TA 2QL3A 1MY1A 3ILUB 1J1NA 3OD7A 1A40A 4R75A 2O84X 4YMBA 2Y7PA 3MVXA 3O9PA 3D4CA 1ATGA 4YMAA 2WKYA 4EUOA 3O28A 3HPIA 1UTHB 3B7DA 1HSEA 1ZIUA 2O6AA 2HZKA 3P7IA 1N3WA 2FYIA 1PB7A 3CFZA 3MP1A 3QK6A 4G4PA 2F6PA 3K6VA 4YB5A 2DWIA 3DP6A 3GXAA 1N04A 1P99A 1OIBA 3FVKA 1M5DA 1XHYA 4IGRA 4N6PA 1QUKA 4ZE8A 3SEWA 3UGWA 4UA8A 3PUZE 4X1DA 3FXQA 4OTEA 1SBPA 1B40A 3GLBA 1Q1KA 2DE3A 4R72A 2V3TA 3O6GA 1IZ1A 3B6TA 5L8DA 3VLWA 1FQBA 2Q2AA 2I58A 4IO6A 1XVYA 1AIVA 1P1UA 4F3PA 1B05A 3DELB 4JWYA 4ECFA 1D3KA 5AA4B 5BUUA 4ZS9A 2F7AA 2HAVA 3R7XA 3ZSFA 3N94A 1H3DA 3E13X 4PQJA 3G3IA 3M3LA 2HEUA 3IJOB 1DPEA 3A3CA 3MP6A 3U92A 1EZPA 3SEYA 2A5TA 1IUDA 2ONSA 3O2AA 4KYEA 3TQLA 2XXRA 2H4IA 2XXUA 3T96B 4HW8A 5ISUA 3FIRA 2GH9A 4DIGA 1R9QA 3FGSA 5KDTB 3O66A 1N3XA 4IY5A 3RLFE 1PBQA 2QMWA 3GZGA 2XXHA 3HSTA 2O68A 4IO7A 4OETA 4QFLA 3QYTA 1MQJA 1R9LA 1IEJA 2NXOA 2O51A 2RCBA 1XS5A 1ANFA 2QS2A 3EPEA 1QUIA 2DS9A 3M3FA 4XKNA 5DT6A 5F7VA 2QMXA 1B5IA 4GWOA 4C1UA 1O7TA 4H1XA 2Q8JA 1FTOA 1BLFA 3MPLA 4NF5B 3TPAA 2QPQA 4RNSA 3UORA 1DSNA 3TAJA 4DZ1A 4Z7EA 2PMSA 2A5SA 3EN3A 5AA3A 3LR1A 2V3UA 4QSDA 2I0CA 3S9EA 4NF5A 3TYHA 4YB6A 1RYXA 1A54A 4YKIA 3CRBA 4EF2A 1GGGA 3H06B 4NF6A 4Q30B 2F34A 4U23A 4F2QA 1LAXA 3K6WA 3QSLA 4XKQA 4YICA 1M5FA 5DEXA 1RKMA 1B7ZA 3IOVA 2OLBA 1B0HA 3UP9A 5KDTA 2F8DA 3IOTA 3KOTA 1SDXA 1MQIA 2ZYNA 4I9DA 1CB6A 4EF1A 4Z0IA 1LB9A 2GHAA 4OESA 3U93A 2HCAA 1M5BA 3O6HA 3T9HB 1DMBA 1JNFA 1MM7A 2UVHA 3O97A 4KCCA 1MM6A 3TEPA 2GFEA 3IJXB 4P0GA 4R73A 1MXVA 1MG1A 1N7WA 2VP1A 1NH8A 3FD3A 1MXUA 1LAHE 3K01A 1AL3A 2HXWA 3FASA 3RY3A 2YLNA 2XX8A 4KYSA 1I6AA 1N84A 2HFBA 3FV1A 1M5CA 1OLCA 3H6TA 3LSLA 4G77A 5I58B 4DLDA 1URSA 4F3GA 3HN0A 2XXIA 3H3GA 2DXRA 4TLMB 3MVWA 5I59B 3PUXE 3RN8A 4KCDA 1B7HA 4F2OA 1IQ7A 2DXYA 2HQ0A 3C31A 3IAZA 1NNKA 3RTWB 4OHNA 2RKMA 1N0TA 4JWOA 1WDNA 1YAEA 2F7BA 4IO2A 1ZKBA 3KN3A 1B6HA 1QUJA 3G3GA 3K6UA 1B5HA 1SI0A 3L6HA 5L9MA 2E0SA 4G8MA 2Z8DA 3FVGA 4H5GA 2DYXA 4KHZE 1OQGA 2F97A 1LCFA 1Y9UA 1UIUA 4N07A 2Y7IA 1CE2A 1NNPA 1Y1MA 2XXYA 3H6UA 5ITOA 3VV5A 3PMXA 5IAIA 2Y7RA 3TQWA 2ONRA 1MQHA 3ILTB 3VXCA 2QSXA 3CIJA 5AE4A 2NVUB 1XC1A 3FXRA 2UYEA 2O1LA 1A55A 4ZEFA 4FAJA 5I57B 2PBWA 5H8SA 2XXTA 4GLIA 4OMBA 3IO6A 1SW2A 4EQBA 2H25A 4NE4A 4UACA 2THIA 1SW5A 4GRKA 1ZU0A 3BKIB 4LP2B 1JVXA 1Z7ME 2I49A 3HHGA 2CZLA 2QS1A 3R26A 5H8HB 3T9UA 3Q26A 1NMUA 4F3BA 1POTA 4QFOA 3CI8A 3OELA 3QUFA 4HCWA 3TTRA 4ZE9A 4RA1A 5ITPA 4OYVA 3QXMA 5L9OA 3CR9A 3R6UA 1MY4A 5HM4B 3PU5A 3LC8A 3MZBA 5FTIA 4ESWA 3IB0A 3C35A 3VFJA 4DDDA 5I57A 4JB7A 3TCGA 1B4HA 4O3AA 1IXIA 4THIA 3H4ZA 5HPQA 1YCJA 3TTLA 4KQPA 4FIMA 2O69A 4XKPA 1Y4TA 2DVZA 1LBCA 2OZZA 3MC2A 5H8FA 1JEVA 1B32A 4BDLA 1SYHA 1MY3A 3OOAA 3TCHA 4F18A 1QKAA 5CBSA 3TUSA 2YPNA 3KZGA 2UXAA 4Q5TA 1M5EA 3DP8A 1QKBA 1A8FA 2CMOA 3MVYA 1D9YA 4IO5A 3KBRA 4TLLB 2RC9A 2RINA 1RYOA 3FJ7A 2H98A 2ZNUA 3MQ9A 4R6YA 1QW0A 3KG2A 4JWXA 3TTMA 2W7YA 3PPOA 5KCJB 1WVJA 4IY6A 1MS7A 2I3VA 2XHDA 3I6VA 3T9VA 4AB6A 1B52A 2H5YA 4ONYA 4QF9A 4LONB 3IX1A 4KPTA 1B3LA 2O1MA 4AQ4A 2R9JA 3OO9A 4MH5A 3OSRA 5I2NA 1B0LA 3BBRA 3KSXA 3W15C 1D9VA 3CG1A 3H6VA 3IB2A 3IR1A 3MWBA 2DVCA 4U1OA 1GV8A 2AL4A 3FVNA 3KJTA 4HTGA 4YAHX 5FHNA 4PFYA 3LSWA 1JW4A 3PPNA 4U4XA 1B58A 4Q8RA 4DE8A 4E0XA 1SD3A 1UIVA 2Q89A 1N76A 1B46A 2FA7A 2RC7A 3AXFA 3CSBA 3FUZA 2F78A 2ZYKA 2I0BA 3ECRA 2KLFA 3C36A 2PX1A 2ZMBA 4RPOA 4WEPA 4EXLA 1NNTA 3OO7A 1NNFA 1MXWA 2I4CA 4GXAA 1A7LA 2RC8A 1A8EA 1QJMA 4OENA 3PPPA 4XIGQ 5CM6A 1I6QA 3T9XB 4BDQA 5I2KA 2XX9A 1H76A 4QFPA 3HV1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4I1D A;  2I6E A;  4MLQ A;  1VFD A;  3TMG A;  4RXL A;  3UA8 A;  2REJ A;  3OEK A;  1HSL A;  4ZEB A;  5H8Q B;  3G3F A;  2XXX A;  3B6W A;  4KD5 A;  5AA2 B;  2NWJ A;  3S2V A;  2OWT A;  3K00 A;  5DVF A;  4F22 A;  4KYD A;  2ZNT A;  1OQH A;  2X7P A;  3U94 A;  4FJP A;  3DLN A;  4LVQ A;  2DQV A;  4ND9 A;  4O3C A;  3KOS A;  4R74 A;  1DTZ A;  3SET A;  4H8I A;  1IXC A;  3OEN A;  4LQ5 A;  5K2X A;  1GVC A;  1HSJ A;  3VVE A;  3FXU A;  5KZT A;  2Z22 A;  2Z8E A;  3K1N A;  5BWJ A;  3Q29 A;  2F5X A;  3FJM A;  2H99 A;  2VHA A;  4JDF A;  1MH4 A;  3MUQ A;  3N26 A;  1MH3 A;  1MQD A;  1H44 A;  3E9X A;  5I84 A;  1S50 A;  4LZ5 A;  3S9N C;  1JW5 A;  3DM0 A;  4RJZ A;  3T22 A;  2Y84 A;  3L6G A;  5EHS A;  5CI5 A;  4XTC Q;  2VD3 A;  3C33 A;  3G3J A;  2GHB A;  2FNC A;  5FHM A;  4PFT A;  4ZEK A;  3I3V A;  2NUV A;  4F3S A;  4EQ9 A;  3WAF A;  1B7U A;  1LAG E;  2UVJ A;  1Y3N A;  4KR5 A;  2O7U A;  1LFH A;  2P0S A;  4QSE A;  1II5 A;  3V83 A;  4C0R A;  2VD2 A;  2LAO A;  4ESX A;  1B3G A;  2GRV A;  3A3U A;  4K3F A;  4MLV A;  3E3K A;  1SW1 A;  5AA2 A;  2XD3 A;  3IO4 A;  4R9F A;  3QIM A;  3W9W A;  3ODB A;  1VR5 A;  4RK2 A;  4NTL A;  5CMC A;  3KN8 A;  3N5L A;  3FV2 A;  4OXV A;  1FTK A;  3SER A;  3T66 A;  4NF4 B;  4QSC A;  3ONM A;  3VLU A;  1TT1 A;  2Q9T A;  4GFR A;  1YPN A;  5TPA A;  3OXN A;  4MF3 A;  1FCK A;  2Y7K A;  2ZYO A;  4H5F A;  1Y1Z A;  5CRY A;  1BP5 A;  2ESN A;  2XXQ A;  1ZJL A;  3H6W A;  3K4U A;  4GIZ A;  3V89 B;  1ZLQ A;  4QFN A;  1ZMG A;  3OO8 A;  1S9T A;  4GF8 A;  4JBZ A;  4XXU A;  2IA4 A;  3TDJ A;  2ZXT A;  1NH7 A;  4OFO A;  4U2R A;  1B1H A;  4G68 C;  1B3H A;  1Y3Q A;  2R71 A;  4BLA A;  4NMY A;  2OK2 A;  1LFI A;  1UTB A;  1VE4 A;  4R6H A;  2B3B A;  2DSF A;  5DVI A;  4POW A;  4ELQ A;  5IKB A;  5LOM A;  4F29 A;  3PMV A;  1SW4 A;  3JV9 A;  4H6D A;  4OFL A;  3A09 A;  5H8N A;  3U72 A;  2D5W A;  3IL1 B;  4U21 A;  1R6Z A;  3DP4 A;  3BFU A;  4I62 A;  5A5X A;  1D4N A;  1FTJ A;  3K1M A;  4WXJ A;  3RUM A;  3TCF A;  2F6G A;  2DOJ A;  2UVG A;  3SEX A;  2OWS A;  3Q25 A;  4LAT A;  2ONK E;  1MRP A;  1MXY A;  4FEB A;  4Q0C A;  2V3Q A;  1OMP A;  2PYY A;  1EZ9 A;  4G8H A;  2DWJ A;  4ELR A;  4RY1 A;  4R2B A;  4IGT A;  1O64 A;  2XX7 A;  5JTY A;  1EU8 A;  3JZJ A;  4E0W A;  2QS4 A;  2ANJ A;  3FVO A;  3MPK A;  5H8H A;  5JK4 A;  4OQO A;  4POX A;  3RTF B;  4EXK A;  5EYF A;  2X26 A;  1B5J A;  1IXH A;  1TFA A;  1URD A;  3G7W A;  5A5X B;  4LZ7 A;  1P1Q A;  2XXW A;  4GXS B;  1A99 A;  3SDF A;  1S7Y A;  1B1X A;  4QFK A;  4ZZE A;  4M1V A;  1L5T A;  2AIX A;  1Y4C A;  2V84 A;  4PP0 A;  2XXV A;  1BTJ A;  2RCA A;  2VOZ A;  4G68 A;  4NWD A;  1MPC A;  3C32 A;  5CBR A;  3N6T A;  4GL8 A;  4GL0 A;  5CMK A;  3THI A;  3IOR A;  2DWH A;  4KI0 E;  3K2D A;  1JVY A;  3VVD A;  1B3E A;  4HS7 A;  1EZO A;  2OCU A;  4XKR A;  4YB7 A;  4RYA A;  2UVI A;  3KGC A;  4TQU Q;  4YKJ A;  3SEV A;  4FAT A;  4ZED A;  4BDO A;  4GVO A;  4F1Y A;  1P1N A;  3PMW A;  5CC2 A;  4IO3 A;  3EF7 A;  2REG A;  3K1P A;  1IIT A;  4FEC A;  1URG A;  4O3B A;  4YKP A;  5F1Q A;  5I56 B;  3CFX A;  1MPD A;  4OVJ A;  1PBP A;  3WAE A;  1B51 A;  4RPN A;  3SES A;  2B3F A;  3LUY A;  4GQO A;  5L9S A;  3BFT A;  3S9M C;  4OEV A;  3RPW A;  3B6Q A;  3C4M A;  4H65 A;  4KFQ A;  3E4R A;  4JSD A;  4OFJ A;  4OWD A;  1DTG A;  3FJG A;  1FW0 A;  3C9H A;  4U4S A;  3TOD A;  1MXX A;  3GBA A;  5EHM A;  3SEU A;  3QUJ A;  4ELP A;  1BKA A;  4ELO A;  1TXF A;  5B70 A;  4QRZ A;  4L17 A;  1F9B A;  2PT1 A;  3RT8 A;  3ZKK A;  3MBP A;  3O6I A;  2Q2C A;  3VE1 B;  3PD9 A;  2XXP A;  1LCT A;  2D3I A;  3TEL A;  3MW0 A;  1H43 A;  1JW1 A;  1KWH A;  1MDQ A;  3MJN A;  1QVS A;  2ABH A;  3IK6 B;  3K02 A;  2NOO A;  1B3F A;  2DP8 A;  2F7C A;  2P2A A;  3RGY A;  4DCY A;  1FQE A;  3MVZ A;  2OBG A;  3UN6 A;  1O63 A;  4X1B A;  5KCJ A;  1LLS A;  1FQC A;  1FTL A;  5TPA B;  5I58 A;  3PGF A;  3OSQ A;  5FTH A;  1XT8 A;  1OLA A;  3M3K A;  5ELV A;  4FE8 A;  3U1O A;  4AB5 A;  1B2H A;  3IB1 A;  1DOT A;  3EHU A;  1PC3 A;  3H7M A;  4N13 A;  3MP8 A;  4ZEI A;  1PB9 A;  2F36 A;  1GR2 A;  4U22 A;  4PE5 B;  4DXU A;  1MY2 A;  4BDR A;  3TZA A;  5H8Q A;  5DTB A;  4G68 B;  3VVF A;  1ZBM A;  1I6B A;  1XVX A;  1JEU A;  3HO7 A;  3IOW A;  1JET A;  3V5A A;  1H45 A;  1LBB A;  3LSF B;  3MZ9 A;  3PD8 A;  1OVT A;  1R1N A;  1VSO A;  3OEM A;  3K6X A;  4U1Z A;  2RF1 A;  1TWY A;  2F35 A;  4FOR A;  1P1W A;  2ALU A;  1NL5 A;  3C34 A;  1USY E;  5I2K B;  5DEX B;  1Q35 A;  3USD A;  4PFU A;  4LZ8 A;  4F1U A;  4F19 A;  1PB8 A;  4WED A;  3HCQ A;  3KN7 A;  4I8C A;  4F1V A;  3MAM A;  3TFL A;  3LSX A;  1IIW A;  1LAF E;  3F11 A;  1AMF A;  4P0I A;  5TU0 A;  1P1O A;  2AL5 A;  4NF8 A;  3EHS A;  4X48 A;  4BDN A;  5JTY B;  1XOC A;  2G93 A;  1Y20 A;  1Y3P A;  4LQ2 A;  4LUB A;  5CMB A;  3VDF A;  1T0K A;  4H67 A;  5TP9 A;  3W9V A;  1SVX B;  2G29 A;  5FHO A;  4EQ7 A;  4IB2 A;  3PPQ A;  1UQW A;  1B4Z A;  3CSG A;  2R6G E;  5I59 A;  4PET A;  3TKD A;  2VGQ A;  1DPP A;  3K0V A;  2V93 A;  3U8Q A;  5I56 A;  3PUV E;  1Z7N E;  2PT2 A;  4MFI A;  3FAT A;  1POY 1;  1QUL A;  3GBB A;  4ZZA A;  1GTK A;  1PEB A;  2A5T B;  2H9B A;  2YJP A;  2I3W A;  2PVU A;  3ZS6 A;  5ICQ A;  1SI1 A;  2Q88 A;  4MBP A;  3S4U A;  4NF4 A;  3KJ7 A;  1EH3 A;  1UTH A;  3LBS A;  5K2Y A;  3UK4 A;  5J1D A;  4C1T A;  5B7D A;  1LST A;  1PDA A;  3Q28 A;  1UTB B;  2OJT A;  1FTM A;  3KEI A;  4H8J A;  1FQA A;  4JSO A;  4DXB A;  2DE2 A;  1MY0 A;  2DWA A;  3N6U A;  4NF8 B;  5AA2 D;  4NWC A;  2M8C A;  4TOZ A;  2IEE A;  3O29 A;  5AA4 A;  1SQY A;  3CVG A;  3SKP A;  3UIF A;  1VFE A;  2X7Q A;  1OVB A;  3H03 A;  5DVJ A;  1LGB C;  3G3H A;  1WOD A;  2HZL A;  2QJE A;  4WKM A;  3ZKL A;  4R6K A;  2I48 A;  1B9J A;  1SYI A;  2UYF A;  3KSJ A;  1MQG A;  4ZDM A;  3D4G A;  3FZV A;  3RNN A;  1MXZ A;  5AA1 A;  1ZTY A;  1ELJ A;  2BJJ X;  1FQD A;  3KFM A;  3M8U A;  3Q27 A;  4NF6 B;  3PUW E;  1AH5 A;  4H0W A;  4QHQ A;  4F39 A;  4YKK A;  2P1S A;  4GD5 A;  4IO4 A;  3RT6 B;  1N7X A;  2I4B A;  1YTV A;  4LA9 A;  4OEU A;  4GOT A;  4R2F A;  5CMM A;  3OO6 A;  5I2N B;  3RQT A;  4P11 A;  3S9L C;  4PFW A;  2Z23 A;  5H8F B;  3EHT A;  1MDP 1;  5M2V A;  3JYR A;  1AOV A;  2QRY A;  1TFD A;  1NFT A;  1MPB A;  3TTN A;  4EDP A;  1I69 A;  4ISU A;  1US5 A;  4ZEC A;  1NKX A;  3I5O A;  2ZYM A;  5TP9 B;  4G2Z A;  3PUY E;  3VLV A;  4YU0 A;  5HBC A;  2DE4 A;  4HCY A;  2Z8F A;  1IXG A;  2HAU A;  3V8X B;  3HHF A;  4DXC A;  1JQF A;  3OMB A;  2XD2 A;  4YZZ A;  4JXI A;  5H8N B;  4M4G A;  3TTK A;  5DYH A;  1FQF A;  2V25 A;  5JEI A;  4RK9 A;  2QS3 A;  4F31 B;  3CFL A;  2B65 A;  3IOU A;  3G3K A;  4FED A;  4G8N A;  4NED A;  1US4 A;  4BDM A;  3EQ1 A;  1USY H;  2D21 A;  2AYS A;  1LFG A;  1LB8 A;  3PPR A;  2ZNS A;  4R9G A;  5ICT A;  3MZ1 A;  2E1S A;  3QAX A;  3T93 B;  4OZ9 A;  3PV0 E;  1BIY A;  4DCX A;  2Y7W A;  3CG3 A;  4OER A;  3VXB A;  2O7I A;  4X9T A;  2QL3 A;  1MY1 A;  3ILU B;  1J1N A;  3OD7 A;  1A40 A;  4R75 A;  2O84 X;  4YMB A;  2Y7P A;  3MVX A;  3O9P A;  3D4C A;  1ATG A;  4YMA A;  2WKY A;  4EUO A;  3O28 A;  3HPI A;  1UTH B;  3B7D A;  1HSE A;  1ZIU A;  2O6A A;  2HZK A;  3P7I A;  1N3W A;  2FYI A;  1PB7 A;  3CFZ A;  3MP1 A;  3QK6 A;  4G4P A;  2F6P A;  3K6V A;  4YB5 A;  2DWI A;  3DP6 A;  3GXA A;  1N04 A;  1P99 A;  1OIB A;  3FVK A;  1M5D A;  1XHY A;  4IGR A;  4N6P A;  1QUK A;  4ZE8 A;  3SEW A;  3UGW A;  4UA8 A;  3PUZ E;  4X1D A;  3FXQ A;  4OTE A;  1SBP A;  1B40 A;  3GLB A;  1Q1K A;  2DE3 A;  4R72 A;  2V3T A;  3O6G A;  1IZ1 A;  3B6T A;  5L8D A;  3VLW A;  1FQB A;  2Q2A A;  2I58 A;  4IO6 A;  1XVY A;  1AIV A;  1P1U A;  4F3P A;  1B05 A;  3DEL B;  4JWY A;  4ECF A;  1D3K A;  5AA4 B;  5BUU A;  4ZS9 A;  2F7A A;  2HAV A;  3R7X A;  3ZSF A;  3N94 A;  1H3D A;  3E13 X;  4PQJ A;  3G3I A;  3M3L A;  2HEU A;  3IJO B;  1DPE A;  3A3C A;  3MP6 A;  3U92 A;  1EZP A;  3SEY A;  2A5T A;  1IUD A;  2ONS A;  3O2A A;  4KYE A;  3TQL A;  2XXR A;  2H4I A;  2XXU A;  3T96 B;  4HW8 A;  5ISU A;  3FIR A;  2GH9 A;  4DIG A;  1R9Q A;  3FGS A;  5KDT B;  3O66 A;  1N3X A;  4IY5 A;  3RLF E;  1PBQ A;  2QMW A;  3GZG A;  2XXH A;  3HST A;  2O68 A;  4IO7 A;  4OET A;  4QFL A;  3QYT A;  1MQJ A;  1R9L A;  1IEJ A;  2NXO A;  2O51 A;  2RCB A;  1XS5 A;  1ANF A;  2QS2 A;  3EPE A;  1QUI A;  2DS9 A;  3M3F A;  4XKN A;  5DT6 A;  5F7V A;  2QMX A;  1B5I A;  4GWO A;  4C1U A;  1O7T A;  4H1X A;  2Q8J A;  1FTO A;  1BLF A;  3MPL A;  4NF5 B;  3TPA A;  2QPQ A;  4RNS A;  3UOR A;  1DSN A;  3TAJ A;  4DZ1 A;  4Z7E A;  2PMS A;  2A5S A;  3EN3 A;  5AA3 A;  3LR1 A;  2V3U A;  4QSD A;  2I0C A;  3S9E A;  4NF5 A;  3TYH A;  4YB6 A;  1RYX A;  1A54 A;  4YKI A;  3CRB A;  4EF2 A;  1GGG A;  3H06 B;  4NF6 A;  4Q30 B;  2F34 A;  4U23 A;  4F2Q A;  1LAX A;  3K6W A;  3QSL A;  4XKQ A;  4YIC A;  1M5F A;  5DEX A;  1RKM A;  1B7Z A;  3IOV A;  2OLB A;  1B0H A;  3UP9 A;  5KDT A;  2F8D A;  3IOT A;  3KOT A;  1SDX A;  1MQI A;  2ZYN A;  4I9D A;  1CB6 A;  4EF1 A;  4Z0I A;  1LB9 A;  2GHA A;  4OES A;  3U93 A;  2HCA A;  1M5B A;  3O6H A;  3T9H B;  1DMB A;  1JNF A;  1MM7 A;  2UVH A;  3O97 A;  4KCC A;  1MM6 A;  3TEP A;  2GFE A;  3IJX B;  4P0G A;  4R73 A;  1MXV A;  1MG1 A;  1N7W A;  2VP1 A;  1NH8 A;  3FD3 A;  1MXU A;  1LAH E;  3K01 A;  1AL3 A;  2HXW A;  3FAS A;  3RY3 A;  2YLN A;  2XX8 A;  4KYS A;  1I6A A;  1N84 A;  2HFB A;  3FV1 A;  1M5C A;  1OLC A;  3H6T A;  3LSL A;  4G77 A;  5I58 B;  4DLD A;  1URS A;  4F3G A;  3HN0 A;  2XXI A;  3H3G A;  2DXR A;  4TLM B;  3MVW A;  5I59 B;  3PUX E;  3RN8 A;  4KCD A;  1B7H A;  4F2O A;  1IQ7 A;  2DXY A;  2HQ0 A;  3C31 A;  3IAZ A;  1NNK A;  3RTW B;  4OHN A;  2RKM A;  1N0T A;  4JWO A;  1WDN A;  1YAE A;  2F7B A;  4IO2 A;  1ZKB A;  3KN3 A;  1B6H A;  1QUJ A;  3G3G A;  3K6U A;  1B5H A;  1SI0 A;  3L6H A;  5L9M A;  2E0S A;  4G8M A;  2Z8D A;  3FVG A;  4H5G A;  2DYX A;  4KHZ E;  1OQG A;  2F97 A;  1LCF A;  1Y9U A;  1UIU A;  4N07 A;  2Y7I A;  1CE2 A;  1NNP A;  1Y1M A;  2XXY A;  3H6U A;  5ITO A;  3VV5 A;  3PMX A;  5IAI A;  2Y7R A;  3TQW A;  2ONR A;  1MQH A;  3ILT B;  3VXC A;  2QSX A;  3CIJ A;  5AE4 A;  2NVU B;  1XC1 A;  3FXR A;  2UYE A;  2O1L A;  1A55 A;  4ZEF A;  4FAJ A;  5I57 B;  2PBW A;  5H8S A;  2XXT A;  4GLI A;  4OMB A;  3IO6 A;  1SW2 A;  4EQB A;  2H25 A;  4NE4 A;  4UAC A;  2THI A;  1SW5 A;  4GRK A;  1ZU0 A;  3BKI B;  4LP2 B;  1JVX A;  1Z7M E;  2I49 A;  3HHG A;  2CZL A;  2QS1 A;  3R26 A;  5H8H B;  3T9U A;  3Q26 A;  1NMU A;  4F3B A;  1POT A;  4QFO A;  3CI8 A;  3OEL A;  3QUF A;  4HCW A;  3TTR A;  4ZE9 A;  4RA1 A;  5ITP A;  4OYV A;  3QXM A;  5L9O A;  3CR9 A;  3R6U A;  1MY4 A;  5HM4 B;  3PU5 A;  3LC8 A;  3MZB A;  5FTI A;  4ESW A;  3IB0 A;  3C35 A;  3VFJ A;  4DDD A;  5I57 A;  4JB7 A;  3TCG A;  1B4H A;  4O3A A;  1IXI A;  4THI A;  3H4Z A;  5HPQ A;  1YCJ A;  3TTL A;  4KQP A;  4FIM A;  2O69 A;  4XKP A;  1Y4T A;  2DVZ A;  1LBC A;  2OZZ A;  3MC2 A;  5H8F A;  1JEV A;  1B32 A;  4BDL A;  1SYH A;  1MY3 A;  3OOA A;  3TCH A;  4F18 A;  1QKA A;  5CBS A;  3TUS A;  2YPN A;  3KZG A;  2UXA A;  4Q5T A;  1M5E A;  3DP8 A;  1QKB A;  1A8F A;  2CMO A;  3MVY A;  1D9Y A;  4IO5 A;  3KBR A;  4TLL B;  2RC9 A;  2RIN A;  1RYO A;  3FJ7 A;  2H98 A;  2ZNU A;  3MQ9 A;  4R6Y A;  1QW0 A;  3KG2 A;  4JWX A;  3TTM A;  2W7Y A;  3PPO A;  5KCJ B;  1WVJ A;  4IY6 A;  1MS7 A;  2I3V A;  2XHD A;  3I6V A;  3T9V A;  4AB6 A;  1B52 A;  2H5Y A;  4ONY A;  4QF9 A;  4LON B;  3IX1 A;  4KPT A;  1B3L A;  2O1M A;  4AQ4 A;  2R9J A;  3OO9 A;  4MH5 A;  3OSR A;  5I2N A;  1B0L A;  3BBR A;  3KSX A;  3W15 C;  1D9V A;  3CG1 A;  3H6V A;  3IB2 A;  3IR1 A;  3MWB A;  2DVC A;  4U1O A;  1GV8 A;  2AL4 A;  3FVN A;  3KJT A;  4HTG A;  4YAH X;  5FHN A;  4PFY A;  3LSW A;  1JW4 A;  3PPN A;  4U4X A;  1B58 A;  4Q8R A;  4DE8 A;  4E0X A;  1SD3 A;  1UIV A;  2Q89 A;  1N76 A;  1B46 A;  2FA7 A;  2RC7 A;  3AXF A;  3CSB A;  3FUZ A;  2F78 A;  2ZYK A;  2I0B A;  3ECR A;  2KLF A;  3C36 A;  2PX1 A;  2ZMB A;  4RPO A;  4WEP A;  4EXL A;  1NNT A;  3OO7 A;  1NNF A;  1MXW A;  2I4C A;  4GXA A;  1A7L A;  2RC8 A;  1A8E A;  1QJM A;  4OEN A;  3PPP A;  4XIG Q;  5CM6 A;  1I6Q A;  3T9X B;  4BDQ A;  5I2K A;  2XX9 A;  1H76 A;  4QFP A;  3HV1 A; 
#chains in the Genus database with same CATH topology
 2DDK A;  4I1D A;  4RXL A;  3UA8 A;  5ET7 A;  5H8Q B;  3B6W A;  1BK4 A;  5DVF A;  4F22 A;  4FJP A;  4LVQ A;  2DQV A;  4R74 A;  4H8I A;  1GVC A;  3OEN A;  1HSJ A;  2KR0 A;  3FXU A;  5KZT A;  5BWJ A;  2F5X A;  1H44 A;  5CI5 A;  4OVP A;  4ZEK A;  2FNC A;  2NUV A;  4LN5 A;  3WAF A;  1Y3N A;  4P3L A;  2P0S A;  3V83 A;  1B3G A;  2FIX A;  1SW1 A;  5AA2 A;  3IO4 A;  4RK2 A;  5CMC A;  5ESY A;  3N5L A;  3VLU A;  1TT1 A;  1YPN A;  3OXN A;  1FCK A;  4GIZ A;  3V89 B;  4XFE A;  1ZLQ A;  1ZMG A;  3OO8 A;  3TDJ A;  1B1H A;  1B3H A;  2CZI A;  4NMY A;  1LFI A;  3GYY A;  4R6H A;  4POW A;  4ELQ A;  3HFU A;  3U72 A;  1D9Q A;  3IL1 B;  4U21 A;  3DP4 A;  3K1M A;  2ONK E;  1MRP A;  2DWJ A;  5EQ7 A;  4ELR A;  3JZJ A;  4NN3 A;  4PAI A;  1QGX A;  5EYF A;  1P1Q A;  1FSA A;  1S7Y A;  4M1V A;  1FPE A;  4PP0 A;  1BTJ A;  2VOZ A;  1MPC A;  3C32 A;  3N6T A;  2DWH A;  2WEF A;  3NOH A;  1EZO A;  3SEV A;  4YB7 A;  4RYA A;  2UVI A;  1P1N A;  3PMW A;  4IO3 A;  2WX9 A;  3EF7 A;  4OVJ A;  1PBP A;  3SES A;  3S9M C;  3RPW A;  3B6Q A;  4X8R A;  4KFQ A;  4OFJ A;  4U4S A;  4MEV A;  3TOD A;  1MXX A;  3SEU A;  4L17 A;  2VPN A;  3RT8 A;  3O6I A;  2HXR A;  3MW0 A;  1MDQ A;  3MJN A;  3IK6 B;  3K02 A;  2DP8 A;  2F7C A;  1FQE A;  3UN6 A;  2OBG A;  2ZZW A;  4OVT A;  5I58 A;  1FTL A;  3PGF A;  1XT8 A;  3M3K A;  4FE8 A;  3EHU A;  1PC3 A;  4N13 A;  3MP8 A;  1MY2 A;  3TZA A;  4N8Y A;  2FBP A;  3VVF A;  1H45 A;  1LBB A;  4PBQ A;  3OEM A;  2ALU A;  5DEX B;  4LZ8 A;  3IFA A;  4N81 A;  3RPL B;  1PB8 A;  4WED A;  3HCQ A;  4I8C A;  3MAM A;  3TFL A;  3LSX A;  1LAF E;  1IIW A;  4P0I A;  5TU0 A;  4NF8 A;  4X48 A;  4BDN A;  4LUB A;  1FPB A;  4GBV A;  4PET A;  3TKD A;  2VGQ A;  3K0V A;  2V93 A;  1GTK A;  2WYK A;  2I3W A;  1K9Y A;  4PDH A;  2Q88 A;  2FHY A;  2BJI A;  5B7D A;  3KEI A;  1FTM A;  3N6U A;  5AA2 D;  4NWC A;  2IEE A;  4N6K A;  2X7Q A;  2HZL A;  1SYI A;  3KSJ A;  3TMG A;  3KFM A;  4NF6 B;  3PUW E;  4YKK A;  2I4B A;  1YTV A;  4OEU A;  4R2F A;  5I2N B;  3RQT A;  2ZZX A;  2Z23 A;  5M2V A;  2QRY A;  1TFD A;  1NFT A;  1MPB A;  4EDP A;  4G61 A;  2XWK A;  5TP9 B;  5HBC A;  1IXG A;  5IZ1 A;  4M4G A;  3TTK A;  1CNQ A;  2XWI A;  1US4 A;  4BDM A;  1USY H;  1LB8 A;  5ICT A;  2E1S A;  5LDZ A;  3VXB A;  2QVR A;  1G0H A;  1A40 A;  4YMA A;  2WKY A;  3HPI A;  1UTH B;  3B7D A;  3TQW A;  4P47 A;  2QVU A;  1N3W A;  3CFZ A;  4PGN A;  4BDR A;  3GXA A;  4IGR A;  4ZE8 A;  3SEW A;  4X1D A;  3FXQ A;  2Y5K A;  1Q1K A;  3O6G A;  4IO6 A;  1XVY A;  2P3V A;  4F3P A;  1XI6 A;  4ZS9 A;  4PDD A;  1H3D A;  4PQJ A;  1NUW A;  3SEY A;  2A5T A;  1IUD A;  2ONS A;  3O2A A;  4IY5 A;  3RLF E;  1PBQ A;  3M3F A;  3QMF A;  4N17 A;  4GWO A;  1FTO A;  3MPL A;  4Z7E A;  2PMS A;  5AA3 A;  4MX6 A;  1RYX A;  4YKI A;  3CRB A;  5DEX A;  2MKZ A;  1B7Z A;  3IOV A;  2OLB A;  1B0H A;  3KOT A;  1SDX A;  3E78 A;  3T9H B;  3TEP A;  1JNF A;  1MM6 A;  1MXV A;  5AA4 A;  4AS5 A;  2YLN A;  4KYS A;  1I6A A;  3FV1 A;  3H6T A;  5I58 B;  4F3G A;  2QFL A;  2XXI A;  1IQ7 A;  3RTW B;  2DXY A;  4JWO A;  1WDN A;  2F7B A;  1NV4 A;  4MHF A;  1ZKB A;  2Z8D A;  3FVG A;  4KHZ E;  1Y9U A;  4N07 A;  1CE2 A;  1Y1M A;  5IAI A;  2Y7R A;  1MQH A;  2QSX A;  3CIJ A;  2O1L A;  5H8S A;  4GLI A;  3IO6 A;  4EQB A;  4UAC A;  4RJZ A;  1JVX A;  3T9U A;  4F3B A;  1EYJ A;  1NMU A;  1POT A;  3OEL A;  4RA1 A;  5ITP A;  2F3B A;  3CR9 A;  3LC8 A;  4ESW A;  3C35 A;  3VFJ A;  3TCG A;  1B4H A;  4KQP A;  1K9Z A;  4I40 A;  3TUS A;  1NV6 A;  3KZG A;  1A8F A;  4IO5 A;  1D9Y A;  4GWZ A;  2RIN A;  2H98 A;  3KG2 A;  3TTM A;  4PAF A;  4AB6 A;  2H5Y A;  4LON B;  4O94 A;  5IGA A;  3A29 A;  5I2N A;  1B0L A;  3BBR A;  2AL4 A;  4FBP A;  4PFY A;  3LSW A;  3PPN A;  1SD3 A;  4IR8 A;  1N76 A;  3JYR A;  2CZH A;  3ECR A;  4WEP A;  3C36 A;  3S9N C;  2I4C A;  5CM6 A;  1I6Q A;  4BDQ A;  1FBC A;  2F3D A;  5I3S A;  2I6E A;  4MLQ A;  4ZEB A;  4KD5 A;  3S2V A;  2ZNT A;  4ND9 A;  4O3C A;  1IXC A;  3FBP A;  2H99 A;  1MQD A;  5I84 A;  1JW5 A;  3T22 A;  3L6G A;  2FIE A;  4XTC Q;  3C33 A;  3G3J A;  3I3V A;  4KR5 A;  4C0R A;  4ESX A;  3A3U A;  3E3K A;  4R9F A;  1IMD A;  1KZ8 A;  4OXV A;  3FV2 A;  4QSC A;  2R8T A;  3ONM A;  5TPA A;  1YZ0 A;  1EYK A;  2ZYO A;  3H6W A;  1ZJL A;  4H45 A;  4QFN A;  1S9T A;  4GF8 A;  4XXU A;  1Y3Q A;  4BLA A;  1IMC A;  1UTB A;  5DVI A;  4F29 A;  3PMV A;  3JV9 A;  4H6D A;  3A09 A;  1R6Z A;  2UVG A;  3SEX A;  4N15 A;  4LAT A;  5IZ3 A;  1FPL A;  2PYY A;  3D1R A;  4R2B A;  4IGT A;  1O64 A;  5JTY A;  5IZZ A;  4E0W A;  2QS4 A;  3FVO A;  1FPJ A;  4O7I A;  4EXK A;  1B5J A;  1URD A;  3G7W A;  5A5X B;  2XXW A;  1B1X A;  4QFK A;  4ZZE A;  2AIX A;  2V84 A;  2RCA A;  4NWD A;  5CBR A;  4GL0 A;  5CMK A;  1JVY A;  3VVD A;  1B3E A;  2OCU A;  4FAT A;  4GBW A;  4F1Y A;  2KQZ A;  4YKP A;  5F1Q A;  3ISP A;  4RPN A;  2B3F A;  4GQO A;  1DCU A;  4H65 A;  4JSD A;  3E4R A;  1FW0 A;  3GBA A;  4ELO A;  4QRZ A;  3T0J A;  3ZKK A;  3B50 A;  4HE2 A;  2Q2C A;  3VE1 B;  3PTY A;  1LCT A;  5DW8 A;  1H43 A;  1QVS A;  2P2A A;  4DCY A;  1LLS A;  1FQC A;  4MAG A;  3IB1 A;  1DOT A;  5I7I A;  3H7M A;  5DTB A;  1ZBM A;  1XVX A;  3HO7 A;  3V5A A;  5I2K B;  3KN7 A;  1NUY A;  4UAB A;  3RYD A;  1FBF A;  2G93 A;  4LQ2 A;  1Y3P A;  4H67 A;  5TP9 A;  4EQ7 A;  3PPQ A;  1UQW A;  1B4Z A;  3CSG A;  4OVR A;  3U8Q A;  5I56 A;  3PUV E;  3GBB A;  1POY 1;  4ZZA A;  2XWV A;  1SI1 A;  3LBS A;  1IME A;  5K2Y A;  2OJT A;  4DXB A;  3O29 A;  1SQY A;  3CVG A;  3UIF A;  3G3H A;  2QJE A;  5ET8 A;  1MXZ A;  1NV7 A;  2P1S A;  4IO4 A;  4P11 A;  5H8F B;  3TTN A;  3PUY E;  1NI9 A;  2DE4 A;  4HCY A;  3V8X B;  3OMB A;  4OVS A;  4JXI A;  5DYH A;  5JEI A;  2QS3 A;  4PFB A;  3RPL A;  2B65 A;  2PCR A;  4NED A;  4R9G A;  3T93 B;  4OZ9 A;  2Y7W A;  3CG3 A;  2OWZ A;  1LBY A;  4X9T A;  4N8G A;  1INP A;  2O84 X;  3O9P A;  1ATG A;  5J16 A;  4EUO A;  4PE5 B;  1ZIU A;  1PB7 A;  4YB5 A;  3DP6 A;  1N04 A;  1P99 A;  4N6P A;  4H46 A;  1XHY A;  4UA8 A;  4OTE A;  1B40 A;  3VLW A;  4R72 A;  2V3T A;  5EQ8 A;  1IMB A;  2Q2A A;  1D3K A;  5AA4 B;  5F24 A;  2F7A A;  3ZSF A;  3G3I A;  5EYG A;  2H4I A;  2XXU A;  3T96 B;  3FIR A;  1R9Q A;  4OET A;  1IEJ A;  1XS5 A;  1ANF A;  2QS2 A;  5F7V A;  5DT6 A;  4C1U A;  2Q8J A;  4NF5 B;  2QPQ A;  4RNS A;  1DSN A;  2WYP A;  4QSD A;  2V3U A;  2I0C A;  1A54 A;  4NF6 A;  4Q30 B;  2VPO A;  1LAX A;  4XKQ A;  5EQ9 A;  1M5F A;  3UP9 A;  3IOT A;  4EF1 A;  4Z0I A;  1LB9 A;  1MM7 A;  3O97 A;  3IJX B;  1MG1 A;  3K01 A;  1LAH E;  3RY3 A;  1N84 A;  2PFY A;  5FBP A;  1M5C A;  1OLC A;  4DLD A;  4MJO A;  2DXR A;  4TLM B;  3MVW A;  3PUX E;  4OHN A;  4IO2 A;  1QUJ A;  1B5H A;  1SI0 A;  3L6H A;  4H5G A;  3LUZ A;  1LCF A;  1FJ9 A;  1FTA A;  3VV5 A;  3PMX A;  3EKI A;  3VXC A;  4O8M A;  4MMP A;  1XC1 A;  2NVU B;  4ZEF A;  5A5L A;  4NQ8 A;  3BKI B;  3HHG A;  1Z7M E;  2B4M A;  2CZL A;  3CI8 A;  3QUF A;  3QXM A;  3R6U A;  5HM4 B;  4P9K A;  4JB7 A;  1IXI A;  4N4U A;  5HPQ A;  2O69 A;  1NUX A;  4MNI A;  1Y4T A;  1MY3 A;  3OOA A;  3TCH A;  1QKA A;  5CBS A;  2UXA A;  4Q5T A;  1QKB A;  3KBR A;  3FJ7 A;  2ZNU A;  5EYH A;  4JWX A;  5KCJ B;  4IY6 A;  1MS7 A;  2XHD A;  4ONY A;  2O1M A;  4GWS A;  2R9J A;  4MH5 A;  1DBZ A;  1D9V A;  3CG1 A;  3H6V A;  3MWB A;  4E0X A;  1B46 A;  4WXJ A;  3FUZ A;  1FBH A;  2ZYK A;  1MXW A;  4OEN A;  4EXL A;  1A8E A;  1QJM A;  4QFP A;  1VFD A;  2REJ A;  1HSL A;  2WBB A;  3G3F A;  2XXX A;  2NWJ A;  2OWT A;  4KYD A;  1OQH A;  3U94 A;  2XA5 A;  3DLN A;  1DTZ A;  3VVE A;  5ET5 A;  3FJM A;  2VHA A;  2XWO A;  3MUQ A;  3N26 A;  1MH3 A;  3E9X A;  1FPD A;  4LZ5 A;  3DM0 A;  1G0I A;  2Y84 A;  2GQ1 A;  2VD3 A;  1LBW A;  5FHM A;  4PFT A;  4F3S A;  1B7U A;  1LAG E;  2PFZ A;  2UVJ A;  1SPI A;  1LFH A;  5I5P A;  1II5 A;  2VD2 A;  4K3F A;  4MLV A;  2XD3 A;  5EQA A;  3ODB A;  3SER A;  3T66 A;  4NF4 B;  2Y7K A;  4H5F A;  1Y1Z A;  2ESN A;  3K4U A;  4U2R A;  4OFO A;  4G68 C;  1VE4 A;  2DSF A;  5IKB A;  1FPK A;  5LOM A;  5H8N A;  1IMA A;  4OFL A;  4PE3 A;  2D5W A;  4GWW A;  3BFU A;  1NV2 A;  3TCF A;  3RUM A;  2F6G A;  3KC1 A;  2OWS A;  4GX4 A;  4FEB A;  2WBD A;  4Q0C A;  1OMP A;  1EZ9 A;  4OAN A;  4I3E A;  4PFI A;  1EU8 A;  2ANJ A;  5H8H A;  4OQO A;  3FXB A;  4HXV A;  2X26 A;  1TFA A;  4GXS B;  1A99 A;  1Y4C A;  2CEY A;  2XXV A;  4G68 A;  4GL8 A;  3THI A;  3IOR A;  4KI0 E;  4NGU A;  4HS7 A;  3KGC A;  4TQU Q;  4ZED A;  4BDO A;  4GVO A;  1AWB A;  2REG A;  4FEC A;  1URG A;  3CFX A;  1MPD A;  1B51 A;  3LUY A;  3IFC A;  1DTG A;  5EHM A;  4OVQ A;  2PT1 A;  3MBP A;  3PD9 A;  2XXP A;  2D3I A;  3TEL A;  1KWH A;  2ABH A;  2NOO A;  1B3F A;  3RGY A;  3MVZ A;  1O63 A;  4X1B A;  5KCJ A;  5TPA B;  3OSQ A;  1PB9 A;  2F36 A;  1GR2 A;  4G68 B;  3IOW A;  1I6B A;  4NX1 A;  1JEU A;  1JET A;  3PD8 A;  1R1N A;  3K6X A;  2RF1 A;  2F35 A;  1P1W A;  4F1U A;  4F19 A;  1AMF A;  3VDF A;  1T0K A;  1KA1 A;  5FHO A;  1DPP A;  1QUL A;  4MNP A;  2A5T B;  2YJP A;  2PVU A;  3S4U A;  1UTH A;  4P8B A;  4C1T A;  1LST A;  3Q28 A;  4JSO A;  2DE2 A;  1MY0 A;  2DWA A;  4TOZ A;  2M8C A;  3SKP A;  1VFE A;  3H03 A;  4ZDM A;  2I48 A;  2UYF A;  3D4G A;  5AA1 A;  1ELJ A;  1ZTY A;  1N7X A;  4NAP A;  5LTC A;  4PFW A;  3EHT A;  1MDP 1;  1AOV A;  1I69 A;  4G2Z A;  3VLV A;  4YU0 A;  2Z8F A;  4DXC A;  1JQF A;  1FPF A;  5H8N B;  1FBE A;  4RK9 A;  3CFL A;  4XEQ A;  3IOU A;  3EQ1 A;  1LFG A;  3PPR A;  2QVV A;  4DCX A;  3PV0 E;  1BIY A;  3MYU A;  2O7I A;  3OD7 A;  1J1N A;  3MVX A;  3O28 A;  3TTL A;  2FYI A;  3MP1 A;  3QK6 A;  2DWI A;  3FVK A;  3PUZ E;  1SBP A;  5L8D A;  1IZ1 A;  3B6T A;  1FQB A;  4GX6 A;  1B05 A;  4JWY A;  2Y5L A;  4N6D A;  2HAV A;  2HEU A;  1DPE A;  3A3C A;  1EZP A;  3TQL A;  2XXR A;  5ISU A;  3GZG A;  4XKR A;  3HST A;  2O68 A;  4QFL A;  3QYT A;  1R9L A;  2O51 A;  2RCB A;  3EPE A;  4PF6 A;  5A5X A;  1QUI A;  2DS9 A;  1B5I A;  4JVD A;  3TPA A;  3UOR A;  4DZ1 A;  3TAJ A;  2A5S A;  3EN3 A;  4YB6 A;  4EF2 A;  4GX3 A;  1GGG A;  3H06 B;  4U23 A;  3K6W A;  1RKM A;  2F8D A;  3SZP A;  4I9D A;  1MQI A;  4NHB A;  3KC0 A;  4OES A;  2HCA A;  1M5B A;  3O6H A;  1DMB A;  2UVH A;  3CHG A;  4KCC A;  2GFE A;  4P0G A;  4R73 A;  1N7W A;  2VP1 A;  1NH8 A;  1MXU A;  1AL3 A;  2HXW A;  2XX8 A;  4G77 A;  2HFB A;  3LSL A;  1URS A;  2JJK A;  3HN0 A;  5I59 B;  1VDW A;  3RN8 A;  4KCD A;  3C31 A;  3IAZ A;  2ZZV A;  1N0T A;  1YXI A;  3KN3 A;  3G3G A;  3K6U A;  5L9M A;  4G8M A;  1Q9D A;  1NNP A;  2Q74 A;  3ILT B;  1IMF A;  3FXR A;  2PBW A;  1SW2 A;  4NE4 A;  2THI A;  1SW5 A;  4GRK A;  1ZU0 A;  5H8H B;  2QS1 A;  4GWX A;  3R26 A;  4QFO A;  1NV0 A;  3TTR A;  4ZE9 A;  1MY4 A;  3B8B A;  3PU5 A;  5I57 A;  3MZB A;  5FTI A;  5IM2 A;  3IB0 A;  4P1E A;  1NV3 A;  4THI A;  4I3Y A;  4PCD A;  1LBC A;  2OZZ A;  1B32 A;  1SYH A;  4F18 A;  4MIJ A;  1M5E A;  2CMO A;  3MVY A;  4TLL B;  2RC9 A;  1RYO A;  1RDX A;  1QW0 A;  3PPO A;  3T9V A;  2I3V A;  1B52 A;  4AQ4 A;  3OO9 A;  3OSR A;  3IB2 A;  3KJT A;  4QBA A;  1JW4 A;  1FBG A;  1B58 A;  4DE8 A;  1UIV A;  3ZS6 A;  4EQ9 A;  3CSB A;  2F78 A;  2I0B A;  4RPO A;  2KLF A;  1NNT A;  1NNF A;  4GXA A;  3PPP A;  4XIG Q;  2XX9 A;  4MNC A;  1H76 A;  4PBH A;  2VT5 A;  3OEK A;  5AA2 B;  3K00 A;  2CEX A;  2X7P A;  3KOS A;  3SET A;  4LQ5 A;  5K2X A;  2Z22 A;  2Z8E A;  3K1N A;  3Q29 A;  1LEV A;  3E79 A;  4JDF A;  1MH4 A;  4AS4 A;  1S50 A;  4DI4 B;  1FBD A;  5EHS A;  2GHB A;  4X04 A;  2O7U A;  4QSE A;  4NF0 A;  2LAO A;  2FVZ A;  4P56 A;  2GRV A;  3QIM A;  3W9W A;  1VR5 A;  4NTL A;  3KN8 A;  1FTK A;  2HPG A;  2Q9T A;  4GFR A;  1LBX A;  4MF3 A;  5CRY A;  1BP5 A;  2XXQ A;  4JBZ A;  2IA4 A;  2ZXT A;  1NH7 A;  2R71 A;  3T1B A;  2OK2 A;  1EYI A;  2B3B A;  1SW4 A;  3U65 A;  4PF8 A;  4I62 A;  1D4N A;  1FTJ A;  3BIG A;  2DOJ A;  3Q25 A;  1MXY A;  2V3Q A;  3LV0 A;  4G8H A;  4RY1 A;  2XX7 A;  3MPK A;  5JK4 A;  2Q8M A;  4POX A;  3RTF B;  1IXH A;  4LZ7 A;  3SDF A;  1L5T A;  3K2D A;  3KBZ A;  4YKJ A;  5ET6 A;  1FPI A;  5CC2 A;  2L5V A;  3K1P A;  1IIT A;  4O3B A;  5I56 B;  3WAE A;  5L9S A;  3BFT A;  4OEV A;  3C4M A;  4OWD A;  3FJG A;  1LBV A;  3C9H A;  4ELP A;  3QUJ A;  1BKA A;  1TXF A;  1F9B A;  3ROJ A;  4PAK A;  1JW1 A;  4PFR A;  4KXP A;  5FTH A;  1OLA A;  3U1O A;  4AB5 A;  1B2H A;  4ZEI A;  4U22 A;  5H8Q A;  2HHM A;  3LSF B;  3MZ9 A;  1OVT A;  1VSO A;  4N91 A;  4U1Z A;  1TWY A;  4FOR A;  3C34 A;  1NL5 A;  1USY E;  3USD A;  1Q35 A;  4PFU A;  4F1V A;  3F11 A;  1P1O A;  2AL5 A;  1FPG A;  3EHS A;  4QXD A;  5JTY B;  1XOC A;  1Y20 A;  5CMB A;  3W9V A;  1SVX B;  2G29 A;  4IB2 A;  2R6G E;  5I59 A;  1Z7N E;  2PT2 A;  4O7M A;  4MFI A;  3FAT A;  1PEB A;  2H9B A;  4MBP A;  4NF4 A;  3KJ7 A;  1EH3 A;  3UK4 A;  5J1D A;  1PDA A;  1UTB B;  3BIH A;  4H8J A;  1FQA A;  4NF8 B;  5DVJ A;  1OVB A;  1LGB C;  1WOD A;  3ZKL A;  4WKM A;  2V4C A;  4R6K A;  1B9J A;  4GWY A;  1MQG A;  3FZV A;  3RNN A;  3M8U A;  5ELV A;  1FQD A;  2BJJ X;  3Q27 A;  4JVC A;  4QHQ A;  4H0W A;  1AH5 A;  4F39 A;  4GD5 A;  4OA4 A;  3RT6 B;  4LA9 A;  5CMM A;  4GOT A;  3OO6 A;  2P3N A;  3S9L C;  1YYZ A;  4DI3 D;  2XXK A;  1NV1 A;  4ISU A;  1US5 A;  4ZEC A;  1NKX A;  3I5O A;  2ZYM A;  1LBZ A;  2HAU A;  3HHF A;  2XD2 A;  4YZZ A;  1FQF A;  2V25 A;  4F31 B;  4PC9 A;  4PTK A;  4G8N A;  3G3K A;  4FED A;  2D21 A;  2AYS A;  2ZNS A;  3MZ1 A;  3QAX A;  4OER A;  2QL3 A;  1MY1 A;  3ILU B;  4R75 A;  4YMB A;  2Y7P A;  3D4C A;  3P7I A;  1HSE A;  2O6A A;  4GWU A;  2HZK A;  4G4P A;  3MST A;  2F6P A;  3K6V A;  5ICQ A;  1OIB A;  3UGW A;  1M5D A;  1QUK A;  3GLB A;  2DE3 A;  1AIV A;  2I58 A;  1P1U A;  3DEL B;  4ECF A;  5BUU A;  1FRP A;  3R7X A;  3N94 A;  3E13 X;  3M3L A;  3IJO B;  3U92 A;  3MP6 A;  4KYE A;  2CZK A;  4HW8 A;  2GH9 A;  4DIG A;  3FGS A;  5KDT B;  3O66 A;  1N3X A;  2QMW A;  4IO7 A;  2XXH A;  5B70 A;  1MQJ A;  2NXO A;  4XKN A;  2QMX A;  1O7T A;  4H1X A;  1BLF A;  3LR1 A;  3S9E A;  4NF5 A;  4XF5 A;  3TYH A;  1NV5 A;  4F2Q A;  2F34 A;  1JP4 A;  3QSL A;  4YIC A;  5KDT A;  2ZYN A;  1CB6 A;  2GHA A;  3U93 A;  4P1L A;  1DK4 A;  3FD3 A;  3FAS A;  5T3J A;  3H3G A;  1B7H A;  4F2O A;  2HQ0 A;  1NNK A;  2RKM A;  1YAE A;  1B6H A;  2E0S A;  2DYX A;  1OQG A;  2F97 A;  1UIU A;  2Y7I A;  3H6U A;  5ITO A;  2XXY A;  1FJ6 A;  2ONR A;  5AE4 A;  4JVI A;  4FAJ A;  2UYE A;  1A55 A;  4HE1 A;  5I57 B;  2XXT A;  4OMB A;  2H25 A;  4LP2 B;  2I49 A;  3Q26 A;  1KA0 A;  4HCW A;  4OYV A;  5L9O A;  1RDY A;  5IZ3 B;  4DDD A;  4O3A A;  1RDZ A;  3H4Z A;  1YCJ A;  4NG7 A;  4FIM A;  4XKP A;  2DVZ A;  3MC2 A;  5H8F A;  1JEV A;  4BDL A;  4HE0 A;  1FBP A;  2YPN A;  3DP8 A;  3MQ9 A;  4R6Y A;  2OX3 A;  2W7Y A;  1WVJ A;  3I6V A;  4QF9 A;  1NUZ A;  3IX1 A;  1B3L A;  4KPT A;  3KSX A;  3W15 C;  1GV8 A;  4U1O A;  3IR1 A;  2DVC A;  4PGP A;  2B4L A;  3FVN A;  4HTG A;  4YAH X;  5FHN A;  4U4X A;  4Q8R A;  2Q89 A;  4MCO A;  3AXF A;  2RC7 A;  4DXU A;  2FA7 A;  2PX1 A;  2ZMB A;  3OO7 A;  1A7L A;  2RC8 A;  5I2K A;  3T9X B;  3HV1 A; 
#chains in the Genus database with same CATH homology
 4I1D A;  2I6E A;  4MLQ A;  1VFD A;  3TMG A;  4RXL A;  3UA8 A;  2REJ A;  3OEK A;  1HSL A;  4ZEB A;  5H8Q B;  3G3F A;  2XXX A;  3B6W A;  4KD5 A;  5AA2 B;  2NWJ A;  3S2V A;  2OWT A;  3K00 A;  5DVF A;  4F22 A;  4KYD A;  2ZNT A;  1OQH A;  2X7P A;  3U94 A;  4FJP A;  3DLN A;  4LVQ A;  2DQV A;  4ND9 A;  4O3C A;  3KOS A;  4R74 A;  1DTZ A;  3SET A;  4H8I A;  1IXC A;  3OEN A;  4LQ5 A;  5K2X A;  1GVC A;  1HSJ A;  3VVE A;  3FXU A;  5KZT A;  2Z22 A;  2Z8E A;  3K1N A;  5BWJ A;  3Q29 A;  2F5X A;  3FJM A;  2H99 A;  2VHA A;  4JDF A;  1MH4 A;  3MUQ A;  3N26 A;  1MH3 A;  1MQD A;  1H44 A;  3E9X A;  5I84 A;  1S50 A;  4LZ5 A;  3S9N C;  1JW5 A;  3DM0 A;  4RJZ A;  3T22 A;  2Y84 A;  3L6G A;  5EHS A;  5CI5 A;  4XTC Q;  2VD3 A;  3C33 A;  3G3J A;  2GHB A;  2FNC A;  5FHM A;  4PFT A;  4ZEK A;  3I3V A;  2NUV A;  4F3S A;  4EQ9 A;  3WAF A;  1B7U A;  1LAG E;  2UVJ A;  1Y3N A;  4KR5 A;  2O7U A;  1LFH A;  2P0S A;  4QSE A;  1II5 A;  3V83 A;  4C0R A;  2VD2 A;  2LAO A;  4ESX A;  1B3G A;  2GRV A;  3A3U A;  4K3F A;  4MLV A;  3E3K A;  1SW1 A;  5AA2 A;  2XD3 A;  3IO4 A;  4R9F A;  3QIM A;  3W9W A;  3ODB A;  1VR5 A;  4RK2 A;  4NTL A;  5CMC A;  3KN8 A;  3N5L A;  3FV2 A;  4OXV A;  1FTK A;  3SER A;  3T66 A;  4NF4 B;  4QSC A;  3ONM A;  3VLU A;  1TT1 A;  2Q9T A;  4GFR A;  1YPN A;  5TPA A;  3OXN A;  4MF3 A;  1FCK A;  2Y7K A;  2ZYO A;  4H5F A;  1Y1Z A;  5CRY A;  1BP5 A;  2ESN A;  2XXQ A;  1ZJL A;  3H6W A;  3K4U A;  4GIZ A;  3V89 B;  1ZLQ A;  4QFN A;  1ZMG A;  3OO8 A;  1S9T A;  4GF8 A;  4JBZ A;  4XXU A;  2IA4 A;  3TDJ A;  2ZXT A;  1NH7 A;  4OFO A;  4U2R A;  1B1H A;  4G68 C;  1B3H A;  1Y3Q A;  2R71 A;  4BLA A;  4NMY A;  2OK2 A;  1LFI A;  1UTB A;  1VE4 A;  4R6H A;  2B3B A;  2DSF A;  5DVI A;  4POW A;  4ELQ A;  5IKB A;  5LOM A;  4F29 A;  3PMV A;  1SW4 A;  3JV9 A;  4H6D A;  4OFL A;  3A09 A;  5H8N A;  3U72 A;  2D5W A;  3IL1 B;  4U21 A;  1R6Z A;  3DP4 A;  3BFU A;  4I62 A;  5A5X A;  1D4N A;  1FTJ A;  3K1M A;  4WXJ A;  3RUM A;  3TCF A;  2F6G A;  2DOJ A;  2UVG A;  3SEX A;  2OWS A;  3Q25 A;  4LAT A;  2ONK E;  1MRP A;  1MXY A;  4FEB A;  4Q0C A;  2V3Q A;  1OMP A;  2PYY A;  1EZ9 A;  4G8H A;  2DWJ A;  4ELR A;  4RY1 A;  4R2B A;  4IGT A;  1O64 A;  2XX7 A;  5JTY A;  1EU8 A;  3JZJ A;  4E0W A;  2QS4 A;  2ANJ A;  3FVO A;  3MPK A;  5H8H A;  5JK4 A;  4OQO A;  4POX A;  3RTF B;  4EXK A;  5EYF A;  2X26 A;  1B5J A;  1IXH A;  1TFA A;  1URD A;  3G7W A;  5A5X B;  4LZ7 A;  1P1Q A;  2XXW A;  4GXS B;  1A99 A;  3SDF A;  1S7Y A;  1B1X A;  4QFK A;  4ZZE A;  4M1V A;  1L5T A;  2AIX A;  1Y4C A;  2V84 A;  4PP0 A;  2XXV A;  1BTJ A;  2RCA A;  2VOZ A;  4G68 A;  4NWD A;  1MPC A;  3C32 A;  5CBR A;  3N6T A;  4GL8 A;  4GL0 A;  5CMK A;  3THI A;  3IOR A;  2DWH A;  4KI0 E;  3K2D A;  1JVY A;  3VVD A;  1B3E A;  4HS7 A;  1EZO A;  2OCU A;  4XKR A;  4YB7 A;  4RYA A;  2UVI A;  3KGC A;  4TQU Q;  4YKJ A;  3SEV A;  4FAT A;  4ZED A;  4BDO A;  4GVO A;  4F1Y A;  1P1N A;  3PMW A;  5CC2 A;  4IO3 A;  3EF7 A;  2REG A;  3K1P A;  1IIT A;  4FEC A;  1URG A;  4O3B A;  4YKP A;  5F1Q A;  5I56 B;  3CFX A;  1MPD A;  4OVJ A;  1PBP A;  3WAE A;  1B51 A;  4RPN A;  3SES A;  2B3F A;  3LUY A;  4GQO A;  5L9S A;  3BFT A;  3S9M C;  4OEV A;  3RPW A;  3B6Q A;  3C4M A;  4H65 A;  4KFQ A;  3E4R A;  4JSD A;  4OFJ A;  4OWD A;  1DTG A;  3FJG A;  1FW0 A;  3C9H A;  4U4S A;  3TOD A;  1MXX A;  3GBA A;  5EHM A;  3SEU A;  3QUJ A;  4ELP A;  1BKA A;  4ELO A;  1TXF A;  5B70 A;  4QRZ A;  4L17 A;  1F9B A;  2PT1 A;  3RT8 A;  3ZKK A;  3MBP A;  3O6I A;  2Q2C A;  3VE1 B;  3PD9 A;  2XXP A;  1LCT A;  2D3I A;  3TEL A;  3MW0 A;  1H43 A;  1JW1 A;  1KWH A;  1MDQ A;  3MJN A;  1QVS A;  2ABH A;  3IK6 B;  3K02 A;  2NOO A;  1B3F A;  2DP8 A;  2F7C A;  2P2A A;  3RGY A;  4DCY A;  1FQE A;  3MVZ A;  2OBG A;  3UN6 A;  1O63 A;  4X1B A;  5KCJ A;  1LLS A;  1FQC A;  1FTL A;  5TPA B;  5I58 A;  3PGF A;  3OSQ A;  5FTH A;  1XT8 A;  1OLA A;  3M3K A;  5ELV A;  4FE8 A;  3U1O A;  4AB5 A;  1B2H A;  3IB1 A;  1DOT A;  3EHU A;  1PC3 A;  3H7M A;  4N13 A;  3MP8 A;  4ZEI A;  1PB9 A;  2F36 A;  1GR2 A;  4U22 A;  4PE5 B;  4DXU A;  1MY2 A;  4BDR A;  3TZA A;  5H8Q A;  5DTB A;  4G68 B;  3VVF A;  1ZBM A;  1I6B A;  1XVX A;  1JEU A;  3HO7 A;  3IOW A;  1JET A;  3V5A A;  1H45 A;  1LBB A;  3LSF B;  3MZ9 A;  3PD8 A;  1OVT A;  1R1N A;  1VSO A;  3OEM A;  3K6X A;  4U1Z A;  2RF1 A;  1TWY A;  2F35 A;  4FOR A;  1P1W A;  2ALU A;  1NL5 A;  3C34 A;  1USY E;  5I2K B;  5DEX B;  1Q35 A;  3USD A;  4PFU A;  4LZ8 A;  4F1U A;  4F19 A;  1PB8 A;  4WED A;  3HCQ A;  3KN7 A;  4I8C A;  4F1V A;  3MAM A;  3TFL A;  3LSX A;  1IIW A;  1LAF E;  3F11 A;  1AMF A;  4P0I A;  5TU0 A;  1P1O A;  2AL5 A;  4NF8 A;  3EHS A;  4X48 A;  4BDN A;  5JTY B;  1XOC A;  2G93 A;  1Y20 A;  1Y3P A;  4LQ2 A;  4LUB A;  5CMB A;  3VDF A;  1T0K A;  4H67 A;  5TP9 A;  3W9V A;  1SVX B;  2G29 A;  5FHO A;  4EQ7 A;  4IB2 A;  3PPQ A;  1UQW A;  1B4Z A;  3CSG A;  2R6G E;  5I59 A;  4PET A;  3TKD A;  2VGQ A;  1DPP A;  3K0V A;  2V93 A;  3U8Q A;  5I56 A;  3PUV E;  1Z7N E;  2PT2 A;  4MFI A;  3FAT A;  1POY 1;  1QUL A;  3GBB A;  4ZZA A;  1GTK A;  1PEB A;  2A5T B;  2H9B A;  2YJP A;  2I3W A;  2PVU A;  3ZS6 A;  5ICQ A;  1SI1 A;  2Q88 A;  4MBP A;  3S4U A;  4NF4 A;  3KJ7 A;  1EH3 A;  1UTH A;  3LBS A;  5K2Y A;  3UK4 A;  5J1D A;  4C1T A;  5B7D A;  1LST A;  1PDA A;  3Q28 A;  1UTB B;  2OJT A;  1FTM A;  3KEI A;  4H8J A;  1FQA A;  4JSO A;  4DXB A;  2DE2 A;  1MY0 A;  2DWA A;  3N6U A;  4NF8 B;  5AA2 D;  4NWC A;  2M8C A;  4TOZ A;  2IEE A;  3O29 A;  5AA4 A;  1SQY A;  3CVG A;  3SKP A;  3UIF A;  1VFE A;  2X7Q A;  1OVB A;  3H03 A;  5DVJ A;  1LGB C;  3G3H A;  1WOD A;  2HZL A;  2QJE A;  4WKM A;  3ZKL A;  4R6K A;  2I48 A;  1B9J A;  1SYI A;  2UYF A;  3KSJ A;  1MQG A;  4ZDM A;  3D4G A;  3FZV A;  3RNN A;  1MXZ A;  5AA1 A;  1ZTY A;  1ELJ A;  2BJJ X;  1FQD A;  3KFM A;  3M8U A;  3Q27 A;  4NF6 B;  3PUW E;  1AH5 A;  4H0W A;  4QHQ A;  4F39 A;  4YKK A;  2P1S A;  4GD5 A;  4IO4 A;  3RT6 B;  1N7X A;  2I4B A;  1YTV A;  4LA9 A;  4OEU A;  4GOT A;  4R2F A;  5CMM A;  3OO6 A;  5I2N B;  3RQT A;  4P11 A;  3S9L C;  4PFW A;  2Z23 A;  5H8F B;  3EHT A;  1MDP 1;  5M2V A;  3JYR A;  1AOV A;  2QRY A;  1TFD A;  1NFT A;  1MPB A;  3TTN A;  4EDP A;  1I69 A;  4ISU A;  1US5 A;  4ZEC A;  1NKX A;  3I5O A;  2ZYM A;  5TP9 B;  4G2Z A;  3PUY E;  3VLV A;  4YU0 A;  5HBC A;  2DE4 A;  4HCY A;  2Z8F A;  1IXG A;  2HAU A;  3V8X B;  3HHF A;  4DXC A;  1JQF A;  3OMB A;  2XD2 A;  4YZZ A;  4JXI A;  5H8N B;  4M4G A;  3TTK A;  5DYH A;  1FQF A;  2V25 A;  5JEI A;  4RK9 A;  2QS3 A;  4F31 B;  3CFL A;  2B65 A;  3IOU A;  3G3K A;  4FED A;  4G8N A;  4NED A;  1US4 A;  4BDM A;  3EQ1 A;  1USY H;  2D21 A;  2AYS A;  1LFG A;  1LB8 A;  3PPR A;  2ZNS A;  4R9G A;  5ICT A;  3MZ1 A;  2E1S A;  3QAX A;  3T93 B;  4OZ9 A;  3PV0 E;  1BIY A;  4DCX A;  2Y7W A;  3CG3 A;  4OER A;  3VXB A;  2O7I A;  4X9T A;  2QL3 A;  1MY1 A;  3ILU B;  1J1N A;  3OD7 A;  1A40 A;  4R75 A;  2O84 X;  4YMB A;  2Y7P A;  3MVX A;  3O9P A;  3D4C A;  1ATG A;  4YMA A;  2WKY A;  4EUO A;  3O28 A;  3HPI A;  1UTH B;  3B7D A;  1HSE A;  1ZIU A;  2O6A A;  2HZK A;  3P7I A;  1N3W A;  2FYI A;  1PB7 A;  3CFZ A;  3MP1 A;  3QK6 A;  4G4P A;  2F6P A;  3K6V A;  4YB5 A;  2DWI A;  3DP6 A;  3GXA A;  1N04 A;  1P99 A;  1OIB A;  3FVK A;  1M5D A;  1XHY A;  4IGR A;  4N6P A;  1QUK A;  4ZE8 A;  3SEW A;  3UGW A;  4UA8 A;  3PUZ E;  4X1D A;  3FXQ A;  4OTE A;  1SBP A;  1B40 A;  3GLB A;  1Q1K A;  2DE3 A;  4R72 A;  2V3T A;  3O6G A;  1IZ1 A;  3B6T A;  5L8D A;  3VLW A;  1FQB A;  2Q2A A;  2I58 A;  4IO6 A;  1XVY A;  1AIV A;  1P1U A;  4F3P A;  1B05 A;  3DEL B;  4JWY A;  4ECF A;  1D3K A;  5AA4 B;  5BUU A;  4ZS9 A;  2F7A A;  2HAV A;  3R7X A;  3ZSF A;  3N94 A;  1H3D A;  3E13 X;  4PQJ A;  3G3I A;  3M3L A;  2HEU A;  3IJO B;  1DPE A;  3A3C A;  3MP6 A;  3U92 A;  1EZP A;  3SEY A;  2A5T A;  1IUD A;  2ONS A;  3O2A A;  4KYE A;  3TQL A;  2XXR A;  2H4I A;  2XXU A;  3T96 B;  4HW8 A;  5ISU A;  3FIR A;  2GH9 A;  4DIG A;  1R9Q A;  3FGS A;  5KDT B;  3O66 A;  1N3X A;  4IY5 A;  3RLF E;  1PBQ A;  2QMW A;  3GZG A;  2XXH A;  3HST A;  2O68 A;  4IO7 A;  4OET A;  4QFL A;  3QYT A;  1MQJ A;  1R9L A;  1IEJ A;  2NXO A;  2O51 A;  2RCB A;  1XS5 A;  1ANF A;  2QS2 A;  3EPE A;  1QUI A;  2DS9 A;  3M3F A;  4XKN A;  5DT6 A;  5F7V A;  2QMX A;  1B5I A;  4GWO A;  4C1U A;  1O7T A;  4H1X A;  2Q8J A;  1FTO A;  1BLF A;  3MPL A;  4NF5 B;  3TPA A;  2QPQ A;  4RNS A;  3UOR A;  1DSN A;  3TAJ A;  4DZ1 A;  4Z7E A;  2PMS A;  2A5S A;  3EN3 A;  5AA3 A;  3LR1 A;  2V3U A;  4QSD A;  2I0C A;  3S9E A;  4NF5 A;  3TYH A;  4YB6 A;  1RYX A;  1A54 A;  4YKI A;  3CRB A;  4EF2 A;  1GGG A;  3H06 B;  4NF6 A;  4Q30 B;  2F34 A;  4U23 A;  4F2Q A;  1LAX A;  3K6W A;  3QSL A;  4XKQ A;  4YIC A;  1M5F A;  5DEX A;  1RKM A;  1B7Z A;  3IOV A;  2OLB A;  1B0H A;  3UP9 A;  5KDT A;  2F8D A;  3IOT A;  3KOT A;  1SDX A;  1MQI A;  2ZYN A;  4I9D A;  1CB6 A;  4EF1 A;  4Z0I A;  1LB9 A;  2GHA A;  4OES A;  3U93 A;  2HCA A;  1M5B A;  3O6H A;  3T9H B;  1DMB A;  1JNF A;  1MM7 A;  2UVH A;  3O97 A;  4KCC A;  1MM6 A;  3TEP A;  2GFE A;  3IJX B;  4P0G A;  4R73 A;  1MXV A;  1MG1 A;  1N7W A;  2VP1 A;  1NH8 A;  3FD3 A;  1MXU A;  1LAH E;  3K01 A;  1AL3 A;  2HXW A;  3FAS A;  3RY3 A;  2YLN A;  2XX8 A;  4KYS A;  1I6A A;  1N84 A;  2HFB A;  3FV1 A;  1M5C A;  1OLC A;  3H6T A;  3LSL A;  4G77 A;  5I58 B;  4DLD A;  1URS A;  4F3G A;  3HN0 A;  2XXI A;  3H3G A;  2DXR A;  4TLM B;  3MVW A;  5I59 B;  3PUX E;  3RN8 A;  4KCD A;  1B7H A;  4F2O A;  1IQ7 A;  2DXY A;  2HQ0 A;  3C31 A;  3IAZ A;  1NNK A;  3RTW B;  4OHN A;  2RKM A;  1N0T A;  4JWO A;  1WDN A;  1YAE A;  2F7B A;  4IO2 A;  1ZKB A;  3KN3 A;  1B6H A;  1QUJ A;  3G3G A;  3K6U A;  1B5H A;  1SI0 A;  3L6H A;  5L9M A;  2E0S A;  4G8M A;  2Z8D A;  3FVG A;  4H5G A;  2DYX A;  4KHZ E;  1OQG A;  2F97 A;  1LCF A;  1Y9U A;  1UIU A;  4N07 A;  2Y7I A;  1CE2 A;  1NNP A;  1Y1M A;  2XXY A;  3H6U A;  5ITO A;  3VV5 A;  3PMX A;  5IAI A;  2Y7R A;  3TQW A;  2ONR A;  1MQH A;  3ILT B;  3VXC A;  2QSX A;  3CIJ A;  5AE4 A;  2NVU B;  1XC1 A;  3FXR A;  2UYE A;  2O1L A;  1A55 A;  4ZEF A;  4FAJ A;  5I57 B;  2PBW A;  5H8S A;  2XXT A;  4GLI A;  4OMB A;  3IO6 A;  1SW2 A;  4EQB A;  2H25 A;  4NE4 A;  4UAC A;  2THI A;  1SW5 A;  4GRK A;  1ZU0 A;  3BKI B;  4LP2 B;  1JVX A;  1Z7M E;  2I49 A;  3HHG A;  2CZL A;  2QS1 A;  3R26 A;  5H8H B;  3T9U A;  3Q26 A;  1NMU A;  4F3B A;  1POT A;  4QFO A;  3CI8 A;  3OEL A;  3QUF A;  4HCW A;  3TTR A;  4ZE9 A;  4RA1 A;  5ITP A;  4OYV A;  3QXM A;  5L9O A;  3CR9 A;  3R6U A;  1MY4 A;  5HM4 B;  3PU5 A;  3LC8 A;  3MZB A;  5FTI A;  4ESW A;  3IB0 A;  3C35 A;  3VFJ A;  4DDD A;  5I57 A;  4JB7 A;  3TCG A;  1B4H A;  4O3A A;  1IXI A;  4THI A;  3H4Z A;  5HPQ A;  1YCJ A;  3TTL A;  4KQP A;  4FIM A;  2O69 A;  4XKP A;  1Y4T A;  2DVZ A;  1LBC A;  2OZZ A;  3MC2 A;  5H8F A;  1JEV A;  1B32 A;  4BDL A;  1SYH A;  1MY3 A;  3OOA A;  3TCH A;  4F18 A;  1QKA A;  5CBS A;  3TUS A;  2YPN A;  3KZG A;  2UXA A;  4Q5T A;  1M5E A;  3DP8 A;  1QKB A;  1A8F A;  2CMO A;  3MVY A;  1D9Y A;  4IO5 A;  3KBR A;  4TLL B;  2RC9 A;  2RIN A;  1RYO A;  3FJ7 A;  2H98 A;  2ZNU A;  3MQ9 A;  4R6Y A;  1QW0 A;  3KG2 A;  4JWX A;  3TTM A;  2W7Y A;  3PPO A;  5KCJ B;  1WVJ A;  4IY6 A;  1MS7 A;  2I3V A;  2XHD A;  3I6V A;  3T9V A;  4AB6 A;  1B52 A;  2H5Y A;  4ONY A;  4QF9 A;  4LON B;  3IX1 A;  4KPT A;  1B3L A;  2O1M A;  4AQ4 A;  2R9J A;  3OO9 A;  4MH5 A;  3OSR A;  5I2N A;  1B0L A;  3BBR A;  3KSX A;  3W15 C;  1D9V A;  3CG1 A;  3H6V A;  3IB2 A;  3IR1 A;  3MWB A;  2DVC A;  4U1O A;  1GV8 A;  2AL4 A;  3FVN A;  3KJT A;  4HTG A;  4YAH X;  5FHN A;  4PFY A;  3LSW A;  1JW4 A;  3PPN A;  4U4X A;  1B58 A;  4Q8R A;  4DE8 A;  4E0X A;  1SD3 A;  1UIV A;  2Q89 A;  1N76 A;  1B46 A;  2FA7 A;  2RC7 A;  3AXF A;  3CSB A;  3FUZ A;  2F78 A;  2ZYK A;  2I0B A;  3ECR A;  2KLF A;  3C36 A;  2PX1 A;  2ZMB A;  4RPO A;  4WEP A;  4EXL A;  1NNT A;  3OO7 A;  1NNF A;  1MXW A;  2I4C A;  4GXA A;  1A7L A;  2RC8 A;  1A8E A;  1QJM A;  4OEN A;  3PPP A;  4XIG Q;  5CM6 A;  1I6Q A;  3T9X B;  4BDQ A;  5I2K A;  2XX9 A;  1H76 A;  4QFP A;  3HV1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...