1I6AA

Crystal structure of the oxidized form of oxyr
Total Genus 62
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
62
sequence length
212
structure length
212
Chain Sequence
b'ETMSGPLHIGLIPTVGPYLLPHIIPMLHQTFPKLEMYLHEAQTHQLLAQLDSGKLDAVILALVKESEAFIEVPLFDEPMLLAIYEDHPWANREAVPMADLAGEKLLMLEDGHCLRDQAMGFCFEAGADEDTHFRATSLETLRNMVAAGSGITLLPALAVPPERKRDGVVYLPAIKPEPRRTIGLVYRPGSPLRSRYEQLAEAIRARMDGHFD'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HYDROGEN PEROXIDE-INDUCIBLE GENES ACTIVATOR
publication title Structural basis of the redox switch in the OxyR transcription factor.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transcription
total genus 62
structure length 212
sequence length 212
ec nomenclature
pdb deposition date 2001-03-02
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 1i6aA01
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 1i6aA02
4F3BA 3MUQA 2IA4A 1H45A 1YAEA 2I4BA 3SKPA 1WODA 2D21A 2F34A 1Y20A 2P1SA 1B3FA 4U1OA 1DOTA 4PE5B 1B9JA 1XHYA 1B5JA 3RN8A 4E0WA 4C0RA 2ALUA 3PPOA 5AA4A 1SVXB 5H8HA 1A8EA 3KJTA 2HXWA 4ZEFA 4FAJA 5KZTA 1ZMGA 1Z7NE 1LFIA 3KEIA 4BDOA 3RT6B 3FJGA 1N7WA 2Q88A 4NF8A 4QFOA 3N6UA 1AH5A 3U8QA 4N13A 1QJMA 2F7AA 3BFUA 5H8QB 1H3DA 1Y3NA 4NF6A 4PFWA 3TYHA 2QRYA 5I2NB 2QSXA 4YKKA 2Q2CA 1R9QA 2DSFA 1KWHA 4OXVA 3MVWA 4F39A 4H5FA 1UIVA 3K02A 4JDFA 1MY0A 4P0IA 1UTBB 4F3SA 4QRZA 3KN3A 1FCKA 2LAOA 3T66A 5CMKA 2DE4A 4WXJA 1B5HA 1B0LA 3T93B 1VFDA 1ZJLA 1T0KA 1NNFA 2OWSA 1UQWA 3K0VA 2HZLA 3E9XA 4DIGA 4M4GA 3T9XB 1LCFA 1MRPA 4MLVA 3CSGA 2GH9A 3U94A 3FVGA 3I5OA 3DP8A 1NKXA 3Q28A 3IX1A 2PX1A 3TPAA 2QMWA 3TODA 2DVZA 2Y7WA 3E13X 3K6WA 2P0SA 3KG2A 5DVJA 5KDTB 1Y3PA 1NH8A 2ONRA 1HSLA 2I0CA 4H0WA 2ONKE 4QFKA 4NF6B 4X9TA 2XHDA 2F5XA 4NF5A 5HPQA 5AE4A 4RJZA 1LAFE 1JVXA 5JK4A 3N94A 2V3QA 4RA1A 5AA2A 4N6PA 2XXTA 2RC9A 3RTWB 3K1MA 2R71A 4FEBA 3V83A 1LFHA 3HHFA 1O7TA 3A09A 5TU0A 3KBRA 3EPEA 1PB9A 2FA7A 3FVKA 2ABHA 3QSLA 4F22A 1AOVA 2QS4A 1IEJA 4IO5A 1WVJA 4G77A 3PV0E 3PPPA 1MM7A 3TAJA 3ODBA 3ILTB 4R9GA 1MXVA 1R6ZA 4MLQA 1AIVA 1Q35A 4O3BA 4PFYA 1H76A 2HAUA 4FEDA 5CC2A 3G3HA 3B6WA 3MAMA 3PUYE 5ICQA 4I8CA 3I6VA 3IL1B 1GV8A 3G7WA 3JZJA 4I62A 3QUJA 4AB5A 4BLAA 4Q8RA 3K6UA 4RPOA 3FV1A 1M5EA 3TCHA 4POWA 5FTIA 4O3CA 1Z7ME 1USYE 4Q0CA 1MPCA 1ZLQA 3M3FA 1B4HA 4OERA 1XOCA 1SYHA 1LSTA 4UA8A 2DWIA 2OBGA 1EZ9A 4JSOA 1M5DA 1UTHA 3QUFA 3VDFA 4LA9A 4OEVA 3ECRA 4F3PA 2X26A 3VVEA 1MXWA 2YJPA 3PD8A 5CMCA 4F2OA 3FXUA 3TFLA 2I58A 3RTFB 4OWDA 2UXAA 2DXRA 3VVDA 1H43A 4PFTA 3H6WA 1XT8A 3FVNA 1FTOA 1JW5A 3Q25A 1YTVA 3M3KA 2Q8JA 3RLFE 4F29A 2XX7A 4ONYA 4JWXA 1FQAA 4FIMA 4QFNA 3MBPA 2H5YA 1WDNA 4R2FA 1I6BA 3O66A 3G3KA 5JTYA 4TLMB 2OCUA 4OVJA 4U4SA 2PBWA 3TTKA 3MWBA 1XC1A 4YKPA 1MH4A 1NL5A 1DPEA 2F6GA 2HAVA 5KCJA 3LBSA 4DCXA 1URDA 3O28A 1MY2A 4G2ZA 1VR5A 4WEDA 1MM6A 2RCAA 3PMWA 2BJJX 2OK2A 3LR1A 5FHNA 5IKBA 3G3GA 4EQBA 2FNCA 3PPQA 5I56A 1IXCA 1R1NA 3VVFA 1ZIUA 1BTJA 1RYXA 2RCBA 1H44A 1FQEA 2HEUA 4Q5TA 4QSCA 3KSXA 3WAEA 2RF1A 1IQ7A 4KFQA 4OESA 2REJA 1D9YA 4JWYA 4KD5A 4IO6A 4G68A 2AL4A 1LAXA 4R6YA 3F11A 3TCFA 5A5XB 1D3KA 1DSNA 2Q9TA 2V93A 3T96B 1QW0A 2GRVA 2F8DA 1N3WA 3A3CA 4R75A 3KJ7A 3KOSA 1QUJA 3S9EA 3SESA 4I1DA 2XXHA 4OEUA 3UK4A 2UVGA 3TKDA 1UIUA 3UP9A 1SW1A 4GVOA 4U1ZA 2ZNSA 1FQBA 4F2QA 4RPNA 2AL5A 1MXUA 2B3BA 4EQ7A 3KN7A 1NNTA 4RK2A 3MP8A 1LB8A 3S2VA 1II5A 1SW5A 5ELVA 5I57A 1B3GA 3E3KA 1ANFA 4RXLA 1A7LA 3DP4A 1O63A 3PPRA 1P1WA 2Y7RA 3MVZA 1QUIA 3UN6A 1OQHA 1B32A 3QIMA 4H67A 2CZLA 4Q30B 3FZVA 3M8UA 1FQDA 5TP9A 1NMUA 4ELRA 3FV2A 4ESXA 4G68B 2W7YA 4GWOA 5DTBA 1SI0A 5I58A 5DEXA 4OZ9A 3SEVA 2OZZA 4EDPA 1OIBA 3UIFA 3UA8A 4FJPA 4YU0A 5CI5A 5L8DA 3K2DA 3K4UA 1FQCA 3GXAA 4ZS9A 1LAGE 3SDFA 2HZKA 5TPAA 5I84A 3CR9A 1Y4TA 1A55A 2I3WA 4R6KA 1B3EA 2WKYA 3RUMA 1M5FA 2PMSA 1R9LA 3IORA 3IJXB 3CFZA 1BP5A 4QSDA 3HN0A 3HHGA 4THIA 4GQOA 1IIWA 1YCJA 2F78A 5F1QA 3H3GA 1BIYA 3LSWA 5EHSA 4HCYA 3K1PA 2DWAA 1NNPA 4AB6A 1B3HA 3TQLA 5H8NB 4BDNA 3T9VA 4QSEA 4LZ5A 3IO6A 1CB6A 4H65A 2QJEA 4WEPA 1LAHE 1SYIA 3CFLA 1MDP1 1Y9UA 3UORA 3TTRA 5L9SA 3FATA 3OO8A 2UVJA 5AA4B 3B6QA 5H8HB 2UVIA 4ZDMA 4U2RA 3QXMA 4O3AA 3L6HA 1IUDA 4YB6A 1B40A 1XVXA 2F7BA 1M5CA 2I49A 3MC2A 4OETA 4NF8B 1Y1ZA 2ESNA 4X48A 3OXNA 4XKRA 2UYFA 5CBRA 5TPAB 1PBQA 4HW8A 4ZEIA 2DVCA 5CBSA 2O84X 2O1MA 2XXPA 1N0TA 4NF4A 3OO7A 5I2KA 3MJNA 3HPIA 1RKMA 1SD3A 2VP1A 1MQDA 2XD3A 4KHZE 3S9NC 3RY3A 3FIRA 3PUZE 5LOMA 1QKAA 1AL3A 2D3IA 1SQYA 3PUVE 1B0HA 1B5IA 3GLBA 3N26A 1I6AA 4JSDA 4YKJA 1MXZA 4EQ9A 3HSTA 1MS7A 4F1YA 5M2VA 2Z8FA 2QS3A 3A3UA 3RT8A 1SW4A 2I4CA 4GXAA 3QYTA 3OO9A 1P1OA 5ITPA 3VXCA 5FHMA 3S9MC 5BWJA 4OQOA 2I3VA 1Y3QA 5AA3A 2M8CA 1YPNA 3IO4A 3O29A 3G3JA 4OMBA 2ZXTA 1FW0A 2QS2A 2XXVA 5ITOA 1IXGA 1M5BA 1MQIA 3S9LC 3GBAA 3ZS6A 4ELQA 5J1DA 5CM6A 5CRYA 2F35A 4C1UA 3H4ZA 1JW4A 1XS5A 1S9TA 4X1DA 2NVUB 3AXFA 1Y4CA 2VHAA 3TEPA 1P1QA 4NF5B 3FXRA 3U72A 1TFDA 3IJOB 2B3FA 3PUXE 2DOJA 4OTEA 4G8HA 3Q26A 3O9PA 4GL8A 1EH3A 4TOZA 4LQ5A 3H06B 4YB5A 2XXUA 5AA2B 1MXXA 1MG1A 4NWCA 5B7DA 2F7CA 1F9BA 4R72A 3MZBA 2PYYA 4H8IA 3CI8A 3MZ1A 3V5AA 4OYVA 4JB7A 4ZEKA 4HCWA 1Q1KA 3PMVA 1USYH 4MF3A 3EF7A 1OVTA 3C36A 1MPDA 4GRKA 3IAZA 3K6VA 3V89B 2Q2AA 5K2XA 4PETA 2P2AA 4G4PA 5I59A 3W9VA 3QAXA 4UACA 4C1TA 4TQUQ 2XXRA 4KCDA 1I6QA 4PQJA 2DXYA 3TZAA 4KCCA 3M3LA 3P7IA 3OEKA 4OFLA 1BKAA 4ZEDA 2GHBA 3C31A 2VGQA 2ZYKA 2YPNA 4XTCQ 1FTJA 3MQ9A 4H8JA 2DS9A 2XX8A 3EN3A 1FTKA 3THIA 5AA2D 5EHMA 4EUOA 2O69A 4DDDA 3C33A 2I0BA 2PT1A 4DZ1A 4JBZA 1UTHB 3FJ7A 3CG3A 2DQVA 4AQ4A 3U92A 3O6IA 1O64A 4HTGA 3KGCA 4IO4A 1B7UA 5H8SA 1SI1A 4U4XA 3MVYA 3D4GA 2G29A 5FHOA 4H1XA 4YICA 3H7MA 4IGRA 2KLFA 1MY4A 3GBBA 3ZKKA 2XXWA 1D4NA 4ESWA 4GXSB 1A54A 4XKPA 3SEYA 4MFIA 2Q89A 1JVYA 4QF9A 3K00A 3LC8A 3KFMA 5JTYB 3G3IA 4GLIA 3OEMA 2D5WA 1TXFA 2I48A 4BDRA 3JYRA 3R7XA 1DPPA 5KCJB 1GTKA 1VE4A 1GR2A 1US5A 2QS1A 5H8QA 4E0XA 4TLLB 3TUSA 3R26A 1OQGA 2R9JA 4JWOA 2O7IA 3K01A 1US4A 4EXLA 1B05A 4FE8A 1B52A 3VV5A 5I56B 3LSXA 3HCQA 4DE8A 1P1NA 2ZYOA 4LP2B 3TTLA 5FTHA 3IOUA 3OD7A 3VE1B 2RKMA 2YLNA 3K6XA 1BLFA 3MVXA 2THIA 2NOOA 3O2AA 4QFPA 3USDA 4U21A 2ONSA 1JW1A 1PB8A 1OLCA 3TDJA 4DXCA 4LQ2A 4LUBA 1MY1A 2UVHA 4KYDA 2XXXA 2OJTA 2IEEA 3DLNA 4YMAA 3SERA 2QPQA 1LBCA 1GVCA 2E0SA 2NXOA 1Y1MA 1OLAA 3H6VA 2V25A 5B70A 4FATA 3N6TA 4U22A 5KDTA 3TTNA 3T9HB 1OMPA 4P11A 1I69A 1NNKA 2Z8DA 3O6HA 1S7YA 3O97A 1MQJA 1JETA 4DXBA 1N76A 4ZZAA 3FASA 1P99A 4NE4A 1HSJA 3C4MA 5HM4B 4QHQA 1JQFA 2RINA 2ZYMA 2VD3A 3O6GA 3N5LA 4F31B 5I57B 3FGSA 4GD5A 4FORA 2RC8A 3KZGA 4NEDA 3W9WA 2XXQA 4ZE8A 3T22A 4HS7A 3CFXA 3DM0A 2HQ0A 1QKBA 3PD9A 1CE2A 3PPNA 4ZE9A 1NFTA 1SW2A 2HCAA 1JEVA 4GF8A 4KYEA 5DT6A 2VOZA 3U93A 4EF2A 1EU8A 5IAIA 1MQGA 2Y7PA 3H6UA 3RGYA 3BFTA 4POXA 3FJMA 4XIGQ 5TP9B 4QFLA 4IO3A 3TELA 3IB0A 4OFOA 4XXUA 1MDQA 3ZKLA 2I6EA 4ZZEA 5I58B 5DEXB 3ILUB 2A5TA 3PUWE 5ICTA 4G8NA 4R73A 3SEUA 1QVSA 4F18A 2Z22A 1DTZA 1N3XA 5L9MA 4NWDA 3C32A 1A40A 5CMMA 2OWTA 2XD2A 3KSJA 3U1OA 3LSFB 1SDXA 5ISUA 4KPTA 1B6HA 2NUVA 1EZPA 2E1SA 2R6GE 5EYFA 1ATGA 4IO7A 3DP6A 1B4ZA 2V3UA 2O6AA 2ANJA 4XKNA 3LUYA 2XXYA 4GL0A 5DYHA 1JNFA 3WAFA 4L17A 1TT1A 5CMBA 4YKIA 4R6HA 3RNNA 3RPWA 2O51A 4RYAA 4EF1A 4GOTA 2CMOA 4IY6A 3LSLA 3MP1A 2ZMBA 5BUUA 1B7ZA 3ONMA 1SBPA 3H03A 2QL3A 2X7QA 3R6UA 4F1VA 4PP0A 1LCTA 2H99A 3EHSA 2F6PA 2X7PA 5DVFA 4Z7EA 2DE3A 4KQPA 4N07A 3K1NA 2A5TB 1A8FA 1TWYA 4F1UA 2DYXA 1ZU0A 2Y7KA 5HBCA 4F3GA 3H6TA 4OHNA 3HO7A 1QULA 2H4IA 1L5TA 1XVYA 1ZKBA 3MZ9A 2HFBA 3SETA 3CG1A 3VLUA 3MPKA 1NH7A 4JXIA 5H8FA 1EZOA 4G68C 1MPBA 2PT2A 1POY1 3TMGA 2Y7IA 3KOTA 3IR1A 2ZNUA 4NF4B 3OSQA 4ELPA 4RK9A 5I2KB 3IOTA 4K3FA 1B3LA 3DELB 1MQHA 1B7HA 1B51A 4KR5A 3G3FA 2B65A 3UGWA 1FTMA 1OVBA 1P1UA 4WKMA 4ISUA 2G93A 3D4CA 4KI0E 2DE2A 1LFGA 4ZEBA 2RC7A 2O1LA 3OOAA 4YAHX 3IOVA 4BDQA 3C34A 2VD2A 5L9OA 2DWHA 3TTMA 4GIZA 1PEBA 2O68A 1B58A 3OELA 1RYOA 1DMBA 1LBBA 3OENA 2ZYNA 3Q29A 4X1BA 5JEIA 1LLSA 5A5XA 2Y84A 3EHUA 3IOWA 3CRBA 3PMXA 3VFJA 4DXUA 3B6TA 3PU5A 4DCYA 2GFEA 4OFJA 4LZ7A 3MP6A 1VSOA 2AYSA 5AA1A 1N7XA 1URGA 2OLBA 2H25A 2V84A 3C35A 2O7UA 3CSBA 1LGBC 4YB7A 2NWJA 2XX9A 3ZSFA 3FVOA 3PGFA 3SEXA 5H8FB 1IITA 4LATA 4ND9A 1JEUA 4R9FA 1PDAA 4R74A 1IXHA 3CIJA 4RY1A 3MW0A 3IB2A 3FD3A 4FECA 3V8XB 3OSRA 3B7DA 3JV9A 5DVIA 1B2HA 1VFEA 2PVUA 2Z8EA 3W15C 4IO2A 3VLWA 2H98A 4KYSA 4H6DA 4LZ8A 3FXQA 1LB9A 3EHTA 4OENA 2A5SA 1J1NA 4P0GA 2F97A 4ZECA 1B1HA 3I3VA 1B1XA 3E4RA 3TQWA 3KN8A 2Z23A 4DLDA 4R2BA 1N04A 4ELOA 1IZ1A 4IY5A 4PFUA 4BDLA 3BKIB 3FUZA 3L6GA 3S4UA 1MH3A 3Q27A 1S50A 1TFAA 2F36A 2REGA 3VLVA 5I59B 3OO6A 2FYIA 5K2YA 2GHAA 4H5GA 4IB2A 3SEWA 1ELJA 2ZNTA 1AMFA 4LONB 4MBPA 2H9BA 1PBPA 1FTLA 5I2NA 2DP8A 4NTLA 4LVQA 1HSEA 1MY3A 1DTGA 1ZBMA 1IXIA 4U23A 1B46A 3IB1A 3VXBA 3CVGA 4Z0IA 1ZTYA 1A99A 5F7VA 1FQFA 4BDMA 1URSA 4ECFA 3GZGA 4F19A 4YMBA 1PC3A 1UTBA 3T9UA 4IGTA 3QK6A 4NMYA 3MPLA 1N84A 2QMXA 4G8MA 2XXIA 1QUKA 1PB7A 4RNSA 4I9DA 1POTA 2AIXA 2DWJA 3TCGA 2UYEA 4YZZA 1MXYA 4EXKA 4GFRA 3C9HA 3HV1A 1GGGA 3OMBA 2V3TA 3IK6B 4M1VA 3BBRA 3RQTA 5H8NA 3EQ1A 4MH5A 1D9VA 4XKQA
chains in the Genus database with same CATH superfamily
1IMEA 4F3BA 3MUQA 2IA4A 1H45A 1YAEA 1FBEA 2VT5A 2I4BA 3SKPA 5DW8A 2B4LA 1WODA 2D21A 2F34A 1Y20A 2P1SA 4GWZA 1B3FA 4U1OA 2QVRA 1DOTA 4PE5B 1B9JA 1BK4A 1XHYA 1SPIA 1B5JA 3RN8A 4E0WA 4C0RA 2ALUA 3PPOA 5AA4A 1G0IA 1SVXB 4NAPA 5H8HA 1A8EA 4N6KA 3KJTA 2HXWA 4ZEFA 4FAJA 2QFLA 5KZTA 1ZMGA 1Z7NE 1LFIA 3KEIA 4BDOA 3RT6B 3FJGA 4P1LA 1N7WA 2Q88A 4NF8A 4QFOA 3N6UA 1AH5A 3U8QA 4N13A 1QJMA 2F7AA 3BFUA 5H8QB 1H3DA 4MX6A 1Y3NA 4NF6A 4PFWA 3TYHA 2QRYA 5EQ9A 4AS5A 5I2NB 4HE2A 2QSXA 4YKKA 2Q2CA 1R9QA 2DSFA 1KWHA 4OXVA 3MVWA 4F39A 4H5FA 1UIVA 5ET6A 5I7IA 3K02A 4JDFA 3EKIA 5ET7A 1MY0A 4P0IA 1CNQA 1UTBB 4F3SA 4QRZA 3KN3A 1FSAA 1FCKA 2LAOA 4PFIA 1FBFA 3T66A 1Q9DA 1DK4A 5CMKA 2DE4A 5LTCA 1NV1A 4WXJA 1B5HA 1B0LA 3T93B 1VFDA 1ZJLA 1T0KA 1NNFA 2OWSA 1UQWA 5FBPA 3K0VA 2HZLA 3E9XA 4OVQA 4DIGA 4M4GA 3T9XB 1LCFA 2HHMA 1MRPA 4MLVA 3CSGA 2GH9A 3U94A 3FVGA 3I5OA 1LBWA 3DP8A 1NKXA 3Q28A 3IX1A 2PX1A 3D1RA 3TPAA 2QMWA 4OANA 3TODA 4PBHA 2DVZA 4P8BA 4GBWA 2Y7WA 1AWBA 3E13X 3K6WA 2P0SA 3KG2A 5DVJA 1DBZA 5KDTB 1Y3PA 4MNCA 1FRPA 1NH8A 2ONRA 1HSLA 2I0CA 4H0WA 5IZ3A 2ONKE 4QFKA 4NF6B 4X9TA 2XHDA 2F5XA 4NF5A 5HPQA 4PCDA 5AE4A 1FPBA 4I3EA 4RJZA 4O94A 1LAFE 1JVXA 5JK4A 3N94A 3E79A 2V3QA 4RA1A 3IFCA 4N6PA 5AA2A 2XXTA 4PAFA 2RC9A 3RTWB 3K1MA 2R71A 4O8MA 2FBPA 4FEBA 3V83A 1LFHA 3HHFA 3LV0A 1O7TA 3A09A 4GWUA 5TU0A 3KBRA 3EPEA 1RDXA 1PB9A 4MCOA 2FA7A 3FVKA 2ABHA 3QSLA 4F22A 1AOVA 2QS4A 2FIEA 1IEJA 4IO5A 5EQAA 1WVJA 4G77A 3PV0E 3PPPA 1MM7A 3TAJA 3ODBA 3ILTB 4LN5A 4R9GA 1MXVA 1R6ZA 4MLQA 1AIVA 1Q35A 4HXVA 4O3BA 4PFYA 1KA1A 1H76A 2HAUA 4FEDA 5CC2A 3G3HA 3B6WA 3MAMA 2WBDA 4PDHA 3PUYE 1LBYA 5ICQA 4I8CA 1FPFA 3I6VA 3IL1B 1GV8A 4UABA 3G7WA 3JZJA 4I62A 3QUJA 4AB5A 4BLAA 4OVRA 4Q8RA 3K6UA 2DDKA 4RPOA 3FV1A 1M5EA 3TCHA 4POWA 5FTIA 4O3CA 1Z7ME 1USYE 4Q0CA 1MPCA 2ZZXA 1ZLQA 3M3FA 1B4HA 4OERA 1XOCA 1SYHA 1LSTA 4UA8A 2DWIA 1FBPA 2OBGA 1EZ9A 4JSOA 1M5DA 1UTHA 3QUFA 3VDFA 4LA9A 4OEVA 3ECRA 2XWVA 4F3PA 2X26A 4N8GA 3VVEA 1MXWA 2YJPA 3BIHA 3PD8A 5CMCA 4F2OA 3FXUA 3TFLA 2I58A 4GWWA 3RTFB 4OWDA 2UXAA 2DXRA 3VVDA 4OVPA 1H43A 4PFTA 3H6WA 1XT8A 3FVNA 1FTOA 4H45A 1JW5A 3Q25A 1YTVA 3M3KA 2Q8JA 3RLFE 1FPEA 4F29A 2XX7A 4ONYA 4JWXA 1FQAA 4FIMA 4QFNA 3MBPA 3RPLB 2H5YA 1WDNA 4R2FA 1I6BA 3O66A 3G3KA 5JTYA 4TLMB 2OCUA 4OVJA 4U4SA 2PBWA 3TTKA 5ET5A 3MWBA 1XC1A 4YKPA 1MH4A 1NL5A 4P9KA 1DPEA 2F6GA 2HAVA 5KCJA 3LBSA 4DCXA 1URDA 4P1EA 3O28A 1MY2A 4G2ZA 1VR5A 4WEDA 1MM6A 2RCAA 3PMWA 2BJJX 2OK2A 3LR1A 5FHNA 5IKBA 3G3GA 3HFUA 4EQBA 2FNCA 3PPQA 5I56A 1IXCA 1R1NA 4X8RA 3VVFA 1ZIUA 4IR8A 1BTJA 1RYXA 2RCBA 1NV5A 1H44A 1FQEA 2HEUA 4Q5TA 2QVUA 4QSCA 4PF6A 4I3YA 1NV7A 1RDZA 1QGXA 3KSXA 3WAEA 2OWZA 2RF1A 1IQ7A 4KFQA 4OESA 2REJA 1D9YA 4JWYA 2PFYA 4KD5A 1FPIA 4IO6A 4G68A 1IMCA 2Q8MA 2AL4A 1LAXA 4R6YA 3F11A 3TCFA 5A5XB 1NUWA 1D3KA 4PF8A 1DSNA 1IMBA 2Q9TA 2V93A 3T96B 1QW0A 2GRVA 1VDWA 2F8DA 1RDYA 1N3WA 3A3CA 4R75A 5ESYA 3KJ7A 3KOSA 1QUJA 3T0JA 3S9EA 3SESA 4I1DA 2XXHA 4OEUA 3UK4A 2UVGA 3TKDA 4GX3A 1UIUA 3UP9A 4MMPA 1SW1A 4GVOA 4U1ZA 2ZNSA 1FQBA 4F2QA 4RPNA 2FVZA 4N6DA 4N4UA 2AL5A 1MXUA 2B3BA 4EQ7A 3KN7A 1NNTA 4RK2A 5IZZA 3MP8A 4PFRA 1LB8A 3S2VA 1II5A 1SW5A 5ELVA 5I57A 2F3BA 1B3GA 3E3KA 1ANFA 4RXLA 1A7LA 3DP4A 1O63A 3PPRA 1P1WA 4GBVA 2Y7RA 3RYDA 1NV6A 3MVZA 1QUIA 3UN6A 1OQHA 1B32A 3QIMA 4H67A 2CZLA 4Q30B 3FZVA 3M8UA 1FQDA 2V4CA 5TP9A 1NMUA 4ELRA 3FV2A 4ESXA 4G68B 2W7YA 4GWOA 5DTBA 1SI0A 5I58A 5DEXA 1NUZA 4OZ9A 1IMFA 3SEVA 2OZZA 4EDPA 1OIBA 1K9ZA 3UIFA 3UA8A 4FJPA 4YU0A 5CI5A 5L8DA 3K2DA 3K4UA 1FQCA 3GXAA 4ZS9A 1LAGE 3SDFA 2HZKA 5TPAA 5I84A 3CR9A 1Y4TA 1A55A 2I3WA 2R8TA 4R6KA 1B3EA 2WKYA 3RUMA 1FPGA 1M5FA 2PMSA 1R9LA 3IORA 2VPOA 3IJXB 4I40A 1NV4A 4N15A 3CFZA 1BP5A 1NUYA 4QSDA 5IZ1A 4GWXA 3HN0A 3HHGA 4THIA 4GQOA 1IIWA 1YCJA 2F78A 5F1QA 3H3GA 1BIYA 3LSWA 5EHSA 5IGAA 5IM2A 4HCYA 3K1PA 2DWAA 1NNPA 4AB6A 4PBQA 1B3HA 3TQLA 4XF5A 5H8NB 4BDNA 3T9VA 4DI3D 4QSEA 4LZ5A 3IO6A 1CB6A 4H65A 2QJEA 4WEPA 1LAHE 4PGPA 2B4MA 1SYIA 2HXRA 3CFLA 1MDP1 1Y9UA 3UORA 4P3LA 2PFZA 4N8YA 3TTRA 5L9SA 3FATA 3OO8A 2UVJA 4QBAA 5AA4B 3B6QA 5H8HB 2UVIA 4ZDMA 4U2RA 4MJOA 3QXMA 4O3AA 3L6HA 1IUDA 4YB6A 1B40A 1XVXA 4NG7A 4HE0A 2F7BA 1M5CA 2I49A 3MC2A 4OETA 4NF8B 1Y1ZA 2ESNA 4NN3A 5LDZA 4X48A 3OXNA 3U65A 4XKRA 2UYFA 5CBRA 5TPAB 1PBQA 4HW8A 4ZEIA 2DVCA 5CBSA 1G0HA 2O84X 2O1MA 1KZ8A 2XXPA 1N0TA 4N91A 4NF4A 3OO7A 5I2KA 3MJNA 3HPIA 1RKMA 2ZZVA 1SD3A 2VP1A 1MQDA 2XD3A 4KHZE 3S9NC 3FIRA 3RY3A 3PUZE 5LOMA 1LBZA 1QKAA 2Q74A 1AL3A 3GYYA 2D3IA 1SQYA 3PUVE 1B0HA 1B5IA 3GLBA 3N26A 1I6AA 4JSDA 4YKJA 1MXZA 3HSTA 4EQ9A 1MS7A 4F1YA 5M2VA 2Z8FA 2QS3A 3A3UA 3RT8A 1SW4A 2I4CA 3SZPA 4GXAA 2F3DA 3QYTA 3OO9A 1P1OA 1EYIA 5ITPA 3VXCA 5FHMA 3KC1A 4DI4B 3S9MC 5BWJA 4P47A 4OQOA 2WEFA 2I3VA 1Y3QA 5AA3A 2M8CA 1YPNA 3IO4A 3O29A 3G3JA 4OMBA 1LEVA 2ZXTA 1FW0A 2QS2A 2XXVA 5ITOA 1IXGA 4XFEA 2KR0A 2CEXA 1M5BA 1MQIA 3S9LC 4OVTA 3GBAA 4AS4A 3ZS6A 1FBGA 3B8BA 4ELQA 1D9QA 4PC9A 3CHGA 5J1DA 5CM6A 5CRYA 2F35A 4XEQA 4C1UA 3MYUA 3H4ZA 5IZ3B 1JW4A 1XS5A 1S9TA 4X1DA 5ET8A 2NVUB 3AXFA 1Y4CA 2VHAA 3TEPA 1P1QA 4NF5B 3FXRA 3U72A 1TFDA 4PTKA 3IJOB 2B3FA 3PUXE 2DOJA 4OTEA 4G8HA 1YXIA 3Q26A 3O9PA 4GL8A 1EH3A 4TOZA 4N81A 4LQ5A 3H06B 4YB5A 2XXUA 5AA2B 1MXXA 1MG1A 4NWCA 5B7DA 2F7CA 1F9BA 1YYZA 3KC0A 4R72A 3MZBA 2PYYA 4XKQA 4H8IA 3CI8A 3MZ1A 3V5AA 2XA5A 4OYVA 4JB7A 4ZEKA 4HCWA 1Q1KA 3PMVA 1USYH 4MF3A 3EF7A 1IMDA 1OVTA 3C36A 1MPDA 4GRKA 3IAZA 3K6VA 3V89B 2Q2AA 5K2XA 4PETA 2P2AA 4G4PA 5I59A 3W9VA 3QAXA 1JP4A 3B50A 4UACA 4C1TA 4TQUQ 2XXRA 4KCDA 1I6QA 4PQJA 2DXYA 3TZAA 4KCCA 3M3LA 3P7IA 3OEKA 4OFLA 1BKAA 4GWYA 4O7MA 4ZEDA 2GHBA 4PAIA 2CEYA 3C31A 2VGQA 2ZYKA 2YPNA 4XTCQ 3IFAA 1FTJA 4MHFA 3MQ9A 4H8JA 2DS9A 2XX8A 3EN3A 1FTKA 2FIXA 3THIA 5AA2D 5EHMA 4EUOA 1YZ0A 2O69A 3PTYA 4DDDA 3C33A 4PFBA 2I0BA 4KXPA 2PT1A 4DZ1A 4JBZA 1UTHB 3FJ7A 3CG3A 2DQVA 3E78A 4AQ4A 4N17A 4GWSA 3U92A 3O6IA 1O64A 4HTGA 3KGCA 4IO4A 1B7UA 1KA0A 5H8SA 1SI1A 2XWIA 4U4XA 3MVYA 3D4GA 2G29A 5FHOA 4H1XA 4YICA 3H7MA 4IGRA 1XI6A 2KLFA 1MY4A 3GBBA 5F24A 3ZKKA 2XXWA 4MEVA 1FJ6A 1D4NA 4ESWA 5I5PA 4MNIA 4GXSB 1A54A 4XKPA 3SEYA 4MFIA 1FPKA 2Q89A 1JVYA 4QF9A 3K00A 3LC8A 3MSTA 3KFMA 5JTYB 1LBVA 3QMFA 2WX9A 3G3IA 4GLIA 5EQ7A 3OEMA 2D5WA 1TXFA 2I48A 4PDDA 4BDRA 3JYRA 3R7XA 1DPPA 5KCJB 1GTKA 1VE4A 1GR2A 1US5A 2QS1A 5H8QA 4E0XA 5EQ8A 4TLLB 3TUSA 3R26A 1NV0A 1OQGA 2R9JA 4JWOA 2O7IA 2FHYA 3K01A 1US4A 2XWOA 4EXLA 1B05A 4FE8A 4G61A 2QVVA 1B52A 3VV5A 5I56B 3LSXA 5EYHA 4NHBA 3HCQA 4X04A 4DE8A 1P1NA 2ZYOA 4MNPA 4LP2B 3TTLA 5FTHA 3IOUA 3OD7A 3VE1B 2RKMA 2YLNA 3K6XA 1BLFA 1DCUA 3MVXA 2THIA 2MKZA 2NOOA 3O2AA 4QFPA 3USDA 1NV2A 4U21A 2ONSA 1JW1A 1PB8A 1OLCA 3TDJA 4DXCA 4LQ2A 4QXDA 5T3JA 4LUBA 1MY1A 2UVHA 4KYDA 2XXXA 2PCRA 2OJTA 2IEEA 3DLNA 2L5VA 3SERA 2VPNA 4YMAA 2QPQA 1LBCA 1GVCA 2E0SA 2NXOA 2Y5KA 1Y1MA 1OLAA 3H6VA 5J16A 2V25A 5B70A 4FATA 3N6TA 4U22A 5KDTA 3TTNA 3T9HB 1OMPA 4P11A 1I69A 1NNKA 4H46A 2Z8DA 3O6HA 1S7YA 3O97A 1MQJA 1JETA 4DXBA 1FPLA 1N76A 3FASA 4NE4A 1P99A 4ZZAA 1HSJA 3C4MA 5HM4B 4QHQA 1JQFA 2RINA 4MAGA 2ZYMA 2VD3A 3O6GA 3N5LA 4F31B 5I57B 3FGSA 4GD5A 4HE1A 4FORA 2RC8A 3KZGA 4NEDA 3W9WA 1EYJA 2XXQA 4ZE8A 3T22A 4HS7A 3CFXA 3DM0A 5I3SA 2HQ0A 1EYKA 1QKBA 3PD9A 1CE2A 3PPNA 4ZE9A 1NFTA 1SW2A 2HCAA 3ROJA 1JEVA 4GF8A 4KYEA 5DT6A 2VOZA 3U93A 4EF2A 1EU8A 5IAIA 1FBDA 2Y5LA 1MQGA 2Y7PA 3H6UA 3BFTA 3RGYA 4POXA 3FJMA 4XIGQ 5TP9B 4QFLA 4IO3A 3TELA 3IB0A 4OFOA 4XXUA 2XWKA 4JVIA 1MDQA 3ZKLA 2I6EA 4ZZEA 5I58B 5DEXB 3ILUB 2A5TA 3PUWE 1FBCA 2P3VA 1IMAA 5ICTA 4G8NA 4R73A 2BJIA 3SEUA 1QVSA 2HPGA 1FPDA 4F18A 2Z22A 1DTZA 1N3XA 5L9MA 4NWDA 3C32A 1A40A 5CMMA 2OWTA 3LUZA 2XD2A 3KSJA 3U1OA 3LSFB 1SDXA 5ISUA 4KPTA 1B6HA 2NUVA 3T1BA 1EZPA 2E1SA 2R6GE 5EYFA 1ATGA 4IO7A 3DP6A 1B4ZA 2V3UA 2O6AA 2ANJA 4XKNA 3LUYA 2XXYA 4GL0A 5DYHA 1JNFA 3WAFA 4L17A 1K9YA 1TT1A 5CMBA 4YKIA 2CZHA 4R6HA 3RNNA 3RPWA 2O51A 4RYAA 4EF1A 4GOTA 2CMOA 4IY6A 3LSLA 3MP1A 2ZMBA 5BUUA 1B7ZA 3ONMA 1SBPA 3H03A 2QL3A 2X7QA 3R6UA 4P56A 4F1VA 4PP0A 1LCTA 2H99A 1FTAA 3EHSA 2F6PA 4OA4A 4PAKA 2X7PA 5DVFA 4Z7EA 2XXKA 2DE3A 3RPLA 5A5LA 4KQPA 4N07A 3K1NA 2A5TB 1A8FA 1TWYA 4F1UA 2DYXA 1ZU0A 2Y7KA 5HBCA 4F3GA 3H6TA 4OHNA 3HO7A 1QULA 2H4IA 1L5TA 1XVYA 1ZKBA 3MZ9A 2HFBA 3SETA 3CG1A 3VLUA 2P3NA 3MPKA 1NH7A 4JXIA 5H8FA 1EZOA 4G68C 1MPBA 2PT2A 1POY1 3TMGA 2Y7IA 3KOTA 3IR1A 2ZNUA 4NF4B 3OSQA 4ELPA 4RK9A 5I2KB 3IOTA 4K3FA 1B3LA 3DELB 1MQHA 1B7HA 1B51A 4KR5A 3G3FA 2B65A 3UGWA 1FTMA 1OVBA 1P1UA 4WKMA 4ISUA 2WYKA 2G93A 3D4CA 3FBPA 4KI0E 2DE2A 1LFGA 3FXBA 4ZEBA 2RC7A 1FJ9A 2O1LA 3OOAA 4YAHX 3IOVA 4BDQA 3C34A 2VD2A 5L9OA 2DWHA 3TTMA 4GIZA 1NV3A 1PEBA 2O68A 1B58A 3OELA 1RYOA 1DMBA 1LBBA 3OENA 2ZYNA 3Q29A 4X1BA 4PE3A 5JEIA 1LLSA 5A5XA 2Y84A 3EHUA 1FPJA 4NF0A 3IOWA 3CRBA 3PMXA 3VFJA 4DXUA 3B6TA 3PU5A 4DCYA 2GFEA 4OFJA 2WBBA 4LZ7A 3MP6A 1VSOA 2AYSA 5AA1A 4O7IA 1N7XA 1URGA 2OLBA 4GX4A 2H25A 2V84A 3C35A 2O7UA 3CSBA 1LGBC 4YB7A 2CZIA 2NWJA 1NI9A 4NX1A 2XX9A 3ZSFA 3FVOA 3PGFA 2JJKA 4JVCA 5H8FB 1IITA 3SEXA 1INPA 4LATA 1LBXA 4OVSA 4ND9A 1JEUA 4R9FA 1PDAA 2KQZA 4R74A 1IXHA 3CIJA 4RY1A 3MW0A 2CZKA 3IB2A 3FD3A 4FECA 3V8XB 3OSRA 4NQ8A 3B7DA 3JV9A 1FBHA 5DVIA 1B2HA 4NGUA 1VFEA 2PVUA 2Z8EA 3W15C 4IO2A 3VLWA 2H98A 4KYSA 4H6DA 3NOHA 4LZ8A 3FXQA 1LB9A 3EHTA 4OENA 2A5SA 1J1NA 4P0GA 2F97A 4FBPA 2WYPA 4ZECA 1B1HA 3I3VA 1B1XA 3E4RA 3TQWA 3KN8A 2Z23A 4DLDA 4R2BA 3ISPA 1N04A 4ELOA 1IZ1A 4IY5A 1NUXA 4PFUA 3BKIB 3FUZA 4GX6A 4BDLA 3L6GA 3S4UA 1MH3A 3Q27A 1S50A 1TFAA 2F36A 2REGA 3VLVA 5I59B 3OO6A 2FYIA 5K2YA 2GHAA 4H5GA 4IB2A 3SEWA 1ELJA 5EYGA 2ZNTA 1AMFA 4LONB 4MBPA 2H9BA 1PBPA 1FTLA 5I2NA 2DP8A 4NTLA 3A29A 4LVQA 1HSEA 1MY3A 1DTGA 1ZBMA 1IXIA 4U23A 3BIGA 1B46A 3IB1A 3VXBA 3CVGA 4Z0IA 1ZTYA 2OX3A 2ZZWA 1A99A 3KBZA 5F7VA 1FQFA 4JVDA 4BDMA 4MIJA 1URSA 4ECFA 3GZGA 4F19A 4YMBA 1PC3A 1UTBA 3T9UA 4IGTA 3QK6A 4NMYA 3MPLA 1N84A 2QMXA 4G8MA 2XXIA 1QUKA 1PB7A 4RNSA 4I9DA 1POTA 2AIXA 2DWJA 2UYEA 3TCGA 4YZZA 1MXYA 4EXKA 4GFRA 3C9HA 3HV1A 1GGGA 3OMBA 2V3TA 3IK6B 4M1VA 3BBRA 3RQTA 5H8NA 3EQ1A 4PGNA 4MH5A 1D9VA 2GQ1A
chains in the Genus database with same CATH topology
4F3BA 3MUQA 2IA4A 1H45A 1YAEA 2I4BA 3SKPA 1WODA 2D21A 2F34A 1Y20A 2P1SA 1B3FA 4U1OA 1DOTA 4PE5B 1B9JA 1XHYA 1B5JA 3RN8A 4E0WA 4C0RA 2ALUA 3PPOA 5AA4A 1SVXB 5H8HA 1A8EA 3KJTA 2HXWA 4ZEFA 4FAJA 5KZTA 1ZMGA 1Z7NE 1LFIA 3KEIA 4BDOA 3RT6B 3FJGA 1N7WA 2Q88A 4NF8A 4QFOA 3N6UA 1AH5A 3U8QA 4N13A 1QJMA 2F7AA 3BFUA 5H8QB 1H3DA 1Y3NA 4NF6A 4PFWA 3TYHA 2QRYA 5I2NB 2QSXA 4YKKA 2Q2CA 1R9QA 2DSFA 1KWHA 4OXVA 3MVWA 4F39A 4H5FA 1UIVA 3K02A 4JDFA 1MY0A 4P0IA 1UTBB 4F3SA 4QRZA 3KN3A 1FCKA 2LAOA 3T66A 5CMKA 2DE4A 4WXJA 1B5HA 1B0LA 3T93B 1VFDA 1ZJLA 1T0KA 1NNFA 2OWSA 1UQWA 3K0VA 2HZLA 3E9XA 4DIGA 4M4GA 3T9XB 1LCFA 1MRPA 4MLVA 3CSGA 2GH9A 3U94A 3FVGA 3I5OA 3DP8A 1NKXA 3Q28A 3IX1A 2PX1A 3TPAA 2QMWA 3TODA 2DVZA 2Y7WA 3E13X 3K6WA 2P0SA 3KG2A 5DVJA 5KDTB 1Y3PA 1NH8A 2ONRA 1HSLA 2I0CA 4H0WA 2ONKE 4QFKA 4NF6B 4X9TA 2XHDA 2F5XA 4NF5A 5HPQA 5AE4A 4RJZA 1LAFE 1JVXA 5JK4A 3N94A 2V3QA 4RA1A 5AA2A 4N6PA 2XXTA 2RC9A 3RTWB 3K1MA 2R71A 4FEBA 3V83A 1LFHA 3HHFA 1O7TA 3A09A 5TU0A 3KBRA 3EPEA 1PB9A 2FA7A 3FVKA 2ABHA 3QSLA 4F22A 1AOVA 2QS4A 1IEJA 4IO5A 1WVJA 4G77A 3PV0E 3PPPA 1MM7A 3TAJA 3ODBA 3ILTB 4R9GA 1MXVA 1R6ZA 4MLQA 1AIVA 1Q35A 4O3BA 4PFYA 1H76A 2HAUA 4FEDA 5CC2A 3G3HA 3B6WA 3MAMA 3PUYE 5ICQA 4I8CA 3I6VA 3IL1B 1GV8A 3G7WA 3JZJA 4I62A 3QUJA 4AB5A 4BLAA 4Q8RA 3K6UA 4RPOA 3FV1A 1M5EA 3TCHA 4POWA 5FTIA 4O3CA 1Z7ME 1USYE 4Q0CA 1MPCA 1ZLQA 3M3FA 1B4HA 4OERA 1XOCA 1SYHA 1LSTA 4UA8A 2DWIA 2OBGA 1EZ9A 4JSOA 1M5DA 1UTHA 3QUFA 3VDFA 4LA9A 4OEVA 3ECRA 4F3PA 2X26A 3VVEA 1MXWA 2YJPA 3PD8A 5CMCA 4F2OA 3FXUA 3TFLA 2I58A 3RTFB 4OWDA 2UXAA 2DXRA 3VVDA 1H43A 4PFTA 3H6WA 1XT8A 3FVNA 1FTOA 1JW5A 3Q25A 1YTVA 3M3KA 2Q8JA 3RLFE 4F29A 2XX7A 4ONYA 4JWXA 1FQAA 4FIMA 4QFNA 3MBPA 2H5YA 1WDNA 4R2FA 1I6BA 3O66A 3G3KA 5JTYA 4TLMB 2OCUA 4OVJA 4U4SA 2PBWA 3TTKA 3MWBA 1XC1A 4YKPA 1MH4A 1NL5A 1DPEA 2F6GA 2HAVA 5KCJA 3LBSA 4DCXA 1URDA 3O28A 1MY2A 4G2ZA 1VR5A 4WEDA 1MM6A 2RCAA 3PMWA 2BJJX 2OK2A 3LR1A 5FHNA 5IKBA 3G3GA 4EQBA 2FNCA 3PPQA 5I56A 1IXCA 1R1NA 3VVFA 1ZIUA 1BTJA 1RYXA 2RCBA 1H44A 1FQEA 2HEUA 4Q5TA 4QSCA 3KSXA 3WAEA 2RF1A 1IQ7A 4KFQA 4OESA 2REJA 1D9YA 4JWYA 4KD5A 4IO6A 4G68A 2AL4A 1LAXA 4R6YA 3F11A 3TCFA 5A5XB 1D3KA 1DSNA 2Q9TA 2V93A 3T96B 1QW0A 2GRVA 2F8DA 1N3WA 3A3CA 4R75A 3KJ7A 3KOSA 1QUJA 3S9EA 3SESA 4I1DA 2XXHA 4OEUA 3UK4A 2UVGA 3TKDA 1UIUA 3UP9A 1SW1A 4GVOA 4U1ZA 2ZNSA 1FQBA 4F2QA 4RPNA 2AL5A 1MXUA 2B3BA 4EQ7A 3KN7A 1NNTA 4RK2A 3MP8A 1LB8A 3S2VA 1II5A 1SW5A 5ELVA 5I57A 1B3GA 3E3KA 1ANFA 4RXLA 1A7LA 3DP4A 1O63A 3PPRA 1P1WA 2Y7RA 3MVZA 1QUIA 3UN6A 1OQHA 1B32A 3QIMA 4H67A 2CZLA 4Q30B 3FZVA 3M8UA 1FQDA 5TP9A 1NMUA 4ELRA 3FV2A 4ESXA 4G68B 2W7YA 4GWOA 5DTBA 1SI0A 5I58A 5DEXA 4OZ9A 3SEVA 2OZZA 4EDPA 1OIBA 3UIFA 3UA8A 4FJPA 4YU0A 5CI5A 5L8DA 3K2DA 3K4UA 1FQCA 3GXAA 4ZS9A 1LAGE 3SDFA 2HZKA 5TPAA 5I84A 3CR9A 1Y4TA 1A55A 2I3WA 4R6KA 1B3EA 2WKYA 3RUMA 1M5FA 2PMSA 1R9LA 3IORA 3IJXB 3CFZA 1BP5A 4QSDA 3HN0A 3HHGA 4THIA 4GQOA 1IIWA 1YCJA 2F78A 5F1QA 3H3GA 1BIYA 3LSWA 5EHSA 4HCYA 3K1PA 2DWAA 1NNPA 4AB6A 1B3HA 3TQLA 5H8NB 4BDNA 3T9VA 4QSEA 4LZ5A 3IO6A 1CB6A 4H65A 2QJEA 4WEPA 1LAHE 1SYIA 3CFLA 1MDP1 1Y9UA 3UORA 3TTRA 5L9SA 3FATA 3OO8A 2UVJA 5AA4B 3B6QA 5H8HB 2UVIA 4ZDMA 4U2RA 3QXMA 4O3AA 3L6HA 1IUDA 4YB6A 1B40A 1XVXA 2F7BA 1M5CA 2I49A 3MC2A 4OETA 4NF8B 1Y1ZA 2ESNA 4X48A 3OXNA 4XKRA 2UYFA 5CBRA 5TPAB 1PBQA 4HW8A 4ZEIA 2DVCA 5CBSA 2O84X 2O1MA 2XXPA 1N0TA 4NF4A 3OO7A 5I2KA 3MJNA 3HPIA 1RKMA 1SD3A 2VP1A 1MQDA 2XD3A 4KHZE 3S9NC 3RY3A 3FIRA 3PUZE 5LOMA 1QKAA 1AL3A 2D3IA 1SQYA 3PUVE 1B0HA 1B5IA 3GLBA 3N26A 1I6AA 4JSDA 4YKJA 1MXZA 4EQ9A 3HSTA 1MS7A 4F1YA 5M2VA 2Z8FA 2QS3A 3A3UA 3RT8A 1SW4A 2I4CA 4GXAA 3QYTA 3OO9A 1P1OA 5ITPA 3VXCA 5FHMA 3S9MC 5BWJA 4OQOA 2I3VA 1Y3QA 5AA3A 2M8CA 1YPNA 3IO4A 3O29A 3G3JA 4OMBA 2ZXTA 1FW0A 2QS2A 2XXVA 5ITOA 1IXGA 1M5BA 1MQIA 3S9LC 3GBAA 3ZS6A 4ELQA 5J1DA 5CM6A 5CRYA 2F35A 4C1UA 3H4ZA 1JW4A 1XS5A 1S9TA 4X1DA 2NVUB 3AXFA 1Y4CA 2VHAA 3TEPA 1P1QA 4NF5B 3FXRA 3U72A 1TFDA 3IJOB 2B3FA 3PUXE 2DOJA 4OTEA 4G8HA 3Q26A 3O9PA 4GL8A 1EH3A 4TOZA 4LQ5A 3H06B 4YB5A 2XXUA 5AA2B 1MXXA 1MG1A 4NWCA 5B7DA 2F7CA 1F9BA 4R72A 3MZBA 2PYYA 4H8IA 3CI8A 3MZ1A 3V5AA 4OYVA 4JB7A 4ZEKA 4HCWA 1Q1KA 3PMVA 1USYH 4MF3A 3EF7A 1OVTA 3C36A 1MPDA 4GRKA 3IAZA 3K6VA 3V89B 2Q2AA 5K2XA 4PETA 2P2AA 4G4PA 5I59A 3W9VA 3QAXA 4UACA 4C1TA 4TQUQ 2XXRA 4KCDA 1I6QA 4PQJA 2DXYA 3TZAA 4KCCA 3M3LA 3P7IA 3OEKA 4OFLA 1BKAA 4ZEDA 2GHBA 3C31A 2VGQA 2ZYKA 2YPNA 4XTCQ 1FTJA 3MQ9A 4H8JA 2DS9A 2XX8A 3EN3A 1FTKA 3THIA 5AA2D 5EHMA 4EUOA 2O69A 4DDDA 3C33A 2I0BA 2PT1A 4DZ1A 4JBZA 1UTHB 3FJ7A 3CG3A 2DQVA 4AQ4A 3U92A 3O6IA 1O64A 4HTGA 3KGCA 4IO4A 1B7UA 5H8SA 1SI1A 4U4XA 3MVYA 3D4GA 2G29A 5FHOA 4H1XA 4YICA 3H7MA 4IGRA 2KLFA 1MY4A 3GBBA 3ZKKA 2XXWA 1D4NA 4ESWA 4GXSB 1A54A 4XKPA 3SEYA 4MFIA 2Q89A 1JVYA 4QF9A 3K00A 3LC8A 3KFMA 5JTYB 3G3IA 4GLIA 3OEMA 2D5WA 1TXFA 2I48A 4BDRA 3JYRA 3R7XA 1DPPA 5KCJB 1GTKA 1VE4A 1GR2A 1US5A 2QS1A 5H8QA 4E0XA 4TLLB 3TUSA 3R26A 1OQGA 2R9JA 4JWOA 2O7IA 3K01A 1US4A 4EXLA 1B05A 4FE8A 1B52A 3VV5A 5I56B 3LSXA 3HCQA 4DE8A 1P1NA 2ZYOA 4LP2B 3TTLA 5FTHA 3IOUA 3OD7A 3VE1B 2RKMA 2YLNA 3K6XA 1BLFA 3MVXA 2THIA 2NOOA 3O2AA 4QFPA 3USDA 4U21A 2ONSA 1JW1A 1PB8A 1OLCA 3TDJA 4DXCA 4LQ2A 4LUBA 1MY1A 2UVHA 4KYDA 2XXXA 2OJTA 2IEEA 3DLNA 4YMAA 3SERA 2QPQA 1LBCA 1GVCA 2E0SA 2NXOA 1Y1MA 1OLAA 3H6VA 2V25A 5B70A 4FATA 3N6TA 4U22A 5KDTA 3TTNA 3T9HB 1OMPA 4P11A 1I69A 1NNKA 2Z8DA 3O6HA 1S7YA 3O97A 1MQJA 1JETA 4DXBA 1N76A 4ZZAA 3FASA 1P99A 4NE4A 1HSJA 3C4MA 5HM4B 4QHQA 1JQFA 2RINA 2ZYMA 2VD3A 3O6GA 3N5LA 4F31B 5I57B 3FGSA 4GD5A 4FORA 2RC8A 3KZGA 4NEDA 3W9WA 2XXQA 4ZE8A 3T22A 4HS7A 3CFXA 3DM0A 2HQ0A 1QKBA 3PD9A 1CE2A 3PPNA 4ZE9A 1NFTA 1SW2A 2HCAA 1JEVA 4GF8A 4KYEA 5DT6A 2VOZA 3U93A 4EF2A 1EU8A 5IAIA 1MQGA 2Y7PA 3H6UA 3RGYA 3BFTA 4POXA 3FJMA 4XIGQ 5TP9B 4QFLA 4IO3A 3TELA 3IB0A 4OFOA 4XXUA 1MDQA 3ZKLA 2I6EA 4ZZEA 5I58B 5DEXB 3ILUB 2A5TA 3PUWE 5ICTA 4G8NA 4R73A 3SEUA 1QVSA 4F18A 2Z22A 1DTZA 1N3XA 5L9MA 4NWDA 3C32A 1A40A 5CMMA 2OWTA 2XD2A 3KSJA 3U1OA 3LSFB 1SDXA 5ISUA 4KPTA 1B6HA 2NUVA 1EZPA 2E1SA 2R6GE 5EYFA 1ATGA 4IO7A 3DP6A 1B4ZA 2V3UA 2O6AA 2ANJA 4XKNA 3LUYA 2XXYA 4GL0A 5DYHA 1JNFA 3WAFA 4L17A 1TT1A 5CMBA 4YKIA 4R6HA 3RNNA 3RPWA 2O51A 4RYAA 4EF1A 4GOTA 2CMOA 4IY6A 3LSLA 3MP1A 2ZMBA 5BUUA 1B7ZA 3ONMA 1SBPA 3H03A 2QL3A 2X7QA 3R6UA 4F1VA 4PP0A 1LCTA 2H99A 3EHSA 2F6PA 2X7PA 5DVFA 4Z7EA 2DE3A 4KQPA 4N07A 3K1NA 2A5TB 1A8FA 1TWYA 4F1UA 2DYXA 1ZU0A 2Y7KA 5HBCA 4F3GA 3H6TA 4OHNA 3HO7A 1QULA 2H4IA 1L5TA 1XVYA 1ZKBA 3MZ9A 2HFBA 3SETA 3CG1A 3VLUA 3MPKA 1NH7A 4JXIA 5H8FA 1EZOA 4G68C 1MPBA 2PT2A 1POY1 3TMGA 2Y7IA 3KOTA 3IR1A 2ZNUA 4NF4B 3OSQA 4ELPA 4RK9A 5I2KB 3IOTA 4K3FA 1B3LA 3DELB 1MQHA 1B7HA 1B51A 4KR5A 3G3FA 2B65A 3UGWA 1FTMA 1OVBA 1P1UA 4WKMA 4ISUA 2G93A 3D4CA 4KI0E 2DE2A 1LFGA 4ZEBA 2RC7A 2O1LA 3OOAA 4YAHX 3IOVA 4BDQA 3C34A 2VD2A 5L9OA 2DWHA 3TTMA 4GIZA 1PEBA 2O68A 1B58A 3OELA 1RYOA 1DMBA 1LBBA 3OENA 2ZYNA 3Q29A 4X1BA 5JEIA 1LLSA 5A5XA 2Y84A 3EHUA 3IOWA 3CRBA 3PMXA 3VFJA 4DXUA 3B6TA 3PU5A 4DCYA 2GFEA 4OFJA 4LZ7A 3MP6A 1VSOA 2AYSA 5AA1A 1N7XA 1URGA 2OLBA 2H25A 2V84A 3C35A 2O7UA 3CSBA 1LGBC 4YB7A 2NWJA 2XX9A 3ZSFA 3FVOA 3PGFA 3SEXA 5H8FB 1IITA 4LATA 4ND9A 1JEUA 4R9FA 1PDAA 4R74A 1IXHA 3CIJA 4RY1A 3MW0A 3IB2A 3FD3A 4FECA 3V8XB 3OSRA 3B7DA 3JV9A 5DVIA 1B2HA 1VFEA 2PVUA 2Z8EA 3W15C 4IO2A 3VLWA 2H98A 4KYSA 4H6DA 4LZ8A 3FXQA 1LB9A 3EHTA 4OENA 2A5SA 1J1NA 4P0GA 2F97A 4ZECA 1B1HA 3I3VA 1B1XA 3E4RA 3TQWA 3KN8A 2Z23A 4DLDA 4R2BA 1N04A 4ELOA 1IZ1A 4IY5A 4PFUA 4BDLA 3BKIB 3FUZA 3L6GA 3S4UA 1MH3A 3Q27A 1S50A 1TFAA 2F36A 2REGA 3VLVA 5I59B 3OO6A 2FYIA 5K2YA 2GHAA 4H5GA 4IB2A 3SEWA 1ELJA 2ZNTA 1AMFA 4LONB 4MBPA 2H9BA 1PBPA 1FTLA 5I2NA 2DP8A 4NTLA 4LVQA 1HSEA 1MY3A 1DTGA 1ZBMA 1IXIA 4U23A 1B46A 3IB1A 3VXBA 3CVGA 4Z0IA 1ZTYA 1A99A 5F7VA 1FQFA 4BDMA 1URSA 4ECFA 3GZGA 4F19A 4YMBA 1PC3A 1UTBA 3T9UA 4IGTA 3QK6A 4NMYA 3MPLA 1N84A 2QMXA 4G8MA 2XXIA 1QUKA 1PB7A 4RNSA 4I9DA 1POTA 2AIXA 2DWJA 3TCGA 2UYEA 4YZZA 1MXYA 4EXKA 4GFRA 3C9HA 3HV1A 1GGGA 3OMBA 2V3TA 3IK6B 4M1VA 3BBRA 3RQTA 5H8NA 3EQ1A 4MH5A 1D9VA 4XKQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4F3B A;  3MUQ A;  2IA4 A;  1H45 A;  1YAE A;  2I4B A;  3SKP A;  1WOD A;  2D21 A;  2F34 A;  1Y20 A;  2P1S A;  1B3F A;  4U1O A;  1DOT A;  4PE5 B;  1B9J A;  1XHY A;  1B5J A;  3RN8 A;  4E0W A;  4C0R A;  2ALU A;  3PPO A;  5AA4 A;  1SVX B;  5H8H A;  1A8E A;  3KJT A;  2HXW A;  4ZEF A;  4FAJ A;  5KZT A;  1ZMG A;  1Z7N E;  1LFI A;  3KEI A;  4BDO A;  3RT6 B;  3FJG A;  1N7W A;  2Q88 A;  4NF8 A;  4QFO A;  3N6U A;  1AH5 A;  3U8Q A;  4N13 A;  1QJM A;  2F7A A;  3BFU A;  5H8Q B;  1H3D A;  1Y3N A;  4NF6 A;  4PFW A;  3TYH A;  2QRY A;  5I2N B;  2QSX A;  4YKK A;  2Q2C A;  1R9Q A;  2DSF A;  1KWH A;  4OXV A;  3MVW A;  4F39 A;  4H5F A;  1UIV A;  3K02 A;  4JDF A;  1MY0 A;  4P0I A;  1UTB B;  4F3S A;  4QRZ A;  3KN3 A;  1FCK A;  2LAO A;  3T66 A;  5CMK A;  2DE4 A;  4WXJ A;  1B5H A;  1B0L A;  3T93 B;  1VFD A;  1ZJL A;  1T0K A;  1NNF A;  2OWS A;  1UQW A;  3K0V A;  2HZL A;  3E9X A;  4DIG A;  4M4G A;  3T9X B;  1LCF A;  1MRP A;  4MLV A;  3CSG A;  2GH9 A;  3U94 A;  3FVG A;  3I5O A;  3DP8 A;  1NKX A;  3Q28 A;  3IX1 A;  2PX1 A;  3TPA A;  2QMW A;  3TOD A;  2DVZ A;  2Y7W A;  3E13 X;  3K6W A;  2P0S A;  3KG2 A;  5DVJ A;  5KDT B;  1Y3P A;  1NH8 A;  2ONR A;  1HSL A;  2I0C A;  4H0W A;  2ONK E;  4QFK A;  4NF6 B;  4X9T A;  2XHD A;  2F5X A;  4NF5 A;  5HPQ A;  5AE4 A;  4RJZ A;  1LAF E;  1JVX A;  5JK4 A;  3N94 A;  2V3Q A;  4RA1 A;  5AA2 A;  4N6P A;  2XXT A;  2RC9 A;  3RTW B;  3K1M A;  2R71 A;  4FEB A;  3V83 A;  1LFH A;  3HHF A;  1O7T A;  3A09 A;  5TU0 A;  3KBR A;  3EPE A;  1PB9 A;  2FA7 A;  3FVK A;  2ABH A;  3QSL A;  4F22 A;  1AOV A;  2QS4 A;  1IEJ A;  4IO5 A;  1WVJ A;  4G77 A;  3PV0 E;  3PPP A;  1MM7 A;  3TAJ A;  3ODB A;  3ILT B;  4R9G A;  1MXV A;  1R6Z A;  4MLQ A;  1AIV A;  1Q35 A;  4O3B A;  4PFY A;  1H76 A;  2HAU A;  4FED A;  5CC2 A;  3G3H A;  3B6W A;  3MAM A;  3PUY E;  5ICQ A;  4I8C A;  3I6V A;  3IL1 B;  1GV8 A;  3G7W A;  3JZJ A;  4I62 A;  3QUJ A;  4AB5 A;  4BLA A;  4Q8R A;  3K6U A;  4RPO A;  3FV1 A;  1M5E A;  3TCH A;  4POW A;  5FTI A;  4O3C A;  1Z7M E;  1USY E;  4Q0C A;  1MPC A;  1ZLQ A;  3M3F A;  1B4H A;  4OER A;  1XOC A;  1SYH A;  1LST A;  4UA8 A;  2DWI A;  2OBG A;  1EZ9 A;  4JSO A;  1M5D A;  1UTH A;  3QUF A;  3VDF A;  4LA9 A;  4OEV A;  3ECR A;  4F3P A;  2X26 A;  3VVE A;  1MXW A;  2YJP A;  3PD8 A;  5CMC A;  4F2O A;  3FXU A;  3TFL A;  2I58 A;  3RTF B;  4OWD A;  2UXA A;  2DXR A;  3VVD A;  1H43 A;  4PFT A;  3H6W A;  1XT8 A;  3FVN A;  1FTO A;  1JW5 A;  3Q25 A;  1YTV A;  3M3K A;  2Q8J A;  3RLF E;  4F29 A;  2XX7 A;  4ONY A;  4JWX A;  1FQA A;  4FIM A;  4QFN A;  3MBP A;  2H5Y A;  1WDN A;  4R2F A;  1I6B A;  3O66 A;  3G3K A;  5JTY A;  4TLM B;  2OCU A;  4OVJ A;  4U4S A;  2PBW A;  3TTK A;  3MWB A;  1XC1 A;  4YKP A;  1MH4 A;  1NL5 A;  1DPE A;  2F6G A;  2HAV A;  5KCJ A;  3LBS A;  4DCX A;  1URD A;  3O28 A;  1MY2 A;  4G2Z A;  1VR5 A;  4WED A;  1MM6 A;  2RCA A;  3PMW A;  2BJJ X;  2OK2 A;  3LR1 A;  5FHN A;  5IKB A;  3G3G A;  4EQB A;  2FNC A;  3PPQ A;  5I56 A;  1IXC A;  1R1N A;  3VVF A;  1ZIU A;  1BTJ A;  1RYX A;  2RCB A;  1H44 A;  1FQE A;  2HEU A;  4Q5T A;  4QSC A;  3KSX A;  3WAE A;  2RF1 A;  1IQ7 A;  4KFQ A;  4OES A;  2REJ A;  1D9Y A;  4JWY A;  4KD5 A;  4IO6 A;  4G68 A;  2AL4 A;  1LAX A;  4R6Y A;  3F11 A;  3TCF A;  5A5X B;  1D3K A;  1DSN A;  2Q9T A;  2V93 A;  3T96 B;  1QW0 A;  2GRV A;  2F8D A;  1N3W A;  3A3C A;  4R75 A;  3KJ7 A;  3KOS A;  1QUJ A;  3S9E A;  3SES A;  4I1D A;  2XXH A;  4OEU A;  3UK4 A;  2UVG A;  3TKD A;  1UIU A;  3UP9 A;  1SW1 A;  4GVO A;  4U1Z A;  2ZNS A;  1FQB A;  4F2Q A;  4RPN A;  2AL5 A;  1MXU A;  2B3B A;  4EQ7 A;  3KN7 A;  1NNT A;  4RK2 A;  3MP8 A;  1LB8 A;  3S2V A;  1II5 A;  1SW5 A;  5ELV A;  5I57 A;  1B3G A;  3E3K A;  1ANF A;  4RXL A;  1A7L A;  3DP4 A;  1O63 A;  3PPR A;  1P1W A;  2Y7R A;  3MVZ A;  1QUI A;  3UN6 A;  1OQH A;  1B32 A;  3QIM A;  4H67 A;  2CZL A;  4Q30 B;  3FZV A;  3M8U A;  1FQD A;  5TP9 A;  1NMU A;  4ELR A;  3FV2 A;  4ESX A;  4G68 B;  2W7Y A;  4GWO A;  5DTB A;  1SI0 A;  5I58 A;  5DEX A;  4OZ9 A;  3SEV A;  2OZZ A;  4EDP A;  1OIB A;  3UIF A;  3UA8 A;  4FJP A;  4YU0 A;  5CI5 A;  5L8D A;  3K2D A;  3K4U A;  1FQC A;  3GXA A;  4ZS9 A;  1LAG E;  3SDF A;  2HZK A;  5TPA A;  5I84 A;  3CR9 A;  1Y4T A;  1A55 A;  2I3W A;  4R6K A;  1B3E A;  2WKY A;  3RUM A;  1M5F A;  2PMS A;  1R9L A;  3IOR A;  3IJX B;  3CFZ A;  1BP5 A;  4QSD A;  3HN0 A;  3HHG A;  4THI A;  4GQO A;  1IIW A;  1YCJ A;  2F78 A;  5F1Q A;  3H3G A;  1BIY A;  3LSW A;  5EHS A;  4HCY A;  3K1P A;  2DWA A;  1NNP A;  4AB6 A;  1B3H A;  3TQL A;  5H8N B;  4BDN A;  3T9V A;  4QSE A;  4LZ5 A;  3IO6 A;  1CB6 A;  4H65 A;  2QJE A;  4WEP A;  1LAH E;  1SYI A;  3CFL A;  1MDP 1;  1Y9U A;  3UOR A;  3TTR A;  5L9S A;  3FAT A;  3OO8 A;  2UVJ A;  5AA4 B;  3B6Q A;  5H8H B;  2UVI A;  4ZDM A;  4U2R A;  3QXM A;  4O3A A;  3L6H A;  1IUD A;  4YB6 A;  1B40 A;  1XVX A;  2F7B A;  1M5C A;  2I49 A;  3MC2 A;  4OET A;  4NF8 B;  1Y1Z A;  2ESN A;  4X48 A;  3OXN A;  4XKR A;  2UYF A;  5CBR A;  5TPA B;  1PBQ A;  4HW8 A;  4ZEI A;  2DVC A;  5CBS A;  2O84 X;  2O1M A;  2XXP A;  1N0T A;  4NF4 A;  3OO7 A;  5I2K A;  3MJN A;  3HPI A;  1RKM A;  1SD3 A;  2VP1 A;  1MQD A;  2XD3 A;  4KHZ E;  3S9N C;  3RY3 A;  3FIR A;  3PUZ E;  5LOM A;  1QKA A;  1AL3 A;  2D3I A;  1SQY A;  3PUV E;  1B0H A;  1B5I A;  3GLB A;  3N26 A;  1I6A A;  4JSD A;  4YKJ A;  1MXZ A;  4EQ9 A;  3HST A;  1MS7 A;  4F1Y A;  5M2V A;  2Z8F A;  2QS3 A;  3A3U A;  3RT8 A;  1SW4 A;  2I4C A;  4GXA A;  3QYT A;  3OO9 A;  1P1O A;  5ITP A;  3VXC A;  5FHM A;  3S9M C;  5BWJ A;  4OQO A;  2I3V A;  1Y3Q A;  5AA3 A;  2M8C A;  1YPN A;  3IO4 A;  3O29 A;  3G3J A;  4OMB A;  2ZXT A;  1FW0 A;  2QS2 A;  2XXV A;  5ITO A;  1IXG A;  1M5B A;  1MQI A;  3S9L C;  3GBA A;  3ZS6 A;  4ELQ A;  5J1D A;  5CM6 A;  5CRY A;  2F35 A;  4C1U A;  3H4Z A;  1JW4 A;  1XS5 A;  1S9T A;  4X1D A;  2NVU B;  3AXF A;  1Y4C A;  2VHA A;  3TEP A;  1P1Q A;  4NF5 B;  3FXR A;  3U72 A;  1TFD A;  3IJO B;  2B3F A;  3PUX E;  2DOJ A;  4OTE A;  4G8H A;  3Q26 A;  3O9P A;  4GL8 A;  1EH3 A;  4TOZ A;  4LQ5 A;  3H06 B;  4YB5 A;  2XXU A;  5AA2 B;  1MXX A;  1MG1 A;  4NWC A;  5B7D A;  2F7C A;  1F9B A;  4R72 A;  3MZB A;  2PYY A;  4H8I A;  3CI8 A;  3MZ1 A;  3V5A A;  4OYV A;  4JB7 A;  4ZEK A;  4HCW A;  1Q1K A;  3PMV A;  1USY H;  4MF3 A;  3EF7 A;  1OVT A;  3C36 A;  1MPD A;  4GRK A;  3IAZ A;  3K6V A;  3V89 B;  2Q2A A;  5K2X A;  4PET A;  2P2A A;  4G4P A;  5I59 A;  3W9V A;  3QAX A;  4UAC A;  4C1T A;  4TQU Q;  2XXR A;  4KCD A;  1I6Q A;  4PQJ A;  2DXY A;  3TZA A;  4KCC A;  3M3L A;  3P7I A;  3OEK A;  4OFL A;  1BKA A;  4ZED A;  2GHB A;  3C31 A;  2VGQ A;  2ZYK A;  2YPN A;  4XTC Q;  1FTJ A;  3MQ9 A;  4H8J A;  2DS9 A;  2XX8 A;  3EN3 A;  1FTK A;  3THI A;  5AA2 D;  5EHM A;  4EUO A;  2O69 A;  4DDD A;  3C33 A;  2I0B A;  2PT1 A;  4DZ1 A;  4JBZ A;  1UTH B;  3FJ7 A;  3CG3 A;  2DQV A;  4AQ4 A;  3U92 A;  3O6I A;  1O64 A;  4HTG A;  3KGC A;  4IO4 A;  1B7U A;  5H8S A;  1SI1 A;  4U4X A;  3MVY A;  3D4G A;  2G29 A;  5FHO A;  4H1X A;  4YIC A;  3H7M A;  4IGR A;  2KLF A;  1MY4 A;  3GBB A;  3ZKK A;  2XXW A;  1D4N A;  4ESW A;  4GXS B;  1A54 A;  4XKP A;  3SEY A;  4MFI A;  2Q89 A;  1JVY A;  4QF9 A;  3K00 A;  3LC8 A;  3KFM A;  5JTY B;  3G3I A;  4GLI A;  3OEM A;  2D5W A;  1TXF A;  2I48 A;  4BDR A;  3JYR A;  3R7X A;  1DPP A;  5KCJ B;  1GTK A;  1VE4 A;  1GR2 A;  1US5 A;  2QS1 A;  5H8Q A;  4E0X A;  4TLL B;  3TUS A;  3R26 A;  1OQG A;  2R9J A;  4JWO A;  2O7I A;  3K01 A;  1US4 A;  4EXL A;  1B05 A;  4FE8 A;  1B52 A;  3VV5 A;  5I56 B;  3LSX A;  3HCQ A;  4DE8 A;  1P1N A;  2ZYO A;  4LP2 B;  3TTL A;  5FTH A;  3IOU A;  3OD7 A;  3VE1 B;  2RKM A;  2YLN A;  3K6X A;  1BLF A;  3MVX A;  2THI A;  2NOO A;  3O2A A;  4QFP A;  3USD A;  4U21 A;  2ONS A;  1JW1 A;  1PB8 A;  1OLC A;  3TDJ A;  4DXC A;  4LQ2 A;  4LUB A;  1MY1 A;  2UVH A;  4KYD A;  2XXX A;  2OJT A;  2IEE A;  3DLN A;  4YMA A;  3SER A;  2QPQ A;  1LBC A;  1GVC A;  2E0S A;  2NXO A;  1Y1M A;  1OLA A;  3H6V A;  2V25 A;  5B70 A;  4FAT A;  3N6T A;  4U22 A;  5KDT A;  3TTN A;  3T9H B;  1OMP A;  4P11 A;  1I69 A;  1NNK A;  2Z8D A;  3O6H A;  1S7Y A;  3O97 A;  1MQJ A;  1JET A;  4DXB A;  1N76 A;  4ZZA A;  3FAS A;  1P99 A;  4NE4 A;  1HSJ A;  3C4M A;  5HM4 B;  4QHQ A;  1JQF A;  2RIN A;  2ZYM A;  2VD3 A;  3O6G A;  3N5L A;  4F31 B;  5I57 B;  3FGS A;  4GD5 A;  4FOR A;  2RC8 A;  3KZG A;  4NED A;  3W9W A;  2XXQ A;  4ZE8 A;  3T22 A;  4HS7 A;  3CFX A;  3DM0 A;  2HQ0 A;  1QKB A;  3PD9 A;  1CE2 A;  3PPN A;  4ZE9 A;  1NFT A;  1SW2 A;  2HCA A;  1JEV A;  4GF8 A;  4KYE A;  5DT6 A;  2VOZ A;  3U93 A;  4EF2 A;  1EU8 A;  5IAI A;  1MQG A;  2Y7P A;  3H6U A;  3RGY A;  3BFT A;  4POX A;  3FJM A;  4XIG Q;  5TP9 B;  4QFL A;  4IO3 A;  3TEL A;  3IB0 A;  4OFO A;  4XXU A;  1MDQ A;  3ZKL A;  2I6E A;  4ZZE A;  5I58 B;  5DEX B;  3ILU B;  2A5T A;  3PUW E;  5ICT A;  4G8N A;  4R73 A;  3SEU A;  1QVS A;  4F18 A;  2Z22 A;  1DTZ A;  1N3X A;  5L9M A;  4NWD A;  3C32 A;  1A40 A;  5CMM A;  2OWT A;  2XD2 A;  3KSJ A;  3U1O A;  3LSF B;  1SDX A;  5ISU A;  4KPT A;  1B6H A;  2NUV A;  1EZP A;  2E1S A;  2R6G E;  5EYF A;  1ATG A;  4IO7 A;  3DP6 A;  1B4Z A;  2V3U A;  2O6A A;  2ANJ A;  4XKN A;  3LUY A;  2XXY A;  4GL0 A;  5DYH A;  1JNF A;  3WAF A;  4L17 A;  1TT1 A;  5CMB A;  4YKI A;  4R6H A;  3RNN A;  3RPW A;  2O51 A;  4RYA A;  4EF1 A;  4GOT A;  2CMO A;  4IY6 A;  3LSL A;  3MP1 A;  2ZMB A;  5BUU A;  1B7Z A;  3ONM A;  1SBP A;  3H03 A;  2QL3 A;  2X7Q A;  3R6U A;  4F1V A;  4PP0 A;  1LCT A;  2H99 A;  3EHS A;  2F6P A;  2X7P A;  5DVF A;  4Z7E A;  2DE3 A;  4KQP A;  4N07 A;  3K1N A;  2A5T B;  1A8F A;  1TWY A;  4F1U A;  2DYX A;  1ZU0 A;  2Y7K A;  5HBC A;  4F3G A;  3H6T A;  4OHN A;  3HO7 A;  1QUL A;  2H4I A;  1L5T A;  1XVY A;  1ZKB A;  3MZ9 A;  2HFB A;  3SET A;  3CG1 A;  3VLU A;  3MPK A;  1NH7 A;  4JXI A;  5H8F A;  1EZO A;  4G68 C;  1MPB A;  2PT2 A;  1POY 1;  3TMG A;  2Y7I A;  3KOT A;  3IR1 A;  2ZNU A;  4NF4 B;  3OSQ A;  4ELP A;  4RK9 A;  5I2K B;  3IOT A;  4K3F A;  1B3L A;  3DEL B;  1MQH A;  1B7H A;  1B51 A;  4KR5 A;  3G3F A;  2B65 A;  3UGW A;  1FTM A;  1OVB A;  1P1U A;  4WKM A;  4ISU A;  2G93 A;  3D4C A;  4KI0 E;  2DE2 A;  1LFG A;  4ZEB A;  2RC7 A;  2O1L A;  3OOA A;  4YAH X;  3IOV A;  4BDQ A;  3C34 A;  2VD2 A;  5L9O A;  2DWH A;  3TTM A;  4GIZ A;  1PEB A;  2O68 A;  1B58 A;  3OEL A;  1RYO A;  1DMB A;  1LBB A;  3OEN A;  2ZYN A;  3Q29 A;  4X1B A;  5JEI A;  1LLS A;  5A5X A;  2Y84 A;  3EHU A;  3IOW A;  3CRB A;  3PMX A;  3VFJ A;  4DXU A;  3B6T A;  3PU5 A;  4DCY A;  2GFE A;  4OFJ A;  4LZ7 A;  3MP6 A;  1VSO A;  2AYS A;  5AA1 A;  1N7X A;  1URG A;  2OLB A;  2H25 A;  2V84 A;  3C35 A;  2O7U A;  3CSB A;  1LGB C;  4YB7 A;  2NWJ A;  2XX9 A;  3ZSF A;  3FVO A;  3PGF A;  3SEX A;  5H8F B;  1IIT A;  4LAT A;  4ND9 A;  1JEU A;  4R9F A;  1PDA A;  4R74 A;  1IXH A;  3CIJ A;  4RY1 A;  3MW0 A;  3IB2 A;  3FD3 A;  4FEC A;  3V8X B;  3OSR A;  3B7D A;  3JV9 A;  5DVI A;  1B2H A;  1VFE A;  2PVU A;  2Z8E A;  3W15 C;  4IO2 A;  3VLW A;  2H98 A;  4KYS A;  4H6D A;  4LZ8 A;  3FXQ A;  1LB9 A;  3EHT A;  4OEN A;  2A5S A;  1J1N A;  4P0G A;  2F97 A;  4ZEC A;  1B1H A;  3I3V A;  1B1X A;  3E4R A;  3TQW A;  3KN8 A;  2Z23 A;  4DLD A;  4R2B A;  1N04 A;  4ELO A;  1IZ1 A;  4IY5 A;  4PFU A;  4BDL A;  3BKI B;  3FUZ A;  3L6G A;  3S4U A;  1MH3 A;  3Q27 A;  1S50 A;  1TFA A;  2F36 A;  2REG A;  3VLV A;  5I59 B;  3OO6 A;  2FYI A;  5K2Y A;  2GHA A;  4H5G A;  4IB2 A;  3SEW A;  1ELJ A;  2ZNT A;  1AMF A;  4LON B;  4MBP A;  2H9B A;  1PBP A;  1FTL A;  5I2N A;  2DP8 A;  4NTL A;  4LVQ A;  1HSE A;  1MY3 A;  1DTG A;  1ZBM A;  1IXI A;  4U23 A;  1B46 A;  3IB1 A;  3VXB A;  3CVG A;  4Z0I A;  1ZTY A;  1A99 A;  5F7V A;  1FQF A;  4BDM A;  1URS A;  4ECF A;  3GZG A;  4F19 A;  4YMB A;  1PC3 A;  1UTB A;  3T9U A;  4IGT A;  3QK6 A;  4NMY A;  3MPL A;  1N84 A;  2QMX A;  4G8M A;  2XXI A;  1QUK A;  1PB7 A;  4RNS A;  4I9D A;  1POT A;  2AIX A;  2DWJ A;  3TCG A;  2UYE A;  4YZZ A;  1MXY A;  4EXK A;  4GFR A;  3C9H A;  3HV1 A;  1GGG A;  3OMB A;  2V3T A;  3IK6 B;  4M1V A;  3BBR A;  3RQT A;  5H8N A;  3EQ1 A;  4MH5 A;  1D9V A;  4XKQ A; 
#chains in the Genus database with same CATH topology
 1IME A;  4F3B A;  3MUQ A;  2IA4 A;  1H45 A;  1YAE A;  1FBE A;  2VT5 A;  2I4B A;  3SKP A;  5DW8 A;  2B4L A;  1WOD A;  2D21 A;  2F34 A;  1Y20 A;  2P1S A;  4GWZ A;  1B3F A;  4U1O A;  2QVR A;  1DOT A;  4PE5 B;  1B9J A;  1BK4 A;  1XHY A;  1SPI A;  1B5J A;  3RN8 A;  4E0W A;  4C0R A;  2ALU A;  3PPO A;  5AA4 A;  1G0I A;  1SVX B;  4NAP A;  5H8H A;  1A8E A;  4N6K A;  3KJT A;  2HXW A;  4ZEF A;  4FAJ A;  2QFL A;  5KZT A;  1ZMG A;  1Z7N E;  1LFI A;  3KEI A;  4BDO A;  3RT6 B;  3FJG A;  4P1L A;  1N7W A;  2Q88 A;  4NF8 A;  4QFO A;  3N6U A;  1AH5 A;  3U8Q A;  4N13 A;  1QJM A;  2F7A A;  3BFU A;  5H8Q B;  1H3D A;  4MX6 A;  1Y3N A;  4NF6 A;  4PFW A;  3TYH A;  2QRY A;  5EQ9 A;  4AS5 A;  5I2N B;  4HE2 A;  2QSX A;  4YKK A;  2Q2C A;  1R9Q A;  2DSF A;  1KWH A;  4OXV A;  3MVW A;  4F39 A;  4H5F A;  1UIV A;  5ET6 A;  5I7I A;  3K02 A;  4JDF A;  3EKI A;  5ET7 A;  1MY0 A;  4P0I A;  1CNQ A;  1UTB B;  4F3S A;  4QRZ A;  3KN3 A;  1FSA A;  1FCK A;  2LAO A;  4PFI A;  1FBF A;  3T66 A;  1Q9D A;  1DK4 A;  5CMK A;  2DE4 A;  5LTC A;  1NV1 A;  4WXJ A;  1B5H A;  1B0L A;  3T93 B;  1VFD A;  1ZJL A;  1T0K A;  1NNF A;  2OWS A;  1UQW A;  5FBP A;  3K0V A;  2HZL A;  3E9X A;  4OVQ A;  4DIG A;  4M4G A;  3T9X B;  1LCF A;  2HHM A;  1MRP A;  4MLV A;  3CSG A;  2GH9 A;  3U94 A;  3FVG A;  3I5O A;  1LBW A;  3DP8 A;  1NKX A;  3Q28 A;  3IX1 A;  2PX1 A;  3D1R A;  3TPA A;  2QMW A;  4OAN A;  3TOD A;  4PBH A;  2DVZ A;  4P8B A;  4GBW A;  2Y7W A;  1AWB A;  3E13 X;  3K6W A;  2P0S A;  3KG2 A;  5DVJ A;  1DBZ A;  5KDT B;  1Y3P A;  4MNC A;  1FRP A;  1NH8 A;  2ONR A;  1HSL A;  2I0C A;  4H0W A;  5IZ3 A;  2ONK E;  4QFK A;  4NF6 B;  4X9T A;  2XHD A;  2F5X A;  4NF5 A;  5HPQ A;  4PCD A;  5AE4 A;  1FPB A;  4I3E A;  4RJZ A;  4O94 A;  1LAF E;  1JVX A;  5JK4 A;  3N94 A;  3E79 A;  2V3Q A;  4RA1 A;  3IFC A;  4N6P A;  5AA2 A;  2XXT A;  4PAF A;  2RC9 A;  3RTW B;  3K1M A;  2R71 A;  4O8M A;  2FBP A;  4FEB A;  3V83 A;  1LFH A;  3HHF A;  3LV0 A;  1O7T A;  3A09 A;  4GWU A;  5TU0 A;  3KBR A;  3EPE A;  1RDX A;  1PB9 A;  4MCO A;  2FA7 A;  3FVK A;  2ABH A;  3QSL A;  4F22 A;  1AOV A;  2QS4 A;  2FIE A;  1IEJ A;  4IO5 A;  5EQA A;  1WVJ A;  4G77 A;  3PV0 E;  3PPP A;  1MM7 A;  3TAJ A;  3ODB A;  3ILT B;  4LN5 A;  4R9G A;  1MXV A;  1R6Z A;  4MLQ A;  1AIV A;  1Q35 A;  4HXV A;  4O3B A;  4PFY A;  1KA1 A;  1H76 A;  2HAU A;  4FED A;  5CC2 A;  3G3H A;  3B6W A;  3MAM A;  2WBD A;  4PDH A;  3PUY E;  1LBY A;  5ICQ A;  4I8C A;  1FPF A;  3I6V A;  3IL1 B;  1GV8 A;  4UAB A;  3G7W A;  3JZJ A;  4I62 A;  3QUJ A;  4AB5 A;  4BLA A;  4OVR A;  4Q8R A;  3K6U A;  2DDK A;  4RPO A;  3FV1 A;  1M5E A;  3TCH A;  4POW A;  5FTI A;  4O3C A;  1Z7M E;  1USY E;  4Q0C A;  1MPC A;  2ZZX A;  1ZLQ A;  3M3F A;  1B4H A;  4OER A;  1XOC A;  1SYH A;  1LST A;  4UA8 A;  2DWI A;  1FBP A;  2OBG A;  1EZ9 A;  4JSO A;  1M5D A;  1UTH A;  3QUF A;  3VDF A;  4LA9 A;  4OEV A;  3ECR A;  2XWV A;  4F3P A;  2X26 A;  4N8G A;  3VVE A;  1MXW A;  2YJP A;  3BIH A;  3PD8 A;  5CMC A;  4F2O A;  3FXU A;  3TFL A;  2I58 A;  4GWW A;  3RTF B;  4OWD A;  2UXA A;  2DXR A;  3VVD A;  4OVP A;  1H43 A;  4PFT A;  3H6W A;  1XT8 A;  3FVN A;  1FTO A;  4H45 A;  1JW5 A;  3Q25 A;  1YTV A;  3M3K A;  2Q8J A;  3RLF E;  1FPE A;  4F29 A;  2XX7 A;  4ONY A;  4JWX A;  1FQA A;  4FIM A;  4QFN A;  3MBP A;  3RPL B;  2H5Y A;  1WDN A;  4R2F A;  1I6B A;  3O66 A;  3G3K A;  5JTY A;  4TLM B;  2OCU A;  4OVJ A;  4U4S A;  2PBW A;  3TTK A;  5ET5 A;  3MWB A;  1XC1 A;  4YKP A;  1MH4 A;  1NL5 A;  4P9K A;  1DPE A;  2F6G A;  2HAV A;  5KCJ A;  3LBS A;  4DCX A;  1URD A;  4P1E A;  3O28 A;  1MY2 A;  4G2Z A;  1VR5 A;  4WED A;  1MM6 A;  2RCA A;  3PMW A;  2BJJ X;  2OK2 A;  3LR1 A;  5FHN A;  5IKB A;  3G3G A;  3HFU A;  4EQB A;  2FNC A;  3PPQ A;  5I56 A;  1IXC A;  1R1N A;  4X8R A;  3VVF A;  1ZIU A;  4IR8 A;  1BTJ A;  1RYX A;  2RCB A;  1NV5 A;  1H44 A;  1FQE A;  2HEU A;  4Q5T A;  2QVU A;  4QSC A;  4PF6 A;  4I3Y A;  1NV7 A;  1RDZ A;  1QGX A;  3KSX A;  3WAE A;  2OWZ A;  2RF1 A;  1IQ7 A;  4KFQ A;  4OES A;  2REJ A;  1D9Y A;  4JWY A;  2PFY A;  4KD5 A;  1FPI A;  4IO6 A;  4G68 A;  1IMC A;  2Q8M A;  2AL4 A;  1LAX A;  4R6Y A;  3F11 A;  3TCF A;  5A5X B;  1NUW A;  1D3K A;  4PF8 A;  1DSN A;  1IMB A;  2Q9T A;  2V93 A;  3T96 B;  1QW0 A;  2GRV A;  1VDW A;  2F8D A;  1RDY A;  1N3W A;  3A3C A;  4R75 A;  5ESY A;  3KJ7 A;  3KOS A;  1QUJ A;  3T0J A;  3S9E A;  3SES A;  4I1D A;  2XXH A;  4OEU A;  3UK4 A;  2UVG A;  3TKD A;  4GX3 A;  1UIU A;  3UP9 A;  4MMP A;  1SW1 A;  4GVO A;  4U1Z A;  2ZNS A;  1FQB A;  4F2Q A;  4RPN A;  2FVZ A;  4N6D A;  4N4U A;  2AL5 A;  1MXU A;  2B3B A;  4EQ7 A;  3KN7 A;  1NNT A;  4RK2 A;  5IZZ A;  3MP8 A;  4PFR A;  1LB8 A;  3S2V A;  1II5 A;  1SW5 A;  5ELV A;  5I57 A;  2F3B A;  1B3G A;  3E3K A;  1ANF A;  4RXL A;  1A7L A;  3DP4 A;  1O63 A;  3PPR A;  1P1W A;  4GBV A;  2Y7R A;  3RYD A;  1NV6 A;  3MVZ A;  1QUI A;  3UN6 A;  1OQH A;  1B32 A;  3QIM A;  4H67 A;  2CZL A;  4Q30 B;  3FZV A;  3M8U A;  1FQD A;  2V4C A;  5TP9 A;  1NMU A;  4ELR A;  3FV2 A;  4ESX A;  4G68 B;  2W7Y A;  4GWO A;  5DTB A;  1SI0 A;  5I58 A;  5DEX A;  1NUZ A;  4OZ9 A;  1IMF A;  3SEV A;  2OZZ A;  4EDP A;  1OIB A;  1K9Z A;  3UIF A;  3UA8 A;  4FJP A;  4YU0 A;  5CI5 A;  5L8D A;  3K2D A;  3K4U A;  1FQC A;  3GXA A;  4ZS9 A;  1LAG E;  3SDF A;  2HZK A;  5TPA A;  5I84 A;  3CR9 A;  1Y4T A;  1A55 A;  2I3W A;  2R8T A;  4R6K A;  1B3E A;  2WKY A;  3RUM A;  1FPG A;  1M5F A;  2PMS A;  1R9L A;  3IOR A;  2VPO A;  3IJX B;  4I40 A;  1NV4 A;  4N15 A;  3CFZ A;  1BP5 A;  1NUY A;  4QSD A;  5IZ1 A;  4GWX A;  3HN0 A;  3HHG A;  4THI A;  4GQO A;  1IIW A;  1YCJ A;  2F78 A;  5F1Q A;  3H3G A;  1BIY A;  3LSW A;  5EHS A;  5IGA A;  5IM2 A;  4HCY A;  3K1P A;  2DWA A;  1NNP A;  4AB6 A;  4PBQ A;  1B3H A;  3TQL A;  4XF5 A;  5H8N B;  4BDN A;  3T9V A;  4DI3 D;  4QSE A;  4LZ5 A;  3IO6 A;  1CB6 A;  4H65 A;  2QJE A;  4WEP A;  1LAH E;  4PGP A;  2B4M A;  1SYI A;  2HXR A;  3CFL A;  1MDP 1;  1Y9U A;  3UOR A;  4P3L A;  2PFZ A;  4N8Y A;  3TTR A;  5L9S A;  3FAT A;  3OO8 A;  2UVJ A;  4QBA A;  5AA4 B;  3B6Q A;  5H8H B;  2UVI A;  4ZDM A;  4U2R A;  4MJO A;  3QXM A;  4O3A A;  3L6H A;  1IUD A;  4YB6 A;  1B40 A;  1XVX A;  4NG7 A;  4HE0 A;  2F7B A;  1M5C A;  2I49 A;  3MC2 A;  4OET A;  4NF8 B;  1Y1Z A;  2ESN A;  4NN3 A;  5LDZ A;  4X48 A;  3OXN A;  3U65 A;  4XKR A;  2UYF A;  5CBR A;  5TPA B;  1PBQ A;  4HW8 A;  4ZEI A;  2DVC A;  5CBS A;  1G0H A;  2O84 X;  2O1M A;  1KZ8 A;  2XXP A;  1N0T A;  4N91 A;  4NF4 A;  3OO7 A;  5I2K A;  3MJN A;  3HPI A;  1RKM A;  2ZZV A;  1SD3 A;  2VP1 A;  1MQD A;  2XD3 A;  4KHZ E;  3S9N C;  3FIR A;  3RY3 A;  3PUZ E;  5LOM A;  1LBZ A;  1QKA A;  2Q74 A;  1AL3 A;  3GYY A;  2D3I A;  1SQY A;  3PUV E;  1B0H A;  1B5I A;  3GLB A;  3N26 A;  1I6A A;  4JSD A;  4YKJ A;  1MXZ A;  3HST A;  4EQ9 A;  1MS7 A;  4F1Y A;  5M2V A;  2Z8F A;  2QS3 A;  3A3U A;  3RT8 A;  1SW4 A;  2I4C A;  3SZP A;  4GXA A;  2F3D A;  3QYT A;  3OO9 A;  1P1O A;  1EYI A;  5ITP A;  3VXC A;  5FHM A;  3KC1 A;  4DI4 B;  3S9M C;  5BWJ A;  4P47 A;  4OQO A;  2WEF A;  2I3V A;  1Y3Q A;  5AA3 A;  2M8C A;  1YPN A;  3IO4 A;  3O29 A;  3G3J A;  4OMB A;  1LEV A;  2ZXT A;  1FW0 A;  2QS2 A;  2XXV A;  5ITO A;  1IXG A;  4XFE A;  2KR0 A;  2CEX A;  1M5B A;  1MQI A;  3S9L C;  4OVT A;  3GBA A;  4AS4 A;  3ZS6 A;  1FBG A;  3B8B A;  4ELQ A;  1D9Q A;  4PC9 A;  3CHG A;  5J1D A;  5CM6 A;  5CRY A;  2F35 A;  4XEQ A;  4C1U A;  3MYU A;  3H4Z A;  5IZ3 B;  1JW4 A;  1XS5 A;  1S9T A;  4X1D A;  5ET8 A;  2NVU B;  3AXF A;  1Y4C A;  2VHA A;  3TEP A;  1P1Q A;  4NF5 B;  3FXR A;  3U72 A;  1TFD A;  4PTK A;  3IJO B;  2B3F A;  3PUX E;  2DOJ A;  4OTE A;  4G8H A;  1YXI A;  3Q26 A;  3O9P A;  4GL8 A;  1EH3 A;  4TOZ A;  4N81 A;  4LQ5 A;  3H06 B;  4YB5 A;  2XXU A;  5AA2 B;  1MXX A;  1MG1 A;  4NWC A;  5B7D A;  2F7C A;  1F9B A;  1YYZ A;  3KC0 A;  4R72 A;  3MZB A;  2PYY A;  4XKQ A;  4H8I A;  3CI8 A;  3MZ1 A;  3V5A A;  2XA5 A;  4OYV A;  4JB7 A;  4ZEK A;  4HCW A;  1Q1K A;  3PMV A;  1USY H;  4MF3 A;  3EF7 A;  1IMD A;  1OVT A;  3C36 A;  1MPD A;  4GRK A;  3IAZ A;  3K6V A;  3V89 B;  2Q2A A;  5K2X A;  4PET A;  2P2A A;  4G4P A;  5I59 A;  3W9V A;  3QAX A;  1JP4 A;  3B50 A;  4UAC A;  4C1T A;  4TQU Q;  2XXR A;  4KCD A;  1I6Q A;  4PQJ A;  2DXY A;  3TZA A;  4KCC A;  3M3L A;  3P7I A;  3OEK A;  4OFL A;  1BKA A;  4GWY A;  4O7M A;  4ZED A;  2GHB A;  4PAI A;  2CEY A;  3C31 A;  2VGQ A;  2ZYK A;  2YPN A;  4XTC Q;  3IFA A;  1FTJ A;  4MHF A;  3MQ9 A;  4H8J A;  2DS9 A;  2XX8 A;  3EN3 A;  1FTK A;  2FIX A;  3THI A;  5AA2 D;  5EHM A;  4EUO A;  1YZ0 A;  2O69 A;  3PTY A;  4DDD A;  3C33 A;  4PFB A;  2I0B A;  4KXP A;  2PT1 A;  4DZ1 A;  4JBZ A;  1UTH B;  3FJ7 A;  3CG3 A;  2DQV A;  3E78 A;  4AQ4 A;  4N17 A;  4GWS A;  3U92 A;  3O6I A;  1O64 A;  4HTG A;  3KGC A;  4IO4 A;  1B7U A;  1KA0 A;  5H8S A;  1SI1 A;  2XWI A;  4U4X A;  3MVY A;  3D4G A;  2G29 A;  5FHO A;  4H1X A;  4YIC A;  3H7M A;  4IGR A;  1XI6 A;  2KLF A;  1MY4 A;  3GBB A;  5F24 A;  3ZKK A;  2XXW A;  4MEV A;  1FJ6 A;  1D4N A;  4ESW A;  5I5P A;  4MNI A;  4GXS B;  1A54 A;  4XKP A;  3SEY A;  4MFI A;  1FPK A;  2Q89 A;  1JVY A;  4QF9 A;  3K00 A;  3LC8 A;  3MST A;  3KFM A;  5JTY B;  1LBV A;  3QMF A;  2WX9 A;  3G3I A;  4GLI A;  5EQ7 A;  3OEM A;  2D5W A;  1TXF A;  2I48 A;  4PDD A;  4BDR A;  3JYR A;  3R7X A;  1DPP A;  5KCJ B;  1GTK A;  1VE4 A;  1GR2 A;  1US5 A;  2QS1 A;  5H8Q A;  4E0X A;  5EQ8 A;  4TLL B;  3TUS A;  3R26 A;  1NV0 A;  1OQG A;  2R9J A;  4JWO A;  2O7I A;  2FHY A;  3K01 A;  1US4 A;  2XWO A;  4EXL A;  1B05 A;  4FE8 A;  4G61 A;  2QVV A;  1B52 A;  3VV5 A;  5I56 B;  3LSX A;  5EYH A;  4NHB A;  3HCQ A;  4X04 A;  4DE8 A;  1P1N A;  2ZYO A;  4MNP A;  4LP2 B;  3TTL A;  5FTH A;  3IOU A;  3OD7 A;  3VE1 B;  2RKM A;  2YLN A;  3K6X A;  1BLF A;  1DCU A;  3MVX A;  2THI A;  2MKZ A;  2NOO A;  3O2A A;  4QFP A;  3USD A;  1NV2 A;  4U21 A;  2ONS A;  1JW1 A;  1PB8 A;  1OLC A;  3TDJ A;  4DXC A;  4LQ2 A;  4QXD A;  5T3J A;  4LUB A;  1MY1 A;  2UVH A;  4KYD A;  2XXX A;  2PCR A;  2OJT A;  2IEE A;  3DLN A;  2L5V A;  3SER A;  2VPN A;  4YMA A;  2QPQ A;  1LBC A;  1GVC A;  2E0S A;  2NXO A;  2Y5K A;  1Y1M A;  1OLA A;  3H6V A;  5J16 A;  2V25 A;  5B70 A;  4FAT A;  3N6T A;  4U22 A;  5KDT A;  3TTN A;  3T9H B;  1OMP A;  4P11 A;  1I69 A;  1NNK A;  4H46 A;  2Z8D A;  3O6H A;  1S7Y A;  3O97 A;  1MQJ A;  1JET A;  4DXB A;  1FPL A;  1N76 A;  3FAS A;  4NE4 A;  1P99 A;  4ZZA A;  1HSJ A;  3C4M A;  5HM4 B;  4QHQ A;  1JQF A;  2RIN A;  4MAG A;  2ZYM A;  2VD3 A;  3O6G A;  3N5L A;  4F31 B;  5I57 B;  3FGS A;  4GD5 A;  4HE1 A;  4FOR A;  2RC8 A;  3KZG A;  4NED A;  3W9W A;  1EYJ A;  2XXQ A;  4ZE8 A;  3T22 A;  4HS7 A;  3CFX A;  3DM0 A;  5I3S A;  2HQ0 A;  1EYK A;  1QKB A;  3PD9 A;  1CE2 A;  3PPN A;  4ZE9 A;  1NFT A;  1SW2 A;  2HCA A;  3ROJ A;  1JEV A;  4GF8 A;  4KYE A;  5DT6 A;  2VOZ A;  3U93 A;  4EF2 A;  1EU8 A;  5IAI A;  1FBD A;  2Y5L A;  1MQG A;  2Y7P A;  3H6U A;  3BFT A;  3RGY A;  4POX A;  3FJM A;  4XIG Q;  5TP9 B;  4QFL A;  4IO3 A;  3TEL A;  3IB0 A;  4OFO A;  4XXU A;  2XWK A;  4JVI A;  1MDQ A;  3ZKL A;  2I6E A;  4ZZE A;  5I58 B;  5DEX B;  3ILU B;  2A5T A;  3PUW E;  1FBC A;  2P3V A;  1IMA A;  5ICT A;  4G8N A;  4R73 A;  2BJI A;  3SEU A;  1QVS A;  2HPG A;  1FPD A;  4F18 A;  2Z22 A;  1DTZ A;  1N3X A;  5L9M A;  4NWD A;  3C32 A;  1A40 A;  5CMM A;  2OWT A;  3LUZ A;  2XD2 A;  3KSJ A;  3U1O A;  3LSF B;  1SDX A;  5ISU A;  4KPT A;  1B6H A;  2NUV A;  3T1B A;  1EZP A;  2E1S A;  2R6G E;  5EYF A;  1ATG A;  4IO7 A;  3DP6 A;  1B4Z A;  2V3U A;  2O6A A;  2ANJ A;  4XKN A;  3LUY A;  2XXY A;  4GL0 A;  5DYH A;  1JNF A;  3WAF A;  4L17 A;  1K9Y A;  1TT1 A;  5CMB A;  4YKI A;  2CZH A;  4R6H A;  3RNN A;  3RPW A;  2O51 A;  4RYA A;  4EF1 A;  4GOT A;  2CMO A;  4IY6 A;  3LSL A;  3MP1 A;  2ZMB A;  5BUU A;  1B7Z A;  3ONM A;  1SBP A;  3H03 A;  2QL3 A;  2X7Q A;  3R6U A;  4P56 A;  4F1V A;  4PP0 A;  1LCT A;  2H99 A;  1FTA A;  3EHS A;  2F6P A;  4OA4 A;  4PAK A;  2X7P A;  5DVF A;  4Z7E A;  2XXK A;  2DE3 A;  3RPL A;  5A5L A;  4KQP A;  4N07 A;  3K1N A;  2A5T B;  1A8F A;  1TWY A;  4F1U A;  2DYX A;  1ZU0 A;  2Y7K A;  5HBC A;  4F3G A;  3H6T A;  4OHN A;  3HO7 A;  1QUL A;  2H4I A;  1L5T A;  1XVY A;  1ZKB A;  3MZ9 A;  2HFB A;  3SET A;  3CG1 A;  3VLU A;  2P3N A;  3MPK A;  1NH7 A;  4JXI A;  5H8F A;  1EZO A;  4G68 C;  1MPB A;  2PT2 A;  1POY 1;  3TMG A;  2Y7I A;  3KOT A;  3IR1 A;  2ZNU A;  4NF4 B;  3OSQ A;  4ELP A;  4RK9 A;  5I2K B;  3IOT A;  4K3F A;  1B3L A;  3DEL B;  1MQH A;  1B7H A;  1B51 A;  4KR5 A;  3G3F A;  2B65 A;  3UGW A;  1FTM A;  1OVB A;  1P1U A;  4WKM A;  4ISU A;  2WYK A;  2G93 A;  3D4C A;  3FBP A;  4KI0 E;  2DE2 A;  1LFG A;  3FXB A;  4ZEB A;  2RC7 A;  1FJ9 A;  2O1L A;  3OOA A;  4YAH X;  3IOV A;  4BDQ A;  3C34 A;  2VD2 A;  5L9O A;  2DWH A;  3TTM A;  4GIZ A;  1NV3 A;  1PEB A;  2O68 A;  1B58 A;  3OEL A;  1RYO A;  1DMB A;  1LBB A;  3OEN A;  2ZYN A;  3Q29 A;  4X1B A;  4PE3 A;  5JEI A;  1LLS A;  5A5X A;  2Y84 A;  3EHU A;  1FPJ A;  4NF0 A;  3IOW A;  3CRB A;  3PMX A;  3VFJ A;  4DXU A;  3B6T A;  3PU5 A;  4DCY A;  2GFE A;  4OFJ A;  2WBB A;  4LZ7 A;  3MP6 A;  1VSO A;  2AYS A;  5AA1 A;  4O7I A;  1N7X A;  1URG A;  2OLB A;  4GX4 A;  2H25 A;  2V84 A;  3C35 A;  2O7U A;  3CSB A;  1LGB C;  4YB7 A;  2CZI A;  2NWJ A;  1NI9 A;  4NX1 A;  2XX9 A;  3ZSF A;  3FVO A;  3PGF A;  2JJK A;  4JVC A;  5H8F B;  1IIT A;  3SEX A;  1INP A;  4LAT A;  1LBX A;  4OVS A;  4ND9 A;  1JEU A;  4R9F A;  1PDA A;  2KQZ A;  4R74 A;  1IXH A;  3CIJ A;  4RY1 A;  3MW0 A;  2CZK A;  3IB2 A;  3FD3 A;  4FEC A;  3V8X B;  3OSR A;  4NQ8 A;  3B7D A;  3JV9 A;  1FBH A;  5DVI A;  1B2H A;  4NGU A;  1VFE A;  2PVU A;  2Z8E A;  3W15 C;  4IO2 A;  3VLW A;  2H98 A;  4KYS A;  4H6D A;  3NOH A;  4LZ8 A;  3FXQ A;  1LB9 A;  3EHT A;  4OEN A;  2A5S A;  1J1N A;  4P0G A;  2F97 A;  4FBP A;  2WYP A;  4ZEC A;  1B1H A;  3I3V A;  1B1X A;  3E4R A;  3TQW A;  3KN8 A;  2Z23 A;  4DLD A;  4R2B A;  3ISP A;  1N04 A;  4ELO A;  1IZ1 A;  4IY5 A;  1NUX A;  4PFU A;  3BKI B;  3FUZ A;  4GX6 A;  4BDL A;  3L6G A;  3S4U A;  1MH3 A;  3Q27 A;  1S50 A;  1TFA A;  2F36 A;  2REG A;  3VLV A;  5I59 B;  3OO6 A;  2FYI A;  5K2Y A;  2GHA A;  4H5G A;  4IB2 A;  3SEW A;  1ELJ A;  5EYG A;  2ZNT A;  1AMF A;  4LON B;  4MBP A;  2H9B A;  1PBP A;  1FTL A;  5I2N A;  2DP8 A;  4NTL A;  3A29 A;  4LVQ A;  1HSE A;  1MY3 A;  1DTG A;  1ZBM A;  1IXI A;  4U23 A;  3BIG A;  1B46 A;  3IB1 A;  3VXB A;  3CVG A;  4Z0I A;  1ZTY A;  2OX3 A;  2ZZW A;  1A99 A;  3KBZ A;  5F7V A;  1FQF A;  4JVD A;  4BDM A;  4MIJ A;  1URS A;  4ECF A;  3GZG A;  4F19 A;  4YMB A;  1PC3 A;  1UTB A;  3T9U A;  4IGT A;  3QK6 A;  4NMY A;  3MPL A;  1N84 A;  2QMX A;  4G8M A;  2XXI A;  1QUK A;  1PB7 A;  4RNS A;  4I9D A;  1POT A;  2AIX A;  2DWJ A;  2UYE A;  3TCG A;  4YZZ A;  1MXY A;  4EXK A;  4GFR A;  3C9H A;  3HV1 A;  1GGG A;  3OMB A;  2V3T A;  3IK6 B;  4M1V A;  3BBR A;  3RQT A;  5H8N A;  3EQ1 A;  4PGN A;  4MH5 A;  1D9V A;  2GQ1 A; 
#chains in the Genus database with same CATH homology
 4F3B A;  3MUQ A;  2IA4 A;  1H45 A;  1YAE A;  2I4B A;  3SKP A;  1WOD A;  2D21 A;  2F34 A;  1Y20 A;  2P1S A;  1B3F A;  4U1O A;  1DOT A;  4PE5 B;  1B9J A;  1XHY A;  1B5J A;  3RN8 A;  4E0W A;  4C0R A;  2ALU A;  3PPO A;  5AA4 A;  1SVX B;  5H8H A;  1A8E A;  3KJT A;  2HXW A;  4ZEF A;  4FAJ A;  5KZT A;  1ZMG A;  1Z7N E;  1LFI A;  3KEI A;  4BDO A;  3RT6 B;  3FJG A;  1N7W A;  2Q88 A;  4NF8 A;  4QFO A;  3N6U A;  1AH5 A;  3U8Q A;  4N13 A;  1QJM A;  2F7A A;  3BFU A;  5H8Q B;  1H3D A;  1Y3N A;  4NF6 A;  4PFW A;  3TYH A;  2QRY A;  5I2N B;  2QSX A;  4YKK A;  2Q2C A;  1R9Q A;  2DSF A;  1KWH A;  4OXV A;  3MVW A;  4F39 A;  4H5F A;  1UIV A;  3K02 A;  4JDF A;  1MY0 A;  4P0I A;  1UTB B;  4F3S A;  4QRZ A;  3KN3 A;  1FCK A;  2LAO A;  3T66 A;  5CMK A;  2DE4 A;  4WXJ A;  1B5H A;  1B0L A;  3T93 B;  1VFD A;  1ZJL A;  1T0K A;  1NNF A;  2OWS A;  1UQW A;  3K0V A;  2HZL A;  3E9X A;  4DIG A;  4M4G A;  3T9X B;  1LCF A;  1MRP A;  4MLV A;  3CSG A;  2GH9 A;  3U94 A;  3FVG A;  3I5O A;  3DP8 A;  1NKX A;  3Q28 A;  3IX1 A;  2PX1 A;  3TPA A;  2QMW A;  3TOD A;  2DVZ A;  2Y7W A;  3E13 X;  3K6W A;  2P0S A;  3KG2 A;  5DVJ A;  5KDT B;  1Y3P A;  1NH8 A;  2ONR A;  1HSL A;  2I0C A;  4H0W A;  2ONK E;  4QFK A;  4NF6 B;  4X9T A;  2XHD A;  2F5X A;  4NF5 A;  5HPQ A;  5AE4 A;  4RJZ A;  1LAF E;  1JVX A;  5JK4 A;  3N94 A;  2V3Q A;  4RA1 A;  5AA2 A;  4N6P A;  2XXT A;  2RC9 A;  3RTW B;  3K1M A;  2R71 A;  4FEB A;  3V83 A;  1LFH A;  3HHF A;  1O7T A;  3A09 A;  5TU0 A;  3KBR A;  3EPE A;  1PB9 A;  2FA7 A;  3FVK A;  2ABH A;  3QSL A;  4F22 A;  1AOV A;  2QS4 A;  1IEJ A;  4IO5 A;  1WVJ A;  4G77 A;  3PV0 E;  3PPP A;  1MM7 A;  3TAJ A;  3ODB A;  3ILT B;  4R9G A;  1MXV A;  1R6Z A;  4MLQ A;  1AIV A;  1Q35 A;  4O3B A;  4PFY A;  1H76 A;  2HAU A;  4FED A;  5CC2 A;  3G3H A;  3B6W A;  3MAM A;  3PUY E;  5ICQ A;  4I8C A;  3I6V A;  3IL1 B;  1GV8 A;  3G7W A;  3JZJ A;  4I62 A;  3QUJ A;  4AB5 A;  4BLA A;  4Q8R A;  3K6U A;  4RPO A;  3FV1 A;  1M5E A;  3TCH A;  4POW A;  5FTI A;  4O3C A;  1Z7M E;  1USY E;  4Q0C A;  1MPC A;  1ZLQ A;  3M3F A;  1B4H A;  4OER A;  1XOC A;  1SYH A;  1LST A;  4UA8 A;  2DWI A;  2OBG A;  1EZ9 A;  4JSO A;  1M5D A;  1UTH A;  3QUF A;  3VDF A;  4LA9 A;  4OEV A;  3ECR A;  4F3P A;  2X26 A;  3VVE A;  1MXW A;  2YJP A;  3PD8 A;  5CMC A;  4F2O A;  3FXU A;  3TFL A;  2I58 A;  3RTF B;  4OWD A;  2UXA A;  2DXR A;  3VVD A;  1H43 A;  4PFT A;  3H6W A;  1XT8 A;  3FVN A;  1FTO A;  1JW5 A;  3Q25 A;  1YTV A;  3M3K A;  2Q8J A;  3RLF E;  4F29 A;  2XX7 A;  4ONY A;  4JWX A;  1FQA A;  4FIM A;  4QFN A;  3MBP A;  2H5Y A;  1WDN A;  4R2F A;  1I6B A;  3O66 A;  3G3K A;  5JTY A;  4TLM B;  2OCU A;  4OVJ A;  4U4S A;  2PBW A;  3TTK A;  3MWB A;  1XC1 A;  4YKP A;  1MH4 A;  1NL5 A;  1DPE A;  2F6G A;  2HAV A;  5KCJ A;  3LBS A;  4DCX A;  1URD A;  3O28 A;  1MY2 A;  4G2Z A;  1VR5 A;  4WED A;  1MM6 A;  2RCA A;  3PMW A;  2BJJ X;  2OK2 A;  3LR1 A;  5FHN A;  5IKB A;  3G3G A;  4EQB A;  2FNC A;  3PPQ A;  5I56 A;  1IXC A;  1R1N A;  3VVF A;  1ZIU A;  1BTJ A;  1RYX A;  2RCB A;  1H44 A;  1FQE A;  2HEU A;  4Q5T A;  4QSC A;  3KSX A;  3WAE A;  2RF1 A;  1IQ7 A;  4KFQ A;  4OES A;  2REJ A;  1D9Y A;  4JWY A;  4KD5 A;  4IO6 A;  4G68 A;  2AL4 A;  1LAX A;  4R6Y A;  3F11 A;  3TCF A;  5A5X B;  1D3K A;  1DSN A;  2Q9T A;  2V93 A;  3T96 B;  1QW0 A;  2GRV A;  2F8D A;  1N3W A;  3A3C A;  4R75 A;  3KJ7 A;  3KOS A;  1QUJ A;  3S9E A;  3SES A;  4I1D A;  2XXH A;  4OEU A;  3UK4 A;  2UVG A;  3TKD A;  1UIU A;  3UP9 A;  1SW1 A;  4GVO A;  4U1Z A;  2ZNS A;  1FQB A;  4F2Q A;  4RPN A;  2AL5 A;  1MXU A;  2B3B A;  4EQ7 A;  3KN7 A;  1NNT A;  4RK2 A;  3MP8 A;  1LB8 A;  3S2V A;  1II5 A;  1SW5 A;  5ELV A;  5I57 A;  1B3G A;  3E3K A;  1ANF A;  4RXL A;  1A7L A;  3DP4 A;  1O63 A;  3PPR A;  1P1W A;  2Y7R A;  3MVZ A;  1QUI A;  3UN6 A;  1OQH A;  1B32 A;  3QIM A;  4H67 A;  2CZL A;  4Q30 B;  3FZV A;  3M8U A;  1FQD A;  5TP9 A;  1NMU A;  4ELR A;  3FV2 A;  4ESX A;  4G68 B;  2W7Y A;  4GWO A;  5DTB A;  1SI0 A;  5I58 A;  5DEX A;  4OZ9 A;  3SEV A;  2OZZ A;  4EDP A;  1OIB A;  3UIF A;  3UA8 A;  4FJP A;  4YU0 A;  5CI5 A;  5L8D A;  3K2D A;  3K4U A;  1FQC A;  3GXA A;  4ZS9 A;  1LAG E;  3SDF A;  2HZK A;  5TPA A;  5I84 A;  3CR9 A;  1Y4T A;  1A55 A;  2I3W A;  4R6K A;  1B3E A;  2WKY A;  3RUM A;  1M5F A;  2PMS A;  1R9L A;  3IOR A;  3IJX B;  3CFZ A;  1BP5 A;  4QSD A;  3HN0 A;  3HHG A;  4THI A;  4GQO A;  1IIW A;  1YCJ A;  2F78 A;  5F1Q A;  3H3G A;  1BIY A;  3LSW A;  5EHS A;  4HCY A;  3K1P A;  2DWA A;  1NNP A;  4AB6 A;  1B3H A;  3TQL A;  5H8N B;  4BDN A;  3T9V A;  4QSE A;  4LZ5 A;  3IO6 A;  1CB6 A;  4H65 A;  2QJE A;  4WEP A;  1LAH E;  1SYI A;  3CFL A;  1MDP 1;  1Y9U A;  3UOR A;  3TTR A;  5L9S A;  3FAT A;  3OO8 A;  2UVJ A;  5AA4 B;  3B6Q A;  5H8H B;  2UVI A;  4ZDM A;  4U2R A;  3QXM A;  4O3A A;  3L6H A;  1IUD A;  4YB6 A;  1B40 A;  1XVX A;  2F7B A;  1M5C A;  2I49 A;  3MC2 A;  4OET A;  4NF8 B;  1Y1Z A;  2ESN A;  4X48 A;  3OXN A;  4XKR A;  2UYF A;  5CBR A;  5TPA B;  1PBQ A;  4HW8 A;  4ZEI A;  2DVC A;  5CBS A;  2O84 X;  2O1M A;  2XXP A;  1N0T A;  4NF4 A;  3OO7 A;  5I2K A;  3MJN A;  3HPI A;  1RKM A;  1SD3 A;  2VP1 A;  1MQD A;  2XD3 A;  4KHZ E;  3S9N C;  3RY3 A;  3FIR A;  3PUZ E;  5LOM A;  1QKA A;  1AL3 A;  2D3I A;  1SQY A;  3PUV E;  1B0H A;  1B5I A;  3GLB A;  3N26 A;  1I6A A;  4JSD A;  4YKJ A;  1MXZ A;  4EQ9 A;  3HST A;  1MS7 A;  4F1Y A;  5M2V A;  2Z8F A;  2QS3 A;  3A3U A;  3RT8 A;  1SW4 A;  2I4C A;  4GXA A;  3QYT A;  3OO9 A;  1P1O A;  5ITP A;  3VXC A;  5FHM A;  3S9M C;  5BWJ A;  4OQO A;  2I3V A;  1Y3Q A;  5AA3 A;  2M8C A;  1YPN A;  3IO4 A;  3O29 A;  3G3J A;  4OMB A;  2ZXT A;  1FW0 A;  2QS2 A;  2XXV A;  5ITO A;  1IXG A;  1M5B A;  1MQI A;  3S9L C;  3GBA A;  3ZS6 A;  4ELQ A;  5J1D A;  5CM6 A;  5CRY A;  2F35 A;  4C1U A;  3H4Z A;  1JW4 A;  1XS5 A;  1S9T A;  4X1D A;  2NVU B;  3AXF A;  1Y4C A;  2VHA A;  3TEP A;  1P1Q A;  4NF5 B;  3FXR A;  3U72 A;  1TFD A;  3IJO B;  2B3F A;  3PUX E;  2DOJ A;  4OTE A;  4G8H A;  3Q26 A;  3O9P A;  4GL8 A;  1EH3 A;  4TOZ A;  4LQ5 A;  3H06 B;  4YB5 A;  2XXU A;  5AA2 B;  1MXX A;  1MG1 A;  4NWC A;  5B7D A;  2F7C A;  1F9B A;  4R72 A;  3MZB A;  2PYY A;  4H8I A;  3CI8 A;  3MZ1 A;  3V5A A;  4OYV A;  4JB7 A;  4ZEK A;  4HCW A;  1Q1K A;  3PMV A;  1USY H;  4MF3 A;  3EF7 A;  1OVT A;  3C36 A;  1MPD A;  4GRK A;  3IAZ A;  3K6V A;  3V89 B;  2Q2A A;  5K2X A;  4PET A;  2P2A A;  4G4P A;  5I59 A;  3W9V A;  3QAX A;  4UAC A;  4C1T A;  4TQU Q;  2XXR A;  4KCD A;  1I6Q A;  4PQJ A;  2DXY A;  3TZA A;  4KCC A;  3M3L A;  3P7I A;  3OEK A;  4OFL A;  1BKA A;  4ZED A;  2GHB A;  3C31 A;  2VGQ A;  2ZYK A;  2YPN A;  4XTC Q;  1FTJ A;  3MQ9 A;  4H8J A;  2DS9 A;  2XX8 A;  3EN3 A;  1FTK A;  3THI A;  5AA2 D;  5EHM A;  4EUO A;  2O69 A;  4DDD A;  3C33 A;  2I0B A;  2PT1 A;  4DZ1 A;  4JBZ A;  1UTH B;  3FJ7 A;  3CG3 A;  2DQV A;  4AQ4 A;  3U92 A;  3O6I A;  1O64 A;  4HTG A;  3KGC A;  4IO4 A;  1B7U A;  5H8S A;  1SI1 A;  4U4X A;  3MVY A;  3D4G A;  2G29 A;  5FHO A;  4H1X A;  4YIC A;  3H7M A;  4IGR A;  2KLF A;  1MY4 A;  3GBB A;  3ZKK A;  2XXW A;  1D4N A;  4ESW A;  4GXS B;  1A54 A;  4XKP A;  3SEY A;  4MFI A;  2Q89 A;  1JVY A;  4QF9 A;  3K00 A;  3LC8 A;  3KFM A;  5JTY B;  3G3I A;  4GLI A;  3OEM A;  2D5W A;  1TXF A;  2I48 A;  4BDR A;  3JYR A;  3R7X A;  1DPP A;  5KCJ B;  1GTK A;  1VE4 A;  1GR2 A;  1US5 A;  2QS1 A;  5H8Q A;  4E0X A;  4TLL B;  3TUS A;  3R26 A;  1OQG A;  2R9J A;  4JWO A;  2O7I A;  3K01 A;  1US4 A;  4EXL A;  1B05 A;  4FE8 A;  1B52 A;  3VV5 A;  5I56 B;  3LSX A;  3HCQ A;  4DE8 A;  1P1N A;  2ZYO A;  4LP2 B;  3TTL A;  5FTH A;  3IOU A;  3OD7 A;  3VE1 B;  2RKM A;  2YLN A;  3K6X A;  1BLF A;  3MVX A;  2THI A;  2NOO A;  3O2A A;  4QFP A;  3USD A;  4U21 A;  2ONS A;  1JW1 A;  1PB8 A;  1OLC A;  3TDJ A;  4DXC A;  4LQ2 A;  4LUB A;  1MY1 A;  2UVH A;  4KYD A;  2XXX A;  2OJT A;  2IEE A;  3DLN A;  4YMA A;  3SER A;  2QPQ A;  1LBC A;  1GVC A;  2E0S A;  2NXO A;  1Y1M A;  1OLA A;  3H6V A;  2V25 A;  5B70 A;  4FAT A;  3N6T A;  4U22 A;  5KDT A;  3TTN A;  3T9H B;  1OMP A;  4P11 A;  1I69 A;  1NNK A;  2Z8D A;  3O6H A;  1S7Y A;  3O97 A;  1MQJ A;  1JET A;  4DXB A;  1N76 A;  4ZZA A;  3FAS A;  1P99 A;  4NE4 A;  1HSJ A;  3C4M A;  5HM4 B;  4QHQ A;  1JQF A;  2RIN A;  2ZYM A;  2VD3 A;  3O6G A;  3N5L A;  4F31 B;  5I57 B;  3FGS A;  4GD5 A;  4FOR A;  2RC8 A;  3KZG A;  4NED A;  3W9W A;  2XXQ A;  4ZE8 A;  3T22 A;  4HS7 A;  3CFX A;  3DM0 A;  2HQ0 A;  1QKB A;  3PD9 A;  1CE2 A;  3PPN A;  4ZE9 A;  1NFT A;  1SW2 A;  2HCA A;  1JEV A;  4GF8 A;  4KYE A;  5DT6 A;  2VOZ A;  3U93 A;  4EF2 A;  1EU8 A;  5IAI A;  1MQG A;  2Y7P A;  3H6U A;  3RGY A;  3BFT A;  4POX A;  3FJM A;  4XIG Q;  5TP9 B;  4QFL A;  4IO3 A;  3TEL A;  3IB0 A;  4OFO A;  4XXU A;  1MDQ A;  3ZKL A;  2I6E A;  4ZZE A;  5I58 B;  5DEX B;  3ILU B;  2A5T A;  3PUW E;  5ICT A;  4G8N A;  4R73 A;  3SEU A;  1QVS A;  4F18 A;  2Z22 A;  1DTZ A;  1N3X A;  5L9M A;  4NWD A;  3C32 A;  1A40 A;  5CMM A;  2OWT A;  2XD2 A;  3KSJ A;  3U1O A;  3LSF B;  1SDX A;  5ISU A;  4KPT A;  1B6H A;  2NUV A;  1EZP A;  2E1S A;  2R6G E;  5EYF A;  1ATG A;  4IO7 A;  3DP6 A;  1B4Z A;  2V3U A;  2O6A A;  2ANJ A;  4XKN A;  3LUY A;  2XXY A;  4GL0 A;  5DYH A;  1JNF A;  3WAF A;  4L17 A;  1TT1 A;  5CMB A;  4YKI A;  4R6H A;  3RNN A;  3RPW A;  2O51 A;  4RYA A;  4EF1 A;  4GOT A;  2CMO A;  4IY6 A;  3LSL A;  3MP1 A;  2ZMB A;  5BUU A;  1B7Z A;  3ONM A;  1SBP A;  3H03 A;  2QL3 A;  2X7Q A;  3R6U A;  4F1V A;  4PP0 A;  1LCT A;  2H99 A;  3EHS A;  2F6P A;  2X7P A;  5DVF A;  4Z7E A;  2DE3 A;  4KQP A;  4N07 A;  3K1N A;  2A5T B;  1A8F A;  1TWY A;  4F1U A;  2DYX A;  1ZU0 A;  2Y7K A;  5HBC A;  4F3G A;  3H6T A;  4OHN A;  3HO7 A;  1QUL A;  2H4I A;  1L5T A;  1XVY A;  1ZKB A;  3MZ9 A;  2HFB A;  3SET A;  3CG1 A;  3VLU A;  3MPK A;  1NH7 A;  4JXI A;  5H8F A;  1EZO A;  4G68 C;  1MPB A;  2PT2 A;  1POY 1;  3TMG A;  2Y7I A;  3KOT A;  3IR1 A;  2ZNU A;  4NF4 B;  3OSQ A;  4ELP A;  4RK9 A;  5I2K B;  3IOT A;  4K3F A;  1B3L A;  3DEL B;  1MQH A;  1B7H A;  1B51 A;  4KR5 A;  3G3F A;  2B65 A;  3UGW A;  1FTM A;  1OVB A;  1P1U A;  4WKM A;  4ISU A;  2G93 A;  3D4C A;  4KI0 E;  2DE2 A;  1LFG A;  4ZEB A;  2RC7 A;  2O1L A;  3OOA A;  4YAH X;  3IOV A;  4BDQ A;  3C34 A;  2VD2 A;  5L9O A;  2DWH A;  3TTM A;  4GIZ A;  1PEB A;  2O68 A;  1B58 A;  3OEL A;  1RYO A;  1DMB A;  1LBB A;  3OEN A;  2ZYN A;  3Q29 A;  4X1B A;  5JEI A;  1LLS A;  5A5X A;  2Y84 A;  3EHU A;  3IOW A;  3CRB A;  3PMX A;  3VFJ A;  4DXU A;  3B6T A;  3PU5 A;  4DCY A;  2GFE A;  4OFJ A;  4LZ7 A;  3MP6 A;  1VSO A;  2AYS A;  5AA1 A;  1N7X A;  1URG A;  2OLB A;  2H25 A;  2V84 A;  3C35 A;  2O7U A;  3CSB A;  1LGB C;  4YB7 A;  2NWJ A;  2XX9 A;  3ZSF A;  3FVO A;  3PGF A;  3SEX A;  5H8F B;  1IIT A;  4LAT A;  4ND9 A;  1JEU A;  4R9F A;  1PDA A;  4R74 A;  1IXH A;  3CIJ A;  4RY1 A;  3MW0 A;  3IB2 A;  3FD3 A;  4FEC A;  3V8X B;  3OSR A;  3B7D A;  3JV9 A;  5DVI A;  1B2H A;  1VFE A;  2PVU A;  2Z8E A;  3W15 C;  4IO2 A;  3VLW A;  2H98 A;  4KYS A;  4H6D A;  4LZ8 A;  3FXQ A;  1LB9 A;  3EHT A;  4OEN A;  2A5S A;  1J1N A;  4P0G A;  2F97 A;  4ZEC A;  1B1H A;  3I3V A;  1B1X A;  3E4R A;  3TQW A;  3KN8 A;  2Z23 A;  4DLD A;  4R2B A;  1N04 A;  4ELO A;  1IZ1 A;  4IY5 A;  4PFU A;  4BDL A;  3BKI B;  3FUZ A;  3L6G A;  3S4U A;  1MH3 A;  3Q27 A;  1S50 A;  1TFA A;  2F36 A;  2REG A;  3VLV A;  5I59 B;  3OO6 A;  2FYI A;  5K2Y A;  2GHA A;  4H5G A;  4IB2 A;  3SEW A;  1ELJ A;  2ZNT A;  1AMF A;  4LON B;  4MBP A;  2H9B A;  1PBP A;  1FTL A;  5I2N A;  2DP8 A;  4NTL A;  4LVQ A;  1HSE A;  1MY3 A;  1DTG A;  1ZBM A;  1IXI A;  4U23 A;  1B46 A;  3IB1 A;  3VXB A;  3CVG A;  4Z0I A;  1ZTY A;  1A99 A;  5F7V A;  1FQF A;  4BDM A;  1URS A;  4ECF A;  3GZG A;  4F19 A;  4YMB A;  1PC3 A;  1UTB A;  3T9U A;  4IGT A;  3QK6 A;  4NMY A;  3MPL A;  1N84 A;  2QMX A;  4G8M A;  2XXI A;  1QUK A;  1PB7 A;  4RNS A;  4I9D A;  1POT A;  2AIX A;  2DWJ A;  3TCG A;  2UYE A;  4YZZ A;  1MXY A;  4EXK A;  4GFR A;  3C9H A;  3HV1 A;  1GGG A;  3OMB A;  2V3T A;  3IK6 B;  4M1V A;  3BBR A;  3RQT A;  5H8N A;  3EQ1 A;  4MH5 A;  1D9V A;  4XKQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...