1I6AA

Crystal structure of the oxidized form of oxyr
Total Genus 62
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
62
sequence length
212
structure length
212
Chain Sequence
ETMSGPLHIGLIPTVGPYLLPHIIPMLHQTFPKLEMYLHEAQTHQLLAQLDSGKLDAVILALVKESEAFIEVPLFDEPMLLAIYEDHPWANREAVPMADLAGEKLLMLEDGHCLRDQAMGFCFEAGADEDTHFRATSLETLRNMVAAGSGITLLPALAVPPERKRDGVVYLPAIKPEPRRTIGLVYRPGSPLRSRYEQLAEAIRARMDGHFD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HYDROGEN PEROXIDE-INDUCIBLE GENES ACTIVATOR
publication title Structural basis of the redox switch in the OxyR transcription factor.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transcription
total genus 62
structure length 212
sequence length 212
ec nomenclature
pdb deposition date 2001-03-02
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 1i6aA01
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 1i6aA02
3FJ7A 3D4GA 3UGWA 3QYTA 3UORA 1JVXA 2DE3A 1TT1A 5KDTA 4N13A 3U1OA 1M5DA 3MZ1A 1Y3QA 5TU0A 4U23A 4H6DA 3LR1A 1BP5A 4O3BA 3CSBA 4U22A 1MPDA 4ELRA 3M3KA 1ZLQA 1URDA 1MXUA 3UN6A 2G93A 1I69A 1R9QA 3O28A 3L6GA 3PU5A 5I56B 3QUFA 1EU8A 3N94A 2ZMBA 2RKMA 3FJGA 1TFDA 1FTLA 2QL3A 4YMAA 3E13X 3KSJA 2OZZA 3E4RA 4YKPA 5HPQA 1BIYA 4RXLA 2LAOA 4F1YA 3A09A 4BDNA 2D21A 3TMGA 1R1NA 4IO2A 3RPWA 2B3FA 5HM4B 1PB7A 4LATA 3RTFB 5H8NA 4LVQA 5HBCA 1GR2A 3E3KA 1NH8A 3FATA 3B6TA 3OENA 3ILTB 3K0VA 4POXA 4KCCA 3K02A 3TCFA 4ESWA 1B7UA 5F1QA 1MXVA 1SBPA 3IB0A 2WKYA 1P1NA 1VR5A 3FJMA 2VD2A 3EQ1A 2V93A 1UQWA 4OQOA 5EHSA 3H6TA 3DP8A 4IO5A 2V3TA 5JTYA 5FTHA 3VVFA 3QUJA 4X1BA 1VFEA 3CG1A 2O1MA 3Q28A 2QMWA 4I1DA 3CRBA 3PUVE 3UA8A 4H65A 1LAGE 2DWJA 3ECRA 4QFNA 3ZSFA 1LFHA 1USYH 3O97A 3KGCA 3MVWA 3M8UA 2RF1A 3K6XA 2H99A 1II5A 2GHAA 1YPNA 1DTZA 2VOZA 1UIVA 1SYIA 1B0HA 2PYYA 3TTRA 1IZ1A 2G29A 1TWYA 3OELA 3BFUA 4BDOA 2D3IA 3BBRA 3MBPA 2M8CA 4FORA 4YKKA 1H43A 3EHTA 2IEEA 4ZDMA 1IEJA 3T93B 4HW8A 1JW4A 2V25A 5H8HB 4JBZA 2XD3A 2UVJA 3VLWA 1DOTA 1OQGA 4XKPA 4ELPA 4DZ1A 4PFWA 4EQ9A 5CMKA 3PMVA 2X7PA 1T0KA 2I4CA 3C4MA 2I0CA 1A54A 1XC1A 5DVIA 4ZECA 2QMXA 1B5HA 4XKNA 4LP2B 4GLIA 2XHDA 2X26A 1B4ZA 1NKXA 2RC9A 1KWHA 5CBRA 3PPPA 1IQ7A 2RC8A 2B65A 2THIA 5CMMA 1N3XA 3V8XB 4AB5A 2X7QA 2I48A 4WKMA 3FVKA 4EF1A 5A5XB 1B2HA 3S9EA 1SYHA 4R72A 3U93A 3C35A 1MG1A 1LSTA 1Q1KA 1Y9UA 1LB9A 3S9NC 5EYFA 3CG3A 1D3KA 3OEKA 3K1NA 1NH7A 2PMSA 4U2RA 5ITOA 1ZU0A 3RNNA 4MF3A 1BKAA 3QIMA 4PFTA 4G8MA 4DXUA 5DYHA 1B46A 3K1PA 5M2VA 4H8IA 1LAXA 2PBWA 3P7IA 4IO4A 4Q0CA 3PUYE 1YTVA 1OQHA 2DQVA 5ICTA 1WVJA 3H06B 1MY0A 2I0BA 3K6UA 4C1UA 3FV2A 5I2NB 4ONYA 5EHMA 2PX1A 2F7CA 5CC2A 4PFUA 4GXSB 2NUVA 1QUKA 4H8JA 4NF8B 5AE4A 3N5LA 4ZE9A 1TFAA 3I3VA 1N7XA 4QFPA 2QSXA 2Q88A 4HS7A 5I59B 4JDFA 1A55A 4DCXA 4K3FA 2O1LA 3PPOA 3OXNA 4KI0E 2PT1A 3N6TA 4ISUA 4RK2A 4F31B 3O6IA 3C32A 5H8FA 3Q27A 4P11A 1B3HA 1B7HA 4R6YA 2UYEA 2QS4A 5FTIA 3KZGA 3B6QA 4G68B 3LSWA 1JEVA 1OMPA 5FHMA 3LSLA 5ITPA 1I6BA 4F1UA 1XOCA 1NNPA 3C9HA 3N26A 3PUXE 3VVEA 4ECFA 4GOTA 3IOUA 3IOWA 4MLQA 4DIGA 3MAMA 4U4XA 4H5FA 2Q89A 3MQ9A 3T66A 2DOJA 3GZGA 5TP9B 3ZKLA 3VFJA 2O7UA 1M5BA 3TCGA 1FQAA 4NF5B 4F3BA 2RCBA 1LFIA 1DMBA 1IXIA 5DEXA 1Y20A 4IGTA 3V5AA 2XXYA 1HSJA 3LC8A 1PC3A 3S4UA 1M5CA 3WAFA 3JYRA 1B0LA 2A5SA 1AMFA 4OERA 4HTGA 4M4GA 2AL4A 1FTOA 2I49A 4LUBA 2A5TA 4C1TA 4N6PA 1LLSA 3M3LA 2CZLA 1J1NA 2E0SA 4I9DA 2HZKA 4OENA 4ZS9A 3CFLA 3TTNA 4DLDA 3TDJA 3S9LC 1YCJA 4P0IA 2DVZA 2F36A 1D9YA 3TPAA 5I56A 2UVIA 1P99A 1P1QA 2OK2A 1NFTA 1DPEA 1LAFE 1CB6A 1VSOA 1MXXA 2XXPA 1OVTA 1B58A 2Z22A 4F1VA 1QKBA 1FTMA 2I4BA 2O84X 3B7DA 1PBPA 1NNFA 1S50A 3HHGA 4OYVA 4E0WA 4H1XA 3QAXA 1B5IA 3IB1A 2P0SA 4RYAA 1OLCA 3O2AA 5AA4A 3A3UA 2DYXA 2UVHA 1MXYA 3QSLA 4G8NA 4LQ5A 1JW1A 1P1WA 2Z23A 5H8SA 5I2KB 2Y7KA 1EZPA 1URSA 4MBPA 1M5FA 3KOTA 3OEMA 3U94A 4Q30B 4YU0A 3H6WA 4U1ZA 4ZZEA 3GXAA 3W15C 5AA4B 4BLAA 2Z8DA 3I5OA 3CI8A 3THIA 4M1VA 4GFRA 3OMBA 2HAVA 3USDA 2ZYKA 2ONSA 4TQUQ 4G8HA 1GV8A 1LBCA 1QKAA 3OO7A 3MUQA 2YPNA 1CE2A 4TLMB 3PPNA 2AIXA 2XD2A 5AA2D 4N07A 1N3WA 4OFLA 2REJA 3IAZA 3KSXA 3UP9A 1FQBA 3MVZA 1BLFA 3Q26A 3VV5A 2QS3A 4FAJA 2GH9A 1B3EA 1MS7A 4YKJA 1BTJA 1B05A 3FXQA 1B3LA 5F7VA 2PVUA 3EHUA 5ELVA 5CRYA 3VE1B 3L6HA 3MZ9A 5JK4A 3H4ZA 5ISUA 2OLBA 4NWDA 4X9TA 5AA1A 2I58A 2Q2AA 4IY5A 3O29A 4AQ4A 4NE4A 5LOMA 4RA1A 3HO7A 5H8HA 3KFMA 2NWJA 4JWXA 2OWSA 3OO8A 4IO7A 2IA4A 1USYE 3TTMA 4O3AA 3IOTA 3ONMA 1MXWA 1QJMA 3K2DA 4YICA 2O6AA 2V3QA 4F3GA 1B6HA 1QUJA 2ANJA 3M3FA 4GVOA 1VFDA 2ONRA 3G7WA 4EXKA 4QHQA 4HCWA 4R6HA 5B7DA 3MWBA 4P0GA 4EUOA 3UK4A 3CVGA 1MM6A 4GRKA 4LZ7A 3F11A 1QULA 3E9XA 2RINA 3MVYA 3UIFA 4OEVA 4YB7A 1ZMGA 4GL8A 4ZEKA 3G3GA 3KN7A 3MW0A 2DS9A 1N84A 1IXHA 2XXTA 2ONKE 4HCYA 4GL0A 4PQJA 3RUMA 4RK9A 4ZZAA 3G3KA 2FYIA 1OLAA 1PDAA 2F8DA 1EZOA 5A5XA 4JSOA 4PFYA 1GVCA 5H8QB 3FXUA 3ZKKA 5I57B 4LZ5A 3TKDA 3O66A 4KPTA 4POWA 3LSFB 2R6GE 3CR9A 2DVCA 3T9UA 2H25A 1Y3PA 4R9GA 3OOAA 3EHSA 3GBAA 4OZ9A 3IO4A 3IJXB 1B3GA 4JWYA 3O6GA 2XXXA 2F7BA 3TYHA 3T22A 5AA3A 4LZ8A 1AH5A 4RY1A 3PPRA 4F19A 1EH3A 3S2VA 1O64A 1PEBA 5K2YA 4JWOA 4H0WA 3TQWA 5I2NA 1IUDA 3EN3A 4DXCA 3PUZE 1RYOA 4PE5B 4BDRA 1R9LA 4XTCQ 3SEYA 2DE4A 4F18A 4NF8A 2QS1A 3FXRA 2Y7WA 5KCJB 2UYFA 3PGFA 2QPQA 1SQYA 3TODA 3RLFE 1XS5A 2H5YA 5B70A 2UVGA 5I59A 1MY2A 4I62A 4F2QA 1A8FA 1ZIUA 2I3WA 4NF6B 4NWCA 1SI0A 4G77A 4G68C 4MLVA 5IAIA 4OETA 1NNKA 1IXGA 2XXUA 2YJPA 3K6VA 1ANFA 1FQCA 1XT8A 1H76A 1OVBA 2HFBA 1VE4A 4RPNA 1B9JA 2REGA 3VLUA 3H6UA 2KLFA 3A3CA 4OFOA 2UXAA 4G68A 4KYSA 4KHZE 3OD7A 4DE8A 3C36A 4Z7EA 1DSNA 4EQBA 3W9VA 4NTLA 1YAEA 5FHOA 3SEXA 2ZYOA 2E1SA 3PPQA 2XX8A 1POTA 3GLBA 1JVYA 4ZEFA 1S7YA 3D4CA 3IK6B 3W9WA 1MH4A 4PP0A 4XIGQ 4ZEBA 4FE8A 2F6GA 1MPCA 1Y3NA 5K2XA 2XXHA 4KCDA 5TP9A 2HXWA 4GXAA 2NVUB 2P1SA 1N0TA 5JEIA 3KOSA 3TUSA 2F5XA 4NF5A 2FNCA 3HSTA 5IKBA 1LFGA 2ZYNA 1MY1A 4ND9A 4IO6A 3LSXA 3SERA 2XX7A 1O7TA 1B4HA 3U8QA 4OVJA 3FIRA 2GHBA 4RPOA 1H3DA 3CFZA 3MJNA 4OXVA 2F34A 4ZE8A 1PBQA 1A7LA 4KR5A 3K00A 3FVGA 3TZAA 3CSGA 2FA7A 2I3VA 1EZ9A 3FD3A 2XXWA 2Q8JA 5L8DA 3VLVA 1MPBA 4Z0IA 1B3FA 4QRZA 5L9MA 1AIVA 2OBGA 3DELB 3HHFA 2H4IA 4EQ7A 3CIJA 1Y1MA 4IB2A 3MVXA 3KN8A 4WEPA 1UTBB 2B3BA 4RNSA 1P1UA 4NEDA 4YAHX 5TPAB 2DWIA 2R71A 3PMWA 2QJEA 2H98A 4FEBA 3TELA 3C31A 5AA2B 2R9JA 5J1DA 3ODBA 4OMBA 2P2AA 1FQFA 3IOVA 1B7ZA 3IX1A 2Z8EA 3V83A 1Y1ZA 3FASA 1FQEA 4F3SA 4C0RA 1AOVA 2NOOA 4H5GA 5L9OA 3C33A 3HPIA 4I8CA 4ELOA 3K1MA 1N76A 1MQIA 1SW4A 1JW5A 3AXFA 1SVXB 3H7MA 3G3IA 4R74A 1TXFA 5I2KA 2Z8FA 4X1DA 1B52A 4R9FA 4UA8A 1WDNA 3DP4A 1B32A 4F29A 2Y84A 3LBSA 4NF4B 5KZTA 1XVXA 2ZNUA 2AYSA 5BUUA 1LCTA 3T9VA 1US4A 4F2OA 3KJ7A 3IORA 3PD8A 2VD3A 1SW5A 3RN8A 2AL5A 4OWDA 1UTHB 4FIMA 4PETA 1B51A 1SD3A 5KDTB 1DPPA 3QK6A 3KBRA 4DXBA 3SEWA 1NL5A 1QVSA 2DP8A 1JNFA 1FTKA 4U4SA 2F7AA 5BWJA 1B40A 1ZTYA 3JZJA 1H45A 2VGQA 4MH5A 5I84A 1OIBA 2QS2A 1RKMA 3GBBA 1US5A 3MP6A 4F3PA 1H44A 3TCHA 3FV1A 1MQDA 5CMCA 1ZKBA 4FATA 4KD5A 3SKPA 3H3GA 4GWOA 1ELJA 4IY6A 3T9HB 1GGGA 5ICQA 4X48A 2VP1A 4YB6A 4QSDA 3PMXA 1MQHA 2DWHA 2O69A 4TOZA 5H8NB 1HSLA 5CM6A 3PV0E 4ESXA 3IB2A 1MRPA 3FZVA 3H03A 3SETA 4R73A 2F6PA 3BFTA 4F39A 3SEUA 4L17A 4FJPA 2O51A 4KFQA 2ABHA 1A99A 2GFEA 4KYDA 1PB9A 1WODA 1FCKA 3SDFA 5JTYB 4YKIA 1JETA 2QRYA 1XVYA 3IJOB 3G3HA 2DWAA 4QFKA 4OESA 1UTHA 3MP1A 1M5EA 3EF7A 3TTKA 4WEDA 1ATGA 1N7WA 4QSEA 1I6AA 4LQ2A 1QW0A 3BKIB 2Y7PA 5L9SA 4DCYA 1Z7ME 3OO9A 4U1OA 3B6WA 2V84A 3K6WA 3OO6A 3FUZA 5H8QA 4RJZA 2ZNTA 5I57A 1MDQA 2XXQA 3EPEA 2H9BA 3KG2A 1S9TA 4GIZA 4ZEDA 4TLLB 1MQJA 4DDDA 4AB6A 5FHNA 4ELQA 4EF2A 1MY4A 3RQTA 4MFIA 3LUYA 3QXMA 5CI5A 3Q29A 1POY1 5DT6A 4XKRA 3O6HA 1NNTA 2HEUA 2F97A 3I6VA 3PD9A 3HV1A 4LONB 4R6KA 1O63A 2OWTA 3KEIA 1HSEA 1RYXA 2ALUA 2DXYA 2XXRA 1LAHE 3RT8A 4QF9A 2RC7A 1Z7NE 2ZXTA 1IITA 4WXJA 1SW2A 3FVOA 5KCJA 2DE2A 3K01A 3IO6A 2HCAA 4FEDA 4UACA 1URGA 2GRVA 1A40A 3VXCA 2ESNA 4NF6A 3JV9A 2F78A 5DVJA 3DP6A 1Q35A 2XX9A 3RT6B 2W7YA 1AL3A 4BDMA 3MP8A 4JXIA 3KJTA 4BDLA 1Y4CA 3MPKA 3MPLA 4Q5TA 5DTBA 3WAEA 3MC2A 4JSDA 2Y7RA 1LBBA 1JEUA 4R75A 5DVFA 3HCQA 2HQ0A 2ZYMA 3O9PA 4KQPA 5CMBA 2D5WA 4IO3A 4QSCA 3PUWE 4GF8A 4OEUA 4LA9A 1Y4TA 3G3FA 4QFOA 3U92A 2NXOA 4THIA 4JB7A 3C34A 3DLNA 4KYEA 1SDXA 4YZZA 1MH3A 1I6QA 3RY3A 4U21A 1FW0A 1MY3A 1B1XA 4EDPA 1MXZA 3R26A 2XXVA 1MQGA 4YB5A 4ZEIA 1PB8A 1MDP1 2F35A 1F9BA 3TEPA 4O3CA 2VHAA 4G2ZA 2BJJX 1B5JA 3MZBA 4R2BA 3H6VA 3S9MC 3CFXA 3SEVA 2CMOA 2XXIA 4NMYA 3U72A 3SESA 2Q2CA 2HAUA 2OCUA 2YLNA 3ILUB 3T9XB 3TQLA 4G4PA 3TAJA 4R2FA 3TFLA 1GTKA 3T96B 5I58A 2I6EA 2RCAA 2Y7IA 1LGBC 3VXBA 4Q8RA 1SW1A 2Q9TA 3Q25A 3OSQA 4E0XA 4FECA 5H8FB 1FTJA 5I58B 1FQDA 4GQOA 3K4UA 1MM7A 3RGYA 1UTBA 2PT2A 4F22A 1D9VA 5TPAA 3FGSA 3IL1B 2O7IA 3FVNA 1IXCA 3VDFA 5AA2A 2OJTA 1QUIA 4XKQA 1LB8A 3N6UA 3KN3A 4BDQA 1NMUA 1DTGA 4EXLA 2O68A 2V3UA 1D4NA 4H67A 1XHYA 5CBSA 3HN0A 3ZS6A 1P1OA 1ZBMA 4OHNA 1SI1A 1R6ZA 1LCFA 1UIUA 4GD5A 3TTLA 1ZJLA 3G3JA 4IGRA 2DSFA 1IIWA 5DEXB 4NF4A 3IR1A 3R6UA 1JQFA 2HZLA 4OTEA 3V89B 1L5TA 2DXRA 3OSRA 3VVDA 4OFJA 1A8EA 4XXUA 3R7XA 3RTWB 1B1HA 4YMBA 3DM0A 2ZNSA 4QFLA 2A5TB 1N04A
chains in the Genus database with same CATH superfamily
3FJ7A 3D4GA 3UGWA 5IZ3B 3QYTA 3UORA 1JVXA 2DE3A 1TT1A 5KDTA 4N13A 3U1OA 1M5DA 3MZ1A 1Y3QA 5TU0A 4U23A 4H6DA 3LR1A 1BP5A 4O3BA 3CSBA 3KC0A 4U22A 1LBWA 1MPDA 4ELRA 3M3KA 2FHYA 1ZLQA 1URDA 1MXUA 3UN6A 2G93A 1I69A 1R9QA 3O28A 3L6GA 2FIXA 3PU5A 5I56B 3RPLA 4O7IA 5DW8A 1SPIA 3QUFA 1EU8A 3N94A 2ZMBA 4HE2A 2RKMA 3FJGA 1TFDA 1FTLA 2QL3A 4YMAA 3E13X 3KSJA 4PAIA 2OZZA 4GBVA 3E4RA 4YKPA 5HPQA 1BIYA 4RXLA 2LAOA 4OVSA 4F1YA 3A09A 4BDNA 2D21A 3PTYA 3TMGA 1R1NA 4IO2A 3RPWA 2B3FA 5HM4B 1PB7A 4LATA 3RTFB 5H8NA 4LVQA 5HBCA 1GR2A 3E3KA 1NH8A 1IMBA 3FATA 3B6TA 3OENA 3ILTB 3K0VA 4POXA 5IGAA 4KCCA 3K02A 3TCFA 1FBEA 4ESWA 1B7UA 5F1QA 4NX1A 2V4CA 1MXVA 1SBPA 3IB0A 2WKYA 1P1NA 4H45A 1VR5A 3FJMA 2VD2A 3EQ1A 2V93A 1UQWA 4OQOA 5EHSA 4O7MA 3H6TA 3DP8A 4IO5A 2V3TA 5JTYA 5FTHA 1IMCA 3VVFA 3QUJA 4X1BA 1VFEA 3CG1A 2O1MA 3Q28A 2QMWA 4I1DA 3CRBA 3PUVE 3UA8A 4H65A 1LAGE 2DWJA 3ECRA 4QFNA 5T3JA 3ZSFA 1LFHA 1USYH 3O97A 3KGCA 3MVWA 3M8UA 2RF1A 3K6XA 2H99A 1II5A 2GHAA 4OVQA 1YPNA 1DTZA 2VOZA 1NUXA 1UIVA 1FPEA 1SYIA 1B0HA 2PYYA 5ET5A 3TTRA 1IZ1A 1FPIA 2G29A 1TWYA 3OELA 3BFUA 1NUWA 4BDOA 2D3IA 3BBRA 3MBPA 2M8CA 3T0JA 4FORA 1FPGA 4YKKA 1H43A 3EHTA 3CHGA 4OVRA 2IEEA 4ZDMA 2L5VA 1IEJA 3T93B 4HW8A 4P1LA 1JW4A 2QFLA 2V25A 5H8HB 4JBZA 2XD3A 2UVJA 4HE1A 3VLWA 1DOTA 1OQGA 4XKPA 1NV4A 4ELPA 4DZ1A 4HXVA 4PFWA 4EQ9A 5CMKA 4H46A 3PMVA 2X7PA 3D1RA 1T0KA 2I4CA 3C4MA 4MEVA 2I0CA 1A54A 1XC1A 5DVIA 4ZECA 2BJIA 2QMXA 1B5HA 4XKNA 4LP2B 4GLIA 1N04A 2XHDA 2X26A 1FBFA 1B4ZA 1NKXA 2OX3A 5LDZA 2RC9A 1KWHA 2KR0A 4PFBA 5CBRA 3PPPA 4PGNA 1IQ7A 2RC8A 2B65A 2THIA 4P47A 5CMMA 1N3XA 3U65A 3V8XB 4AB5A 2X7QA 1NV3A 2I48A 4NQ8A 4WKMA 2CEXA 3FVKA 4EF1A 3E79A 5A5XB 1B2HA 3S9EA 1RDZA 1SYHA 4R72A 3U93A 3C35A 1K9YA 5EYGA 1MG1A 1LSTA 1Q1KA 1Y9UA 1LB9A 1D9QA 3S9NC 4MX6A 5EYFA 3CG3A 1D3KA 3OEKA 1NV6A 3K1NA 1NH7A 2PMSA 4U2RA 5ITOA 1ZU0A 3RNNA 4MF3A 1BKAA 3QIMA 4PFTA 4G8MA 4DXUA 5DYHA 1B46A 3K1PA 5M2VA 4H8IA 1LAXA 2PBWA 3P7IA 4IO4A 4Q0CA 3PUYE 1YTVA 1OQHA 2DQVA 5ICTA 1WVJA 3H06B 1MY0A 1FBPA 2I0BA 3K6UA 4C1UA 3FV2A 5I2NB 4ONYA 5EHMA 2PX1A 4N8YA 2F7CA 5CC2A 4PFUA 4GXSB 2NUVA 1QUKA 1FJ9A 4H8JA 4NF8B 5AE4A 3N5LA 4ZE9A 1TFAA 3I3VA 1N7XA 4QFPA 2QSXA 1KZ8A 2Q88A 4HS7A 5I59B 4JDFA 1A55A 4DCXA 4K3FA 1NUYA 2O1LA 3PPOA 3OXNA 4KI0E 2PT1A 3N6TA 4RK2A 4ISUA 4I40A 4F31B 3O6IA 3C32A 5H8FA 4PTKA 3Q27A 4P11A 1B3HA 2HHMA 1B7HA 4R6YA 2UYEA 2QS4A 2WBDA 5FTIA 1FPJA 3KZGA 3B6QA 4G68B 3LSWA 1JEVA 1OMPA 5FHMA 3LSLA 5ITPA 1I6BA 4F1UA 1XOCA 1NNPA 4GWUA 3C9HA 3N26A 3PUXE 4HE0A 1NV7A 3VVEA 4ECFA 4MNIA 4GOTA 3IOUA 1DCUA 3IOWA 4MLQA 1BK4A 4DIGA 3MAMA 2Y5KA 4U4XA 4H5FA 4GWZA 2Q89A 3MQ9A 3B8BA 3T66A 2DOJA 3GZGA 5TP9B 3ZKLA 3VFJA 2O7UA 1M5BA 3TCGA 1FQAA 4NF5B 4F3BA 2RCBA 1LFIA 1DMBA 3FBPA 1IXIA 5DEXA 1Y20A 4N6DA 4IGTA 2XWVA 3V5AA 2XXYA 1HSJA 3GYYA 3LC8A 1PC3A 3S4UA 1M5CA 3WAFA 3JYRA 1B0LA 2A5SA 1K9ZA 4OERA 1AMFA 4HTGA 4M4GA 1AWBA 2AL4A 4O94A 1FTOA 2I49A 4LUBA 2A5TA 4C1TA 2PFYA 4N6PA 1LLSA 5IZ3A 2GQ1A 3M3LA 4XF5A 2CZLA 1J1NA 2E0SA 4I9DA 2HZKA 5IZZA 4OENA 4ZS9A 3CFLA 3TTNA 4DLDA 3B50A 3TDJA 3S9LC 1YCJA 4PBQA 4P0IA 2DVZA 2F36A 1D9YA 3TPAA 5I56A 2UVIA 1P99A 1P1QA 2OK2A 1NFTA 2Q74A 1DPEA 1LAFE 1CB6A 1VSOA 1MXXA 2XXPA 1OVTA 1B58A 5EQ7A 2Z22A 4F1VA 4OVPA 1QKBA 1FTMA 2I4BA 1LEVA 2O84X 3B7DA 1PBPA 1NNFA 1S50A 3HHGA 4OYVA 4E0WA 4H1XA 3QAXA 1NI9A 1B5IA 3IB1A 5EQ8A 2P0SA 4RYAA 4UABA 2MKZA 1OLCA 3O2AA 5AA4A 3A3UA 2DYXA 2UVHA 1YZ0A 1MXYA 3QSLA 4G8NA 4LQ5A 1JW1A 1P1WA 2Z23A 2VPNA 5H8SA 5I2KB 1FSAA 2Y7KA 1EZPA 1URSA 4MBPA 1M5FA 3KOTA 3OEMA 3U94A 4Q30B 4GX6A 4YU0A 4OA4A 3H6WA 4U1ZA 4ZZEA 3GXAA 3W15C 5AA4B 4BLAA 4PF8A 2Z8DA 3I5OA 3CI8A 3THIA 2WYKA 4M1VA 4JVIA 4GFRA 3OMBA 2HAVA 3USDA 2ZYKA 2ONSA 4TQUQ 4G8HA 1GV8A 1LBCA 1QKAA 3OO7A 3MUQA 1IMAA 2YPNA 1CE2A 4TLMB 3PPNA 1FPFA 2AIXA 2XD2A 5AA2D 4N07A 2Q8MA 1N3WA 4GWXA 2REJA 4OFLA 3IAZA 3KSXA 2QVRA 3UP9A 1FQBA 3MVZA 1BLFA 3Q26A 3VV5A 2QS3A 4FAJA 2GH9A 1B3EA 1MS7A 5ET7A 4YKJA 1BTJA 1B05A 3FXQA 5F24A 1B3LA 5F7VA 2PVUA 3EHUA 5ELVA 5CRYA 3VE1B 3L6HA 3MZ9A 5JK4A 3H4ZA 5ISUA 2OLBA 4NWDA 4X9TA 4DI4B 1NV5A 4GBWA 5AA1A 2I58A 2Q2AA 2XA5A 4I3EA 4IY5A 3O29A 2HXRA 4AQ4A 4NE4A 4N15A 5LOMA 4RA1A 3HO7A 5H8HA 3KFMA 2NWJA 4JWXA 2OWSA 3OO8A 4IO7A 2IA4A 1USYE 3TTMA 4OVTA 4O3AA 4DI3D 3IFCA 3IOTA 3ONMA 1MXWA 5IM2A 1QJMA 3K2DA 4YICA 3KC1A 2O6AA 2V3QA 4F3GA 1B6HA 1QUJA 2ANJA 3M3FA 4GVOA 1VFDA 5LTCA 2ONRA 3G7WA 2CZIA 4EXKA 4QHQA 4HCWA 4R6HA 5B7DA 4PAKA 2XWIA 3MWBA 4P0GA 2F3BA 4EUOA 3UK4A 3CVGA 1MM6A 4GRKA 4LZ7A 3F11A 1QULA 3E9XA 2RINA 3MVYA 2DDKA 3UIFA 2VPOA 4OEVA 4YB7A 1ZMGA 4GL8A 3BIHA 4N8GA 4ZEKA 3G3GA 3KN7A 3MW0A 2DS9A 1N84A 1IXHA 2XXTA 3EKIA 2ONKE 4HCYA 4GL0A 4PQJA 3RUMA 4RK9A 4ZZAA 4PGPA 3G3KA 2FYIA 1OLAA 1PDAA 2F8DA 1EZOA 5A5XA 4JSOA 4PFYA 1GVCA 5H8QB 3FXUA 3ZKKA 5I57B 4LZ5A 3TKDA 3O66A 4KPTA 4POWA 3LSFB 1NV0A 1VDWA 2R6GE 3CR9A 2DVCA 3T9UA 2XWOA 2H25A 4PC9A 1Y3PA 4R9GA 3OOAA 1EYKA 3EHSA 3GBAA 3BIGA 4OZ9A 3IO4A 3IJXB 1B3GA 5I3SA 4JWYA 3O6GA 2XXXA 2F7BA 3NOHA 3TYHA 3T22A 5AA3A 4LZ8A 1AH5A 4RY1A 3PPRA 4F19A 1EH3A 3S2VA 1O64A 1PEBA 1LBZA 2WBBA 5K2YA 4JWOA 4H0WA 3TQWA 5I2NA 1IUDA 3EN3A 4N6KA 3RYDA 4DXCA 3PUZE 1RYOA 4PE5B 4BDRA 1R9LA 4XTCQ 3SEYA 2DE4A 5IZ1A 4F18A 4NF8A 1EYIA 2QS1A 3FXRA 2Y7WA 4GWWA 4XEQA 5KCJB 2UYFA 3PGFA 2QPQA 1SQYA 1LBYA 3TODA 3RLFE 1XS5A 2H5YA 5B70A 2UVGA 5I59A 1MY2A 4I62A 4F2QA 1A8FA 1ZIUA 2I3WA 4NF6B 4NWCA 1SI0A 1FRPA 4G77A 4G68C 4MLVA 5IAIA 4OETA 1NNKA 1IXGA 3IFAA 2XXUA 2YJPA 3K6VA 1ANFA 1FQCA 1XT8A 1H76A 1OVBA 2HFBA 1VE4A 4RPNA 1B9JA 2REGA 2CZHA 3VLUA 3H6UA 2KLFA 3A3CA 4OFOA 2UXAA 4G68A 4KYSA 4KHZE 3OD7A 4AS4A 4DE8A 3C36A 4Z7EA 1DSNA 2JJKA 4EQBA 3W9VA 4NTLA 1YAEA 5FHOA 3SEXA 2P3VA 2ZYOA 2E1SA 4PDDA 3PPQA 2XX8A 1G0IA 1POTA 3GLBA 1JVYA 4ZEFA 1S7YA 3D4CA 3IK6B 3W9WA 1MH4A 4PP0A 4XIGQ 4ZEBA 4FE8A 4X04A 2F6GA 4PAFA 1MPCA 1Y3NA 5K2XA 2XXHA 1IMDA 4KCDA 5TP9A 1YXIA 2HXWA 4GXAA 2NVUB 2P1SA 1N0TA 2VT5A 3KOSA 5JEIA 3TUSA 2F5XA 4PCDA 4NF5A 2FNCA 3HSTA 5IKBA 1LFGA 2ZYNA 1MY1A 4ND9A 4IO6A 3LSXA 3SERA 2XX7A 1O7TA 1NUZA 1B4HA 3U8QA 4OVJA 4PFIA 3FIRA 2GHBA 1KA1A 4RPOA 1H3DA 3CFZA 3MJNA 4OXVA 2F34A 4ZE8A 1PBQA 1A7LA 4KR5A 2ZZWA 2ZZVA 3K00A 3FVGA 3TZAA 2XWKA 2QVUA 1FTAA 3CSGA 2FA7A 2I3VA 1EZ9A 3FD3A 2XXWA 2Q8JA 5L8DA 3VLVA 1MPBA 3KBZA 4Z0IA 1B3FA 4QRZA 5L9MA 1AIVA 2OBGA 3DELB 3HHFA 2H4IA 4EQ7A 3CIJA 1Y1MA 4IB2A 3MVXA 3KN8A 4WEPA 1IMFA 1UTBB 2B3BA 4RNSA 1P1UA 4NEDA 2DWIA 4YAHX 5TPAB 2R71A 3PMWA 2QJEA 4NG7A 2H98A 4FEBA 3TELA 2B4LA 3C31A 5AA2B 2R9JA 5J1DA 3ODBA 5ET8A 4OMBA 2P2AA 2Y5LA 1FQFA 1FPBA 3IOVA 1B7ZA 3IX1A 2Z8EA 3V83A 1Y1ZA 3FASA 4MIJA 1FQEA 4F3SA 4C0RA 1AOVA 2NOOA 4H5GA 5L9OA 3C33A 2PFZA 3HPIA 4GX3A 4I8CA 4ELOA 3K1MA 1N76A 1MQIA 1SW4A 4N4UA 1EYJA 1JW5A 2XXKA 3AXFA 1SVXB 3H7MA 3G3IA 4R74A 1TXFA 5I2KA 2Z8FA 4X1DA 1B52A 4R9FA 4UA8A 1WDNA 3DP4A 1B32A 4F29A 2Y84A 4NN3A 3LBSA 4NF4B 5KZTA 1XVXA 2ZNUA 2AYSA 5BUUA 1LCTA 3T9VA 1US4A 4F2OA 3KJ7A 3IORA 3PD8A 2VD3A 1SW5A 3RN8A 2AL5A 4OWDA 1UTHB 4GWSA 4FIMA 4PETA 5ESYA 1B51A 4FBPA 1SD3A 5KDTB 1DPPA 3QK6A 3KBRA 5I5PA 4DXBA 1G0HA 3SEWA 1NL5A 1QVSA 2DP8A 1JNFA 1Q9DA 1FTKA 4U4SA 2F7AA 5BWJA 1DK4A 3FXBA 1B40A 4MNCA 4NF0A 1NV1A 1ZTYA 3JZJA 1H45A 2VGQA 4MH5A 3LUZA 5I84A 4PF6A 1OIBA 2QS2A 3RPLB 2OWZA 1RKMA 4P8BA 3GBBA 4PDHA 1US5A 2ZZXA 3MP6A 4F3PA 1H44A 3TCHA 3FV1A 1MQDA 5CMCA 1ZKBA 2FIEA 4FATA 4KD5A 4PFRA 2FBPA 4P9KA 3SKPA 3H3GA 5EYHA 4GWOA 1ELJA 4IY6A 3T9HB 1GGGA 5ICQA 1KA0A 4X48A 2VP1A 4YB6A 4QSDA 3PMXA 1MQHA 2DWHA 2O69A 4TOZA 5H8NB 1LBVA 1IMEA 1HSLA 5CM6A 3PV0E 4ESXA 3IB2A 1MRPA 3FZVA 3H03A 1FBDA 3SETA 4R73A 2F6PA 3BFTA 4KXPA 4F39A 2KQZA 5EQAA 3SEUA 4L17A 4FJPA 2O51A 4KFQA 2ABHA 1JP4A 1A99A 2WYPA 3ROJA 4MMPA 2GFEA 4KYDA 1PB9A 1WODA 1FCKA 3SDFA 5JTYB 3MSTA 5ET6A 4YKIA 1FPLA 1JETA 2QRYA 1XVYA 3IJOB 3G3HA 2DWAA 4QFKA 4OESA 3MP1A 1M5EA 3EF7A 3TTKA 1CNQA 4WEDA 1ATGA 1N7WA 4QSEA 1I6AA 4LQ2A 1QW0A 3BKIB 2Y7PA 5L9SA 4DCYA 1Z7ME 1FJ6A 3OO9A 4U1OA 3B6WA 2V84A 5FBPA 3K6WA 3OO6A 4PE3A 3FUZA 5H8QA 4RJZA 4P56A 4MCOA 2ZNTA 5I57A 1MDQA 4N91A 2XXQA 3EPEA 2H9BA 3KG2A 2WEFA 1S9TA 4GIZA 4ZEDA 4TLLB 1MQJA 4DDDA 1QGXA 4AB6A 5FHNA 4ELQA 4EF2A 1MY4A 3RQTA 4OANA 5A5LA 4MFIA 3LUYA 3QXMA 5CI5A 3Q29A 1POY1 5DT6A 4XKRA 4QXDA 3O6HA 1NNTA 2HEUA 4X8RA 2F97A 4G61A 3I6VA 3PD9A 1XI6A 3HV1A 4LONB 4R6KA 2F3DA 3MYUA 1O63A 2OWTA 3KEIA 1HSEA 1RYXA 2CEYA 3ISPA 1FBCA 2ALUA 2DXYA 2XXRA 1LAHE 3RT8A 4QF9A 2RC7A 1Z7NE 2ZXTA 5EQ9A 4GX4A 1IITA 1LBXA 4QBAA 4WXJA 1SW2A 3FVOA 5KCJA 2B4MA 2DE2A 3K01A 3A29A 1FPDA 3IO6A 2HCAA 4FEDA 4UACA 1URGA 2GRVA 3LV0A 1A40A 3VXCA 2ESNA 4NF6A 3JV9A 2F78A 5DVJA 4MAGA 3DP6A 1Q35A 2XX9A 3RT6B 2W7YA 1AL3A 4BDMA 4JVDA 3MP8A 4JXIA 3KJTA 4BDLA 1Y4CA 3MPKA 3MPLA 4Q5TA 2PCRA 5DTBA 3WAEA 3MC2A 4N17A 4JSDA 2Y7RA 3QMFA 1LBBA 1JEUA 4R75A 5DVFA 4P3LA 3HCQA 2HQ0A 4NAPA 2ZYMA 3O9PA 1FBGA 4KQPA 2D5WA 5CMBA 4IO3A 4MNPA 4QSCA 3PUWE 4GF8A 4OEUA 4LA9A 3T1BA 1Y4TA 3G3FA 4QFOA 3U92A 2NXOA 4THIA 4JB7A 3C34A 3DLNA 4O8MA 4KYEA 1SDXA 2P3NA 4YZZA 1MH3A 1I6QA 3RY3A 4P1EA 4U21A 4I3YA 1FW0A 1MY3A 1B1XA 4N81A 1YYZA 4EDPA 1MXZA 3R26A 2XXVA 1MQGA 4YB5A 4ZEIA 5I7IA 1PB8A 4GWYA 1MDP1 2F35A 1F9BA 4MJOA 3TEPA 3E78A 4O3CA 2VHAA 4G2ZA 2BJJX 1B5JA 3MZBA 4R2BA 3H6VA 4AS5A 3S9MC 3CFXA 3SEVA 4NHBA 2CMOA 2XXIA 4NMYA 3U72A 3SESA 2Q2CA 2HAUA 2OCUA 2YLNA 3ILUB 3T9XB 3TQLA 4G4PA 3TAJA 1INPA 2WX9A 4R2FA 3TFLA 1GTKA 3T96B 5I58A 2I6EA 2RCAA 2Y7IA 1LGBC 3VXBA 4Q8RA 1SW1A 4XFEA 2Q9TA 3Q25A 3OSQA 4PBHA 4E0XA 4FECA 5H8FB 1FTJA 1FBHA 4NGUA 5I58B 1FQDA 4GQOA 3K4UA 1MM7A 3RGYA 1UTBA 2HPGA 2PT2A 4F22A 1D9VA 5TPAA 3FGSA 1FPKA 2QVVA 3IL1B 2O7IA 3FVNA 2R8TA 1IXCA 3VDFA 5AA2A 2OJTA 1QUIA 4XKQA 1LB8A 3N6UA 3KN3A 4BDQA 1NMUA 1DTGA 4EXLA 2O68A 2V3UA 1D4NA 4H67A 1XHYA 5CBSA 3HN0A 1DBZA 3HFUA 3ZS6A 1P1OA 1ZBMA 4OHNA 1SI1A 1R6ZA 1LCFA 4LN5A 1UIUA 4GD5A 2CZKA 3TTLA 1ZJLA 3G3JA 5J16A 4IGRA 3SZPA 2DSFA 1IIWA 5DEXB 4NF4A 4MHFA 3IR1A 3R6UA 1JQFA 2HZLA 1RDYA 4OTEA 3V89B 1L5TA 2DXRA 3OSRA 3VVDA 4OFJA 1A8EA 4XXUA 3R7XA 3RTWB 1B1HA 1NV2A 4JVCA 2FVZA 4IR8A 4YMBA 1RDXA 3DM0A 2ZNSA 4QFLA 2A5TB 1UTHA
chains in the Genus database with same CATH topology
3FJ7A 3D4GA 3UGWA 3QYTA 3UORA 1JVXA 2DE3A 1TT1A 5KDTA 4N13A 3U1OA 1M5DA 3MZ1A 1Y3QA 5TU0A 4U23A 4H6DA 3LR1A 1BP5A 4O3BA 3CSBA 4U22A 1MPDA 4ELRA 3M3KA 1ZLQA 1URDA 1MXUA 3UN6A 2G93A 1I69A 1R9QA 3O28A 3L6GA 3PU5A 5I56B 3QUFA 1EU8A 3N94A 2ZMBA 2RKMA 3FJGA 1TFDA 1FTLA 2QL3A 4YMAA 3E13X 3KSJA 2OZZA 3E4RA 4YKPA 5HPQA 1BIYA 4RXLA 2LAOA 4F1YA 3A09A 4BDNA 2D21A 3TMGA 1R1NA 4IO2A 3RPWA 2B3FA 5HM4B 1PB7A 4LATA 3RTFB 5H8NA 4LVQA 5HBCA 1GR2A 3E3KA 1NH8A 3FATA 3B6TA 3OENA 3ILTB 3K0VA 4POXA 4KCCA 3K02A 3TCFA 4ESWA 1B7UA 5F1QA 1MXVA 1SBPA 3IB0A 2WKYA 1P1NA 1VR5A 3FJMA 2VD2A 3EQ1A 2V93A 1UQWA 4OQOA 5EHSA 3H6TA 3DP8A 4IO5A 2V3TA 5JTYA 5FTHA 3VVFA 3QUJA 4X1BA 1VFEA 3CG1A 2O1MA 3Q28A 2QMWA 4I1DA 3CRBA 3PUVE 3UA8A 4H65A 1LAGE 2DWJA 3ECRA 4QFNA 3ZSFA 1LFHA 1USYH 3O97A 3KGCA 3MVWA 3M8UA 2RF1A 3K6XA 2H99A 1II5A 2GHAA 1YPNA 1DTZA 2VOZA 1UIVA 1SYIA 1B0HA 2PYYA 3TTRA 1IZ1A 2G29A 1TWYA 3OELA 3BFUA 4BDOA 2D3IA 3BBRA 3MBPA 2M8CA 4FORA 4YKKA 1H43A 3EHTA 2IEEA 4ZDMA 1IEJA 3T93B 4HW8A 1JW4A 2V25A 5H8HB 4JBZA 2XD3A 2UVJA 3VLWA 1DOTA 1OQGA 4XKPA 4ELPA 4DZ1A 4PFWA 4EQ9A 5CMKA 3PMVA 2X7PA 1T0KA 2I4CA 3C4MA 2I0CA 1A54A 1XC1A 5DVIA 4ZECA 2QMXA 1B5HA 4XKNA 4LP2B 4GLIA 2XHDA 2X26A 1B4ZA 1NKXA 2RC9A 1KWHA 5CBRA 3PPPA 1IQ7A 2RC8A 2B65A 2THIA 5CMMA 1N3XA 3V8XB 4AB5A 2X7QA 2I48A 4WKMA 3FVKA 4EF1A 5A5XB 1B2HA 3S9EA 1SYHA 4R72A 3U93A 3C35A 1MG1A 1LSTA 1Q1KA 1Y9UA 1LB9A 3S9NC 5EYFA 3CG3A 1D3KA 3OEKA 3K1NA 1NH7A 2PMSA 4U2RA 5ITOA 1ZU0A 3RNNA 4MF3A 1BKAA 3QIMA 4PFTA 4G8MA 4DXUA 5DYHA 1B46A 3K1PA 5M2VA 4H8IA 1LAXA 2PBWA 3P7IA 4IO4A 4Q0CA 3PUYE 1YTVA 1OQHA 2DQVA 5ICTA 1WVJA 3H06B 1MY0A 2I0BA 3K6UA 4C1UA 3FV2A 5I2NB 4ONYA 5EHMA 2PX1A 2F7CA 5CC2A 4PFUA 4GXSB 2NUVA 1QUKA 4H8JA 4NF8B 5AE4A 3N5LA 4ZE9A 1TFAA 3I3VA 1N7XA 4QFPA 2QSXA 2Q88A 4HS7A 5I59B 4JDFA 1A55A 4DCXA 4K3FA 2O1LA 3PPOA 3OXNA 4KI0E 2PT1A 3N6TA 4ISUA 4RK2A 4F31B 3O6IA 3C32A 5H8FA 3Q27A 4P11A 1B3HA 1B7HA 4R6YA 2UYEA 2QS4A 5FTIA 3KZGA 3B6QA 4G68B 3LSWA 1JEVA 1OMPA 5FHMA 3LSLA 5ITPA 1I6BA 4F1UA 1XOCA 1NNPA 3C9HA 3N26A 3PUXE 3VVEA 4ECFA 4GOTA 3IOUA 3IOWA 4MLQA 4DIGA 3MAMA 4U4XA 4H5FA 2Q89A 3MQ9A 3T66A 2DOJA 3GZGA 5TP9B 3ZKLA 3VFJA 2O7UA 1M5BA 3TCGA 1FQAA 4NF5B 4F3BA 2RCBA 1LFIA 1DMBA 1IXIA 5DEXA 1Y20A 4IGTA 3V5AA 2XXYA 1HSJA 3LC8A 1PC3A 3S4UA 1M5CA 3WAFA 3JYRA 1B0LA 2A5SA 1AMFA 4OERA 4HTGA 4M4GA 2AL4A 1FTOA 2I49A 4LUBA 2A5TA 4C1TA 4N6PA 1LLSA 3M3LA 2CZLA 1J1NA 2E0SA 4I9DA 2HZKA 4OENA 4ZS9A 3CFLA 3TTNA 4DLDA 3TDJA 3S9LC 1YCJA 4P0IA 2DVZA 2F36A 1D9YA 3TPAA 5I56A 2UVIA 1P99A 1P1QA 2OK2A 1NFTA 1DPEA 1LAFE 1CB6A 1VSOA 1MXXA 2XXPA 1OVTA 1B58A 2Z22A 4F1VA 1QKBA 1FTMA 2I4BA 2O84X 3B7DA 1PBPA 1NNFA 1S50A 3HHGA 4OYVA 4E0WA 4H1XA 3QAXA 1B5IA 3IB1A 2P0SA 4RYAA 1OLCA 3O2AA 5AA4A 3A3UA 2DYXA 2UVHA 1MXYA 3QSLA 4G8NA 4LQ5A 1JW1A 1P1WA 2Z23A 5H8SA 5I2KB 2Y7KA 1EZPA 1URSA 4MBPA 1M5FA 3KOTA 3OEMA 3U94A 4Q30B 4YU0A 3H6WA 4U1ZA 4ZZEA 3GXAA 3W15C 5AA4B 4BLAA 2Z8DA 3I5OA 3CI8A 3THIA 4M1VA 4GFRA 3OMBA 2HAVA 3USDA 2ZYKA 2ONSA 4TQUQ 4G8HA 1GV8A 1LBCA 1QKAA 3OO7A 3MUQA 2YPNA 1CE2A 4TLMB 3PPNA 2AIXA 2XD2A 5AA2D 4N07A 1N3WA 4OFLA 2REJA 3IAZA 3KSXA 3UP9A 1FQBA 3MVZA 1BLFA 3Q26A 3VV5A 2QS3A 4FAJA 2GH9A 1B3EA 1MS7A 4YKJA 1BTJA 1B05A 3FXQA 1B3LA 5F7VA 2PVUA 3EHUA 5ELVA 5CRYA 3VE1B 3L6HA 3MZ9A 5JK4A 3H4ZA 5ISUA 2OLBA 4NWDA 4X9TA 5AA1A 2I58A 2Q2AA 4IY5A 3O29A 4AQ4A 4NE4A 5LOMA 4RA1A 3HO7A 5H8HA 3KFMA 2NWJA 4JWXA 2OWSA 3OO8A 4IO7A 2IA4A 1USYE 3TTMA 4O3AA 3IOTA 3ONMA 1MXWA 1QJMA 3K2DA 4YICA 2O6AA 2V3QA 4F3GA 1B6HA 1QUJA 2ANJA 3M3FA 4GVOA 1VFDA 2ONRA 3G7WA 4EXKA 4QHQA 4HCWA 4R6HA 5B7DA 3MWBA 4P0GA 4EUOA 3UK4A 3CVGA 1MM6A 4GRKA 4LZ7A 3F11A 1QULA 3E9XA 2RINA 3MVYA 3UIFA 4OEVA 4YB7A 1ZMGA 4GL8A 4ZEKA 3G3GA 3KN7A 3MW0A 2DS9A 1N84A 1IXHA 2XXTA 2ONKE 4HCYA 4GL0A 4PQJA 3RUMA 4RK9A 4ZZAA 3G3KA 2FYIA 1OLAA 1PDAA 2F8DA 1EZOA 5A5XA 4JSOA 4PFYA 1GVCA 5H8QB 3FXUA 3ZKKA 5I57B 4LZ5A 3TKDA 3O66A 4KPTA 4POWA 3LSFB 2R6GE 3CR9A 2DVCA 3T9UA 2H25A 1Y3PA 4R9GA 3OOAA 3EHSA 3GBAA 4OZ9A 3IO4A 3IJXB 1B3GA 4JWYA 3O6GA 2XXXA 2F7BA 3TYHA 3T22A 5AA3A 4LZ8A 1AH5A 4RY1A 3PPRA 4F19A 1EH3A 3S2VA 1O64A 1PEBA 5K2YA 4JWOA 4H0WA 3TQWA 5I2NA 1IUDA 3EN3A 4DXCA 3PUZE 1RYOA 4PE5B 4BDRA 1R9LA 4XTCQ 3SEYA 2DE4A 4F18A 4NF8A 2QS1A 3FXRA 2Y7WA 5KCJB 2UYFA 3PGFA 2QPQA 1SQYA 3TODA 3RLFE 1XS5A 2H5YA 5B70A 2UVGA 5I59A 1MY2A 4I62A 4F2QA 1A8FA 1ZIUA 2I3WA 4NF6B 4NWCA 1SI0A 4G77A 4G68C 4MLVA 5IAIA 4OETA 1NNKA 1IXGA 2XXUA 2YJPA 3K6VA 1ANFA 1FQCA 1XT8A 1H76A 1OVBA 2HFBA 1VE4A 4RPNA 1B9JA 2REGA 3VLUA 3H6UA 2KLFA 3A3CA 4OFOA 2UXAA 4G68A 4KYSA 4KHZE 3OD7A 4DE8A 3C36A 4Z7EA 1DSNA 4EQBA 3W9VA 4NTLA 1YAEA 5FHOA 3SEXA 2ZYOA 2E1SA 3PPQA 2XX8A 1POTA 3GLBA 1JVYA 4ZEFA 1S7YA 3D4CA 3IK6B 3W9WA 1MH4A 4PP0A 4XIGQ 4ZEBA 4FE8A 2F6GA 1MPCA 1Y3NA 5K2XA 2XXHA 4KCDA 5TP9A 2HXWA 4GXAA 2NVUB 2P1SA 1N0TA 5JEIA 3KOSA 3TUSA 2F5XA 4NF5A 2FNCA 3HSTA 5IKBA 1LFGA 2ZYNA 1MY1A 4ND9A 4IO6A 3LSXA 3SERA 2XX7A 1O7TA 1B4HA 3U8QA 4OVJA 3FIRA 2GHBA 4RPOA 1H3DA 3CFZA 3MJNA 4OXVA 2F34A 4ZE8A 1PBQA 1A7LA 4KR5A 3K00A 3FVGA 3TZAA 3CSGA 2FA7A 2I3VA 1EZ9A 3FD3A 2XXWA 2Q8JA 5L8DA 3VLVA 1MPBA 4Z0IA 1B3FA 4QRZA 5L9MA 1AIVA 2OBGA 3DELB 3HHFA 2H4IA 4EQ7A 3CIJA 1Y1MA 4IB2A 3MVXA 3KN8A 4WEPA 1UTBB 2B3BA 4RNSA 1P1UA 4NEDA 4YAHX 5TPAB 2DWIA 2R71A 3PMWA 2QJEA 2H98A 4FEBA 3TELA 3C31A 5AA2B 2R9JA 5J1DA 3ODBA 4OMBA 2P2AA 1FQFA 3IOVA 1B7ZA 3IX1A 2Z8EA 3V83A 1Y1ZA 3FASA 1FQEA 4F3SA 4C0RA 1AOVA 2NOOA 4H5GA 5L9OA 3C33A 3HPIA 4I8CA 4ELOA 3K1MA 1N76A 1MQIA 1SW4A 1JW5A 3AXFA 1SVXB 3H7MA 3G3IA 4R74A 1TXFA 5I2KA 2Z8FA 4X1DA 1B52A 4R9FA 4UA8A 1WDNA 3DP4A 1B32A 4F29A 2Y84A 3LBSA 4NF4B 5KZTA 1XVXA 2ZNUA 2AYSA 5BUUA 1LCTA 3T9VA 1US4A 4F2OA 3KJ7A 3IORA 3PD8A 2VD3A 1SW5A 3RN8A 2AL5A 4OWDA 1UTHB 4FIMA 4PETA 1B51A 1SD3A 5KDTB 1DPPA 3QK6A 3KBRA 4DXBA 3SEWA 1NL5A 1QVSA 2DP8A 1JNFA 1FTKA 4U4SA 2F7AA 5BWJA 1B40A 1ZTYA 3JZJA 1H45A 2VGQA 4MH5A 5I84A 1OIBA 2QS2A 1RKMA 3GBBA 1US5A 3MP6A 4F3PA 1H44A 3TCHA 3FV1A 1MQDA 5CMCA 1ZKBA 4FATA 4KD5A 3SKPA 3H3GA 4GWOA 1ELJA 4IY6A 3T9HB 1GGGA 5ICQA 4X48A 2VP1A 4YB6A 4QSDA 3PMXA 1MQHA 2DWHA 2O69A 4TOZA 5H8NB 1HSLA 5CM6A 3PV0E 4ESXA 3IB2A 1MRPA 3FZVA 3H03A 3SETA 4R73A 2F6PA 3BFTA 4F39A 3SEUA 4L17A 4FJPA 2O51A 4KFQA 2ABHA 1A99A 2GFEA 4KYDA 1PB9A 1WODA 1FCKA 3SDFA 5JTYB 4YKIA 1JETA 2QRYA 1XVYA 3IJOB 3G3HA 2DWAA 4QFKA 4OESA 1UTHA 3MP1A 1M5EA 3EF7A 3TTKA 4WEDA 1ATGA 1N7WA 4QSEA 1I6AA 4LQ2A 1QW0A 3BKIB 2Y7PA 5L9SA 4DCYA 1Z7ME 3OO9A 4U1OA 3B6WA 2V84A 3K6WA 3OO6A 3FUZA 5H8QA 4RJZA 2ZNTA 5I57A 1MDQA 2XXQA 3EPEA 2H9BA 3KG2A 1S9TA 4GIZA 4ZEDA 4TLLB 1MQJA 4DDDA 4AB6A 5FHNA 4ELQA 4EF2A 1MY4A 3RQTA 4MFIA 3LUYA 3QXMA 5CI5A 3Q29A 1POY1 5DT6A 4XKRA 3O6HA 1NNTA 2HEUA 2F97A 3I6VA 3PD9A 3HV1A 4LONB 4R6KA 1O63A 2OWTA 3KEIA 1HSEA 1RYXA 2ALUA 2DXYA 2XXRA 1LAHE 3RT8A 4QF9A 2RC7A 1Z7NE 2ZXTA 1IITA 4WXJA 1SW2A 3FVOA 5KCJA 2DE2A 3K01A 3IO6A 2HCAA 4FEDA 4UACA 1URGA 2GRVA 1A40A 3VXCA 2ESNA 4NF6A 3JV9A 2F78A 5DVJA 3DP6A 1Q35A 2XX9A 3RT6B 2W7YA 1AL3A 4BDMA 3MP8A 4JXIA 3KJTA 4BDLA 1Y4CA 3MPKA 3MPLA 4Q5TA 5DTBA 3WAEA 3MC2A 4JSDA 2Y7RA 1LBBA 1JEUA 4R75A 5DVFA 3HCQA 2HQ0A 2ZYMA 3O9PA 4KQPA 5CMBA 2D5WA 4IO3A 4QSCA 3PUWE 4GF8A 4OEUA 4LA9A 1Y4TA 3G3FA 4QFOA 3U92A 2NXOA 4THIA 4JB7A 3C34A 3DLNA 4KYEA 1SDXA 4YZZA 1MH3A 1I6QA 3RY3A 4U21A 1FW0A 1MY3A 1B1XA 4EDPA 1MXZA 3R26A 2XXVA 1MQGA 4YB5A 4ZEIA 1PB8A 1MDP1 2F35A 1F9BA 3TEPA 4O3CA 2VHAA 4G2ZA 2BJJX 1B5JA 3MZBA 4R2BA 3H6VA 3S9MC 3CFXA 3SEVA 2CMOA 2XXIA 4NMYA 3U72A 3SESA 2Q2CA 2HAUA 2OCUA 2YLNA 3ILUB 3T9XB 3TQLA 4G4PA 3TAJA 4R2FA 3TFLA 1GTKA 3T96B 5I58A 2I6EA 2RCAA 2Y7IA 1LGBC 3VXBA 4Q8RA 1SW1A 2Q9TA 3Q25A 3OSQA 4E0XA 4FECA 5H8FB 1FTJA 5I58B 1FQDA 4GQOA 3K4UA 1MM7A 3RGYA 1UTBA 2PT2A 4F22A 1D9VA 5TPAA 3FGSA 3IL1B 2O7IA 3FVNA 1IXCA 3VDFA 5AA2A 2OJTA 1QUIA 4XKQA 1LB8A 3N6UA 3KN3A 4BDQA 1NMUA 1DTGA 4EXLA 2O68A 2V3UA 1D4NA 4H67A 1XHYA 5CBSA 3HN0A 3ZS6A 1P1OA 1ZBMA 4OHNA 1SI1A 1R6ZA 1LCFA 1UIUA 4GD5A 3TTLA 1ZJLA 3G3JA 4IGRA 2DSFA 1IIWA 5DEXB 4NF4A 3IR1A 3R6UA 1JQFA 2HZLA 4OTEA 3V89B 1L5TA 2DXRA 3OSRA 3VVDA 4OFJA 1A8EA 4XXUA 3R7XA 3RTWB 1B1HA 4YMBA 3DM0A 2ZNSA 4QFLA 2A5TB 1N04A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3FJ7 A;  3D4G A;  3UGW A;  3QYT A;  3UOR A;  1JVX A;  2DE3 A;  1TT1 A;  5KDT A;  4N13 A;  3U1O A;  1M5D A;  3MZ1 A;  1Y3Q A;  5TU0 A;  4U23 A;  4H6D A;  3LR1 A;  1BP5 A;  4O3B A;  3CSB A;  4U22 A;  1MPD A;  4ELR A;  3M3K A;  1ZLQ A;  1URD A;  1MXU A;  3UN6 A;  2G93 A;  1I69 A;  1R9Q A;  3O28 A;  3L6G A;  3PU5 A;  5I56 B;  3QUF A;  1EU8 A;  3N94 A;  2ZMB A;  2RKM A;  3FJG A;  1TFD A;  1FTL A;  2QL3 A;  4YMA A;  3E13 X;  3KSJ A;  2OZZ A;  3E4R A;  4YKP A;  5HPQ A;  1BIY A;  4RXL A;  2LAO A;  4F1Y A;  3A09 A;  4BDN A;  2D21 A;  3TMG A;  1R1N A;  4IO2 A;  3RPW A;  2B3F A;  5HM4 B;  1PB7 A;  4LAT A;  3RTF B;  5H8N A;  4LVQ A;  5HBC A;  1GR2 A;  3E3K A;  1NH8 A;  3FAT A;  3B6T A;  3OEN A;  3ILT B;  3K0V A;  4POX A;  4KCC A;  3K02 A;  3TCF A;  4ESW A;  1B7U A;  5F1Q A;  1MXV A;  1SBP A;  3IB0 A;  2WKY A;  1P1N A;  1VR5 A;  3FJM A;  2VD2 A;  3EQ1 A;  2V93 A;  1UQW A;  4OQO A;  5EHS A;  3H6T A;  3DP8 A;  4IO5 A;  2V3T A;  5JTY A;  5FTH A;  3VVF A;  3QUJ A;  4X1B A;  1VFE A;  3CG1 A;  2O1M A;  3Q28 A;  2QMW A;  4I1D A;  3CRB A;  3PUV E;  3UA8 A;  4H65 A;  1LAG E;  2DWJ A;  3ECR A;  4QFN A;  3ZSF A;  1LFH A;  1USY H;  3O97 A;  3KGC A;  3MVW A;  3M8U A;  2RF1 A;  3K6X A;  2H99 A;  1II5 A;  2GHA A;  1YPN A;  1DTZ A;  2VOZ A;  1UIV A;  1SYI A;  1B0H A;  2PYY A;  3TTR A;  1IZ1 A;  2G29 A;  1TWY A;  3OEL A;  3BFU A;  4BDO A;  2D3I A;  3BBR A;  3MBP A;  2M8C A;  4FOR A;  4YKK A;  1H43 A;  3EHT A;  2IEE A;  4ZDM A;  1IEJ A;  3T93 B;  4HW8 A;  1JW4 A;  2V25 A;  5H8H B;  4JBZ A;  2XD3 A;  2UVJ A;  3VLW A;  1DOT A;  1OQG A;  4XKP A;  4ELP A;  4DZ1 A;  4PFW A;  4EQ9 A;  5CMK A;  3PMV A;  2X7P A;  1T0K A;  2I4C A;  3C4M A;  2I0C A;  1A54 A;  1XC1 A;  5DVI A;  4ZEC A;  2QMX A;  1B5H A;  4XKN A;  4LP2 B;  4GLI A;  2XHD A;  2X26 A;  1B4Z A;  1NKX A;  2RC9 A;  1KWH A;  5CBR A;  3PPP A;  1IQ7 A;  2RC8 A;  2B65 A;  2THI A;  5CMM A;  1N3X A;  3V8X B;  4AB5 A;  2X7Q A;  2I48 A;  4WKM A;  3FVK A;  4EF1 A;  5A5X B;  1B2H A;  3S9E A;  1SYH A;  4R72 A;  3U93 A;  3C35 A;  1MG1 A;  1LST A;  1Q1K A;  1Y9U A;  1LB9 A;  3S9N C;  5EYF A;  3CG3 A;  1D3K A;  3OEK A;  3K1N A;  1NH7 A;  2PMS A;  4U2R A;  5ITO A;  1ZU0 A;  3RNN A;  4MF3 A;  1BKA A;  3QIM A;  4PFT A;  4G8M A;  4DXU A;  5DYH A;  1B46 A;  3K1P A;  5M2V A;  4H8I A;  1LAX A;  2PBW A;  3P7I A;  4IO4 A;  4Q0C A;  3PUY E;  1YTV A;  1OQH A;  2DQV A;  5ICT A;  1WVJ A;  3H06 B;  1MY0 A;  2I0B A;  3K6U A;  4C1U A;  3FV2 A;  5I2N B;  4ONY A;  5EHM A;  2PX1 A;  2F7C A;  5CC2 A;  4PFU A;  4GXS B;  2NUV A;  1QUK A;  4H8J A;  4NF8 B;  5AE4 A;  3N5L A;  4ZE9 A;  1TFA A;  3I3V A;  1N7X A;  4QFP A;  2QSX A;  2Q88 A;  4HS7 A;  5I59 B;  4JDF A;  1A55 A;  4DCX A;  4K3F A;  2O1L A;  3PPO A;  3OXN A;  4KI0 E;  2PT1 A;  3N6T A;  4ISU A;  4RK2 A;  4F31 B;  3O6I A;  3C32 A;  5H8F A;  3Q27 A;  4P11 A;  1B3H A;  1B7H A;  4R6Y A;  2UYE A;  2QS4 A;  5FTI A;  3KZG A;  3B6Q A;  4G68 B;  3LSW A;  1JEV A;  1OMP A;  5FHM A;  3LSL A;  5ITP A;  1I6B A;  4F1U A;  1XOC A;  1NNP A;  3C9H A;  3N26 A;  3PUX E;  3VVE A;  4ECF A;  4GOT A;  3IOU A;  3IOW A;  4MLQ A;  4DIG A;  3MAM A;  4U4X A;  4H5F A;  2Q89 A;  3MQ9 A;  3T66 A;  2DOJ A;  3GZG A;  5TP9 B;  3ZKL A;  3VFJ A;  2O7U A;  1M5B A;  3TCG A;  1FQA A;  4NF5 B;  4F3B A;  2RCB A;  1LFI A;  1DMB A;  1IXI A;  5DEX A;  1Y20 A;  4IGT A;  3V5A A;  2XXY A;  1HSJ A;  3LC8 A;  1PC3 A;  3S4U A;  1M5C A;  3WAF A;  3JYR A;  1B0L A;  2A5S A;  1AMF A;  4OER A;  4HTG A;  4M4G A;  2AL4 A;  1FTO A;  2I49 A;  4LUB A;  2A5T A;  4C1T A;  4N6P A;  1LLS A;  3M3L A;  2CZL A;  1J1N A;  2E0S A;  4I9D A;  2HZK A;  4OEN A;  4ZS9 A;  3CFL A;  3TTN A;  4DLD A;  3TDJ A;  3S9L C;  1YCJ A;  4P0I A;  2DVZ A;  2F36 A;  1D9Y A;  3TPA A;  5I56 A;  2UVI A;  1P99 A;  1P1Q A;  2OK2 A;  1NFT A;  1DPE A;  1LAF E;  1CB6 A;  1VSO A;  1MXX A;  2XXP A;  1OVT A;  1B58 A;  2Z22 A;  4F1V A;  1QKB A;  1FTM A;  2I4B A;  2O84 X;  3B7D A;  1PBP A;  1NNF A;  1S50 A;  3HHG A;  4OYV A;  4E0W A;  4H1X A;  3QAX A;  1B5I A;  3IB1 A;  2P0S A;  4RYA A;  1OLC A;  3O2A A;  5AA4 A;  3A3U A;  2DYX A;  2UVH A;  1MXY A;  3QSL A;  4G8N A;  4LQ5 A;  1JW1 A;  1P1W A;  2Z23 A;  5H8S A;  5I2K B;  2Y7K A;  1EZP A;  1URS A;  4MBP A;  1M5F A;  3KOT A;  3OEM A;  3U94 A;  4Q30 B;  4YU0 A;  3H6W A;  4U1Z A;  4ZZE A;  3GXA A;  3W15 C;  5AA4 B;  4BLA A;  2Z8D A;  3I5O A;  3CI8 A;  3THI A;  4M1V A;  4GFR A;  3OMB A;  2HAV A;  3USD A;  2ZYK A;  2ONS A;  4TQU Q;  4G8H A;  1GV8 A;  1LBC A;  1QKA A;  3OO7 A;  3MUQ A;  2YPN A;  1CE2 A;  4TLM B;  3PPN A;  2AIX A;  2XD2 A;  5AA2 D;  4N07 A;  1N3W A;  4OFL A;  2REJ A;  3IAZ A;  3KSX A;  3UP9 A;  1FQB A;  3MVZ A;  1BLF A;  3Q26 A;  3VV5 A;  2QS3 A;  4FAJ A;  2GH9 A;  1B3E A;  1MS7 A;  4YKJ A;  1BTJ A;  1B05 A;  3FXQ A;  1B3L A;  5F7V A;  2PVU A;  3EHU A;  5ELV A;  5CRY A;  3VE1 B;  3L6H A;  3MZ9 A;  5JK4 A;  3H4Z A;  5ISU A;  2OLB A;  4NWD A;  4X9T A;  5AA1 A;  2I58 A;  2Q2A A;  4IY5 A;  3O29 A;  4AQ4 A;  4NE4 A;  5LOM A;  4RA1 A;  3HO7 A;  5H8H A;  3KFM A;  2NWJ A;  4JWX A;  2OWS A;  3OO8 A;  4IO7 A;  2IA4 A;  1USY E;  3TTM A;  4O3A A;  3IOT A;  3ONM A;  1MXW A;  1QJM A;  3K2D A;  4YIC A;  2O6A A;  2V3Q A;  4F3G A;  1B6H A;  1QUJ A;  2ANJ A;  3M3F A;  4GVO A;  1VFD A;  2ONR A;  3G7W A;  4EXK A;  4QHQ A;  4HCW A;  4R6H A;  5B7D A;  3MWB A;  4P0G A;  4EUO A;  3UK4 A;  3CVG A;  1MM6 A;  4GRK A;  4LZ7 A;  3F11 A;  1QUL A;  3E9X A;  2RIN A;  3MVY A;  3UIF A;  4OEV A;  4YB7 A;  1ZMG A;  4GL8 A;  4ZEK A;  3G3G A;  3KN7 A;  3MW0 A;  2DS9 A;  1N84 A;  1IXH A;  2XXT A;  2ONK E;  4HCY A;  4GL0 A;  4PQJ A;  3RUM A;  4RK9 A;  4ZZA A;  3G3K A;  2FYI A;  1OLA A;  1PDA A;  2F8D A;  1EZO A;  5A5X A;  4JSO A;  4PFY A;  1GVC A;  5H8Q B;  3FXU A;  3ZKK A;  5I57 B;  4LZ5 A;  3TKD A;  3O66 A;  4KPT A;  4POW A;  3LSF B;  2R6G E;  3CR9 A;  2DVC A;  3T9U A;  2H25 A;  1Y3P A;  4R9G A;  3OOA A;  3EHS A;  3GBA A;  4OZ9 A;  3IO4 A;  3IJX B;  1B3G A;  4JWY A;  3O6G A;  2XXX A;  2F7B A;  3TYH A;  3T22 A;  5AA3 A;  4LZ8 A;  1AH5 A;  4RY1 A;  3PPR A;  4F19 A;  1EH3 A;  3S2V A;  1O64 A;  1PEB A;  5K2Y A;  4JWO A;  4H0W A;  3TQW A;  5I2N A;  1IUD A;  3EN3 A;  4DXC A;  3PUZ E;  1RYO A;  4PE5 B;  4BDR A;  1R9L A;  4XTC Q;  3SEY A;  2DE4 A;  4F18 A;  4NF8 A;  2QS1 A;  3FXR A;  2Y7W A;  5KCJ B;  2UYF A;  3PGF A;  2QPQ A;  1SQY A;  3TOD A;  3RLF E;  1XS5 A;  2H5Y A;  5B70 A;  2UVG A;  5I59 A;  1MY2 A;  4I62 A;  4F2Q A;  1A8F A;  1ZIU A;  2I3W A;  4NF6 B;  4NWC A;  1SI0 A;  4G77 A;  4G68 C;  4MLV A;  5IAI A;  4OET A;  1NNK A;  1IXG A;  2XXU A;  2YJP A;  3K6V A;  1ANF A;  1FQC A;  1XT8 A;  1H76 A;  1OVB A;  2HFB A;  1VE4 A;  4RPN A;  1B9J A;  2REG A;  3VLU A;  3H6U A;  2KLF A;  3A3C A;  4OFO A;  2UXA A;  4G68 A;  4KYS A;  4KHZ E;  3OD7 A;  4DE8 A;  3C36 A;  4Z7E A;  1DSN A;  4EQB A;  3W9V A;  4NTL A;  1YAE A;  5FHO A;  3SEX A;  2ZYO A;  2E1S A;  3PPQ A;  2XX8 A;  1POT A;  3GLB A;  1JVY A;  4ZEF A;  1S7Y A;  3D4C A;  3IK6 B;  3W9W A;  1MH4 A;  4PP0 A;  4XIG Q;  4ZEB A;  4FE8 A;  2F6G A;  1MPC A;  1Y3N A;  5K2X A;  2XXH A;  4KCD A;  5TP9 A;  2HXW A;  4GXA A;  2NVU B;  2P1S A;  1N0T A;  5JEI A;  3KOS A;  3TUS A;  2F5X A;  4NF5 A;  2FNC A;  3HST A;  5IKB A;  1LFG A;  2ZYN A;  1MY1 A;  4ND9 A;  4IO6 A;  3LSX A;  3SER A;  2XX7 A;  1O7T A;  1B4H A;  3U8Q A;  4OVJ A;  3FIR A;  2GHB A;  4RPO A;  1H3D A;  3CFZ A;  3MJN A;  4OXV A;  2F34 A;  4ZE8 A;  1PBQ A;  1A7L A;  4KR5 A;  3K00 A;  3FVG A;  3TZA A;  3CSG A;  2FA7 A;  2I3V A;  1EZ9 A;  3FD3 A;  2XXW A;  2Q8J A;  5L8D A;  3VLV A;  1MPB A;  4Z0I A;  1B3F A;  4QRZ A;  5L9M A;  1AIV A;  2OBG A;  3DEL B;  3HHF A;  2H4I A;  4EQ7 A;  3CIJ A;  1Y1M A;  4IB2 A;  3MVX A;  3KN8 A;  4WEP A;  1UTB B;  2B3B A;  4RNS A;  1P1U A;  4NED A;  4YAH X;  5TPA B;  2DWI A;  2R71 A;  3PMW A;  2QJE A;  2H98 A;  4FEB A;  3TEL A;  3C31 A;  5AA2 B;  2R9J A;  5J1D A;  3ODB A;  4OMB A;  2P2A A;  1FQF A;  3IOV A;  1B7Z A;  3IX1 A;  2Z8E A;  3V83 A;  1Y1Z A;  3FAS A;  1FQE A;  4F3S A;  4C0R A;  1AOV A;  2NOO A;  4H5G A;  5L9O A;  3C33 A;  3HPI A;  4I8C A;  4ELO A;  3K1M A;  1N76 A;  1MQI A;  1SW4 A;  1JW5 A;  3AXF A;  1SVX B;  3H7M A;  3G3I A;  4R74 A;  1TXF A;  5I2K A;  2Z8F A;  4X1D A;  1B52 A;  4R9F A;  4UA8 A;  1WDN A;  3DP4 A;  1B32 A;  4F29 A;  2Y84 A;  3LBS A;  4NF4 B;  5KZT A;  1XVX A;  2ZNU A;  2AYS A;  5BUU A;  1LCT A;  3T9V A;  1US4 A;  4F2O A;  3KJ7 A;  3IOR A;  3PD8 A;  2VD3 A;  1SW5 A;  3RN8 A;  2AL5 A;  4OWD A;  1UTH B;  4FIM A;  4PET A;  1B51 A;  1SD3 A;  5KDT B;  1DPP A;  3QK6 A;  3KBR A;  4DXB A;  3SEW A;  1NL5 A;  1QVS A;  2DP8 A;  1JNF A;  1FTK A;  4U4S A;  2F7A A;  5BWJ A;  1B40 A;  1ZTY A;  3JZJ A;  1H45 A;  2VGQ A;  4MH5 A;  5I84 A;  1OIB A;  2QS2 A;  1RKM A;  3GBB A;  1US5 A;  3MP6 A;  4F3P A;  1H44 A;  3TCH A;  3FV1 A;  1MQD A;  5CMC A;  1ZKB A;  4FAT A;  4KD5 A;  3SKP A;  3H3G A;  4GWO A;  1ELJ A;  4IY6 A;  3T9H B;  1GGG A;  5ICQ A;  4X48 A;  2VP1 A;  4YB6 A;  4QSD A;  3PMX A;  1MQH A;  2DWH A;  2O69 A;  4TOZ A;  5H8N B;  1HSL A;  5CM6 A;  3PV0 E;  4ESX A;  3IB2 A;  1MRP A;  3FZV A;  3H03 A;  3SET A;  4R73 A;  2F6P A;  3BFT A;  4F39 A;  3SEU A;  4L17 A;  4FJP A;  2O51 A;  4KFQ A;  2ABH A;  1A99 A;  2GFE A;  4KYD A;  1PB9 A;  1WOD A;  1FCK A;  3SDF A;  5JTY B;  4YKI A;  1JET A;  2QRY A;  1XVY A;  3IJO B;  3G3H A;  2DWA A;  4QFK A;  4OES A;  1UTH A;  3MP1 A;  1M5E A;  3EF7 A;  3TTK A;  4WED A;  1ATG A;  1N7W A;  4QSE A;  1I6A A;  4LQ2 A;  1QW0 A;  3BKI B;  2Y7P A;  5L9S A;  4DCY A;  1Z7M E;  3OO9 A;  4U1O A;  3B6W A;  2V84 A;  3K6W A;  3OO6 A;  3FUZ A;  5H8Q A;  4RJZ A;  2ZNT A;  5I57 A;  1MDQ A;  2XXQ A;  3EPE A;  2H9B A;  3KG2 A;  1S9T A;  4GIZ A;  4ZED A;  4TLL B;  1MQJ A;  4DDD A;  4AB6 A;  5FHN A;  4ELQ A;  4EF2 A;  1MY4 A;  3RQT A;  4MFI A;  3LUY A;  3QXM A;  5CI5 A;  3Q29 A;  1POY 1;  5DT6 A;  4XKR A;  3O6H A;  1NNT A;  2HEU A;  2F97 A;  3I6V A;  3PD9 A;  3HV1 A;  4LON B;  4R6K A;  1O63 A;  2OWT A;  3KEI A;  1HSE A;  1RYX A;  2ALU A;  2DXY A;  2XXR A;  1LAH E;  3RT8 A;  4QF9 A;  2RC7 A;  1Z7N E;  2ZXT A;  1IIT A;  4WXJ A;  1SW2 A;  3FVO A;  5KCJ A;  2DE2 A;  3K01 A;  3IO6 A;  2HCA A;  4FED A;  4UAC A;  1URG A;  2GRV A;  1A40 A;  3VXC A;  2ESN A;  4NF6 A;  3JV9 A;  2F78 A;  5DVJ A;  3DP6 A;  1Q35 A;  2XX9 A;  3RT6 B;  2W7Y A;  1AL3 A;  4BDM A;  3MP8 A;  4JXI A;  3KJT A;  4BDL A;  1Y4C A;  3MPK A;  3MPL A;  4Q5T A;  5DTB A;  3WAE A;  3MC2 A;  4JSD A;  2Y7R A;  1LBB A;  1JEU A;  4R75 A;  5DVF A;  3HCQ A;  2HQ0 A;  2ZYM A;  3O9P A;  4KQP A;  5CMB A;  2D5W A;  4IO3 A;  4QSC A;  3PUW E;  4GF8 A;  4OEU A;  4LA9 A;  1Y4T A;  3G3F A;  4QFO A;  3U92 A;  2NXO A;  4THI A;  4JB7 A;  3C34 A;  3DLN A;  4KYE A;  1SDX A;  4YZZ A;  1MH3 A;  1I6Q A;  3RY3 A;  4U21 A;  1FW0 A;  1MY3 A;  1B1X A;  4EDP A;  1MXZ A;  3R26 A;  2XXV A;  1MQG A;  4YB5 A;  4ZEI A;  1PB8 A;  1MDP 1;  2F35 A;  1F9B A;  3TEP A;  4O3C A;  2VHA A;  4G2Z A;  2BJJ X;  1B5J A;  3MZB A;  4R2B A;  3H6V A;  3S9M C;  3CFX A;  3SEV A;  2CMO A;  2XXI A;  4NMY A;  3U72 A;  3SES A;  2Q2C A;  2HAU A;  2OCU A;  2YLN A;  3ILU B;  3T9X B;  3TQL A;  4G4P A;  3TAJ A;  4R2F A;  3TFL A;  1GTK A;  3T96 B;  5I58 A;  2I6E A;  2RCA A;  2Y7I A;  1LGB C;  3VXB A;  4Q8R A;  1SW1 A;  2Q9T A;  3Q25 A;  3OSQ A;  4E0X A;  4FEC A;  5H8F B;  1FTJ A;  5I58 B;  1FQD A;  4GQO A;  3K4U A;  1MM7 A;  3RGY A;  1UTB A;  2PT2 A;  4F22 A;  1D9V A;  5TPA A;  3FGS A;  3IL1 B;  2O7I A;  3FVN A;  1IXC A;  3VDF A;  5AA2 A;  2OJT A;  1QUI A;  4XKQ A;  1LB8 A;  3N6U A;  3KN3 A;  4BDQ A;  1NMU A;  1DTG A;  4EXL A;  2O68 A;  2V3U A;  1D4N A;  4H67 A;  1XHY A;  5CBS A;  3HN0 A;  3ZS6 A;  1P1O A;  1ZBM A;  4OHN A;  1SI1 A;  1R6Z A;  1LCF A;  1UIU A;  4GD5 A;  3TTL A;  1ZJL A;  3G3J A;  4IGR A;  2DSF A;  1IIW A;  5DEX B;  4NF4 A;  3IR1 A;  3R6U A;  1JQF A;  2HZL A;  4OTE A;  3V89 B;  1L5T A;  2DXR A;  3OSR A;  3VVD A;  4OFJ A;  1A8E A;  4XXU A;  3R7X A;  3RTW B;  1B1H A;  4YMB A;  3DM0 A;  2ZNS A;  4QFL A;  2A5T B;  1N04 A; 
#chains in the Genus database with same CATH topology
 3FJ7 A;  3D4G A;  3UGW A;  5IZ3 B;  3QYT A;  3UOR A;  1JVX A;  2DE3 A;  1TT1 A;  5KDT A;  4N13 A;  3U1O A;  1M5D A;  3MZ1 A;  1Y3Q A;  5TU0 A;  4U23 A;  4H6D A;  3LR1 A;  1BP5 A;  4O3B A;  3CSB A;  3KC0 A;  4U22 A;  1LBW A;  1MPD A;  4ELR A;  3M3K A;  2FHY A;  1ZLQ A;  1URD A;  1MXU A;  3UN6 A;  2G93 A;  1I69 A;  1R9Q A;  3O28 A;  3L6G A;  2FIX A;  3PU5 A;  5I56 B;  3RPL A;  4O7I A;  5DW8 A;  1SPI A;  3QUF A;  1EU8 A;  3N94 A;  2ZMB A;  4HE2 A;  2RKM A;  3FJG A;  1TFD A;  1FTL A;  2QL3 A;  4YMA A;  3E13 X;  3KSJ A;  4PAI A;  2OZZ A;  4GBV A;  3E4R A;  4YKP A;  5HPQ A;  1BIY A;  4RXL A;  2LAO A;  4OVS A;  4F1Y A;  3A09 A;  4BDN A;  2D21 A;  3PTY A;  3TMG A;  1R1N A;  4IO2 A;  3RPW A;  2B3F A;  5HM4 B;  1PB7 A;  4LAT A;  3RTF B;  5H8N A;  4LVQ A;  5HBC A;  1GR2 A;  3E3K A;  1NH8 A;  1IMB A;  3FAT A;  3B6T A;  3OEN A;  3ILT B;  3K0V A;  4POX A;  5IGA A;  4KCC A;  3K02 A;  3TCF A;  1FBE A;  4ESW A;  1B7U A;  5F1Q A;  4NX1 A;  2V4C A;  1MXV A;  1SBP A;  3IB0 A;  2WKY A;  1P1N A;  4H45 A;  1VR5 A;  3FJM A;  2VD2 A;  3EQ1 A;  2V93 A;  1UQW A;  4OQO A;  5EHS A;  4O7M A;  3H6T A;  3DP8 A;  4IO5 A;  2V3T A;  5JTY A;  5FTH A;  1IMC A;  3VVF A;  3QUJ A;  4X1B A;  1VFE A;  3CG1 A;  2O1M A;  3Q28 A;  2QMW A;  4I1D A;  3CRB A;  3PUV E;  3UA8 A;  4H65 A;  1LAG E;  2DWJ A;  3ECR A;  4QFN A;  5T3J A;  3ZSF A;  1LFH A;  1USY H;  3O97 A;  3KGC A;  3MVW A;  3M8U A;  2RF1 A;  3K6X A;  2H99 A;  1II5 A;  2GHA A;  4OVQ A;  1YPN A;  1DTZ A;  2VOZ A;  1NUX A;  1UIV A;  1FPE A;  1SYI A;  1B0H A;  2PYY A;  5ET5 A;  3TTR A;  1IZ1 A;  1FPI A;  2G29 A;  1TWY A;  3OEL A;  3BFU A;  1NUW A;  4BDO A;  2D3I A;  3BBR A;  3MBP A;  2M8C A;  3T0J A;  4FOR A;  1FPG A;  4YKK A;  1H43 A;  3EHT A;  3CHG A;  4OVR A;  2IEE A;  4ZDM A;  2L5V A;  1IEJ A;  3T93 B;  4HW8 A;  4P1L A;  1JW4 A;  2QFL A;  2V25 A;  5H8H B;  4JBZ A;  2XD3 A;  2UVJ A;  4HE1 A;  3VLW A;  1DOT A;  1OQG A;  4XKP A;  1NV4 A;  4ELP A;  4DZ1 A;  4HXV A;  4PFW A;  4EQ9 A;  5CMK A;  4H46 A;  3PMV A;  2X7P A;  3D1R A;  1T0K A;  2I4C A;  3C4M A;  4MEV A;  2I0C A;  1A54 A;  1XC1 A;  5DVI A;  4ZEC A;  2BJI A;  2QMX A;  1B5H A;  4XKN A;  4LP2 B;  4GLI A;  1N04 A;  2XHD A;  2X26 A;  1FBF A;  1B4Z A;  1NKX A;  2OX3 A;  5LDZ A;  2RC9 A;  1KWH A;  2KR0 A;  4PFB A;  5CBR A;  3PPP A;  4PGN A;  1IQ7 A;  2RC8 A;  2B65 A;  2THI A;  4P47 A;  5CMM A;  1N3X A;  3U65 A;  3V8X B;  4AB5 A;  2X7Q A;  1NV3 A;  2I48 A;  4NQ8 A;  4WKM A;  2CEX A;  3FVK A;  4EF1 A;  3E79 A;  5A5X B;  1B2H A;  3S9E A;  1RDZ A;  1SYH A;  4R72 A;  3U93 A;  3C35 A;  1K9Y A;  5EYG A;  1MG1 A;  1LST A;  1Q1K A;  1Y9U A;  1LB9 A;  1D9Q A;  3S9N C;  4MX6 A;  5EYF A;  3CG3 A;  1D3K A;  3OEK A;  1NV6 A;  3K1N A;  1NH7 A;  2PMS A;  4U2R A;  5ITO A;  1ZU0 A;  3RNN A;  4MF3 A;  1BKA A;  3QIM A;  4PFT A;  4G8M A;  4DXU A;  5DYH A;  1B46 A;  3K1P A;  5M2V A;  4H8I A;  1LAX A;  2PBW A;  3P7I A;  4IO4 A;  4Q0C A;  3PUY E;  1YTV A;  1OQH A;  2DQV A;  5ICT A;  1WVJ A;  3H06 B;  1MY0 A;  1FBP A;  2I0B A;  3K6U A;  4C1U A;  3FV2 A;  5I2N B;  4ONY A;  5EHM A;  2PX1 A;  4N8Y A;  2F7C A;  5CC2 A;  4PFU A;  4GXS B;  2NUV A;  1QUK A;  1FJ9 A;  4H8J A;  4NF8 B;  5AE4 A;  3N5L A;  4ZE9 A;  1TFA A;  3I3V A;  1N7X A;  4QFP A;  2QSX A;  1KZ8 A;  2Q88 A;  4HS7 A;  5I59 B;  4JDF A;  1A55 A;  4DCX A;  4K3F A;  1NUY A;  2O1L A;  3PPO A;  3OXN A;  4KI0 E;  2PT1 A;  3N6T A;  4RK2 A;  4ISU A;  4I40 A;  4F31 B;  3O6I A;  3C32 A;  5H8F A;  4PTK A;  3Q27 A;  4P11 A;  1B3H A;  2HHM A;  1B7H A;  4R6Y A;  2UYE A;  2QS4 A;  2WBD A;  5FTI A;  1FPJ A;  3KZG A;  3B6Q A;  4G68 B;  3LSW A;  1JEV A;  1OMP A;  5FHM A;  3LSL A;  5ITP A;  1I6B A;  4F1U A;  1XOC A;  1NNP A;  4GWU A;  3C9H A;  3N26 A;  3PUX E;  4HE0 A;  1NV7 A;  3VVE A;  4ECF A;  4MNI A;  4GOT A;  3IOU A;  1DCU A;  3IOW A;  4MLQ A;  1BK4 A;  4DIG A;  3MAM A;  2Y5K A;  4U4X A;  4H5F A;  4GWZ A;  2Q89 A;  3MQ9 A;  3B8B A;  3T66 A;  2DOJ A;  3GZG A;  5TP9 B;  3ZKL A;  3VFJ A;  2O7U A;  1M5B A;  3TCG A;  1FQA A;  4NF5 B;  4F3B A;  2RCB A;  1LFI A;  1DMB A;  3FBP A;  1IXI A;  5DEX A;  1Y20 A;  4N6D A;  4IGT A;  2XWV A;  3V5A A;  2XXY A;  1HSJ A;  3GYY A;  3LC8 A;  1PC3 A;  3S4U A;  1M5C A;  3WAF A;  3JYR A;  1B0L A;  2A5S A;  1K9Z A;  4OER A;  1AMF A;  4HTG A;  4M4G A;  1AWB A;  2AL4 A;  4O94 A;  1FTO A;  2I49 A;  4LUB A;  2A5T A;  4C1T A;  2PFY A;  4N6P A;  1LLS A;  5IZ3 A;  2GQ1 A;  3M3L A;  4XF5 A;  2CZL A;  1J1N A;  2E0S A;  4I9D A;  2HZK A;  5IZZ A;  4OEN A;  4ZS9 A;  3CFL A;  3TTN A;  4DLD A;  3B50 A;  3TDJ A;  3S9L C;  1YCJ A;  4PBQ A;  4P0I A;  2DVZ A;  2F36 A;  1D9Y A;  3TPA A;  5I56 A;  2UVI A;  1P99 A;  1P1Q A;  2OK2 A;  1NFT A;  2Q74 A;  1DPE A;  1LAF E;  1CB6 A;  1VSO A;  1MXX A;  2XXP A;  1OVT A;  1B58 A;  5EQ7 A;  2Z22 A;  4F1V A;  4OVP A;  1QKB A;  1FTM A;  2I4B A;  1LEV A;  2O84 X;  3B7D A;  1PBP A;  1NNF A;  1S50 A;  3HHG A;  4OYV A;  4E0W A;  4H1X A;  3QAX A;  1NI9 A;  1B5I A;  3IB1 A;  5EQ8 A;  2P0S A;  4RYA A;  4UAB A;  2MKZ A;  1OLC A;  3O2A A;  5AA4 A;  3A3U A;  2DYX A;  2UVH A;  1YZ0 A;  1MXY A;  3QSL A;  4G8N A;  4LQ5 A;  1JW1 A;  1P1W A;  2Z23 A;  2VPN A;  5H8S A;  5I2K B;  1FSA A;  2Y7K A;  1EZP A;  1URS A;  4MBP A;  1M5F A;  3KOT A;  3OEM A;  3U94 A;  4Q30 B;  4GX6 A;  4YU0 A;  4OA4 A;  3H6W A;  4U1Z A;  4ZZE A;  3GXA A;  3W15 C;  5AA4 B;  4BLA A;  4PF8 A;  2Z8D A;  3I5O A;  3CI8 A;  3THI A;  2WYK A;  4M1V A;  4JVI A;  4GFR A;  3OMB A;  2HAV A;  3USD A;  2ZYK A;  2ONS A;  4TQU Q;  4G8H A;  1GV8 A;  1LBC A;  1QKA A;  3OO7 A;  3MUQ A;  1IMA A;  2YPN A;  1CE2 A;  4TLM B;  3PPN A;  1FPF A;  2AIX A;  2XD2 A;  5AA2 D;  4N07 A;  2Q8M A;  1N3W A;  4GWX A;  2REJ A;  4OFL A;  3IAZ A;  3KSX A;  2QVR A;  3UP9 A;  1FQB A;  3MVZ A;  1BLF A;  3Q26 A;  3VV5 A;  2QS3 A;  4FAJ A;  2GH9 A;  1B3E A;  1MS7 A;  5ET7 A;  4YKJ A;  1BTJ A;  1B05 A;  3FXQ A;  5F24 A;  1B3L A;  5F7V A;  2PVU A;  3EHU A;  5ELV A;  5CRY A;  3VE1 B;  3L6H A;  3MZ9 A;  5JK4 A;  3H4Z A;  5ISU A;  2OLB A;  4NWD A;  4X9T A;  4DI4 B;  1NV5 A;  4GBW A;  5AA1 A;  2I58 A;  2Q2A A;  2XA5 A;  4I3E A;  4IY5 A;  3O29 A;  2HXR A;  4AQ4 A;  4NE4 A;  4N15 A;  5LOM A;  4RA1 A;  3HO7 A;  5H8H A;  3KFM A;  2NWJ A;  4JWX A;  2OWS A;  3OO8 A;  4IO7 A;  2IA4 A;  1USY E;  3TTM A;  4OVT A;  4O3A A;  4DI3 D;  3IFC A;  3IOT A;  3ONM A;  1MXW A;  5IM2 A;  1QJM A;  3K2D A;  4YIC A;  3KC1 A;  2O6A A;  2V3Q A;  4F3G A;  1B6H A;  1QUJ A;  2ANJ A;  3M3F A;  4GVO A;  1VFD A;  5LTC A;  2ONR A;  3G7W A;  2CZI A;  4EXK A;  4QHQ A;  4HCW A;  4R6H A;  5B7D A;  4PAK A;  2XWI A;  3MWB A;  4P0G A;  2F3B A;  4EUO A;  3UK4 A;  3CVG A;  1MM6 A;  4GRK A;  4LZ7 A;  3F11 A;  1QUL A;  3E9X A;  2RIN A;  3MVY A;  2DDK A;  3UIF A;  2VPO A;  4OEV A;  4YB7 A;  1ZMG A;  4GL8 A;  3BIH A;  4N8G A;  4ZEK A;  3G3G A;  3KN7 A;  3MW0 A;  2DS9 A;  1N84 A;  1IXH A;  2XXT A;  3EKI A;  2ONK E;  4HCY A;  4GL0 A;  4PQJ A;  3RUM A;  4RK9 A;  4ZZA A;  4PGP A;  3G3K A;  2FYI A;  1OLA A;  1PDA A;  2F8D A;  1EZO A;  5A5X A;  4JSO A;  4PFY A;  1GVC A;  5H8Q B;  3FXU A;  3ZKK A;  5I57 B;  4LZ5 A;  3TKD A;  3O66 A;  4KPT A;  4POW A;  3LSF B;  1NV0 A;  1VDW A;  2R6G E;  3CR9 A;  2DVC A;  3T9U A;  2XWO A;  2H25 A;  4PC9 A;  1Y3P A;  4R9G A;  3OOA A;  1EYK A;  3EHS A;  3GBA A;  3BIG A;  4OZ9 A;  3IO4 A;  3IJX B;  1B3G A;  5I3S A;  4JWY A;  3O6G A;  2XXX A;  2F7B A;  3NOH A;  3TYH A;  3T22 A;  5AA3 A;  4LZ8 A;  1AH5 A;  4RY1 A;  3PPR A;  4F19 A;  1EH3 A;  3S2V A;  1O64 A;  1PEB A;  1LBZ A;  2WBB A;  5K2Y A;  4JWO A;  4H0W A;  3TQW A;  5I2N A;  1IUD A;  3EN3 A;  4N6K A;  3RYD A;  4DXC A;  3PUZ E;  1RYO A;  4PE5 B;  4BDR A;  1R9L A;  4XTC Q;  3SEY A;  2DE4 A;  5IZ1 A;  4F18 A;  4NF8 A;  1EYI A;  2QS1 A;  3FXR A;  2Y7W A;  4GWW A;  4XEQ A;  5KCJ B;  2UYF A;  3PGF A;  2QPQ A;  1SQY A;  1LBY A;  3TOD A;  3RLF E;  1XS5 A;  2H5Y A;  5B70 A;  2UVG A;  5I59 A;  1MY2 A;  4I62 A;  4F2Q A;  1A8F A;  1ZIU A;  2I3W A;  4NF6 B;  4NWC A;  1SI0 A;  1FRP A;  4G77 A;  4G68 C;  4MLV A;  5IAI A;  4OET A;  1NNK A;  1IXG A;  3IFA A;  2XXU A;  2YJP A;  3K6V A;  1ANF A;  1FQC A;  1XT8 A;  1H76 A;  1OVB A;  2HFB A;  1VE4 A;  4RPN A;  1B9J A;  2REG A;  2CZH A;  3VLU A;  3H6U A;  2KLF A;  3A3C A;  4OFO A;  2UXA A;  4G68 A;  4KYS A;  4KHZ E;  3OD7 A;  4AS4 A;  4DE8 A;  3C36 A;  4Z7E A;  1DSN A;  2JJK A;  4EQB A;  3W9V A;  4NTL A;  1YAE A;  5FHO A;  3SEX A;  2P3V A;  2ZYO A;  2E1S A;  4PDD A;  3PPQ A;  2XX8 A;  1G0I A;  1POT A;  3GLB A;  1JVY A;  4ZEF A;  1S7Y A;  3D4C A;  3IK6 B;  3W9W A;  1MH4 A;  4PP0 A;  4XIG Q;  4ZEB A;  4FE8 A;  4X04 A;  2F6G A;  4PAF A;  1MPC A;  1Y3N A;  5K2X A;  2XXH A;  1IMD A;  4KCD A;  5TP9 A;  1YXI A;  2HXW A;  4GXA A;  2NVU B;  2P1S A;  1N0T A;  2VT5 A;  3KOS A;  5JEI A;  3TUS A;  2F5X A;  4PCD A;  4NF5 A;  2FNC A;  3HST A;  5IKB A;  1LFG A;  2ZYN A;  1MY1 A;  4ND9 A;  4IO6 A;  3LSX A;  3SER A;  2XX7 A;  1O7T A;  1NUZ A;  1B4H A;  3U8Q A;  4OVJ A;  4PFI A;  3FIR A;  2GHB A;  1KA1 A;  4RPO A;  1H3D A;  3CFZ A;  3MJN A;  4OXV A;  2F34 A;  4ZE8 A;  1PBQ A;  1A7L A;  4KR5 A;  2ZZW A;  2ZZV A;  3K00 A;  3FVG A;  3TZA A;  2XWK A;  2QVU A;  1FTA A;  3CSG A;  2FA7 A;  2I3V A;  1EZ9 A;  3FD3 A;  2XXW A;  2Q8J A;  5L8D A;  3VLV A;  1MPB A;  3KBZ A;  4Z0I A;  1B3F A;  4QRZ A;  5L9M A;  1AIV A;  2OBG A;  3DEL B;  3HHF A;  2H4I A;  4EQ7 A;  3CIJ A;  1Y1M A;  4IB2 A;  3MVX A;  3KN8 A;  4WEP A;  1IMF A;  1UTB B;  2B3B A;  4RNS A;  1P1U A;  4NED A;  2DWI A;  4YAH X;  5TPA B;  2R71 A;  3PMW A;  2QJE A;  4NG7 A;  2H98 A;  4FEB A;  3TEL A;  2B4L A;  3C31 A;  5AA2 B;  2R9J A;  5J1D A;  3ODB A;  5ET8 A;  4OMB A;  2P2A A;  2Y5L A;  1FQF A;  1FPB A;  3IOV A;  1B7Z A;  3IX1 A;  2Z8E A;  3V83 A;  1Y1Z A;  3FAS A;  4MIJ A;  1FQE A;  4F3S A;  4C0R A;  1AOV A;  2NOO A;  4H5G A;  5L9O A;  3C33 A;  2PFZ A;  3HPI A;  4GX3 A;  4I8C A;  4ELO A;  3K1M A;  1N76 A;  1MQI A;  1SW4 A;  4N4U A;  1EYJ A;  1JW5 A;  2XXK A;  3AXF A;  1SVX B;  3H7M A;  3G3I A;  4R74 A;  1TXF A;  5I2K A;  2Z8F A;  4X1D A;  1B52 A;  4R9F A;  4UA8 A;  1WDN A;  3DP4 A;  1B32 A;  4F29 A;  2Y84 A;  4NN3 A;  3LBS A;  4NF4 B;  5KZT A;  1XVX A;  2ZNU A;  2AYS A;  5BUU A;  1LCT A;  3T9V A;  1US4 A;  4F2O A;  3KJ7 A;  3IOR A;  3PD8 A;  2VD3 A;  1SW5 A;  3RN8 A;  2AL5 A;  4OWD A;  1UTH B;  4GWS A;  4FIM A;  4PET A;  5ESY A;  1B51 A;  4FBP A;  1SD3 A;  5KDT B;  1DPP A;  3QK6 A;  3KBR A;  5I5P A;  4DXB A;  1G0H A;  3SEW A;  1NL5 A;  1QVS A;  2DP8 A;  1JNF A;  1Q9D A;  1FTK A;  4U4S A;  2F7A A;  5BWJ A;  1DK4 A;  3FXB A;  1B40 A;  4MNC A;  4NF0 A;  1NV1 A;  1ZTY A;  3JZJ A;  1H45 A;  2VGQ A;  4MH5 A;  3LUZ A;  5I84 A;  4PF6 A;  1OIB A;  2QS2 A;  3RPL B;  2OWZ A;  1RKM A;  4P8B A;  3GBB A;  4PDH A;  1US5 A;  2ZZX A;  3MP6 A;  4F3P A;  1H44 A;  3TCH A;  3FV1 A;  1MQD A;  5CMC A;  1ZKB A;  2FIE A;  4FAT A;  4KD5 A;  4PFR A;  2FBP A;  4P9K A;  3SKP A;  3H3G A;  5EYH A;  4GWO A;  1ELJ A;  4IY6 A;  3T9H B;  1GGG A;  5ICQ A;  1KA0 A;  4X48 A;  2VP1 A;  4YB6 A;  4QSD A;  3PMX A;  1MQH A;  2DWH A;  2O69 A;  4TOZ A;  5H8N B;  1LBV A;  1IME A;  1HSL A;  5CM6 A;  3PV0 E;  4ESX A;  3IB2 A;  1MRP A;  3FZV A;  3H03 A;  1FBD A;  3SET A;  4R73 A;  2F6P A;  3BFT A;  4KXP A;  4F39 A;  2KQZ A;  5EQA A;  3SEU A;  4L17 A;  4FJP A;  2O51 A;  4KFQ A;  2ABH A;  1JP4 A;  1A99 A;  2WYP A;  3ROJ A;  4MMP A;  2GFE A;  4KYD A;  1PB9 A;  1WOD A;  1FCK A;  3SDF A;  5JTY B;  3MST A;  5ET6 A;  4YKI A;  1FPL A;  1JET A;  2QRY A;  1XVY A;  3IJO B;  3G3H A;  2DWA A;  4QFK A;  4OES A;  3MP1 A;  1M5E A;  3EF7 A;  3TTK A;  1CNQ A;  4WED A;  1ATG A;  1N7W A;  4QSE A;  1I6A A;  4LQ2 A;  1QW0 A;  3BKI B;  2Y7P A;  5L9S A;  4DCY A;  1Z7M E;  1FJ6 A;  3OO9 A;  4U1O A;  3B6W A;  2V84 A;  5FBP A;  3K6W A;  3OO6 A;  4PE3 A;  3FUZ A;  5H8Q A;  4RJZ A;  4P56 A;  4MCO A;  2ZNT A;  5I57 A;  1MDQ A;  4N91 A;  2XXQ A;  3EPE A;  2H9B A;  3KG2 A;  2WEF A;  1S9T A;  4GIZ A;  4ZED A;  4TLL B;  1MQJ A;  4DDD A;  1QGX A;  4AB6 A;  5FHN A;  4ELQ A;  4EF2 A;  1MY4 A;  3RQT A;  4OAN A;  5A5L A;  4MFI A;  3LUY A;  3QXM A;  5CI5 A;  3Q29 A;  1POY 1;  5DT6 A;  4XKR A;  4QXD A;  3O6H A;  1NNT A;  2HEU A;  4X8R A;  2F97 A;  4G61 A;  3I6V A;  3PD9 A;  1XI6 A;  3HV1 A;  4LON B;  4R6K A;  2F3D A;  3MYU A;  1O63 A;  2OWT A;  3KEI A;  1HSE A;  1RYX A;  2CEY A;  3ISP A;  1FBC A;  2ALU A;  2DXY A;  2XXR A;  1LAH E;  3RT8 A;  4QF9 A;  2RC7 A;  1Z7N E;  2ZXT A;  5EQ9 A;  4GX4 A;  1IIT A;  1LBX A;  4QBA A;  4WXJ A;  1SW2 A;  3FVO A;  5KCJ A;  2B4M A;  2DE2 A;  3K01 A;  3A29 A;  1FPD A;  3IO6 A;  2HCA A;  4FED A;  4UAC A;  1URG A;  2GRV A;  3LV0 A;  1A40 A;  3VXC A;  2ESN A;  4NF6 A;  3JV9 A;  2F78 A;  5DVJ A;  4MAG A;  3DP6 A;  1Q35 A;  2XX9 A;  3RT6 B;  2W7Y A;  1AL3 A;  4BDM A;  4JVD A;  3MP8 A;  4JXI A;  3KJT A;  4BDL A;  1Y4C A;  3MPK A;  3MPL A;  4Q5T A;  2PCR A;  5DTB A;  3WAE A;  3MC2 A;  4N17 A;  4JSD A;  2Y7R A;  3QMF A;  1LBB A;  1JEU A;  4R75 A;  5DVF A;  4P3L A;  3HCQ A;  2HQ0 A;  4NAP A;  2ZYM A;  3O9P A;  1FBG A;  4KQP A;  2D5W A;  5CMB A;  4IO3 A;  4MNP A;  4QSC A;  3PUW E;  4GF8 A;  4OEU A;  4LA9 A;  3T1B A;  1Y4T A;  3G3F A;  4QFO A;  3U92 A;  2NXO A;  4THI A;  4JB7 A;  3C34 A;  3DLN A;  4O8M A;  4KYE A;  1SDX A;  2P3N A;  4YZZ A;  1MH3 A;  1I6Q A;  3RY3 A;  4P1E A;  4U21 A;  4I3Y A;  1FW0 A;  1MY3 A;  1B1X A;  4N81 A;  1YYZ A;  4EDP A;  1MXZ A;  3R26 A;  2XXV A;  1MQG A;  4YB5 A;  4ZEI A;  5I7I A;  1PB8 A;  4GWY A;  1MDP 1;  2F35 A;  1F9B A;  4MJO A;  3TEP A;  3E78 A;  4O3C A;  2VHA A;  4G2Z A;  2BJJ X;  1B5J A;  3MZB A;  4R2B A;  3H6V A;  4AS5 A;  3S9M C;  3CFX A;  3SEV A;  4NHB A;  2CMO A;  2XXI A;  4NMY A;  3U72 A;  3SES A;  2Q2C A;  2HAU A;  2OCU A;  2YLN A;  3ILU B;  3T9X B;  3TQL A;  4G4P A;  3TAJ A;  1INP A;  2WX9 A;  4R2F A;  3TFL A;  1GTK A;  3T96 B;  5I58 A;  2I6E A;  2RCA A;  2Y7I A;  1LGB C;  3VXB A;  4Q8R A;  1SW1 A;  4XFE A;  2Q9T A;  3Q25 A;  3OSQ A;  4PBH A;  4E0X A;  4FEC A;  5H8F B;  1FTJ A;  1FBH A;  4NGU A;  5I58 B;  1FQD A;  4GQO A;  3K4U A;  1MM7 A;  3RGY A;  1UTB A;  2HPG A;  2PT2 A;  4F22 A;  1D9V A;  5TPA A;  3FGS A;  1FPK A;  2QVV A;  3IL1 B;  2O7I A;  3FVN A;  2R8T A;  1IXC A;  3VDF A;  5AA2 A;  2OJT A;  1QUI A;  4XKQ A;  1LB8 A;  3N6U A;  3KN3 A;  4BDQ A;  1NMU A;  1DTG A;  4EXL A;  2O68 A;  2V3U A;  1D4N A;  4H67 A;  1XHY A;  5CBS A;  3HN0 A;  1DBZ A;  3HFU A;  3ZS6 A;  1P1O A;  1ZBM A;  4OHN A;  1SI1 A;  1R6Z A;  1LCF A;  4LN5 A;  1UIU A;  4GD5 A;  2CZK A;  3TTL A;  1ZJL A;  3G3J A;  5J16 A;  4IGR A;  3SZP A;  2DSF A;  1IIW A;  5DEX B;  4NF4 A;  4MHF A;  3IR1 A;  3R6U A;  1JQF A;  2HZL A;  1RDY A;  4OTE A;  3V89 B;  1L5T A;  2DXR A;  3OSR A;  3VVD A;  4OFJ A;  1A8E A;  4XXU A;  3R7X A;  3RTW B;  1B1H A;  1NV2 A;  4JVC A;  2FVZ A;  4IR8 A;  4YMB A;  1RDX A;  3DM0 A;  2ZNS A;  4QFL A;  2A5T B;  1UTH A; 
#chains in the Genus database with same CATH homology
 3FJ7 A;  3D4G A;  3UGW A;  3QYT A;  3UOR A;  1JVX A;  2DE3 A;  1TT1 A;  5KDT A;  4N13 A;  3U1O A;  1M5D A;  3MZ1 A;  1Y3Q A;  5TU0 A;  4U23 A;  4H6D A;  3LR1 A;  1BP5 A;  4O3B A;  3CSB A;  4U22 A;  1MPD A;  4ELR A;  3M3K A;  1ZLQ A;  1URD A;  1MXU A;  3UN6 A;  2G93 A;  1I69 A;  1R9Q A;  3O28 A;  3L6G A;  3PU5 A;  5I56 B;  3QUF A;  1EU8 A;  3N94 A;  2ZMB A;  2RKM A;  3FJG A;  1TFD A;  1FTL A;  2QL3 A;  4YMA A;  3E13 X;  3KSJ A;  2OZZ A;  3E4R A;  4YKP A;  5HPQ A;  1BIY A;  4RXL A;  2LAO A;  4F1Y A;  3A09 A;  4BDN A;  2D21 A;  3TMG A;  1R1N A;  4IO2 A;  3RPW A;  2B3F A;  5HM4 B;  1PB7 A;  4LAT A;  3RTF B;  5H8N A;  4LVQ A;  5HBC A;  1GR2 A;  3E3K A;  1NH8 A;  3FAT A;  3B6T A;  3OEN A;  3ILT B;  3K0V A;  4POX A;  4KCC A;  3K02 A;  3TCF A;  4ESW A;  1B7U A;  5F1Q A;  1MXV A;  1SBP A;  3IB0 A;  2WKY A;  1P1N A;  1VR5 A;  3FJM A;  2VD2 A;  3EQ1 A;  2V93 A;  1UQW A;  4OQO A;  5EHS A;  3H6T A;  3DP8 A;  4IO5 A;  2V3T A;  5JTY A;  5FTH A;  3VVF A;  3QUJ A;  4X1B A;  1VFE A;  3CG1 A;  2O1M A;  3Q28 A;  2QMW A;  4I1D A;  3CRB A;  3PUV E;  3UA8 A;  4H65 A;  1LAG E;  2DWJ A;  3ECR A;  4QFN A;  3ZSF A;  1LFH A;  1USY H;  3O97 A;  3KGC A;  3MVW A;  3M8U A;  2RF1 A;  3K6X A;  2H99 A;  1II5 A;  2GHA A;  1YPN A;  1DTZ A;  2VOZ A;  1UIV A;  1SYI A;  1B0H A;  2PYY A;  3TTR A;  1IZ1 A;  2G29 A;  1TWY A;  3OEL A;  3BFU A;  4BDO A;  2D3I A;  3BBR A;  3MBP A;  2M8C A;  4FOR A;  4YKK A;  1H43 A;  3EHT A;  2IEE A;  4ZDM A;  1IEJ A;  3T93 B;  4HW8 A;  1JW4 A;  2V25 A;  5H8H B;  4JBZ A;  2XD3 A;  2UVJ A;  3VLW A;  1DOT A;  1OQG A;  4XKP A;  4ELP A;  4DZ1 A;  4PFW A;  4EQ9 A;  5CMK A;  3PMV A;  2X7P A;  1T0K A;  2I4C A;  3C4M A;  2I0C A;  1A54 A;  1XC1 A;  5DVI A;  4ZEC A;  2QMX A;  1B5H A;  4XKN A;  4LP2 B;  4GLI A;  2XHD A;  2X26 A;  1B4Z A;  1NKX A;  2RC9 A;  1KWH A;  5CBR A;  3PPP A;  1IQ7 A;  2RC8 A;  2B65 A;  2THI A;  5CMM A;  1N3X A;  3V8X B;  4AB5 A;  2X7Q A;  2I48 A;  4WKM A;  3FVK A;  4EF1 A;  5A5X B;  1B2H A;  3S9E A;  1SYH A;  4R72 A;  3U93 A;  3C35 A;  1MG1 A;  1LST A;  1Q1K A;  1Y9U A;  1LB9 A;  3S9N C;  5EYF A;  3CG3 A;  1D3K A;  3OEK A;  3K1N A;  1NH7 A;  2PMS A;  4U2R A;  5ITO A;  1ZU0 A;  3RNN A;  4MF3 A;  1BKA A;  3QIM A;  4PFT A;  4G8M A;  4DXU A;  5DYH A;  1B46 A;  3K1P A;  5M2V A;  4H8I A;  1LAX A;  2PBW A;  3P7I A;  4IO4 A;  4Q0C A;  3PUY E;  1YTV A;  1OQH A;  2DQV A;  5ICT A;  1WVJ A;  3H06 B;  1MY0 A;  2I0B A;  3K6U A;  4C1U A;  3FV2 A;  5I2N B;  4ONY A;  5EHM A;  2PX1 A;  2F7C A;  5CC2 A;  4PFU A;  4GXS B;  2NUV A;  1QUK A;  4H8J A;  4NF8 B;  5AE4 A;  3N5L A;  4ZE9 A;  1TFA A;  3I3V A;  1N7X A;  4QFP A;  2QSX A;  2Q88 A;  4HS7 A;  5I59 B;  4JDF A;  1A55 A;  4DCX A;  4K3F A;  2O1L A;  3PPO A;  3OXN A;  4KI0 E;  2PT1 A;  3N6T A;  4ISU A;  4RK2 A;  4F31 B;  3O6I A;  3C32 A;  5H8F A;  3Q27 A;  4P11 A;  1B3H A;  1B7H A;  4R6Y A;  2UYE A;  2QS4 A;  5FTI A;  3KZG A;  3B6Q A;  4G68 B;  3LSW A;  1JEV A;  1OMP A;  5FHM A;  3LSL A;  5ITP A;  1I6B A;  4F1U A;  1XOC A;  1NNP A;  3C9H A;  3N26 A;  3PUX E;  3VVE A;  4ECF A;  4GOT A;  3IOU A;  3IOW A;  4MLQ A;  4DIG A;  3MAM A;  4U4X A;  4H5F A;  2Q89 A;  3MQ9 A;  3T66 A;  2DOJ A;  3GZG A;  5TP9 B;  3ZKL A;  3VFJ A;  2O7U A;  1M5B A;  3TCG A;  1FQA A;  4NF5 B;  4F3B A;  2RCB A;  1LFI A;  1DMB A;  1IXI A;  5DEX A;  1Y20 A;  4IGT A;  3V5A A;  2XXY A;  1HSJ A;  3LC8 A;  1PC3 A;  3S4U A;  1M5C A;  3WAF A;  3JYR A;  1B0L A;  2A5S A;  1AMF A;  4OER A;  4HTG A;  4M4G A;  2AL4 A;  1FTO A;  2I49 A;  4LUB A;  2A5T A;  4C1T A;  4N6P A;  1LLS A;  3M3L A;  2CZL A;  1J1N A;  2E0S A;  4I9D A;  2HZK A;  4OEN A;  4ZS9 A;  3CFL A;  3TTN A;  4DLD A;  3TDJ A;  3S9L C;  1YCJ A;  4P0I A;  2DVZ A;  2F36 A;  1D9Y A;  3TPA A;  5I56 A;  2UVI A;  1P99 A;  1P1Q A;  2OK2 A;  1NFT A;  1DPE A;  1LAF E;  1CB6 A;  1VSO A;  1MXX A;  2XXP A;  1OVT A;  1B58 A;  2Z22 A;  4F1V A;  1QKB A;  1FTM A;  2I4B A;  2O84 X;  3B7D A;  1PBP A;  1NNF A;  1S50 A;  3HHG A;  4OYV A;  4E0W A;  4H1X A;  3QAX A;  1B5I A;  3IB1 A;  2P0S A;  4RYA A;  1OLC A;  3O2A A;  5AA4 A;  3A3U A;  2DYX A;  2UVH A;  1MXY A;  3QSL A;  4G8N A;  4LQ5 A;  1JW1 A;  1P1W A;  2Z23 A;  5H8S A;  5I2K B;  2Y7K A;  1EZP A;  1URS A;  4MBP A;  1M5F A;  3KOT A;  3OEM A;  3U94 A;  4Q30 B;  4YU0 A;  3H6W A;  4U1Z A;  4ZZE A;  3GXA A;  3W15 C;  5AA4 B;  4BLA A;  2Z8D A;  3I5O A;  3CI8 A;  3THI A;  4M1V A;  4GFR A;  3OMB A;  2HAV A;  3USD A;  2ZYK A;  2ONS A;  4TQU Q;  4G8H A;  1GV8 A;  1LBC A;  1QKA A;  3OO7 A;  3MUQ A;  2YPN A;  1CE2 A;  4TLM B;  3PPN A;  2AIX A;  2XD2 A;  5AA2 D;  4N07 A;  1N3W A;  4OFL A;  2REJ A;  3IAZ A;  3KSX A;  3UP9 A;  1FQB A;  3MVZ A;  1BLF A;  3Q26 A;  3VV5 A;  2QS3 A;  4FAJ A;  2GH9 A;  1B3E A;  1MS7 A;  4YKJ A;  1BTJ A;  1B05 A;  3FXQ A;  1B3L A;  5F7V A;  2PVU A;  3EHU A;  5ELV A;  5CRY A;  3VE1 B;  3L6H A;  3MZ9 A;  5JK4 A;  3H4Z A;  5ISU A;  2OLB A;  4NWD A;  4X9T A;  5AA1 A;  2I58 A;  2Q2A A;  4IY5 A;  3O29 A;  4AQ4 A;  4NE4 A;  5LOM A;  4RA1 A;  3HO7 A;  5H8H A;  3KFM A;  2NWJ A;  4JWX A;  2OWS A;  3OO8 A;  4IO7 A;  2IA4 A;  1USY E;  3TTM A;  4O3A A;  3IOT A;  3ONM A;  1MXW A;  1QJM A;  3K2D A;  4YIC A;  2O6A A;  2V3Q A;  4F3G A;  1B6H A;  1QUJ A;  2ANJ A;  3M3F A;  4GVO A;  1VFD A;  2ONR A;  3G7W A;  4EXK A;  4QHQ A;  4HCW A;  4R6H A;  5B7D A;  3MWB A;  4P0G A;  4EUO A;  3UK4 A;  3CVG A;  1MM6 A;  4GRK A;  4LZ7 A;  3F11 A;  1QUL A;  3E9X A;  2RIN A;  3MVY A;  3UIF A;  4OEV A;  4YB7 A;  1ZMG A;  4GL8 A;  4ZEK A;  3G3G A;  3KN7 A;  3MW0 A;  2DS9 A;  1N84 A;  1IXH A;  2XXT A;  2ONK E;  4HCY A;  4GL0 A;  4PQJ A;  3RUM A;  4RK9 A;  4ZZA A;  3G3K A;  2FYI A;  1OLA A;  1PDA A;  2F8D A;  1EZO A;  5A5X A;  4JSO A;  4PFY A;  1GVC A;  5H8Q B;  3FXU A;  3ZKK A;  5I57 B;  4LZ5 A;  3TKD A;  3O66 A;  4KPT A;  4POW A;  3LSF B;  2R6G E;  3CR9 A;  2DVC A;  3T9U A;  2H25 A;  1Y3P A;  4R9G A;  3OOA A;  3EHS A;  3GBA A;  4OZ9 A;  3IO4 A;  3IJX B;  1B3G A;  4JWY A;  3O6G A;  2XXX A;  2F7B A;  3TYH A;  3T22 A;  5AA3 A;  4LZ8 A;  1AH5 A;  4RY1 A;  3PPR A;  4F19 A;  1EH3 A;  3S2V A;  1O64 A;  1PEB A;  5K2Y A;  4JWO A;  4H0W A;  3TQW A;  5I2N A;  1IUD A;  3EN3 A;  4DXC A;  3PUZ E;  1RYO A;  4PE5 B;  4BDR A;  1R9L A;  4XTC Q;  3SEY A;  2DE4 A;  4F18 A;  4NF8 A;  2QS1 A;  3FXR A;  2Y7W A;  5KCJ B;  2UYF A;  3PGF A;  2QPQ A;  1SQY A;  3TOD A;  3RLF E;  1XS5 A;  2H5Y A;  5B70 A;  2UVG A;  5I59 A;  1MY2 A;  4I62 A;  4F2Q A;  1A8F A;  1ZIU A;  2I3W A;  4NF6 B;  4NWC A;  1SI0 A;  4G77 A;  4G68 C;  4MLV A;  5IAI A;  4OET A;  1NNK A;  1IXG A;  2XXU A;  2YJP A;  3K6V A;  1ANF A;  1FQC A;  1XT8 A;  1H76 A;  1OVB A;  2HFB A;  1VE4 A;  4RPN A;  1B9J A;  2REG A;  3VLU A;  3H6U A;  2KLF A;  3A3C A;  4OFO A;  2UXA A;  4G68 A;  4KYS A;  4KHZ E;  3OD7 A;  4DE8 A;  3C36 A;  4Z7E A;  1DSN A;  4EQB A;  3W9V A;  4NTL A;  1YAE A;  5FHO A;  3SEX A;  2ZYO A;  2E1S A;  3PPQ A;  2XX8 A;  1POT A;  3GLB A;  1JVY A;  4ZEF A;  1S7Y A;  3D4C A;  3IK6 B;  3W9W A;  1MH4 A;  4PP0 A;  4XIG Q;  4ZEB A;  4FE8 A;  2F6G A;  1MPC A;  1Y3N A;  5K2X A;  2XXH A;  4KCD A;  5TP9 A;  2HXW A;  4GXA A;  2NVU B;  2P1S A;  1N0T A;  5JEI A;  3KOS A;  3TUS A;  2F5X A;  4NF5 A;  2FNC A;  3HST A;  5IKB A;  1LFG A;  2ZYN A;  1MY1 A;  4ND9 A;  4IO6 A;  3LSX A;  3SER A;  2XX7 A;  1O7T A;  1B4H A;  3U8Q A;  4OVJ A;  3FIR A;  2GHB A;  4RPO A;  1H3D A;  3CFZ A;  3MJN A;  4OXV A;  2F34 A;  4ZE8 A;  1PBQ A;  1A7L A;  4KR5 A;  3K00 A;  3FVG A;  3TZA A;  3CSG A;  2FA7 A;  2I3V A;  1EZ9 A;  3FD3 A;  2XXW A;  2Q8J A;  5L8D A;  3VLV A;  1MPB A;  4Z0I A;  1B3F A;  4QRZ A;  5L9M A;  1AIV A;  2OBG A;  3DEL B;  3HHF A;  2H4I A;  4EQ7 A;  3CIJ A;  1Y1M A;  4IB2 A;  3MVX A;  3KN8 A;  4WEP A;  1UTB B;  2B3B A;  4RNS A;  1P1U A;  4NED A;  4YAH X;  5TPA B;  2DWI A;  2R71 A;  3PMW A;  2QJE A;  2H98 A;  4FEB A;  3TEL A;  3C31 A;  5AA2 B;  2R9J A;  5J1D A;  3ODB A;  4OMB A;  2P2A A;  1FQF A;  3IOV A;  1B7Z A;  3IX1 A;  2Z8E A;  3V83 A;  1Y1Z A;  3FAS A;  1FQE A;  4F3S A;  4C0R A;  1AOV A;  2NOO A;  4H5G A;  5L9O A;  3C33 A;  3HPI A;  4I8C A;  4ELO A;  3K1M A;  1N76 A;  1MQI A;  1SW4 A;  1JW5 A;  3AXF A;  1SVX B;  3H7M A;  3G3I A;  4R74 A;  1TXF A;  5I2K A;  2Z8F A;  4X1D A;  1B52 A;  4R9F A;  4UA8 A;  1WDN A;  3DP4 A;  1B32 A;  4F29 A;  2Y84 A;  3LBS A;  4NF4 B;  5KZT A;  1XVX A;  2ZNU A;  2AYS A;  5BUU A;  1LCT A;  3T9V A;  1US4 A;  4F2O A;  3KJ7 A;  3IOR A;  3PD8 A;  2VD3 A;  1SW5 A;  3RN8 A;  2AL5 A;  4OWD A;  1UTH B;  4FIM A;  4PET A;  1B51 A;  1SD3 A;  5KDT B;  1DPP A;  3QK6 A;  3KBR A;  4DXB A;  3SEW A;  1NL5 A;  1QVS A;  2DP8 A;  1JNF A;  1FTK A;  4U4S A;  2F7A A;  5BWJ A;  1B40 A;  1ZTY A;  3JZJ A;  1H45 A;  2VGQ A;  4MH5 A;  5I84 A;  1OIB A;  2QS2 A;  1RKM A;  3GBB A;  1US5 A;  3MP6 A;  4F3P A;  1H44 A;  3TCH A;  3FV1 A;  1MQD A;  5CMC A;  1ZKB A;  4FAT A;  4KD5 A;  3SKP A;  3H3G A;  4GWO A;  1ELJ A;  4IY6 A;  3T9H B;  1GGG A;  5ICQ A;  4X48 A;  2VP1 A;  4YB6 A;  4QSD A;  3PMX A;  1MQH A;  2DWH A;  2O69 A;  4TOZ A;  5H8N B;  1HSL A;  5CM6 A;  3PV0 E;  4ESX A;  3IB2 A;  1MRP A;  3FZV A;  3H03 A;  3SET A;  4R73 A;  2F6P A;  3BFT A;  4F39 A;  3SEU A;  4L17 A;  4FJP A;  2O51 A;  4KFQ A;  2ABH A;  1A99 A;  2GFE A;  4KYD A;  1PB9 A;  1WOD A;  1FCK A;  3SDF A;  5JTY B;  4YKI A;  1JET A;  2QRY A;  1XVY A;  3IJO B;  3G3H A;  2DWA A;  4QFK A;  4OES A;  1UTH A;  3MP1 A;  1M5E A;  3EF7 A;  3TTK A;  4WED A;  1ATG A;  1N7W A;  4QSE A;  1I6A A;  4LQ2 A;  1QW0 A;  3BKI B;  2Y7P A;  5L9S A;  4DCY A;  1Z7M E;  3OO9 A;  4U1O A;  3B6W A;  2V84 A;  3K6W A;  3OO6 A;  3FUZ A;  5H8Q A;  4RJZ A;  2ZNT A;  5I57 A;  1MDQ A;  2XXQ A;  3EPE A;  2H9B A;  3KG2 A;  1S9T A;  4GIZ A;  4ZED A;  4TLL B;  1MQJ A;  4DDD A;  4AB6 A;  5FHN A;  4ELQ A;  4EF2 A;  1MY4 A;  3RQT A;  4MFI A;  3LUY A;  3QXM A;  5CI5 A;  3Q29 A;  1POY 1;  5DT6 A;  4XKR A;  3O6H A;  1NNT A;  2HEU A;  2F97 A;  3I6V A;  3PD9 A;  3HV1 A;  4LON B;  4R6K A;  1O63 A;  2OWT A;  3KEI A;  1HSE A;  1RYX A;  2ALU A;  2DXY A;  2XXR A;  1LAH E;  3RT8 A;  4QF9 A;  2RC7 A;  1Z7N E;  2ZXT A;  1IIT A;  4WXJ A;  1SW2 A;  3FVO A;  5KCJ A;  2DE2 A;  3K01 A;  3IO6 A;  2HCA A;  4FED A;  4UAC A;  1URG A;  2GRV A;  1A40 A;  3VXC A;  2ESN A;  4NF6 A;  3JV9 A;  2F78 A;  5DVJ A;  3DP6 A;  1Q35 A;  2XX9 A;  3RT6 B;  2W7Y A;  1AL3 A;  4BDM A;  3MP8 A;  4JXI A;  3KJT A;  4BDL A;  1Y4C A;  3MPK A;  3MPL A;  4Q5T A;  5DTB A;  3WAE A;  3MC2 A;  4JSD A;  2Y7R A;  1LBB A;  1JEU A;  4R75 A;  5DVF A;  3HCQ A;  2HQ0 A;  2ZYM A;  3O9P A;  4KQP A;  5CMB A;  2D5W A;  4IO3 A;  4QSC A;  3PUW E;  4GF8 A;  4OEU A;  4LA9 A;  1Y4T A;  3G3F A;  4QFO A;  3U92 A;  2NXO A;  4THI A;  4JB7 A;  3C34 A;  3DLN A;  4KYE A;  1SDX A;  4YZZ A;  1MH3 A;  1I6Q A;  3RY3 A;  4U21 A;  1FW0 A;  1MY3 A;  1B1X A;  4EDP A;  1MXZ A;  3R26 A;  2XXV A;  1MQG A;  4YB5 A;  4ZEI A;  1PB8 A;  1MDP 1;  2F35 A;  1F9B A;  3TEP A;  4O3C A;  2VHA A;  4G2Z A;  2BJJ X;  1B5J A;  3MZB A;  4R2B A;  3H6V A;  3S9M C;  3CFX A;  3SEV A;  2CMO A;  2XXI A;  4NMY A;  3U72 A;  3SES A;  2Q2C A;  2HAU A;  2OCU A;  2YLN A;  3ILU B;  3T9X B;  3TQL A;  4G4P A;  3TAJ A;  4R2F A;  3TFL A;  1GTK A;  3T96 B;  5I58 A;  2I6E A;  2RCA A;  2Y7I A;  1LGB C;  3VXB A;  4Q8R A;  1SW1 A;  2Q9T A;  3Q25 A;  3OSQ A;  4E0X A;  4FEC A;  5H8F B;  1FTJ A;  5I58 B;  1FQD A;  4GQO A;  3K4U A;  1MM7 A;  3RGY A;  1UTB A;  2PT2 A;  4F22 A;  1D9V A;  5TPA A;  3FGS A;  3IL1 B;  2O7I A;  3FVN A;  1IXC A;  3VDF A;  5AA2 A;  2OJT A;  1QUI A;  4XKQ A;  1LB8 A;  3N6U A;  3KN3 A;  4BDQ A;  1NMU A;  1DTG A;  4EXL A;  2O68 A;  2V3U A;  1D4N A;  4H67 A;  1XHY A;  5CBS A;  3HN0 A;  3ZS6 A;  1P1O A;  1ZBM A;  4OHN A;  1SI1 A;  1R6Z A;  1LCF A;  1UIU A;  4GD5 A;  3TTL A;  1ZJL A;  3G3J A;  4IGR A;  2DSF A;  1IIW A;  5DEX B;  4NF4 A;  3IR1 A;  3R6U A;  1JQF A;  2HZL A;  4OTE A;  3V89 B;  1L5T A;  2DXR A;  3OSR A;  3VVD A;  4OFJ A;  1A8E A;  4XXU A;  3R7X A;  3RTW B;  1B1H A;  4YMB A;  3DM0 A;  2ZNS A;  4QFL A;  2A5T B;  1N04 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...