1I6HJ

Rna polymerase ii elongation complex
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
65
structure length
65
Chain Sequence
MIVPVRCFSCGKVVGDKWESYLNLLQEDELDEGTALSRLGLKRYCCRRMILTHVDLIEKFLRYNP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis of transcription: an RNA polymerase II elongation complex at 3.3 A resolution.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Transcription/dna-rna hybrid
molecule keywords 5'-D(P*AP*AP*AP*TP*GP*CP*CP*TP*GP*GP*TP*CP*T)-3'
total genus 17
structure length 65
sequence length 65
ec nomenclature
pdb deposition date 2001-03-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
J PF01194 RNA_pol_N RNA polymerases N / 8 kDa subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 1i6hJ00
1B8IB 4AC0A 2E2IJ 4X6AJ 3S2DJ 3H0GJ 5M3FJ 3FK7A 5BNGA 2O7OA 3IH2A 1B8IA 1GT0C 1BL0A 1IG7A 1WI3A 1JUPA 4G12A 3BR3A 1QVTA 4XRSA 3RKQA 2DMUA 2K9SA 2WV1A 5FKNA 4XRSG 3GTOJ 3JRCA 4M3GA 4C3IJ 1RPWA 4QIWN 2DA3A 3HOZJ 2CQQA 1MBGA 4A3CJ 1JGGA 2H8RA 1BJZA 2HYJA 1TWFJ 1MSEC 2E2JJ 3GTGJ 4C3JJ 3PO2J 3LSPA 1Y1VJ 3I4MJ 1OCPA 5J1UA 1TWGJ 2R5ZA 1XS9A 4D5CA 1AKHB 2JN6A 2E19A 1B72A 2JK3A 3S2HJ 5EGOA 2DA6A 3MVPA 1AKHA 4M3DA 2L0KA 3S14J 3RZDJ 1VI0A 3JRIA 2Y2ZA 5C3EJ 3I4NJ 3Q0UA 2DMTA 3GTJJ 1A5JA 3BG3A 5FKLA 2NOGA 2HOTA 1P7IA 3BG9A 4D7MA 1JT6A 4JX4A 1RR7A 2HQ5A 2XRLA 2EBIA 2LP0A 4L5EA 2LK2A 3TW6A 2DA5A 5FKOA 4V2GA 1JKRC 2EZKA 2XPWA 5EEAA 5J1YA 4A3EJ 2DN0A 2YS9A 4A93J 5F1JA 4DYQA 4M3EA 2ECBA 3BT9A 1HCRA 1E3OC 3S1QJ 4MO7A 1OFCX 3B6CA 3MKLA 1UHSA 1ETOA 1IC8A 3D1NI 3K7AJ 4ABZA 2NVXJ 5C44J 1APLC 4DZJA 4XIDA 4MIMA 3ZQIA 1X58A 2OPTA 5GPAA 2O9LA 3K2AA 4MFDA 3TW7A 3IV5A 1P7JA 1JJ8C 4EEFG 2X9DA 3JR9A 1R9TJ 3HB9A 5M5XJ 4A3MJ 1JKOC 3G1MA 1TWHJ 3GTQJ 2ECCA 4BY7J 1JKPC 2HDDA 3HOVJ 5C4XJ 3F0CA 3HEFA 1ZGWA 2DMPA 4A3DJ 3DCFA 5M5YJ 4D7NA 3OIOA 1PUFB 4X1EA 5E3NA 3HOWJ 4XK4A 4QTRA 2CUFA 3LSRA 5E3MA 5C4JJ 2ELKA 5J3LA 2Y9ZA 3LOCA 1BA5A 3E7LA 2QF7A 1IUFA 2Y9YA 2KDZA 5IYCJ 2K9QA 1GV5A 1JUMA 1DU0A 1JTYA 1HOMA 2ID6A 2KT0A 5EZGA 5F0HA 4IHVA 2JA7J 1WCMJ 4CYCA 2HOSA 1OCTC 1SANA 3Q0WA 3M3YJ 1YRNB 3TP3A 4A3IJ 4BBSJ 3A01A 1ITYA 2R0QC 1LFUP 1RESA 4B4CA 2R92J 2RAEA 2VKEA 3BR1A 3GTMJ 1TWAJ 2H1KA 1O4XA 2EZIA 4A3GJ 1IV6A 4QSHA 3HDDA 1RKWA 2EZHA 4AYBN 1GDTA 2IBDA 4A3LJ 2I10A 4RDUA 1ZR2A 3M4OJ 2WB1N 3BTIA 2VUMJ 5FLVA 3O8GA 4DYRA 1FTZA 3SDGA 2GLOA 3UKGA 1MSFC 1ZKGA 1JKQC 2Y30A 1FJLA 1LE8B 5IP6A 4RBOA 3ZQCA 2L7ZA 1Y1WJ 1K83J 1FIAA 3LNQA 1MBKA 3A02A 3ZQLA 1Q1VA 1NK2P 3OSFA 1H8AC 3S17J 2LR8A 3BR2A 2M8GX 3JRFA 3BR6A 1W0UA 2DA1A 3ZQFA 3VPRA 5GPCA 4GFBA 5IPAA 2NS7A 3GBGA 4D5FA 4DW6A 4FTHA 4V2FA 5GP9A 3LSGA 3FK6A 2N8GA 4I76A 5IP9J 1T33A 1TWCJ 5IOYA 1IDYA 1PUFA 5F08A 5E3LA 3G1LA 3G1OA 5EG0A 4JX6A 5EGOB 2G0EA 5EYRA 4B3AA 3QPSA 1T56A 1GUUA 3JREA 5J1RA 1VF9A 4BKXA 3BG5A 3IH3A 2MGQA 3C2BA 4JX5A 5HODA 1IGNA 4B1RA 3GTKJ 4A69C 3CQZJ 2MG4A 1XC5A 2AHQA 2MSYA 1DU6A 3PM1A 1B72B 2O8KA 1HDPA 4M3FA 3Q3SA 2XGEA 3BR5A 4UUTA 3O8HA 2HI3A 4NDLA 2LLKA 4FE7A 1QVUA 3PO3J 2NS8A 3BTCA 2NVTJ 2GM4A 4IHWA 3CCYA 4Y52J 4C3HJ 2CU7A 1POGA 1FTTA 1JT0A 2HOAA 5F04A 5FKKA 5K7ZA 3FKIJ 2YU9J 1H88C 2JA8J 4DZPA 3GTLJ 2R5YA 1JJ6C 2JA6J 3JRAA 4UUSA 4A3KJ 4LOCA 3BQYA 3HOYJ 3TP0A 3W6VA 4UUSB 2L7FP 5EDNA 1WPKA 3S1NJ 4AUXA 2R5ZB 2JJ7A 2JWTA 2DMQA 1X2NA 3QQAA 4FE4A 2FX0A 2TRTA 3HBLA 1HF0A 3CDLA 5F27A 2K40A 5EG0B 3FIWA 1ZR4A 2M0CA 3FISA 4FCYA 4IHXA 1ETXA 3BTJA 5JLXA 2M34A 1U9OA 3B6AA 3S15J 2OF7A 2EZLA 2XB5A 3TEDA 2D5VA 2QCOA 3S1MJ 1HDDC 1ETKA 4S0HB 1U78A 2XGDA 5IYDJ 1ETWA 4C2MJ 3LSJA 3S1RJ 4XRMA 4MLOA 1WGXA 2MW8A 2FD5A 1RKTA 4BXXJ 1MBJA 3ZQHA 3H3VK 2VKVA 2E2HJ 4W97A 2XGCA 3QPLA 1I6HJ 1F43A 2ZB9A 3WHCA 4IHYA 2VI6A 2FQ4A 1MH4A 1Z77A 2EH3A 1W0TA 1S7EA 3MN2A 3ZQGA 4DYCA 2XPVA 3HM5A 1TC3C 4M3BA 2HXOA 2NVYJ 5K7FA 2LFBA 1GV2A 1SFOJ 1EF4A 2R93J 5FKMA 5IOZA 1CQTA 1ETQA 3HKZN 1LFBA 2ME6A 1OJLA 1I3QJ 2DTZA 2VPRA 4MFEA 1X2MA 1BW5A 2L9RA 3OOUA 4M6VA 3HOXJ 1JTXA 2PMZN 1HLVA 3GTPJ 2CUEA 3A01B 2E1OA 5IYBJ 5EF6A 3BTLA 1FEXA 1RETA 3HGGA 2COBA 1ZTRA 4J19A 3Q0VA 1A6IA 4A3BJ 1VFCA 2DA2A 9ANTA 1MBFA 1LE8A 3BQZA 5FLMJ 5FJ8J 2ID3A 3BR0A 1WH5A 1Z0XA 1ENHA 5IP7J 1AHDP 2DA7A 3OSGA 3HGYA 3WHBA 2WAQN 1NK3P 3S16J 4JYKA 5E3OA 2TCTA 2JA5J 1XG1A 4BBRJ 5M5WJ 3L1PA 3SJMA 2CRGA 2ME0A 2LY9A 2L7MP 3IH4A 3SFIA 3A03A 2GBYA 2X6OA 5F0CA 2EQRA 4BY1J 3CMYA 1QPIA 1MNMC 3RZOJ 2M2EA 1U8BA 5K7HA 3ZOBA 1ZQ3P 5M3MJ 1JUSA 2DA4A 3RQIA 5F0FA 1VNDA 1BW6A 2LD5A 2YUSA 2XB0X 2CQXA 1H89C 1ZK8A 4CYCB 2DMNA 2AO9A 1NTCA 2IAIA 2P81A 4IEJA 4JP0A 5DTDA 4XICA 1YRNA 2HXIA 3JRGA 2NVQJ 5EZHA 1ETVA 1MBEA 4Y7NJ 1ETYA 2W48A 4HNVA 2XPUA 4W1UA 3JRBA 1AU7A 2IEKA 1K61A 1U9NA 1GVDA 2CJJA 2R5YB 1IRZA 2JMWA 1IDZA 3HOUJ 2M9HA 1D5YA 1G2HA 2LTPA 1QRYA 3NARA 3DEWA 2Y0SN 3NAUA 2FJ1A 5JLWA 4A3JJ 1I50J 2LVSA 2XSDC 1FIPA 1WH7A 4A3FJ 1MBHA 1MH3A 5DS9A 3JRHA 2K9NA 3JRDA 1IJWC 4FISA 4I6ZA 2R7ZJ 2Y31A 1UG2A 2B63J 1ORKA 2DJNA 2LKXA 1F36A 2X48A 1UMQA
chains in the Genus database with same CATH superfamily
3F9KA 2LH9A 1VQOI 1B8IB 3K0LA 5M3FJ 2L9SA 5BNGA 3R6SA 2O7OA 3WTZA 5KAFC 1BC8C 3HHGA 2LF8A 3MKZA 3G4SI 4DOZA 3BR3A 1KU9A 4ZJZA 1FX7A 2JPCA 4XRSG 5LFAA 1BI3A 1DP3A 2AXLA 3GUDA 4M3GA 2Q2EB 4FX4A 3GZNB 2XF7A 1DP7P 3SZPA 4I02A 4F92B 1BJZA 4XLAA 4Y3OA 3B73A 1XN7A 2EB7A 1BIBA 1XB4A 2PMUA 2DFFA 3LSPA 3I4MJ 1OCPA 4UVCA 5J1UA 2KHMA 4S04A 4B47A 1OMIA 1GXPA 3S2HJ 3BWGA 3MVPA 1YJWI 2X0LA 1UHMA 2LRDA 2ZXJA 1ZN2A 1USSA 4HW0A 1P6RA 2EV0A 1EH8A 2Y2ZA 2ZSHB 3HRTA 2DU9A 2HDWA 3Q9SA 1BIAA 1I39A 3B02A 1BN5A 4E6KG 1P7IA 4H4KC 4I2OA 1T98A 1RR7A 1IN7A 5LGTA 4KIGA 2J5OA 2MLGA 1HSJA 5LHGA 3TW6A 3GO5A 2E60A 1D8JA 5FKOA 3V8KA 4IRIA 2EZKA 2R7VA 3CCQI 1PJRA 1LEAA 2DN0A 4D9JA 1YTYA 4FQGA 2CSOA 1SD5A 1HCRA 2DPUA 3J7YJ 3KYCB 4QLCU 4HSTA 4NHJA 4PSWA 1IC8A 3F23A 4KA4A 2QBYB 3QWLA 4F7ZA 1APLC 1XTAA 1OCRH 3CDHA 2NRAC 1FBUA 3ZQIA 2QBYA 2EPFA 2OPTA 2IW5A 2ZJ2A 3K2AA 1ZG5A 5TGTA 1J5YA 4BHBA 1USTA 1P7JA 4BUPA 1A04A 3DEEA 4BJ5C 1JJ8C 2KDOA 3MQ0A 4N0BA 1A31A 3ZQ7A 5AIPA 4XLCA 2X9DA 5M5XJ 3S2WA 1K6OA 1S8NA 3V4GA 3G1MA 3GTQJ 2ECCA 3CCLI 2X4HA 1LNWA 2LOOA 5J40A 3IHUA 4N4NB 4BQNA 4AYBA 3F0CA 3HEFA 3K10A 3ZMVA 4BHCA 1MMAA 5M5YJ 2IVMA 1P2FA 2E1NA 3TQNA 5L3EA 5HLIA 1IUYA 5CQEA 1FYMA 1HKTA 2HWVA 4D7NA 3R4KA 4NB5A 4G6QA 1R6RA 4C9YA 3HRMA 1PUFB 4X1EA 3CCRI 1D0YA 1S7OA 2O8XA 4DGWB 4ZTFA 3LSRA 3ERMA 4PGHA 1O7FA 3JW4A 5C4JJ 2JT1A 1HBXG 3A2KA 1V5FA 2ZSIB 5J3LA 3T8TA 5DM6F 1TQPA 2ACJA 4I0BA 3M1EA 4HRIA 4KNYA 2K9QA 1YHQI 1DU0A 2ID6A 3N4MA 2JZYA 2VT3A 1LDJA 3O2PE 4GYGA 2XAJA 4CYCA 2WAFA 2M7AA 1SANA 3Q0WA 1YRNB 4BYYA 4HNUA 2CV1A 1V4RA 1FT9A 4B4CA 5CVRA 3F8BA 3FM3A 3HG9A 3E1SA 4EJTA 3CP2A 1O4XA 3A1YA 2EA4A 2EZIA 4P55A 3U1KA 3IP4B 4P5OA 4AD9A 4A3GJ 2IS2A 3GW2A 4HLXA 4QSHA 2EK5A 2CO5A 2YX7A 4I7HA 2FBKA 2IBDA 4NQWA 2F5CA 4A3LJ 2I10A 4RDUA 3CUQC 2WB1N 2QYOA 3BTIA 1XSXA 3DWLE 2ESNA 3OL3A 2VUMJ 2VLAA 5FO5A 3SDGA 4PK4A 3MZHA 1MSFC 3ZPLA 3H9QA 1JKQC 2GOXB 2G7UA 1R00A 2Y30A 4II2A 1FP2A 3VFZA 5JFRA 3H0DA 1U5TA 2L7ZA 1Y1WJ 2VBZA 3OYBA 3GVAA 4XKVA 1LQ1A 1HW2A 3HSEA 4KYWA 2R7OA 1YE9A 3ABLH 3AG3H 4B43A 3S17J 4UB6C 2M8GX 4QWQA 4ZC3A 3JRFA 3L2UA 5KHDA 3LWFA 3VPRA 4GFBA 1QZYA 3P5JA 3FXRA 3L9FA 2ZO4A 3H3UA 1OR7C 3GBGA 5DUKA 1YIJI 2DOAA 4MGRA 4HEA2 1MJAA 3KEQA 4G94A 1VQ5I 2BW3B 4BAYA 3QPHA 2E7WA 1TTYA 2R7FA 5IP9J 3Q5FA 1OYIA 2TDXA 5D5XB 1YJ9I 4P1WA 5J6XA 1T2KA 5CVVA 3WE3A 5F08A 1T0FC 1XMKA 1I27A 5EG0A 3TKYA 4JX6A 4GXOA 1ZGJA 1MW7A 2NAZA 2VQGA 1W36C 3HKZA 1X4OA 3OYGA 1GUUA 1LPQA 2Y75A 3JREA 4Q5SF 1D0ZA 5J1RA 1MZBA 2IA0A 3RI4A 4ON0A 2NNYA 4ZYDA 3IH3A 4AIJA 3P9KA 2MGQA 4B1RA 1D5VA 2MG4A 1DDNA 2ZNZA 2ZJRF 2K85A 4HQMA 4A6DA 1JGSA 1B72B 2O8KA 2IJLA 3E5UA 4JQFA 4M3FA 4EM0B 1KQ0A 3FXQA 4YFXF 4Z6YA 4UUTA 2XDVA 4IOAF 3JSPA 3VYUB 2UWMA 1J59A 1ZREA 2XC7A 2VPLA 3D5LA 1T8IA 5L3GA 3SQNA 2GM4A 4IHWA 2HU9A 5B1BH 1AWCA 4Y52J 1SD7A 2QZ8A 3WGGA 3OYJA 3O3KA 4HG2A 5F04A 3FKIJ 4XSXF 5AONA 2PLYA 3JTGA 1PDNC 2YU9J 1H88C 2JA8J 1X1DA 3E5XA 1JJ6C 1MIJA 2ETHA 4IVNA 1UG0A 1MKMA 2IPQX 4LLGF 3KEOA 3JRAA 4KUMA 2UV1A 2ELJA 1RR8C 4LOCA 3CP8A 4RS8A 3ECHA 3K69A 1D1BA 1DPRA 2L7FP 3WG9A 5GAEJ 1WJ5A 6PAXA 3OYMA 3K9TA 3RIRA 2R5ZB 1VTNC 4WX9A 2JWTA 1TT0A 4L9NA 4CSWA 1P4AA 3DKWA 1ZRFA 1S9HA 3DBRB 4FE4A 1QZEA 2TRTA 3HBLA 5DCMB 1YW9A 3L2QA 3OWTA 3FIWA 4M9ZA 3IRQA 1OYYA 3LSTA 1JI8A 2BZTA 4IHXA 2XAHA 2M34A 3AL0B 3RPQA 3B6AA 4IRGA 1F1ZA 1MGTA 2HPMA 5H6RA 3PL8A 3TEDA 4CICA 3EUHC 1Z05A 4BJ6C 5JHUA 2KJCA 2M3AA 1ETWA 5E1XA 4LB6B 3ZP5A 1BI0A 2G7HA 3RKYA 2GXBA 4XSZF 4Y17A 3H3VK 2E2HJ 2L02A 1ON1A 2XGCA 3HPGA 3QPLA 4HPQA 1I6HJ 1QPMA 4KN4X 1SFUA 2DDAA 3WHCA 2VI6A 1U8RA 3C7JA 3PUFA 3REOA 3NWSA 1U6GA 2VXDA 4DYCA 3OOPA 2XPVA 3HM5A 1TC3C 2CW7A 2YR2A 4EJVA 2OJED 3PSIA 1X4PA 2W1OA 1ETQA 4ANJA 1G8XA 3CC7I 2VPRA 3DEUA 2FBIA 2I5UA 1X2MA 1FBSA 2M45A 3PIPF 2LC2A 3QP5A 3HOXJ 3CO7C 2PMHA 2KIUA 1SMYF 2M4KA 4OWRB 2CUEA 3WTYC 3GCMA 3A01B 3I56I 2MFZA 3DV8A 1Z91A 1MD0A 1FEXA 2WTEA 4IO9F 2A05A 3M8EA 4RB1A 3OIQA 2BYVE 5F64A 3GZ6A 1R5HA 1XPXA 3A0HC 5IY5H 3K1NA 3ZXSA 1B59A 1UJ8A 2DOEA 1WJAA 4RMNA 5AIQA 9ANTA 4PFOA 2IT0A 1LE8A 1LJ9A 3RCOA 1W7PB 4YELA 4NC7A 2A3SA 2DXIA 4OIPF 5LLQA 2ID3A 2Y0SA 3BJ6A 1WH5A 3K1MA 3OSGA 1XMAA 2MA3A 1RUOA 4I09A 1VQPI 4HYEA 1NK3P 2VJJA 5KK1A 3UR3C 1TBXA 4EQQA 2TCTA 2HEOA 2DI3A 2JA5J 1KU2A 2ZKZA 3L1PA 1WHUA 2LY9A 2EJRA 2VQLA 1ZARA 2RNGA 4G9YA 4BY1J 2EWNA 4B48A 1B9NA 3GFJA 2B7EA 4PCQA 4F52A 3RZOJ 4FHTA 4XKWA 1MNDA 4C30A 3ZOBA 2P7VB 2VJ4A 4BE0A 1ZQ3P 1FBQA 2XF6A 1JUSA 2DA4A 3RQIA 5LGNA 5D5UB 4CCLA 5DDGA 1B9MA 2YUSA 4DBRA 1KYZA 2KMUA 2KJBA 1S6LA 2X1DA 3DTIA 1ZK8A 1FOYA 2V26A 3BP8A 2XAGA 1SMTA 5DTDA 2GOMA 3ESWB 3V8JA 5ICGA 4H0EA 3KLNA 1YO5C 1SD4A 4KISA 1EV7A 2W48A 3MAJA 4MHGA 4M74A 2VIXA 3FZVA 1FSHA 3FM5A 2VASA 2IEKA 2OCCH 1K61A 4G7HF 5CPRB 4RGXA 3DF8A 4DBQA 2R5YB 4Q4ZF 2L5QA 5HLTA 3HOUJ 3JCUC 1TNSA 1QRYA 4XL9A 4CO8A 1U5TB 4XLNF 3F8FA 2V7FA 3DEWA 4A3JJ 1I50J 2IS4A 1FIPA 1FP1D 1WH7A 1ZLJA 3QU3A 3OL4A 4KFCA 4A3FJ 4LJZF 2JUGA 5DS9A 3JRHA 3V42A 2K9NA 2B9SA 3FXOA 1IJWC 3AAFA 1O3RA 4PSXA 1ZH5A 4EGZA 2Y31A 1EJ9A 1Y39A 3FMSA 2A6EF 2LY2A 3DKXA 3OYNA 2LKXA 2JRMA 3P7NA 5K5QA 3F8MA 4AC0A 3LA3A 2E2IJ 3FK7A 3DBHB 1IG7A 5JR3A 1GT0C 1LDKB 3GFLA 4G12A 2DOFA 1QVTA 2GXAA 1JXSA 3E0JB 3GTOJ 3L09A 4XOTA 4C3IJ 2XIGA 4QIWN 3I5UA 3HUGB 2DYSH 1STZA 2DA3A 3H1CA 3HOZJ 2CQQA 1MBGA 2E35A 2HYJA 2ZCWA 3GTGJ 2CW8A 4C3JJ 2PJRA 3GF2A 3MMYB 3QYBA 4U0YA 2GIZA 3NEUA 2F4OB 1Z6RA 2V1NA 4ENJA 1TQIA 2LBFA 1AKHB 3M07A 2JK3A 1RZ4A 4OIQF 2LBFB 2DODA 1AKHA 2L0KA 2WB1A 4JBAA 2Z2SB 3LAJA 2XKOA 2DMTA 2BBYA 3HPHA 3IUOA 3BG3A 1M1EB 2D1HA 1YG2A 1BBYA 3KCCA 3J7AO 2VC0A 4CUGA 5LD2C 2DFHA 2L4MA 1FWZA 2IGMA 4KICA 3ABUA 3DU5A 3LSHA 1XDSA 2LK2A 2O0YA 4ENKA 1Z3YA 2PMZA 3SXYA 2QM3A 5EEAA 3S32A 1T95A 2BV6A 5J1YA 2F5DA 4A3EJ 3EUHA 2UXNA 3LFKA 3DLLF 5BPIA 1X1AA 2E1MC 5F1JA 2MD0A 3IL2A 3BT9A 1OCCH 1E3OC 3S1QJ 4I01A 4MO7A 1Q1HA 2ZMEB 2F4IA 3B6CA 1UHSA 4BACA 1U3EM 1ETOA 3RPUA 2V4JC 2O61A 3FKJA 2CMPA 3CMAI 3H9JA 4MNUA 1VQLI 1UB9A 1YYVA 5HOOA 5DUIA 2I8DA 2L2OA 2X6WA 1X58A 2NS0A 1VQ8I 2ZFWA 5GPAA 4MFDA 3TOAA 3TW7A 2ICWG 1MMGA 1F9NA 1GLNA 3EYYA 1PVEA 4ZYGA 2HDCA 2VN2A 2OD5A 4EEFG 3JR9A 1R9TJ 3HB9A 1BJAA 4BJTA 1E3PA 4A3MJ 1JKOC 1IXCA 3I54A 1I6XA 1R58A 5LGUA 1PUEE 4F3QA 1YW8A 1S7AA 2LG4A 1F5TA 5C4XJ 4A3DJ 2KRCA 4OAZA 5IT3A 2Q1ZB 1G4DA 3K70D 2F2EA 2HR3A 4GDFA 4OMYA 4CA0A 3VODA 5KNLA 3OS1A 4NC6A 2R7SA 5E3NA 4P96A 4G7ZF 1G59A 3J7AY 2CUFA 4RAFA 5E3MA 3QYEA 2P7CB 2BY2A 2QQBA 2FMYA 2EIJH 2JQ7A 4G8XA 2QF7A 3PUBA 5FROA 1GV5A 4XRFA 5B1AH 1B1BA 3KP4A 4OIOF 5EZGA 1QU3A 1YIOA 2JA7J 2HOSA 1OCTC 2IRFG 2WAEA 4XORA 2KQRA 3ABMH 4BBSJ 3A01A 1NHAA 1ITYA 1K4SA 2R0QC 1FMWA 2P8TA 1B6AA 1F4KA 3WG7H 1RESA 1XD7A 5H2FC 5JVGF 4HLYA 3PFIA 3T8RA 1UHWA 1H9TA 1QBJA 4UV8A 2DT5A 4BH9A 3S3NA 5DCFA 2NVUB 1KONA 5HNHA 4RLQA 2XRNA 3KE2A 1RKWA 2EZHA 4B8XA 3CCVI 4AYBN 1GDTA 3X2QH 2YPRA 5D5VB 1LB2A 3QRFF 3M8FA 2D1VA 2KIMA 4RB0A 3RYPA 4F55A 4U7DA 3H92A 2HOEA 3OYIA 4MTEA 1DPUA 5FLVA 4LK1F 1X3UA 2LKPA 3O8GA 1U0JA 4WXHA 2E1CA 2GLOA 4XOPA 1ZKGA 1R22A 3TGNA 1MDMA 4BNCA 5HDKA 4UVBA 2KP6A 2HKXA 5IP6A 3WU1B 3E3VA 1Y0NA 2ZXHA 3LNQA 1MBKA 3BG7A 3K70C 3H5RA 4WF2A 1YS7A 3RQ4A 2KPMA 3BR2A 3HHHA 3LL7A 1YLFA 4RAGA 1W0UA 4EVIA 5F6FA 2NS7A 4C2TA 1SC7A 1KQ9A 4AIDA 3CF2A 1U2WA 1V55H 3D5RC 3FXKA 4DW6A 3CCEI 4FTHA 1D1AA 2HYGD 1FSEA 2V79A 2N8GA 4OAYA 1IRGA 2HNHA 2PJPA 3S3MA 1Z6TA 4CCKA 2CV2A 1TWCJ 2JA2A 4HOBA 1X19A 4L9VA 1LKXA 2VE8A 3KX2A 2PX9A 3L7WA 5E3LA 1P4WA 3G1OA 1IXRC 3N05A 1ONVA 1G3YA 3EDPA 5DEQA 3CC2I 4WCGA 3NRVA 1NG7A 2A68F 3TDUC 2E34A 5TJJA 2QA4I 3OS2A 3WGHA 1ODDA 3E97A 5ICEA 4L0YB 2D45A 1HQCA 3A4CA 3BROA 2L4AA 3PSFA 2IXSA 3LSIA 1IGNA 4JX5A 5HODA 3GTKJ 2QWWA 3GYHX 2XUBA 4D0PA 2A6HF 2FE3A 2HI3A 3ELKA 4FE7A 4FASD 2NS8A 3OR1C 2NVTJ 2L7KA 5FD5A 3K4BA 2A07F 1DGWY 3OR2C 3ZQQA 2CU7A 5H6QA 3WE2A 1FTTA 3LMMA 4L5JA 1E0EA 1G3SA 3CUQA 2M8EA 3ZN0A 3L2CA 5FKKA 5K7ZA 3VSLA 3VYRB 3CJTB 1TW3A 4DZPA 2K5CA 2VB6A 2R5YA 5CJ9A 2HKOA 1XCVA 2K3PA 1BOAA 3TMOA 4UUSA 2JRTA 3TP0A 3CESA 5ILUA 3W6VA 3OV8A 5ERIA 1K78A 5EDNA 1WPKA 4Y4RA 3S1NJ 1GHCA 1ZLKA 5J4VA 4IQJA 3HXLA 1MMDA 3CC4I 2WBMA 3QQAA 1H0MA 2FX0A 4UHTA 3VB2A 3FBIB 3CDLA 3CJQB 3QAHA 5EG0B 1XGOA 2K27A 2M0CA 3BTJA 1G6NA 4CCJA 2ZBKA 3BPVA 1I1SA 3HC7A 2EZLA 2EFPA 1HDDC 2HQAA 1ETKA 1R4MB 1R36A 2FEZA 2OA4A 2HTSA 2XGDA 4XQFA 4RLFA 4HV6A 2IGOA 4C2MJ 1C0WA 2BHYA 2VBWA 3LSJA 5E1WA 3S1RJ 1VQMI 5HS9A 5FRNA 4MLOA 1WGXA 1W7PD 2MW8A 1RKTA 5LHIA 2PG4A 5ILSA 4GRIA 1N25A 1K7AA 2IS6A 3RJPA 4CZCA 5HNFA 3IKTA 5DYMA 2ZB9A 3DLAA 4HF2A 2UUZA 2MC3A 2X6YA 1MH4A 2HGCA 1D0XA 2ADUA 3WU2C 3HRSA 5BPDA 1W0TA 2G9WA 2MYSA 3IC7A 2CWEA 4O6JA 2ZMEA 3SFZA 4M3BA 2KIFA 4HDUA 1N75A 2NVYJ 3ABKH 4MTDA 2LFBA 4E7IA 2CFXA 3ZN1A 1CQTA 4E7HA 2ME6A 1OJLA 1FNNA 2DTZA 3BZ6A 3OY9A 2QENA 4PGGA 4KMUX 4MFEA 1BW5A 4WXDA 4M6VA 2DTRA 3ML6A 2QGUA 5B5EC 1PP7U 1HLVA 1HC8A 2VBYA 1ZAOA 1GXQA 3R0AA 5E20A 1XMXA 3OYEA 4ZDOA 5A2QK 3U9GA 3M9AA 2P6SA 3FMRA 1FYLA 3ZR8X 2XROA 2M1BA 1Z0XA 3PIOF 1ENHA 3OS0A 3HOTA 1ZG1A 1TNTA 1WJBA 2KIQA 3WHBA 3S16J 4GGGA 1O7LA 4JYKA 4M73A 2M7BA 5FB2A 2YSRA 1IN4A 3OMYA 3IH4A 1J75A 2BW3A 3FHZA 1QPIA 2OUMA 4PJMA 5K7HA 3ONQA 4HX8A 1XGMA 1XCBA 3COAC 1IV8A 1IAWA 2LD5A 3C18A 3CO6C 1R7JA 2FRHA 4XR6A 3HRUA 4E7SA 3WTVC 3ZMDA 4IHSA 4R1HA 5DCMA 2AO9A 3IAS2 3PNYA 1NTCA 4IEJA 2M5WA 2P81A 2LY1A 1YRNA 3MWMA 4E7LA 2BXYA 3R0JA 3JRGA 5EZHA 4U0VA 4ZH4F 4HNVA 2F5FA 3MD2A 4LITA 4EGYA 4KN7X 2UXXA 4E7ZA 2EILH 3JRBA 2K9MA 3BY6A 2NNNA 4ITVA 3KZZA 2YU3A 4N9IA 1GVDA 2GQQA 3C1DA 3TO9A 1IRZA 4MEYF 5LRSA 3GWZA 2M9HA 4JOMA 1S72I 1D5YA 3NARA 2RKHA 2UZKA 3GMEA 1FYKA 1W5CC 1U5TC 5D4RA 1BOBA 1XGNA 5HDGA 1FPQA 4A0XA 5J8CA 2B63J 3OIPA 1UMQA 4IL6C 2EV5A 1E17A 3F8NA 3ZMZA 5GADJ 4X6AJ 1S5LC 4IJAA 4CYDA 3OYHA 1YFHA 2O3FA 3F21A 3IH2A 3TO7A 1B8IA 1WI3A 1JUPA 4OU0A 1RUNA 3VWBA 4XRSA 1QO0D 3O6BB 2Q2EA 2IP2A 2FMLA 3JRCA 2DO7A 5FGMA 3FHNA 1JHHA 2OCEA 3DXJF 2W82A 2LMDA 2H6BA 4BDYA 1O3TA 1K4TA 1IN6A 1MSEC 2RVCA 3K4NA 1ZGAA 5DD4A 2ZJPF 2E2JJ 1Y1VJ 3PO2J 3G3ZA 4EMSA 2R5ZA 4L9JA 1XS9A 1K79A 1CF7A 2AQEA 2JN6A 2E19A 4UY8I 4IF4A 2AXTC 4M3DA 4MQVA 3HL2A 3RZDJ 3RPUD 3U1DA 3JRIA 3M8JA 3F8CA 3I4NJ 3KP3A 3K4KA 2W24A 1IZ1A 3OYDA 1A5JA 2RC4A 3PFYA 2HOTA 2EIMH 2A61A 4PZJA 1JT6A 2ZFUA 2HQ5A 2H8WA 3P9CA 1OCOH 2M87A 3CCSI 3BLYA 1WJEA 2XRLA 4L5EA 2KZVA 3TL4X 1KGSA 1FLIA 2DA5A 2XAUA 1MNEA 2FSWA 2ZMEC 4A2UA 2XF5A 1O3SA 4V2GA 1JKRC 4BE2A 2XPWA 1YQAA 2OV7A 5FFXA 3EUAA 4A93J 2K3FA 3SHFA 5J47A 2ECBA 1HA8A 3CTAA 5DV5A 2CW0F 3M7GA 3EPZA 4G6TB 2K02A 3OYCA 4ABZA 2NVXJ 4A0YA 2CUJA 1L0OC 4DZJA 4XIDA 4MIMA 5CKTA 5CVJA 3EUKL 5DD8A 2ESHA 2RV8A 2H09A 3SZTA 2P0WA 5ICFA 3ZMUA 4BGDA 4R79A 2O9LA 1PYVA 2H94A 1WI9A 2JPBA 3V7SA 3ISPA 1W36D 2ZC2A 1LFPA 4YFKF 2BGCA 2X1EA 1KU7A 1SFEA 4BY7J 5E8IA 2DLLA 2GWRA 1B4AA 4ZYAA 2X51A 2HDDA 1VQ6I 3HOVJ 3KYLA 1ERDA 2LSOA 4BDZA 2DMPA 3L2VA 2C6YA 2FBHA 3E6BA 3VYTB 4J01A 2OTJI 2EV6A 5KCMA 4I98B 2E36A 4MEXF 3OIOA 3CUOA 1WRJA 2MH9A 3K6GA 4M71A 3HOWJ 4QTRA 3KEYA 1RI7A 4BL0B 3G73A 2E5NA 4G6DA 2P5LC 3VEPA 2ELKA 2BE5F 2Y9ZA 1BA5A 3E7LA 3BDDA 3E6MA 1CGPA 2Y9YA 2KDZA 5IYCJ 4WK8F 5DM7F 2KT0A 2KZGA 5F0HA 3TOBA 4HF0A 1UELB 4F91B 2DQRA 2J5PA 2WY8Q 4HQEA 3M3YJ 4RAYA 4BEHA 4A3IJ 2QQ8A 5JHFA 1OPCA 2PJRB 2R92J 1IRFA 2RQQA 2L54A 2RAEA 2VKEA 2STTA 2BY1A 4FETA 3BR1A 3GTMJ 2VOPA 3AG2H 3GLXA 3F6OA 1TWAJ 2RREA 1G3TA 1HKQA 2PEXA 2V6CA 1BM9A 1YS6A 1TL8A 4L18B 1IV6A 1QGPA 2CYYA 5L3BA 2DT7B 3LSMA 4HZFA 3BJOA 4U87A 2FNPA 2AS5F 5TISC 2K9LA 4AIHA 4LG0B 2WADA 5CVUA 1QA6A 1KA8A 3HSFA 4DIQA 4DYRA 4XKCA 3WGIA 3WU0A 3UKGA 2Z9OA 4ZYHA 4Y33A 4U88A 1FJLA 3PNVA 3IWZA 2BXZA 3ZQCA 1FIAA 1ZRDA 1UZCA 3A02A 1NK2P 3OSFA 2LR8A 5K5RA 3SYTA 2WY7Q 1V54H 2RQPA 1WFXA 1YJNI 1RRJA 2NXNB 2DFEA 1J9IA 5IPAA 2QQAA 1Z3XA 2A69F 5LEJA 4F93B 3OYFA 4D5FA 4IPAA 3KZIC 4LB5A 2L9NA 5GP9A 2R7RA 3CJNA 1KYWA 3SEZA 2QEXI 4GO1A 4PJNA 3ZMTA 1YW7A 2XSJC 2Q0OA 2WA0A 1Y56A 1G3WA 3BJAA 3JTHA 1PUFA 2VODA 3BPXA 2IGKA 1E2XA 5EGOB 5EYRA 3J7ZI 1J0RA 5BS6A 1CF7B 2KRHA 3QPSA 1T56A 2R7WA 2OQGA 2R7DA 1VF9A 1H9GA 4BKXA 2MD5A 3BG5A 4HAMA 1EA3A 3S8PA 3V8LA 3GZ5A 3C2BA 4IOCF 3H35A 2KFDA 3KP2A 3TDZC 3CQZJ 3FBNB 1IN5A 1XC5A 3CMEI 5JVTA 1VQ9I 3KIOA 1S29A 3Q3SA 3HSRA 4NDLA 2XGXA 2BEOA 1QVUA 3PO3J 1IO2A 3BTCA 5E17F 3CJRB 4K2EA 2CFOA 1LVKA 4PDKA 4UUVA 3CCYA 4C3HJ 4ETSA 5D4SA 1Y6IA 3H3ZA 4Z2YA 2WWYA 4EM2A 2HOAA 1WJDA 3MZ8A 5B3SH 3FXLA 2CH0A 1HXDA 3TO6A 3HTSB 1T0FA 4BXUA 3GTLJ 3QOEA 3WTXC 3DKYA 4RGUA 4LFUA 1KU3A 1EKEA 2JA6J 2K7LA 3WTTC 3H5AA 3CF5F 2VQCA 2DBBA 3BQYA 3HOYJ 4HNTA 1MJBA 2GAUA 3W2WA 4QPQA 2AQFA 2LDUA 1W5TA 4ASNA 4AUXA 1DGRM 1TQMA 2DPDA 2DMQA 4PJLA 1X2NA 2X6XA 1HF0A 4DJAA 1SEUA 5F27A 2K40A 4YG2F 1W4MA 3K4CA 1WJCA 5D5WB 4XLPF 3H36A 3C3WA 2VC1A 2OF7A 4KT6A 2XV4S 3I3LA 1J2XA 4S0HB 4I0AA 3PJRA 5IYDJ 1WKMA 2RN7A 2V1DA 5L3CA 3K2ZA 3J80K 2FD5A 4BXXJ 3ZQHA 2DJIA 1HSTA 4RA2A 5D8LB 2XASA 2O6GE 1IXSB 2VJIA 3K4JA 4ESFA 4RGSA 1AA7A 4YIRX 2VBXA 4FT8A 4M9SA 1FZPB 1OISA 2EH3A 2VXZA 3ZQGA 2L01A 2W57A 1BI1A 2KISA 2O03A 5GTHC 3VOEA 5F1RA 2H6CA 3QU6A 1ACIA 4RM3A 1SFOJ 1EF4A 5FKMA 1LFBA 3I71A 1R23A 5B66C 3U2RA 1QHHD 5H20A 4BQOA 2L9RA 5GAGJ 3ZCOA 2A5YB 3PQJA 2JSPA 3A0BC 1JTXA 4M9XA 5LHHA 5EF6A 3FF5A 1RETA 2COBA 4LLLA 1ZTRA 3T1BA 3Q0VA 1UAAA 1A6IA 4UV9A 2E1MB 1FOKA 3NQOA 5BQTA 2F4MB 2DA2A 2HVSA 2ISZA 4AWXB 2Y69H 4LG3A 1RIOH 4RAZA 5FLMJ 1QNTA 5A2QZ 4YIFA 1YOVB 3D5SC 3DP7A 2QKMB 3I59A 2GA2A 1OLTA 3F22A 2DA7A 1AHDP 1WZ2A 3W6KB 3DU6A 3S93A 4B09A 1R71A 4AIKA 2IA1A 2BY0A 3TBIA 5J4YA 5E3OA 3W3CA 2DCEA 4X0GA 1XG1A 4HV5A 4XNFA 1R49A 2CRGA 2XAQA 2PQ8A 3UNGC 3MEXA 1SD6A 4RGRA 3DBLB 2L7MP 3A03A 1AOYA 5F0CA 4II3A 2VKDA 1ZG3A 3CMYA 3HUGA 2GXGA 4HSRA 4E70A 1MNMC 2VONA 2M2EA 1U8BA 5FLXZ 2FUG2 4XLEA 3ERED 3ASOH 2P6TA 5GAHJ 1OR7A 4ENNA 2PBIA 5F0FA 4BHPA 5HVQC 1BW6A 1T39A 2XB0X 3VYSB 2CQXA 3DPLC 2JVGA 1WSUA 3LA7A 1H89C 1X3ZB 4KIFA 5JI6A 2DMNA 2VKHA 3EQLF 2FQ3A 3MKWB 4CGZA 4G7OF 3IAM2 2DYRH 4JP0A 4IX7A 2L9VA 1J7KA 2D2WA 3AL0C 1QHGA 3BCBA 2LNBA 4TV7A 3DPUA 1ETVA 3ABTA 1MBEA 1LUJB 4Y7NJ 3I58A 2ZXWH 1D1CA 3KP5A 4W1UA 4LG0A 1GVJA 1P9QC 1AU7A 3IRRA 2M30A 3V7RA 2OBPA 1W1WE 2V9VA 1HKSA 2VJ5A 2STWA 1U9NA 2LREA 4IQ4A 5J8FA 2JMWA 1A35A 1IDZA 3KP6A 1D3YA 4JK1X 4ESBA 1P4XA 3LAPA 3NAUA 1OQYA 2FJ1A 5ILVA 5JLWA 2LVSA 2XSDC 2BOLA 1IRXA 2VT2A 2CS3A 3I0TA 4RM2A 3BCAA 1EH6A 1MBHA 1MH3A 3IKVA 4ZZLA 1BI2A 3JRDA 3CCJI 4I6ZA 2FU4A 1REPC 2Z99A 4A12A 3GFMA 3RDIA 4ZTJA 2H27A 1ORKA 4IKFA 4RB3C 2DJNA 2HVQA 3W6JB 3H5NA 4XLFA 3CCUI 4CDGA 2Z1DA 4AVZA 3H0GJ 3S2DJ 3GX4X 1JHFA 3AG4H 4BQQA 1BL0A 3LA2A 2R7UA 1UCRA 4U7BA 3N97A 1SAXA 4XMYA 1Z1DA 2E7XA 3RKQA 2DMUA 2MLKA 2CGPA 2Z5UA 2ISYA 2K9SA 2WV1A 2ZNYA 1R1TA 5FKNA 1N77A 4FX0A 3R60A 4NBQA 3HJEA 2HYFA 1RPWA 2CQ7A 2DQLA 3G6EI 4BQAA 1KQ8A 4A3CJ 2HQNA 1JGGA 2DK8A 2H8RA 5FFZA 2WC2A 1TWFJ 1R1VA 4OIRF 4I99C 2ELHA 4ZDPA 2M0MA 1TWGJ 1PP8F 2EFOA 3BG6A 4D5CA 4O5VA 1VZ0A 1B72A 5E18F 2VL8A 5EGOA 2DA6A 1I5ZA 5CQGA 3OYLA 1VQKI 1QQIA 1J09A 3FX3A 3I9V2 3ZGKA 3S14J 4CCNA 1VI0A 3AFHA 4P9FA 2V9KA 1V5GA 3AKZA 5C3EJ 3L00A 4UVAA 3Q0UA 1P92A 3GTJJ 1WQ2A 5K1YA 1X1PA 2HZTA 2QSHX 2CV0A 5FKLA 2NOGA 2XHKA 3BG9A 3CMMA 3QOPA 4D7MA 1TLHB 1ZHFA 2Z33A 4JX4A 2H1LA 3I64A 1KZHA 2EBIA 2LP0A 1N78A 3RKXA 2EFWA 1IW7F 2EFNA 5LEKA 2P5KA 3KYDB 3QYFA 1R1UA 3BC8A 3F72A 3K4MA 3CD6I 4NNJA 5CLSA 4OOIA 4P9UA 4PJJA 2YS9A 2W00A 4DYQA 4M3EA 2NYXA 5HS7A 4EJUA 3ECOA 1OFCX 2ZXIA 1HW5A 3MKLA 1X3WB 3LQRA 1T6SA 4DQ2A 2Z16A 1ZYRF 2DW4A 4HA8A 3D1NI 3K7AJ 4O3MA 2HTJA 5C44J 3PNTA 4NC8A 2DFIA 2JVHA 1MMNA 3C2GA 1V5EA 3QPTA 2RNJA 2BHZA 3IV5A 3NWTA 3WODF 3S3OA 1XGSA 2P4WA 2W25A 4QPOA 1MJ9A 5LRRA 3GXOA 5D6EA 4MQ9F 4CH7A 1TWHJ 2KRFA 2CQNA 2DDBA 4HX7A 4XN0A 3Q9VA 3RKWA 5TRDA 1RNLA 5FD6A 4XM3A 1JKPC 3KFWX 1ZGWA 2JUCA 3DCFA 4DNCA 2V6EA 4KMFA 4LK0F 2CUZA 2QSFX 4XK4A 2QLZA 2KKOA 2R7TA 2OU2A 1X1BA 4ZYEA 3LOCA 4B44A 1IUFA 2E5ZA 5GTIC 4WXCA 1JUMA 2W7NA 2P5VA 1JTYA 1HOMA 4IHVA 4A5MA 1WCMJ 2Y48A 1VQ7I 1WWXA 2RDPA 2A6TA 2K4JA 3TP3A 2LF7A 4LIVA 3G71I 4B3XA 2WAQA 4HDVA 4IHTA 1LFUP 4BE1A 2HFHA 2R3SA 4CZZA 1YX3A 1UFMA 5CVIA 4YRVA 2F6CA 3FXMA 3KP7A 3ULQB 1E3HA 4ESJA 1Y0UA 2H1KA 4EV0A 4ZZDA 3OYAA 5L3FA 4Y15A 4BXFA 2HS5A 2K4BA 4U0WA 3LSKA 4HX4A 5EJCA 3HIFA 4NUBA 3HDDA 3V7CA 2MABA 1JE8A 4BU2A 1ZR2A 3M4OJ 2FNAA 5EEGA 5HDNA 2YX4A 5E8GA 4OMZA 3SDBA 4IZZA 2V1XA 5HLGA 3WTWC 1FTZA 5HS8A 2K86A 5CYVA 5E1ZB 1ULYA 2QUFA 4L0ZB 1R5GA 1LE8B 4XKBA 1I3AA 4XONA 3CZ6A 4RBOA 2DT6A 2IS1A 1K83J 4UNOA 3I59B 5FLXK 3HZJA 1BR4A 3ZQLA 1Q1VA 3FMQA 2X1CA 1K78B 1H8AC 2IA2A 1TP4A 3BR6A 3E5QA 1ON2A 2DA1A 3DFGA 3C2HA 4KT5C 3ZQFA 2W85A 1ZRCA 1VQ4I 3HYIA 3CLOA 5GPCA 3WTSC 3FXJA 4M6YA 3KZYA 3OYKA 1T08B 2OZUA 4M72A 4V2FA 1A36A 3LSGA 3FK6A 3K4LA 2PN6A 4GYIA 4V19K 4I76A 3MCZA 2LYCA 1T33A 5IOYA 2CG4A 3ASNH 4AM3A 4KDPA 3MKYB 1IDYA 4A0ZA 2WV0A 3G1LA 1K6YA 1X1CA 2JSCA 1IF1A 3RSNA 1OKRA 2G0EA 4B3AA 3F3XA 2F5EA 3J81K 3T0YA 2DK5A 3I53A 3W2VA 5IT9Z 3KETA 4ZDLA 4Q48A 4EJWA 2DAOA 1BR1A 1QZZA 4A69C 2MSYA 2AHQA 4PUSA 3E6CC 1DU6A 4OINF 3PM1A 1HDPA 3G2BA 1TZLA 2QVOA 1D8KA 2XGEA 3BR5A 4E7KA 3O8HA 2BVLA 2V9PA 1SFKA 2LLKA 1XSVA 1FY7A 2HVRA 1O57A 4HBLA 4BS9A 3CUQB 3LFUA 4N4OB 1POGA 3KPHA 3ROUA 5KAIC 1L3LA 1JT0A 2EA2A 2VE9A 4BEHB 4IXAA 3J80Z 4CCOA 2MBFA 2QKLB 3K1PA 1MDMB 4CCMA 3WTUC 4PFPA 1WVRA 2M4GA 2JTVA 2Z3YA 4A6EA 4A3KJ 4LGWA 1SVOA 3BZCA 1XX5A 2HZDA 3JAMZ 5BMZA 4UUSB 1Z7UA 3CLQA 3FXUA 4NQWB 2JJ7A 3BOQA 3DTKA 3SEQA 1LDDA 2R7QA 1XDUA 1TW2A 1V3FA 1ZR4A 4LLNA 2EIKH 2FA5A 1VQNI 4FCYA 3FISA 3QODA 1O3QA 1ETXA 5JLXA 3MZYA 3FWEA 3BZKA 2OQRA 1U9OA 3S15J 2A5WA 2XB5A 3CDIA 2D5VA 2QCOA 3S1MJ 2MC4A 4UXNA 5IT9K 1U78A 3GEZA 4HF1A 1R5ID 2QQ9A 3I4PA 4CXFA 4XRMA 3L2RA 3ZMSA 1MBJA 2MH2A 3HTUA 1T38A 4EATA 2COMA 2VKVA 2XKPA 1MMSA 4W97A 2Q8KA 3P9IA 3W2AA 3PQKA 1FOWA 1F43A 3F6VA 2OZ6A 3DPTA 3FDYA 2ZJQF 3VDXA 4IHYA 2FQ4A 2R7XA 1Z77A 1S7EA 3MN2A 3JAMK 4A5NA 3VSKA 2HXOA 3H9GA 5FRMA 1YITI 5K7FA 4Y13A 1GV2A 5D6FA 2R93J 3AG1H 5IOZA 1NG6A 3HKZN 4M6XA 3I55I 1Y8RB 1I3QJ 2BVMA 2BY3A 3EETA 4EJOA 4Q47A 1S3JA 1BR2A 3OOUA 4KIBA 5LBQA 1OYWA 1Z9CA 5L3DA 2GIVA 2PMZN 3GTPJ 4R8HA 4AU7A 2E1OA 2FOKA 5IYBJ 2W84A 3BTLA 3HGGA 5BOXA 2HQRA 3GLLA 4J19A 1SFXA 2EINH 3T5XA 1XSDA 4A3BJ 2W4SA 1I1GA 3U21A 1SAUA 4E4HA 1Y8QB 1VFCA 2RGVA 1MBFA 2O5RA 4ENMA 3BQZA 5EEHA 2XVCA 4UB8C 3GFIA 5FJ8J 2GA1A 2GZWA 3BR0A 5K5OA 5IP7J 1LEBA 3E6DA 2LKSA 3HGYA 2PI0A 1R4NB 4LMYA 2WAQN 3MFKA 4XBFA 1FC3A 3KLOA 2VOOA 2OTLI 4BBRJ 4LIUA 5M5WJ 3DTEA 3SJMA 1YI2I 4PJ0C 4AVPA 2ME0A 3SFIA 1RC9A 2GBYA 2L3DA 2X6OA 1FOXA 4KITB 2EQRA 3DQVC 1OCZH 5HLHA 2PFBA 5ED4A 2V1UA 2R4GA 3ZRGA 1IN8A 1LVAA 1W5SA 2OAZA 2XAFA 4CHUA 2QSGX 4EM1A 2HPIA 5M3MJ 4YFNF 5E79C 4N9HA 2FXAA 1A6QA 1VNDA 4GCVA 2CQKA 1YX5A 1Z21A 1SVLA 3QP6A 2IGNA 4CYCB 1EH7A 4L9TA 4XN3A 4LD5A 2IAIA 4WWCA 4XICA 4D1QA 2FOWA 4L5IA 2HXIA 2NVQJ 1Z67A 2NOJB 3LQQA 3CCMI 4E7JA 1ETYA 2OC6A 3M1CA 4J00A 2XPUA 3D0SA 2KLOA 2FF4A 2F48A 1NH3A 3RYRA 1DUXC 4YEJA 2F5VA 2CJJA 5ICCA 1WJFA 1HW1A 5D8KB 1G2HA 2VQHA 1FMVA 2LTPA 2E71A 2B0LA 3HOSA 2Y0SN 3RTRA 1DQUA 2KL4A 1ZELA 1W7PA 2Y0MA 3JSOA 4FISA 1TT5B 5KVRA 2R7ZJ 4RB2C 2EFQA 1SVMA 1UG2A 1BC7C 3IWFA 4KJZA 1Z7LA 3L2WA 4C2UA 4IRHA 3EYIA 4XLHA 4S05A 3R61A 4YIIA 1F36A 3SZGA 2X48A 2X85A 3J81Z
chains in the Genus database with same CATH topology
1B8IB 4AC0A 2E2IJ 4X6AJ 3S2DJ 3H0GJ 5M3FJ 3FK7A 5BNGA 2O7OA 3IH2A 1B8IA 1GT0C 1BL0A 1IG7A 1WI3A 1JUPA 4G12A 3BR3A 1QVTA 4XRSA 3RKQA 2DMUA 2K9SA 2WV1A 5FKNA 4XRSG 3GTOJ 3JRCA 4M3GA 4C3IJ 1RPWA 4QIWN 2DA3A 3HOZJ 2CQQA 1MBGA 4A3CJ 1JGGA 2H8RA 1BJZA 2HYJA 1TWFJ 1MSEC 2E2JJ 3GTGJ 4C3JJ 3PO2J 3LSPA 1Y1VJ 3I4MJ 1OCPA 5J1UA 1TWGJ 2R5ZA 1XS9A 4D5CA 1AKHB 2JN6A 2E19A 1B72A 2JK3A 3S2HJ 5EGOA 2DA6A 3MVPA 1AKHA 4M3DA 2L0KA 3S14J 3RZDJ 1VI0A 3JRIA 2Y2ZA 5C3EJ 3I4NJ 3Q0UA 2DMTA 3GTJJ 1A5JA 3BG3A 5FKLA 2NOGA 2HOTA 1P7IA 3BG9A 4D7MA 1JT6A 4JX4A 1RR7A 2HQ5A 2XRLA 2EBIA 2LP0A 4L5EA 2LK2A 3TW6A 2DA5A 5FKOA 4V2GA 1JKRC 2EZKA 2XPWA 5EEAA 5J1YA 4A3EJ 2DN0A 2YS9A 4A93J 5F1JA 4DYQA 4M3EA 2ECBA 3BT9A 1HCRA 1E3OC 3S1QJ 4MO7A 1OFCX 3B6CA 3MKLA 1UHSA 1ETOA 1IC8A 3D1NI 3K7AJ 4ABZA 2NVXJ 5C44J 1APLC 4DZJA 4XIDA 4MIMA 3ZQIA 1X58A 2OPTA 5GPAA 2O9LA 3K2AA 4MFDA 3TW7A 3IV5A 1P7JA 1JJ8C 4EEFG 2X9DA 3JR9A 1R9TJ 3HB9A 5M5XJ 4A3MJ 1JKOC 3G1MA 1TWHJ 3GTQJ 2ECCA 4BY7J 1JKPC 2HDDA 3HOVJ 5C4XJ 3F0CA 3HEFA 1ZGWA 2DMPA 4A3DJ 3DCFA 5M5YJ 4D7NA 3OIOA 1PUFB 4X1EA 5E3NA 3HOWJ 4XK4A 4QTRA 2CUFA 3LSRA 5E3MA 5C4JJ 2ELKA 5J3LA 2Y9ZA 3LOCA 1BA5A 3E7LA 2QF7A 1IUFA 2Y9YA 2KDZA 5IYCJ 2K9QA 1GV5A 1JUMA 1DU0A 1JTYA 1HOMA 2ID6A 2KT0A 5EZGA 5F0HA 4IHVA 2JA7J 1WCMJ 4CYCA 2HOSA 1OCTC 1SANA 3Q0WA 3M3YJ 1YRNB 3TP3A 4A3IJ 4BBSJ 3A01A 1ITYA 2R0QC 1LFUP 1RESA 4B4CA 2R92J 2RAEA 2VKEA 3BR1A 3GTMJ 1TWAJ 2H1KA 1O4XA 2EZIA 4A3GJ 1IV6A 4QSHA 3HDDA 1RKWA 2EZHA 4AYBN 1GDTA 2IBDA 4A3LJ 2I10A 4RDUA 1ZR2A 3M4OJ 2WB1N 3BTIA 2VUMJ 5FLVA 3O8GA 4DYRA 1FTZA 3SDGA 2GLOA 3UKGA 1MSFC 1ZKGA 1JKQC 2Y30A 1FJLA 1LE8B 5IP6A 4RBOA 3ZQCA 2L7ZA 1Y1WJ 1K83J 1FIAA 3LNQA 1MBKA 3A02A 3ZQLA 1Q1VA 1NK2P 3OSFA 1H8AC 3S17J 2LR8A 3BR2A 2M8GX 3JRFA 3BR6A 1W0UA 2DA1A 3ZQFA 3VPRA 5GPCA 4GFBA 5IPAA 2NS7A 3GBGA 4D5FA 4DW6A 4FTHA 4V2FA 5GP9A 3LSGA 3FK6A 2N8GA 4I76A 5IP9J 1T33A 1TWCJ 5IOYA 1IDYA 1PUFA 5F08A 5E3LA 3G1LA 3G1OA 5EG0A 4JX6A 5EGOB 2G0EA 5EYRA 4B3AA 3QPSA 1T56A 1GUUA 3JREA 5J1RA 1VF9A 4BKXA 3BG5A 3IH3A 2MGQA 3C2BA 4JX5A 5HODA 1IGNA 4B1RA 3GTKJ 4A69C 3CQZJ 2MG4A 1XC5A 2AHQA 2MSYA 1DU6A 3PM1A 1B72B 2O8KA 1HDPA 4M3FA 3Q3SA 2XGEA 3BR5A 4UUTA 3O8HA 2HI3A 4NDLA 2LLKA 4FE7A 1QVUA 3PO3J 2NS8A 3BTCA 2NVTJ 2GM4A 4IHWA 3CCYA 4Y52J 4C3HJ 2CU7A 1POGA 1FTTA 1JT0A 2HOAA 5F04A 5FKKA 5K7ZA 3FKIJ 2YU9J 1H88C 2JA8J 4DZPA 3GTLJ 2R5YA 1JJ6C 2JA6J 3JRAA 4UUSA 4A3KJ 4LOCA 3BQYA 3HOYJ 3TP0A 3W6VA 4UUSB 2L7FP 5EDNA 1WPKA 3S1NJ 4AUXA 2R5ZB 2JJ7A 2JWTA 2DMQA 1X2NA 3QQAA 4FE4A 2FX0A 2TRTA 3HBLA 1HF0A 3CDLA 5F27A 2K40A 5EG0B 3FIWA 1ZR4A 2M0CA 3FISA 4FCYA 4IHXA 1ETXA 3BTJA 5JLXA 2M34A 1U9OA 3B6AA 3S15J 2OF7A 2EZLA 2XB5A 3TEDA 2D5VA 2QCOA 3S1MJ 1HDDC 1ETKA 4S0HB 1U78A 2XGDA 5IYDJ 1ETWA 4C2MJ 3LSJA 3S1RJ 4XRMA 4MLOA 1WGXA 2MW8A 2FD5A 1RKTA 4BXXJ 1MBJA 3ZQHA 3H3VK 2VKVA 2E2HJ 4W97A 2XGCA 3QPLA 1I6HJ 1F43A 2ZB9A 3WHCA 4IHYA 2VI6A 2FQ4A 1MH4A 1Z77A 2EH3A 1W0TA 1S7EA 3MN2A 3ZQGA 4DYCA 2XPVA 3HM5A 1TC3C 4M3BA 2HXOA 2NVYJ 5K7FA 2LFBA 1GV2A 1SFOJ 1EF4A 2R93J 5FKMA 5IOZA 1CQTA 1ETQA 3HKZN 1LFBA 2ME6A 1OJLA 1I3QJ 2DTZA 2VPRA 4MFEA 1X2MA 1BW5A 2L9RA 3OOUA 4M6VA 3HOXJ 1JTXA 2PMZN 1HLVA 3GTPJ 2CUEA 3A01B 2E1OA 5IYBJ 5EF6A 3BTLA 1FEXA 1RETA 3HGGA 2COBA 1ZTRA 4J19A 3Q0VA 1A6IA 4A3BJ 1VFCA 2DA2A 9ANTA 1MBFA 1LE8A 3BQZA 5FLMJ 5FJ8J 2ID3A 3BR0A 1WH5A 1Z0XA 1ENHA 5IP7J 1AHDP 2DA7A 3OSGA 3HGYA 3WHBA 2WAQN 1NK3P 3S16J 4JYKA 5E3OA 2TCTA 2JA5J 1XG1A 4BBRJ 5M5WJ 3L1PA 3SJMA 2CRGA 2ME0A 2LY9A 2L7MP 3IH4A 3SFIA 3A03A 2GBYA 2X6OA 5F0CA 2EQRA 4BY1J 3CMYA 1QPIA 1MNMC 3RZOJ 2M2EA 1U8BA 5K7HA 3ZOBA 1ZQ3P 5M3MJ 1JUSA 2DA4A 3RQIA 5F0FA 1VNDA 1BW6A 2LD5A 2YUSA 2XB0X 2CQXA 1H89C 1ZK8A 4CYCB 2DMNA 2AO9A 1NTCA 2IAIA 2P81A 4IEJA 4JP0A 5DTDA 4XICA 1YRNA 2HXIA 3JRGA 2NVQJ 5EZHA 1ETVA 1MBEA 4Y7NJ 1ETYA 2W48A 4HNVA 2XPUA 4W1UA 3JRBA 1AU7A 2IEKA 1K61A 1U9NA 1GVDA 2CJJA 2R5YB 1IRZA 2JMWA 1IDZA 3HOUJ 2M9HA 1D5YA 1G2HA 2LTPA 1QRYA 3NARA 3DEWA 2Y0SN 3NAUA 2FJ1A 5JLWA 4A3JJ 1I50J 2LVSA 2XSDC 1FIPA 1WH7A 4A3FJ 1MBHA 1MH3A 5DS9A 3JRHA 2K9NA 3JRDA 1IJWC 4FISA 4I6ZA 2R7ZJ 2Y31A 1UG2A 2B63J 1ORKA 2DJNA 2LKXA 1F36A 2X48A 1UMQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1B8I B;  4AC0 A;  2E2I J;  4X6A J;  3S2D J;  3H0G J;  5M3F J;  3FK7 A;  5BNG A;  2O7O A;  3IH2 A;  1B8I A;  1GT0 C;  1BL0 A;  1IG7 A;  1WI3 A;  1JUP A;  4G12 A;  3BR3 A;  1QVT A;  4XRS A;  3RKQ A;  2DMU A;  2K9S A;  2WV1 A;  5FKN A;  4XRS G;  3GTO J;  3JRC A;  4M3G A;  4C3I J;  1RPW A;  4QIW N;  2DA3 A;  3HOZ J;  2CQQ A;  1MBG A;  4A3C J;  1JGG A;  2H8R A;  1BJZ A;  2HYJ A;  1TWF J;  1MSE C;  2E2J J;  3GTG J;  4C3J J;  3PO2 J;  3LSP A;  1Y1V J;  3I4M J;  1OCP A;  5J1U A;  1TWG J;  2R5Z A;  1XS9 A;  4D5C A;  1AKH B;  2JN6 A;  2E19 A;  1B72 A;  2JK3 A;  3S2H J;  5EGO A;  2DA6 A;  3MVP A;  1AKH A;  4M3D A;  2L0K A;  3S14 J;  3RZD J;  1VI0 A;  3JRI A;  2Y2Z A;  5C3E J;  3I4N J;  3Q0U A;  2DMT A;  3GTJ J;  1A5J A;  3BG3 A;  5FKL A;  2NOG A;  2HOT A;  1P7I A;  3BG9 A;  4D7M A;  1JT6 A;  4JX4 A;  1RR7 A;  2HQ5 A;  2XRL A;  2EBI A;  2LP0 A;  4L5E A;  2LK2 A;  3TW6 A;  2DA5 A;  5FKO A;  4V2G A;  1JKR C;  2EZK A;  2XPW A;  5EEA A;  5J1Y A;  4A3E J;  2DN0 A;  2YS9 A;  4A93 J;  5F1J A;  4DYQ A;  4M3E A;  2ECB A;  3BT9 A;  1HCR A;  1E3O C;  3S1Q J;  4MO7 A;  1OFC X;  3B6C A;  3MKL A;  1UHS A;  1ETO A;  1IC8 A;  3D1N I;  3K7A J;  4ABZ A;  2NVX J;  5C44 J;  1APL C;  4DZJ A;  4XID A;  4MIM A;  3ZQI A;  1X58 A;  2OPT A;  5GPA A;  2O9L A;  3K2A A;  4MFD A;  3TW7 A;  3IV5 A;  1P7J A;  1JJ8 C;  4EEF G;  2X9D A;  3JR9 A;  1R9T J;  3HB9 A;  5M5X J;  4A3M J;  1JKO C;  3G1M A;  1TWH J;  3GTQ J;  2ECC A;  4BY7 J;  1JKP C;  2HDD A;  3HOV J;  5C4X J;  3F0C A;  3HEF A;  1ZGW A;  2DMP A;  4A3D J;  3DCF A;  5M5Y J;  4D7N A;  3OIO A;  1PUF B;  4X1E A;  5E3N A;  3HOW J;  4XK4 A;  4QTR A;  2CUF A;  3LSR A;  5E3M A;  5C4J J;  2ELK A;  5J3L A;  2Y9Z A;  3LOC A;  1BA5 A;  3E7L A;  2QF7 A;  1IUF A;  2Y9Y A;  2KDZ A;  5IYC J;  2K9Q A;  1GV5 A;  1JUM A;  1DU0 A;  1JTY A;  1HOM A;  2ID6 A;  2KT0 A;  5EZG A;  5F0H A;  4IHV A;  2JA7 J;  1WCM J;  4CYC A;  2HOS A;  1OCT C;  1SAN A;  3Q0W A;  3M3Y J;  1YRN B;  3TP3 A;  4A3I J;  4BBS J;  3A01 A;  1ITY A;  2R0Q C;  1LFU P;  1RES A;  4B4C A;  2R92 J;  2RAE A;  2VKE A;  3BR1 A;  3GTM J;  1TWA J;  2H1K A;  1O4X A;  2EZI A;  4A3G J;  1IV6 A;  4QSH A;  3HDD A;  1RKW A;  2EZH A;  4AYB N;  1GDT A;  2IBD A;  4A3L J;  2I10 A;  4RDU A;  1ZR2 A;  3M4O J;  2WB1 N;  3BTI A;  2VUM J;  5FLV A;  3O8G A;  4DYR A;  1FTZ A;  3SDG A;  2GLO A;  3UKG A;  1MSF C;  1ZKG A;  1JKQ C;  2Y30 A;  1FJL A;  1LE8 B;  5IP6 A;  4RBO A;  3ZQC A;  2L7Z A;  1Y1W J;  1K83 J;  1FIA A;  3LNQ A;  1MBK A;  3A02 A;  3ZQL A;  1Q1V A;  1NK2 P;  3OSF A;  1H8A C;  3S17 J;  2LR8 A;  3BR2 A;  2M8G X;  3JRF A;  3BR6 A;  1W0U A;  2DA1 A;  3ZQF A;  3VPR A;  5GPC A;  4GFB A;  5IPA A;  2NS7 A;  3GBG A;  4D5F A;  4DW6 A;  4FTH A;  4V2F A;  5GP9 A;  3LSG A;  3FK6 A;  2N8G A;  4I76 A;  5IP9 J;  1T33 A;  1TWC J;  5IOY A;  1IDY A;  1PUF A;  5F08 A;  5E3L A;  3G1L A;  3G1O A;  5EG0 A;  4JX6 A;  5EGO B;  2G0E A;  5EYR A;  4B3A A;  3QPS A;  1T56 A;  1GUU A;  3JRE A;  5J1R A;  1VF9 A;  4BKX A;  3BG5 A;  3IH3 A;  2MGQ A;  3C2B A;  4JX5 A;  5HOD A;  1IGN A;  4B1R A;  3GTK J;  4A69 C;  3CQZ J;  2MG4 A;  1XC5 A;  2AHQ A;  2MSY A;  1DU6 A;  3PM1 A;  1B72 B;  2O8K A;  1HDP A;  4M3F A;  3Q3S A;  2XGE A;  3BR5 A;  4UUT A;  3O8H A;  2HI3 A;  4NDL A;  2LLK A;  4FE7 A;  1QVU A;  3PO3 J;  2NS8 A;  3BTC A;  2NVT J;  2GM4 A;  4IHW A;  3CCY A;  4Y52 J;  4C3H J;  2CU7 A;  1POG A;  1FTT A;  1JT0 A;  2HOA A;  5F04 A;  5FKK A;  5K7Z A;  3FKI J;  2YU9 J;  1H88 C;  2JA8 J;  4DZP A;  3GTL J;  2R5Y A;  1JJ6 C;  2JA6 J;  3JRA A;  4UUS A;  4A3K J;  4LOC A;  3BQY A;  3HOY J;  3TP0 A;  3W6V A;  4UUS B;  2L7F P;  5EDN A;  1WPK A;  3S1N J;  4AUX A;  2R5Z B;  2JJ7 A;  2JWT A;  2DMQ A;  1X2N A;  3QQA A;  4FE4 A;  2FX0 A;  2TRT A;  3HBL A;  1HF0 A;  3CDL A;  5F27 A;  2K40 A;  5EG0 B;  3FIW A;  1ZR4 A;  2M0C A;  3FIS A;  4FCY A;  4IHX A;  1ETX A;  3BTJ A;  5JLX A;  2M34 A;  1U9O A;  3B6A A;  3S15 J;  2OF7 A;  2EZL A;  2XB5 A;  3TED A;  2D5V A;  2QCO A;  3S1M J;  1HDD C;  1ETK A;  4S0H B;  1U78 A;  2XGD A;  5IYD J;  1ETW A;  4C2M J;  3LSJ A;  3S1R J;  4XRM A;  4MLO A;  1WGX A;  2MW8 A;  2FD5 A;  1RKT A;  4BXX J;  1MBJ A;  3ZQH A;  3H3V K;  2VKV A;  2E2H J;  4W97 A;  2XGC A;  3QPL A;  1I6H J;  1F43 A;  2ZB9 A;  3WHC A;  4IHY A;  2VI6 A;  2FQ4 A;  1MH4 A;  1Z77 A;  2EH3 A;  1W0T A;  1S7E A;  3MN2 A;  3ZQG A;  4DYC A;  2XPV A;  3HM5 A;  1TC3 C;  4M3B A;  2HXO A;  2NVY J;  5K7F A;  2LFB A;  1GV2 A;  1SFO J;  1EF4 A;  2R93 J;  5FKM A;  5IOZ A;  1CQT A;  1ETQ A;  3HKZ N;  1LFB A;  2ME6 A;  1OJL A;  1I3Q J;  2DTZ A;  2VPR A;  4MFE A;  1X2M A;  1BW5 A;  2L9R A;  3OOU A;  4M6V A;  3HOX J;  1JTX A;  2PMZ N;  1HLV A;  3GTP J;  2CUE A;  3A01 B;  2E1O A;  5IYB J;  5EF6 A;  3BTL A;  1FEX A;  1RET A;  3HGG A;  2COB A;  1ZTR A;  4J19 A;  3Q0V A;  1A6I A;  4A3B J;  1VFC A;  2DA2 A;  9ANT A;  1MBF A;  1LE8 A;  3BQZ A;  5FLM J;  5FJ8 J;  2ID3 A;  3BR0 A;  1WH5 A;  1Z0X A;  1ENH A;  5IP7 J;  1AHD P;  2DA7 A;  3OSG A;  3HGY A;  3WHB A;  2WAQ N;  1NK3 P;  3S16 J;  4JYK A;  5E3O A;  2TCT A;  2JA5 J;  1XG1 A;  4BBR J;  5M5W J;  3L1P A;  3SJM A;  2CRG A;  2ME0 A;  2LY9 A;  2L7M P;  3IH4 A;  3SFI A;  3A03 A;  2GBY A;  2X6O A;  5F0C A;  2EQR A;  4BY1 J;  3CMY A;  1QPI A;  1MNM C;  3RZO J;  2M2E A;  1U8B A;  5K7H A;  3ZOB A;  1ZQ3 P;  5M3M J;  1JUS A;  2DA4 A;  3RQI A;  5F0F A;  1VND A;  1BW6 A;  2LD5 A;  2YUS A;  2XB0 X;  2CQX A;  1H89 C;  1ZK8 A;  4CYC B;  2DMN A;  2AO9 A;  1NTC A;  2IAI A;  2P81 A;  4IEJ A;  4JP0 A;  5DTD A;  4XIC A;  1YRN A;  2HXI A;  3JRG A;  2NVQ J;  5EZH A;  1ETV A;  1MBE A;  4Y7N J;  1ETY A;  2W48 A;  4HNV A;  2XPU A;  4W1U A;  3JRB A;  1AU7 A;  2IEK A;  1K61 A;  1U9N A;  1GVD A;  2CJJ A;  2R5Y B;  1IRZ A;  2JMW A;  1IDZ A;  3HOU J;  2M9H A;  1D5Y A;  1G2H A;  2LTP A;  1QRY A;  3NAR A;  3DEW A;  2Y0S N;  3NAU A;  2FJ1 A;  5JLW A;  4A3J J;  1I50 J;  2LVS A;  2XSD C;  1FIP A;  1WH7 A;  4A3F J;  1MBH A;  1MH3 A;  5DS9 A;  3JRH A;  2K9N A;  3JRD A;  1IJW C;  4FIS A;  4I6Z A;  2R7Z J;  2Y31 A;  1UG2 A;  2B63 J;  1ORK A;  2DJN A;  2LKX A;  1F36 A;  2X48 A;  1UMQ A; 
#chains in the Genus database with same CATH topology
 3F9K A;  2LH9 A;  1VQO I;  1B8I B;  3K0L A;  5M3F J;  2L9S A;  5BNG A;  3R6S A;  2O7O A;  3WTZ A;  5KAF C;  1BC8 C;  3HHG A;  2LF8 A;  3MKZ A;  3G4S I;  4DOZ A;  3BR3 A;  1KU9 A;  4ZJZ A;  1FX7 A;  2JPC A;  4XRS G;  5LFA A;  1BI3 A;  1DP3 A;  2AXL A;  3GUD A;  4M3G A;  2Q2E B;  4FX4 A;  3GZN B;  2XF7 A;  1DP7 P;  3SZP A;  4I02 A;  4F92 B;  1BJZ A;  4XLA A;  4Y3O A;  3B73 A;  1XN7 A;  2EB7 A;  1BIB A;  1XB4 A;  2PMU A;  2DFF A;  3LSP A;  3I4M J;  1OCP A;  4UVC A;  5J1U A;  2KHM A;  4S04 A;  4B47 A;  1OMI A;  1GXP A;  3S2H J;  3BWG A;  3MVP A;  1YJW I;  2X0L A;  1UHM A;  2LRD A;  2ZXJ A;  1ZN2 A;  1USS A;  4HW0 A;  1P6R A;  2EV0 A;  1EH8 A;  2Y2Z A;  2ZSH B;  3HRT A;  2DU9 A;  2HDW A;  3Q9S A;  1BIA A;  1I39 A;  3B02 A;  1BN5 A;  4E6K G;  1P7I A;  4H4K C;  4I2O A;  1T98 A;  1RR7 A;  1IN7 A;  5LGT A;  4KIG A;  2J5O A;  2MLG A;  1HSJ A;  5LHG A;  3TW6 A;  3GO5 A;  2E60 A;  1D8J A;  5FKO A;  3V8K A;  4IRI A;  2EZK A;  2R7V A;  3CCQ I;  1PJR A;  1LEA A;  2DN0 A;  4D9J A;  1YTY A;  4FQG A;  2CSO A;  1SD5 A;  1HCR A;  2DPU A;  3J7Y J;  3KYC B;  4QLC U;  4HST A;  4NHJ A;  4PSW A;  1IC8 A;  3F23 A;  4KA4 A;  2QBY B;  3QWL A;  4F7Z A;  1APL C;  1XTA A;  1OCR H;  3CDH A;  2NRA C;  1FBU A;  3ZQI A;  2QBY A;  2EPF A;  2OPT A;  2IW5 A;  2ZJ2 A;  3K2A A;  1ZG5 A;  5TGT A;  1J5Y A;  4BHB A;  1UST A;  1P7J A;  4BUP A;  1A04 A;  3DEE A;  4BJ5 C;  1JJ8 C;  2KDO A;  3MQ0 A;  4N0B A;  1A31 A;  3ZQ7 A;  5AIP A;  4XLC A;  2X9D A;  5M5X J;  3S2W A;  1K6O A;  1S8N A;  3V4G A;  3G1M A;  3GTQ J;  2ECC A;  3CCL I;  2X4H A;  1LNW A;  2LOO A;  5J40 A;  3IHU A;  4N4N B;  4BQN A;  4AYB A;  3F0C A;  3HEF A;  3K10 A;  3ZMV A;  4BHC A;  1MMA A;  5M5Y J;  2IVM A;  1P2F A;  2E1N A;  3TQN A;  5L3E A;  5HLI A;  1IUY A;  5CQE A;  1FYM A;  1HKT A;  2HWV A;  4D7N A;  3R4K A;  4NB5 A;  4G6Q A;  1R6R A;  4C9Y A;  3HRM A;  1PUF B;  4X1E A;  3CCR I;  1D0Y A;  1S7O A;  2O8X A;  4DGW B;  4ZTF A;  3LSR A;  3ERM A;  4PGH A;  1O7F A;  3JW4 A;  5C4J J;  2JT1 A;  1HBX G;  3A2K A;  1V5F A;  2ZSI B;  5J3L A;  3T8T A;  5DM6 F;  1TQP A;  2ACJ A;  4I0B A;  3M1E A;  4HRI A;  4KNY A;  2K9Q A;  1YHQ I;  1DU0 A;  2ID6 A;  3N4M A;  2JZY A;  2VT3 A;  1LDJ A;  3O2P E;  4GYG A;  2XAJ A;  4CYC A;  2WAF A;  2M7A A;  1SAN A;  3Q0W A;  1YRN B;  4BYY A;  4HNU A;  2CV1 A;  1V4R A;  1FT9 A;  4B4C A;  5CVR A;  3F8B A;  3FM3 A;  3HG9 A;  3E1S A;  4EJT A;  3CP2 A;  1O4X A;  3A1Y A;  2EA4 A;  2EZI A;  4P55 A;  3U1K A;  3IP4 B;  4P5O A;  4AD9 A;  4A3G J;  2IS2 A;  3GW2 A;  4HLX A;  4QSH A;  2EK5 A;  2CO5 A;  2YX7 A;  4I7H A;  2FBK A;  2IBD A;  4NQW A;  2F5C A;  4A3L J;  2I10 A;  4RDU A;  3CUQ C;  2WB1 N;  2QYO A;  3BTI A;  1XSX A;  3DWL E;  2ESN A;  3OL3 A;  2VUM J;  2VLA A;  5FO5 A;  3SDG A;  4PK4 A;  3MZH A;  1MSF C;  3ZPL A;  3H9Q A;  1JKQ C;  2GOX B;  2G7U A;  1R00 A;  2Y30 A;  4II2 A;  1FP2 A;  3VFZ A;  5JFR A;  3H0D A;  1U5T A;  2L7Z A;  1Y1W J;  2VBZ A;  3OYB A;  3GVA A;  4XKV A;  1LQ1 A;  1HW2 A;  3HSE A;  4KYW A;  2R7O A;  1YE9 A;  3ABL H;  3AG3 H;  4B43 A;  3S17 J;  4UB6 C;  2M8G X;  4QWQ A;  4ZC3 A;  3JRF A;  3L2U A;  5KHD A;  3LWF A;  3VPR A;  4GFB A;  1QZY A;  3P5J A;  3FXR A;  3L9F A;  2ZO4 A;  3H3U A;  1OR7 C;  3GBG A;  5DUK A;  1YIJ I;  2DOA A;  4MGR A;  4HEA 2;  1MJA A;  3KEQ A;  4G94 A;  1VQ5 I;  2BW3 B;  4BAY A;  3QPH A;  2E7W A;  1TTY A;  2R7F A;  5IP9 J;  3Q5F A;  1OYI A;  2TDX A;  5D5X B;  1YJ9 I;  4P1W A;  5J6X A;  1T2K A;  5CVV A;  3WE3 A;  5F08 A;  1T0F C;  1XMK A;  1I27 A;  5EG0 A;  3TKY A;  4JX6 A;  4GXO A;  1ZGJ A;  1MW7 A;  2NAZ A;  2VQG A;  1W36 C;  3HKZ A;  1X4O A;  3OYG A;  1GUU A;  1LPQ A;  2Y75 A;  3JRE A;  4Q5S F;  1D0Z A;  5J1R A;  1MZB A;  2IA0 A;  3RI4 A;  4ON0 A;  2NNY A;  4ZYD A;  3IH3 A;  4AIJ A;  3P9K A;  2MGQ A;  4B1R A;  1D5V A;  2MG4 A;  1DDN A;  2ZNZ A;  2ZJR F;  2K85 A;  4HQM A;  4A6D A;  1JGS A;  1B72 B;  2O8K A;  2IJL A;  3E5U A;  4JQF A;  4M3F A;  4EM0 B;  1KQ0 A;  3FXQ A;  4YFX F;  4Z6Y A;  4UUT A;  2XDV A;  4IOA F;  3JSP A;  3VYU B;  2UWM A;  1J59 A;  1ZRE A;  2XC7 A;  2VPL A;  3D5L A;  1T8I A;  5L3G A;  3SQN A;  2GM4 A;  4IHW A;  2HU9 A;  5B1B H;  1AWC A;  4Y52 J;  1SD7 A;  2QZ8 A;  3WGG A;  3OYJ A;  3O3K A;  4HG2 A;  5F04 A;  3FKI J;  4XSX F;  5AON A;  2PLY A;  3JTG A;  1PDN C;  2YU9 J;  1H88 C;  2JA8 J;  1X1D A;  3E5X A;  1JJ6 C;  1MIJ A;  2ETH A;  4IVN A;  1UG0 A;  1MKM A;  2IPQ X;  4LLG F;  3KEO A;  3JRA A;  4KUM A;  2UV1 A;  2ELJ A;  1RR8 C;  4LOC A;  3CP8 A;  4RS8 A;  3ECH A;  3K69 A;  1D1B A;  1DPR A;  2L7F P;  3WG9 A;  5GAE J;  1WJ5 A;  6PAX A;  3OYM A;  3K9T A;  3RIR A;  2R5Z B;  1VTN C;  4WX9 A;  2JWT A;  1TT0 A;  4L9N A;  4CSW A;  1P4A A;  3DKW A;  1ZRF A;  1S9H A;  3DBR B;  4FE4 A;  1QZE A;  2TRT A;  3HBL A;  5DCM B;  1YW9 A;  3L2Q A;  3OWT A;  3FIW A;  4M9Z A;  3IRQ A;  1OYY A;  3LST A;  1JI8 A;  2BZT A;  4IHX A;  2XAH A;  2M34 A;  3AL0 B;  3RPQ A;  3B6A A;  4IRG A;  1F1Z A;  1MGT A;  2HPM A;  5H6R A;  3PL8 A;  3TED A;  4CIC A;  3EUH C;  1Z05 A;  4BJ6 C;  5JHU A;  2KJC A;  2M3A A;  1ETW A;  5E1X A;  4LB6 B;  3ZP5 A;  1BI0 A;  2G7H A;  3RKY A;  2GXB A;  4XSZ F;  4Y17 A;  3H3V K;  2E2H J;  2L02 A;  1ON1 A;  2XGC A;  3HPG A;  3QPL A;  4HPQ A;  1I6H J;  1QPM A;  4KN4 X;  1SFU A;  2DDA A;  3WHC A;  2VI6 A;  1U8R A;  3C7J A;  3PUF A;  3REO A;  3NWS A;  1U6G A;  2VXD A;  4DYC A;  3OOP A;  2XPV A;  3HM5 A;  1TC3 C;  2CW7 A;  2YR2 A;  4EJV A;  2OJE D;  3PSI A;  1X4P A;  2W1O A;  1ETQ A;  4ANJ A;  1G8X A;  3CC7 I;  2VPR A;  3DEU A;  2FBI A;  2I5U A;  1X2M A;  1FBS A;  2M45 A;  3PIP F;  2LC2 A;  3QP5 A;  3HOX J;  3CO7 C;  2PMH A;  2KIU A;  1SMY F;  2M4K A;  4OWR B;  2CUE A;  3WTY C;  3GCM A;  3A01 B;  3I56 I;  2MFZ A;  3DV8 A;  1Z91 A;  1MD0 A;  1FEX A;  2WTE A;  4IO9 F;  2A05 A;  3M8E A;  4RB1 A;  3OIQ A;  2BYV E;  5F64 A;  3GZ6 A;  1R5H A;  1XPX A;  3A0H C;  5IY5 H;  3K1N A;  3ZXS A;  1B59 A;  1UJ8 A;  2DOE A;  1WJA A;  4RMN A;  5AIQ A;  9ANT A;  4PFO A;  2IT0 A;  1LE8 A;  1LJ9 A;  3RCO A;  1W7P B;  4YEL A;  4NC7 A;  2A3S A;  2DXI A;  4OIP F;  5LLQ A;  2ID3 A;  2Y0S A;  3BJ6 A;  1WH5 A;  3K1M A;  3OSG A;  1XMA A;  2MA3 A;  1RUO A;  4I09 A;  1VQP I;  4HYE A;  1NK3 P;  2VJJ A;  5KK1 A;  3UR3 C;  1TBX A;  4EQQ A;  2TCT A;  2HEO A;  2DI3 A;  2JA5 J;  1KU2 A;  2ZKZ A;  3L1P A;  1WHU A;  2LY9 A;  2EJR A;  2VQL A;  1ZAR A;  2RNG A;  4G9Y A;  4BY1 J;  2EWN A;  4B48 A;  1B9N A;  3GFJ A;  2B7E A;  4PCQ A;  4F52 A;  3RZO J;  4FHT A;  4XKW A;  1MND A;  4C30 A;  3ZOB A;  2P7V B;  2VJ4 A;  4BE0 A;  1ZQ3 P;  1FBQ A;  2XF6 A;  1JUS A;  2DA4 A;  3RQI A;  5LGN A;  5D5U B;  4CCL A;  5DDG A;  1B9M A;  2YUS A;  4DBR A;  1KYZ A;  2KMU A;  2KJB A;  1S6L A;  2X1D A;  3DTI A;  1ZK8 A;  1FOY A;  2V26 A;  3BP8 A;  2XAG A;  1SMT A;  5DTD A;  2GOM A;  3ESW B;  3V8J A;  5ICG A;  4H0E A;  3KLN A;  1YO5 C;  1SD4 A;  4KIS A;  1EV7 A;  2W48 A;  3MAJ A;  4MHG A;  4M74 A;  2VIX A;  3FZV A;  1FSH A;  3FM5 A;  2VAS A;  2IEK A;  2OCC H;  1K61 A;  4G7H F;  5CPR B;  4RGX A;  3DF8 A;  4DBQ A;  2R5Y B;  4Q4Z F;  2L5Q A;  5HLT A;  3HOU J;  3JCU C;  1TNS A;  1QRY A;  4XL9 A;  4CO8 A;  1U5T B;  4XLN F;  3F8F A;  2V7F A;  3DEW A;  4A3J J;  1I50 J;  2IS4 A;  1FIP A;  1FP1 D;  1WH7 A;  1ZLJ A;  3QU3 A;  3OL4 A;  4KFC A;  4A3F J;  4LJZ F;  2JUG A;  5DS9 A;  3JRH A;  3V42 A;  2K9N A;  2B9S A;  3FXO A;  1IJW C;  3AAF A;  1O3R A;  4PSX A;  1ZH5 A;  4EGZ A;  2Y31 A;  1EJ9 A;  1Y39 A;  3FMS A;  2A6E F;  2LY2 A;  3DKX A;  3OYN A;  2LKX A;  2JRM A;  3P7N A;  5K5Q A;  3F8M A;  4AC0 A;  3LA3 A;  2E2I J;  3FK7 A;  3DBH B;  1IG7 A;  5JR3 A;  1GT0 C;  1LDK B;  3GFL A;  4G12 A;  2DOF A;  1QVT A;  2GXA A;  1JXS A;  3E0J B;  3GTO J;  3L09 A;  4XOT A;  4C3I J;  2XIG A;  4QIW N;  3I5U A;  3HUG B;  2DYS H;  1STZ A;  2DA3 A;  3H1C A;  3HOZ J;  2CQQ A;  1MBG A;  2E35 A;  2HYJ A;  2ZCW A;  3GTG J;  2CW8 A;  4C3J J;  2PJR A;  3GF2 A;  3MMY B;  3QYB A;  4U0Y A;  2GIZ A;  3NEU A;  2F4O B;  1Z6R A;  2V1N A;  4ENJ A;  1TQI A;  2LBF A;  1AKH B;  3M07 A;  2JK3 A;  1RZ4 A;  4OIQ F;  2LBF B;  2DOD A;  1AKH A;  2L0K A;  2WB1 A;  4JBA A;  2Z2S B;  3LAJ A;  2XKO A;  2DMT A;  2BBY A;  3HPH A;  3IUO A;  3BG3 A;  1M1E B;  2D1H A;  1YG2 A;  1BBY A;  3KCC A;  3J7A O;  2VC0 A;  4CUG A;  5LD2 C;  2DFH A;  2L4M A;  1FWZ A;  2IGM A;  4KIC A;  3ABU A;  3DU5 A;  3LSH A;  1XDS A;  2LK2 A;  2O0Y A;  4ENK A;  1Z3Y A;  2PMZ A;  3SXY A;  2QM3 A;  5EEA A;  3S32 A;  1T95 A;  2BV6 A;  5J1Y A;  2F5D A;  4A3E J;  3EUH A;  2UXN A;  3LFK A;  3DLL F;  5BPI A;  1X1A A;  2E1M C;  5F1J A;  2MD0 A;  3IL2 A;  3BT9 A;  1OCC H;  1E3O C;  3S1Q J;  4I01 A;  4MO7 A;  1Q1H A;  2ZME B;  2F4I A;  3B6C A;  1UHS A;  4BAC A;  1U3E M;  1ETO A;  3RPU A;  2V4J C;  2O61 A;  3FKJ A;  2CMP A;  3CMA I;  3H9J A;  4MNU A;  1VQL I;  1UB9 A;  1YYV A;  5HOO A;  5DUI A;  2I8D A;  2L2O A;  2X6W A;  1X58 A;  2NS0 A;  1VQ8 I;  2ZFW A;  5GPA A;  4MFD A;  3TOA A;  3TW7 A;  2ICW G;  1MMG A;  1F9N A;  1GLN A;  3EYY A;  1PVE A;  4ZYG A;  2HDC A;  2VN2 A;  2OD5 A;  4EEF G;  3JR9 A;  1R9T J;  3HB9 A;  1BJA A;  4BJT A;  1E3P A;  4A3M J;  1JKO C;  1IXC A;  3I54 A;  1I6X A;  1R58 A;  5LGU A;  1PUE E;  4F3Q A;  1YW8 A;  1S7A A;  2LG4 A;  1F5T A;  5C4X J;  4A3D J;  2KRC A;  4OAZ A;  5IT3 A;  2Q1Z B;  1G4D A;  3K70 D;  2F2E A;  2HR3 A;  4GDF A;  4OMY A;  4CA0 A;  3VOD A;  5KNL A;  3OS1 A;  4NC6 A;  2R7S A;  5E3N A;  4P96 A;  4G7Z F;  1G59 A;  3J7A Y;  2CUF A;  4RAF A;  5E3M A;  3QYE A;  2P7C B;  2BY2 A;  2QQB A;  2FMY A;  2EIJ H;  2JQ7 A;  4G8X A;  2QF7 A;  3PUB A;  5FRO A;  1GV5 A;  4XRF A;  5B1A H;  1B1B A;  3KP4 A;  4OIO F;  5EZG A;  1QU3 A;  1YIO A;  2JA7 J;  2HOS A;  1OCT C;  2IRF G;  2WAE A;  4XOR A;  2KQR A;  3ABM H;  4BBS J;  3A01 A;  1NHA A;  1ITY A;  1K4S A;  2R0Q C;  1FMW A;  2P8T A;  1B6A A;  1F4K A;  3WG7 H;  1RES A;  1XD7 A;  5H2F C;  5JVG F;  4HLY A;  3PFI A;  3T8R A;  1UHW A;  1H9T A;  1QBJ A;  4UV8 A;  2DT5 A;  4BH9 A;  3S3N A;  5DCF A;  2NVU B;  1KON A;  5HNH A;  4RLQ A;  2XRN A;  3KE2 A;  1RKW A;  2EZH A;  4B8X A;  3CCV I;  4AYB N;  1GDT A;  3X2Q H;  2YPR A;  5D5V B;  1LB2 A;  3QRF F;  3M8F A;  2D1V A;  2KIM A;  4RB0 A;  3RYP A;  4F55 A;  4U7D A;  3H92 A;  2HOE A;  3OYI A;  4MTE A;  1DPU A;  5FLV A;  4LK1 F;  1X3U A;  2LKP A;  3O8G A;  1U0J A;  4WXH A;  2E1C A;  2GLO A;  4XOP A;  1ZKG A;  1R22 A;  3TGN A;  1MDM A;  4BNC A;  5HDK A;  4UVB A;  2KP6 A;  2HKX A;  5IP6 A;  3WU1 B;  3E3V A;  1Y0N A;  2ZXH A;  3LNQ A;  1MBK A;  3BG7 A;  3K70 C;  3H5R A;  4WF2 A;  1YS7 A;  3RQ4 A;  2KPM A;  3BR2 A;  3HHH A;  3LL7 A;  1YLF A;  4RAG A;  1W0U A;  4EVI A;  5F6F A;  2NS7 A;  4C2T A;  1SC7 A;  1KQ9 A;  4AID A;  3CF2 A;  1U2W A;  1V55 H;  3D5R C;  3FXK A;  4DW6 A;  3CCE I;  4FTH A;  1D1A A;  2HYG D;  1FSE A;  2V79 A;  2N8G A;  4OAY A;  1IRG A;  2HNH A;  2PJP A;  3S3M A;  1Z6T A;  4CCK A;  2CV2 A;  1TWC J;  2JA2 A;  4HOB A;  1X19 A;  4L9V A;  1LKX A;  2VE8 A;  3KX2 A;  2PX9 A;  3L7W A;  5E3L A;  1P4W A;  3G1O A;  1IXR C;  3N05 A;  1ONV A;  1G3Y A;  3EDP A;  5DEQ A;  3CC2 I;  4WCG A;  3NRV A;  1NG7 A;  2A68 F;  3TDU C;  2E34 A;  5TJJ A;  2QA4 I;  3OS2 A;  3WGH A;  1ODD A;  3E97 A;  5ICE A;  4L0Y B;  2D45 A;  1HQC A;  3A4C A;  3BRO A;  2L4A A;  3PSF A;  2IXS A;  3LSI A;  1IGN A;  4JX5 A;  5HOD A;  3GTK J;  2QWW A;  3GYH X;  2XUB A;  4D0P A;  2A6H F;  2FE3 A;  2HI3 A;  3ELK A;  4FE7 A;  4FAS D;  2NS8 A;  3OR1 C;  2NVT J;  2L7K A;  5FD5 A;  3K4B A;  2A07 F;  1DGW Y;  3OR2 C;  3ZQQ A;  2CU7 A;  5H6Q A;  3WE2 A;  1FTT A;  3LMM A;  4L5J A;  1E0E A;  1G3S A;  3CUQ A;  2M8E A;  3ZN0 A;  3L2C A;  5FKK A;  5K7Z A;  3VSL A;  3VYR B;  3CJT B;  1TW3 A;  4DZP A;  2K5C A;  2VB6 A;  2R5Y A;  5CJ9 A;  2HKO A;  1XCV A;  2K3P A;  1BOA A;  3TMO A;  4UUS A;  2JRT A;  3TP0 A;  3CES A;  5ILU A;  3W6V A;  3OV8 A;  5ERI A;  1K78 A;  5EDN A;  1WPK A;  4Y4R A;  3S1N J;  1GHC A;  1ZLK A;  5J4V A;  4IQJ A;  3HXL A;  1MMD A;  3CC4 I;  2WBM A;  3QQA A;  1H0M A;  2FX0 A;  4UHT A;  3VB2 A;  3FBI B;  3CDL A;  3CJQ B;  3QAH A;  5EG0 B;  1XGO A;  2K27 A;  2M0C A;  3BTJ A;  1G6N A;  4CCJ A;  2ZBK A;  3BPV A;  1I1S A;  3HC7 A;  2EZL A;  2EFP A;  1HDD C;  2HQA A;  1ETK A;  1R4M B;  1R36 A;  2FEZ A;  2OA4 A;  2HTS A;  2XGD A;  4XQF A;  4RLF A;  4HV6 A;  2IGO A;  4C2M J;  1C0W A;  2BHY A;  2VBW A;  3LSJ A;  5E1W A;  3S1R J;  1VQM I;  5HS9 A;  5FRN A;  4MLO A;  1WGX A;  1W7P D;  2MW8 A;  1RKT A;  5LHI A;  2PG4 A;  5ILS A;  4GRI A;  1N25 A;  1K7A A;  2IS6 A;  3RJP A;  4CZC A;  5HNF A;  3IKT A;  5DYM A;  2ZB9 A;  3DLA A;  4HF2 A;  2UUZ A;  2MC3 A;  2X6Y A;  1MH4 A;  2HGC A;  1D0X A;  2ADU A;  3WU2 C;  3HRS A;  5BPD A;  1W0T A;  2G9W A;  2MYS A;  3IC7 A;  2CWE A;  4O6J A;  2ZME A;  3SFZ A;  4M3B A;  2KIF A;  4HDU A;  1N75 A;  2NVY J;  3ABK H;  4MTD A;  2LFB A;  4E7I A;  2CFX A;  3ZN1 A;  1CQT A;  4E7H A;  2ME6 A;  1OJL A;  1FNN A;  2DTZ A;  3BZ6 A;  3OY9 A;  2QEN A;  4PGG A;  4KMU X;  4MFE A;  1BW5 A;  4WXD A;  4M6V A;  2DTR A;  3ML6 A;  2QGU A;  5B5E C;  1PP7 U;  1HLV A;  1HC8 A;  2VBY A;  1ZAO A;  1GXQ A;  3R0A A;  5E20 A;  1XMX A;  3OYE A;  4ZDO A;  5A2Q K;  3U9G A;  3M9A A;  2P6S A;  3FMR A;  1FYL A;  3ZR8 X;  2XRO A;  2M1B A;  1Z0X A;  3PIO F;  1ENH A;  3OS0 A;  3HOT A;  1ZG1 A;  1TNT A;  1WJB A;  2KIQ A;  3WHB A;  3S16 J;  4GGG A;  1O7L A;  4JYK A;  4M73 A;  2M7B A;  5FB2 A;  2YSR A;  1IN4 A;  3OMY A;  3IH4 A;  1J75 A;  2BW3 A;  3FHZ A;  1QPI A;  2OUM A;  4PJM A;  5K7H A;  3ONQ A;  4HX8 A;  1XGM A;  1XCB A;  3COA C;  1IV8 A;  1IAW A;  2LD5 A;  3C18 A;  3CO6 C;  1R7J A;  2FRH A;  4XR6 A;  3HRU A;  4E7S A;  3WTV C;  3ZMD A;  4IHS A;  4R1H A;  5DCM A;  2AO9 A;  3IAS 2;  3PNY A;  1NTC A;  4IEJ A;  2M5W A;  2P81 A;  2LY1 A;  1YRN A;  3MWM A;  4E7L A;  2BXY A;  3R0J A;  3JRG A;  5EZH A;  4U0V A;  4ZH4 F;  4HNV A;  2F5F A;  3MD2 A;  4LIT A;  4EGY A;  4KN7 X;  2UXX A;  4E7Z A;  2EIL H;  3JRB A;  2K9M A;  3BY6 A;  2NNN A;  4ITV A;  3KZZ A;  2YU3 A;  4N9I A;  1GVD A;  2GQQ A;  3C1D A;  3TO9 A;  1IRZ A;  4MEY F;  5LRS A;  3GWZ A;  2M9H A;  4JOM A;  1S72 I;  1D5Y A;  3NAR A;  2RKH A;  2UZK A;  3GME A;  1FYK A;  1W5C C;  1U5T C;  5D4R A;  1BOB A;  1XGN A;  5HDG A;  1FPQ A;  4A0X A;  5J8C A;  2B63 J;  3OIP A;  1UMQ A;  4IL6 C;  2EV5 A;  1E17 A;  3F8N A;  3ZMZ A;  5GAD J;  4X6A J;  1S5L C;  4IJA A;  4CYD A;  3OYH A;  1YFH A;  2O3F A;  3F21 A;  3IH2 A;  3TO7 A;  1B8I A;  1WI3 A;  1JUP A;  4OU0 A;  1RUN A;  3VWB A;  4XRS A;  1QO0 D;  3O6B B;  2Q2E A;  2IP2 A;  2FML A;  3JRC A;  2DO7 A;  5FGM A;  3FHN A;  1JHH A;  2OCE A;  3DXJ F;  2W82 A;  2LMD A;  2H6B A;  4BDY A;  1O3T A;  1K4T A;  1IN6 A;  1MSE C;  2RVC A;  3K4N A;  1ZGA A;  5DD4 A;  2ZJP F;  2E2J J;  1Y1V J;  3PO2 J;  3G3Z A;  4EMS A;  2R5Z A;  4L9J A;  1XS9 A;  1K79 A;  1CF7 A;  2AQE A;  2JN6 A;  2E19 A;  4UY8 I;  4IF4 A;  2AXT C;  4M3D A;  4MQV A;  3HL2 A;  3RZD J;  3RPU D;  3U1D A;  3JRI A;  3M8J A;  3F8C A;  3I4N J;  3KP3 A;  3K4K A;  2W24 A;  1IZ1 A;  3OYD A;  1A5J A;  2RC4 A;  3PFY A;  2HOT A;  2EIM H;  2A61 A;  4PZJ A;  1JT6 A;  2ZFU A;  2HQ5 A;  2H8W A;  3P9C A;  1OCO H;  2M87 A;  3CCS I;  3BLY A;  1WJE A;  2XRL A;  4L5E A;  2KZV A;  3TL4 X;  1KGS A;  1FLI A;  2DA5 A;  2XAU A;  1MNE A;  2FSW A;  2ZME C;  4A2U A;  2XF5 A;  1O3S A;  4V2G A;  1JKR C;  4BE2 A;  2XPW A;  1YQA A;  2OV7 A;  5FFX A;  3EUA A;  4A93 J;  2K3F A;  3SHF A;  5J47 A;  2ECB A;  1HA8 A;  3CTA A;  5DV5 A;  2CW0 F;  3M7G A;  3EPZ A;  4G6T B;  2K02 A;  3OYC A;  4ABZ A;  2NVX J;  4A0Y A;  2CUJ A;  1L0O C;  4DZJ A;  4XID A;  4MIM A;  5CKT A;  5CVJ A;  3EUK L;  5DD8 A;  2ESH A;  2RV8 A;  2H09 A;  3SZT A;  2P0W A;  5ICF A;  3ZMU A;  4BGD A;  4R79 A;  2O9L A;  1PYV A;  2H94 A;  1WI9 A;  2JPB A;  3V7S A;  3ISP A;  1W36 D;  2ZC2 A;  1LFP A;  4YFK F;  2BGC A;  2X1E A;  1KU7 A;  1SFE A;  4BY7 J;  5E8I A;  2DLL A;  2GWR A;  1B4A A;  4ZYA A;  2X51 A;  2HDD A;  1VQ6 I;  3HOV J;  3KYL A;  1ERD A;  2LSO A;  4BDZ A;  2DMP A;  3L2V A;  2C6Y A;  2FBH A;  3E6B A;  3VYT B;  4J01 A;  2OTJ I;  2EV6 A;  5KCM A;  4I98 B;  2E36 A;  4MEX F;  3OIO A;  3CUO A;  1WRJ A;  2MH9 A;  3K6G A;  4M71 A;  3HOW J;  4QTR A;  3KEY A;  1RI7 A;  4BL0 B;  3G73 A;  2E5N A;  4G6D A;  2P5L C;  3VEP A;  2ELK A;  2BE5 F;  2Y9Z A;  1BA5 A;  3E7L A;  3BDD A;  3E6M A;  1CGP A;  2Y9Y A;  2KDZ A;  5IYC J;  4WK8 F;  5DM7 F;  2KT0 A;  2KZG A;  5F0H A;  3TOB A;  4HF0 A;  1UEL B;  4F91 B;  2DQR A;  2J5P A;  2WY8 Q;  4HQE A;  3M3Y J;  4RAY A;  4BEH A;  4A3I J;  2QQ8 A;  5JHF A;  1OPC A;  2PJR B;  2R92 J;  1IRF A;  2RQQ A;  2L54 A;  2RAE A;  2VKE A;  2STT A;  2BY1 A;  4FET A;  3BR1 A;  3GTM J;  2VOP A;  3AG2 H;  3GLX A;  3F6O A;  1TWA J;  2RRE A;  1G3T A;  1HKQ A;  2PEX A;  2V6C A;  1BM9 A;  1YS6 A;  1TL8 A;  4L18 B;  1IV6 A;  1QGP A;  2CYY A;  5L3B A;  2DT7 B;  3LSM A;  4HZF A;  3BJO A;  4U87 A;  2FNP A;  2AS5 F;  5TIS C;  2K9L A;  4AIH A;  4LG0 B;  2WAD A;  5CVU A;  1QA6 A;  1KA8 A;  3HSF A;  4DIQ A;  4DYR A;  4XKC A;  3WGI A;  3WU0 A;  3UKG A;  2Z9O A;  4ZYH A;  4Y33 A;  4U88 A;  1FJL A;  3PNV A;  3IWZ A;  2BXZ A;  3ZQC A;  1FIA A;  1ZRD A;  1UZC A;  3A02 A;  1NK2 P;  3OSF A;  2LR8 A;  5K5R A;  3SYT A;  2WY7 Q;  1V54 H;  2RQP A;  1WFX A;  1YJN I;  1RRJ A;  2NXN B;  2DFE A;  1J9I A;  5IPA A;  2QQA A;  1Z3X A;  2A69 F;  5LEJ A;  4F93 B;  3OYF A;  4D5F A;  4IPA A;  3KZI C;  4LB5 A;  2L9N A;  5GP9 A;  2R7R A;  3CJN A;  1KYW A;  3SEZ A;  2QEX I;  4GO1 A;  4PJN A;  3ZMT A;  1YW7 A;  2XSJ C;  2Q0O A;  2WA0 A;  1Y56 A;  1G3W A;  3BJA A;  3JTH A;  1PUF A;  2VOD A;  3BPX A;  2IGK A;  1E2X A;  5EGO B;  5EYR A;  3J7Z I;  1J0R A;  5BS6 A;  1CF7 B;  2KRH A;  3QPS A;  1T56 A;  2R7W A;  2OQG A;  2R7D A;  1VF9 A;  1H9G A;  4BKX A;  2MD5 A;  3BG5 A;  4HAM A;  1EA3 A;  3S8P A;  3V8L A;  3GZ5 A;  3C2B A;  4IOC F;  3H35 A;  2KFD A;  3KP2 A;  3TDZ C;  3CQZ J;  3FBN B;  1IN5 A;  1XC5 A;  3CME I;  5JVT A;  1VQ9 I;  3KIO A;  1S29 A;  3Q3S A;  3HSR A;  4NDL A;  2XGX A;  2BEO A;  1QVU A;  3PO3 J;  1IO2 A;  3BTC A;  5E17 F;  3CJR B;  4K2E A;  2CFO A;  1LVK A;  4PDK A;  4UUV A;  3CCY A;  4C3H J;  4ETS A;  5D4S A;  1Y6I A;  3H3Z A;  4Z2Y A;  2WWY A;  4EM2 A;  2HOA A;  1WJD A;  3MZ8 A;  5B3S H;  3FXL A;  2CH0 A;  1HXD A;  3TO6 A;  3HTS B;  1T0F A;  4BXU A;  3GTL J;  3QOE A;  3WTX C;  3DKY A;  4RGU A;  4LFU A;  1KU3 A;  1EKE A;  2JA6 J;  2K7L A;  3WTT C;  3H5A A;  3CF5 F;  2VQC A;  2DBB A;  3BQY A;  3HOY J;  4HNT A;  1MJB A;  2GAU A;  3W2W A;  4QPQ A;  2AQF A;  2LDU A;  1W5T A;  4ASN A;  4AUX A;  1DGR M;  1TQM A;  2DPD A;  2DMQ A;  4PJL A;  1X2N A;  2X6X A;  1HF0 A;  4DJA A;  1SEU A;  5F27 A;  2K40 A;  4YG2 F;  1W4M A;  3K4C A;  1WJC A;  5D5W B;  4XLP F;  3H36 A;  3C3W A;  2VC1 A;  2OF7 A;  4KT6 A;  2XV4 S;  3I3L A;  1J2X A;  4S0H B;  4I0A A;  3PJR A;  5IYD J;  1WKM A;  2RN7 A;  2V1D A;  5L3C A;  3K2Z A;  3J80 K;  2FD5 A;  4BXX J;  3ZQH A;  2DJI A;  1HST A;  4RA2 A;  5D8L B;  2XAS A;  2O6G E;  1IXS B;  2VJI A;  3K4J A;  4ESF A;  4RGS A;  1AA7 A;  4YIR X;  2VBX A;  4FT8 A;  4M9S A;  1FZP B;  1OIS A;  2EH3 A;  2VXZ A;  3ZQG A;  2L01 A;  2W57 A;  1BI1 A;  2KIS A;  2O03 A;  5GTH C;  3VOE A;  5F1R A;  2H6C A;  3QU6 A;  1ACI A;  4RM3 A;  1SFO J;  1EF4 A;  5FKM A;  1LFB A;  3I71 A;  1R23 A;  5B66 C;  3U2R A;  1QHH D;  5H20 A;  4BQO A;  2L9R A;  5GAG J;  3ZCO A;  2A5Y B;  3PQJ A;  2JSP A;  3A0B C;  1JTX A;  4M9X A;  5LHH A;  5EF6 A;  3FF5 A;  1RET A;  2COB A;  4LLL A;  1ZTR A;  3T1B A;  3Q0V A;  1UAA A;  1A6I A;  4UV9 A;  2E1M B;  1FOK A;  3NQO A;  5BQT A;  2F4M B;  2DA2 A;  2HVS A;  2ISZ A;  4AWX B;  2Y69 H;  4LG3 A;  1RIO H;  4RAZ A;  5FLM J;  1QNT A;  5A2Q Z;  4YIF A;  1YOV B;  3D5S C;  3DP7 A;  2QKM B;  3I59 A;  2GA2 A;  1OLT A;  3F22 A;  2DA7 A;  1AHD P;  1WZ2 A;  3W6K B;  3DU6 A;  3S93 A;  4B09 A;  1R71 A;  4AIK A;  2IA1 A;  2BY0 A;  3TBI A;  5J4Y A;  5E3O A;  3W3C A;  2DCE A;  4X0G A;  1XG1 A;  4HV5 A;  4XNF A;  1R49 A;  2CRG A;  2XAQ A;  2PQ8 A;  3UNG C;  3MEX A;  1SD6 A;  4RGR A;  3DBL B;  2L7M P;  3A03 A;  1AOY A;  5F0C A;  4II3 A;  2VKD A;  1ZG3 A;  3CMY A;  3HUG A;  2GXG A;  4HSR A;  4E70 A;  1MNM C;  2VON A;  2M2E A;  1U8B A;  5FLX Z;  2FUG 2;  4XLE A;  3ERE D;  3ASO H;  2P6T A;  5GAH J;  1OR7 A;  4ENN A;  2PBI A;  5F0F A;  4BHP A;  5HVQ C;  1BW6 A;  1T39 A;  2XB0 X;  3VYS B;  2CQX A;  3DPL C;  2JVG A;  1WSU A;  3LA7 A;  1H89 C;  1X3Z B;  4KIF A;  5JI6 A;  2DMN A;  2VKH A;  3EQL F;  2FQ3 A;  3MKW B;  4CGZ A;  4G7O F;  3IAM 2;  2DYR H;  4JP0 A;  4IX7 A;  2L9V A;  1J7K A;  2D2W A;  3AL0 C;  1QHG A;  3BCB A;  2LNB A;  4TV7 A;  3DPU A;  1ETV A;  3ABT A;  1MBE A;  1LUJ B;  4Y7N J;  3I58 A;  2ZXW H;  1D1C A;  3KP5 A;  4W1U A;  4LG0 A;  1GVJ A;  1P9Q C;  1AU7 A;  3IRR A;  2M30 A;  3V7R A;  2OBP A;  1W1W E;  2V9V A;  1HKS A;  2VJ5 A;  2STW A;  1U9N A;  2LRE A;  4IQ4 A;  5J8F A;  2JMW A;  1A35 A;  1IDZ A;  3KP6 A;  1D3Y A;  4JK1 X;  4ESB A;  1P4X A;  3LAP A;  3NAU A;  1OQY A;  2FJ1 A;  5ILV A;  5JLW A;  2LVS A;  2XSD C;  2BOL A;  1IRX A;  2VT2 A;  2CS3 A;  3I0T A;  4RM2 A;  3BCA A;  1EH6 A;  1MBH A;  1MH3 A;  3IKV A;  4ZZL A;  1BI2 A;  3JRD A;  3CCJ I;  4I6Z A;  2FU4 A;  1REP C;  2Z99 A;  4A12 A;  3GFM A;  3RDI A;  4ZTJ A;  2H27 A;  1ORK A;  4IKF A;  4RB3 C;  2DJN A;  2HVQ A;  3W6J B;  3H5N A;  4XLF A;  3CCU I;  4CDG A;  2Z1D A;  4AVZ A;  3H0G J;  3S2D J;  3GX4 X;  1JHF A;  3AG4 H;  4BQQ A;  1BL0 A;  3LA2 A;  2R7U A;  1UCR A;  4U7B A;  3N97 A;  1SAX A;  4XMY A;  1Z1D A;  2E7X A;  3RKQ A;  2DMU A;  2MLK A;  2CGP A;  2Z5U A;  2ISY A;  2K9S A;  2WV1 A;  2ZNY A;  1R1T A;  5FKN A;  1N77 A;  4FX0 A;  3R60 A;  4NBQ A;  3HJE A;  2HYF A;  1RPW A;  2CQ7 A;  2DQL A;  3G6E I;  4BQA A;  1KQ8 A;  4A3C J;  2HQN A;  1JGG A;  2DK8 A;  2H8R A;  5FFZ A;  2WC2 A;  1TWF J;  1R1V A;  4OIR F;  4I99 C;  2ELH A;  4ZDP A;  2M0M A;  1TWG J;  1PP8 F;  2EFO A;  3BG6 A;  4D5C A;  4O5V A;  1VZ0 A;  1B72 A;  5E18 F;  2VL8 A;  5EGO A;  2DA6 A;  1I5Z A;  5CQG A;  3OYL A;  1VQK I;  1QQI A;  1J09 A;  3FX3 A;  3I9V 2;  3ZGK A;  3S14 J;  4CCN A;  1VI0 A;  3AFH A;  4P9F A;  2V9K A;  1V5G A;  3AKZ A;  5C3E J;  3L00 A;  4UVA A;  3Q0U A;  1P92 A;  3GTJ J;  1WQ2 A;  5K1Y A;  1X1P A;  2HZT A;  2QSH X;  2CV0 A;  5FKL A;  2NOG A;  2XHK A;  3BG9 A;  3CMM A;  3QOP A;  4D7M A;  1TLH B;  1ZHF A;  2Z33 A;  4JX4 A;  2H1L A;  3I64 A;  1KZH A;  2EBI A;  2LP0 A;  1N78 A;  3RKX A;  2EFW A;  1IW7 F;  2EFN A;  5LEK A;  2P5K A;  3KYD B;  3QYF A;  1R1U A;  3BC8 A;  3F72 A;  3K4M A;  3CD6 I;  4NNJ A;  5CLS A;  4OOI A;  4P9U A;  4PJJ A;  2YS9 A;  2W00 A;  4DYQ A;  4M3E A;  2NYX A;  5HS7 A;  4EJU A;  3ECO A;  1OFC X;  2ZXI A;  1HW5 A;  3MKL A;  1X3W B;  3LQR A;  1T6S A;  4DQ2 A;  2Z16 A;  1ZYR F;  2DW4 A;  4HA8 A;  3D1N I;  3K7A J;  4O3M A;  2HTJ A;  5C44 J;  3PNT A;  4NC8 A;  2DFI A;  2JVH A;  1MMN A;  3C2G A;  1V5E A;  3QPT A;  2RNJ A;  2BHZ A;  3IV5 A;  3NWT A;  3WOD F;  3S3O A;  1XGS A;  2P4W A;  2W25 A;  4QPO A;  1MJ9 A;  5LRR A;  3GXO A;  5D6E A;  4MQ9 F;  4CH7 A;  1TWH J;  2KRF A;  2CQN A;  2DDB A;  4HX7 A;  4XN0 A;  3Q9V A;  3RKW A;  5TRD A;  1RNL A;  5FD6 A;  4XM3 A;  1JKP C;  3KFW X;  1ZGW A;  2JUC A;  3DCF A;  4DNC A;  2V6E A;  4KMF A;  4LK0 F;  2CUZ A;  2QSF X;  4XK4 A;  2QLZ A;  2KKO A;  2R7T A;  2OU2 A;  1X1B A;  4ZYE A;  3LOC A;  4B44 A;  1IUF A;  2E5Z A;  5GTI C;  4WXC A;  1JUM A;  2W7N A;  2P5V A;  1JTY A;  1HOM A;  4IHV A;  4A5M A;  1WCM J;  2Y48 A;  1VQ7 I;  1WWX A;  2RDP A;  2A6T A;  2K4J A;  3TP3 A;  2LF7 A;  4LIV A;  3G71 I;  4B3X A;  2WAQ A;  4HDV A;  4IHT A;  1LFU P;  4BE1 A;  2HFH A;  2R3S A;  4CZZ A;  1YX3 A;  1UFM A;  5CVI A;  4YRV A;  2F6C A;  3FXM A;  3KP7 A;  3ULQ B;  1E3H A;  4ESJ A;  1Y0U A;  2H1K A;  4EV0 A;  4ZZD A;  3OYA A;  5L3F A;  4Y15 A;  4BXF A;  2HS5 A;  2K4B A;  4U0W A;  3LSK A;  4HX4 A;  5EJC A;  3HIF A;  4NUB A;  3HDD A;  3V7C A;  2MAB A;  1JE8 A;  4BU2 A;  1ZR2 A;  3M4O J;  2FNA A;  5EEG A;  5HDN A;  2YX4 A;  5E8G A;  4OMZ A;  3SDB A;  4IZZ A;  2V1X A;  5HLG A;  3WTW C;  1FTZ A;  5HS8 A;  2K86 A;  5CYV A;  5E1Z B;  1ULY A;  2QUF A;  4L0Z B;  1R5G A;  1LE8 B;  4XKB A;  1I3A A;  4XON A;  3CZ6 A;  4RBO A;  2DT6 A;  2IS1 A;  1K83 J;  4UNO A;  3I59 B;  5FLX K;  3HZJ A;  1BR4 A;  3ZQL A;  1Q1V A;  3FMQ A;  2X1C A;  1K78 B;  1H8A C;  2IA2 A;  1TP4 A;  3BR6 A;  3E5Q A;  1ON2 A;  2DA1 A;  3DFG A;  3C2H A;  4KT5 C;  3ZQF A;  2W85 A;  1ZRC A;  1VQ4 I;  3HYI A;  3CLO A;  5GPC A;  3WTS C;  3FXJ A;  4M6Y A;  3KZY A;  3OYK A;  1T08 B;  2OZU A;  4M72 A;  4V2F A;  1A36 A;  3LSG A;  3FK6 A;  3K4L A;  2PN6 A;  4GYI A;  4V19 K;  4I76 A;  3MCZ A;  2LYC A;  1T33 A;  5IOY A;  2CG4 A;  3ASN H;  4AM3 A;  4KDP A;  3MKY B;  1IDY A;  4A0Z A;  2WV0 A;  3G1L A;  1K6Y A;  1X1C A;  2JSC A;  1IF1 A;  3RSN A;  1OKR A;  2G0E A;  4B3A A;  3F3X A;  2F5E A;  3J81 K;  3T0Y A;  2DK5 A;  3I53 A;  3W2V A;  5IT9 Z;  3KET A;  4ZDL A;  4Q48 A;  4EJW A;  2DAO A;  1BR1 A;  1QZZ A;  4A69 C;  2MSY A;  2AHQ A;  4PUS A;  3E6C C;  1DU6 A;  4OIN F;  3PM1 A;  1HDP A;  3G2B A;  1TZL A;  2QVO A;  1D8K A;  2XGE A;  3BR5 A;  4E7K A;  3O8H A;  2BVL A;  2V9P A;  1SFK A;  2LLK A;  1XSV A;  1FY7 A;  2HVR A;  1O57 A;  4HBL A;  4BS9 A;  3CUQ B;  3LFU A;  4N4O B;  1POG A;  3KPH A;  3ROU A;  5KAI C;  1L3L A;  1JT0 A;  2EA2 A;  2VE9 A;  4BEH B;  4IXA A;  3J80 Z;  4CCO A;  2MBF A;  2QKL B;  3K1P A;  1MDM B;  4CCM A;  3WTU C;  4PFP A;  1WVR A;  2M4G A;  2JTV A;  2Z3Y A;  4A6E A;  4A3K J;  4LGW A;  1SVO A;  3BZC A;  1XX5 A;  2HZD A;  3JAM Z;  5BMZ A;  4UUS B;  1Z7U A;  3CLQ A;  3FXU A;  4NQW B;  2JJ7 A;  3BOQ A;  3DTK A;  3SEQ A;  1LDD A;  2R7Q A;  1XDU A;  1TW2 A;  1V3F A;  1ZR4 A;  4LLN A;  2EIK H;  2FA5 A;  1VQN I;  4FCY A;  3FIS A;  3QOD A;  1O3Q A;  1ETX A;  5JLX A;  3MZY A;  3FWE A;  3BZK A;  2OQR A;  1U9O A;  3S15 J;  2A5W A;  2XB5 A;  3CDI A;  2D5V A;  2QCO A;  3S1M J;  2MC4 A;  4UXN A;  5IT9 K;  1U78 A;  3GEZ A;  4HF1 A;  1R5I D;  2QQ9 A;  3I4P A;  4CXF A;  4XRM A;  3L2R A;  3ZMS A;  1MBJ A;  2MH2 A;  3HTU A;  1T38 A;  4EAT A;  2COM A;  2VKV A;  2XKP A;  1MMS A;  4W97 A;  2Q8K A;  3P9I A;  3W2A A;  3PQK A;  1FOW A;  1F43 A;  3F6V A;  2OZ6 A;  3DPT A;  3FDY A;  2ZJQ F;  3VDX A;  4IHY A;  2FQ4 A;  2R7X A;  1Z77 A;  1S7E A;  3MN2 A;  3JAM K;  4A5N A;  3VSK A;  2HXO A;  3H9G A;  5FRM A;  1YIT I;  5K7F A;  4Y13 A;  1GV2 A;  5D6F A;  2R93 J;  3AG1 H;  5IOZ A;  1NG6 A;  3HKZ N;  4M6X A;  3I55 I;  1Y8R B;  1I3Q J;  2BVM A;  2BY3 A;  3EET A;  4EJO A;  4Q47 A;  1S3J A;  1BR2 A;  3OOU A;  4KIB A;  5LBQ A;  1OYW A;  1Z9C A;  5L3D A;  2GIV A;  2PMZ N;  3GTP J;  4R8H A;  4AU7 A;  2E1O A;  2FOK A;  5IYB J;  2W84 A;  3BTL A;  3HGG A;  5BOX A;  2HQR A;  3GLL A;  4J19 A;  1SFX A;  2EIN H;  3T5X A;  1XSD A;  4A3B J;  2W4S A;  1I1G A;  3U21 A;  1SAU A;  4E4H A;  1Y8Q B;  1VFC A;  2RGV A;  1MBF A;  2O5R A;  4ENM A;  3BQZ A;  5EEH A;  2XVC A;  4UB8 C;  3GFI A;  5FJ8 J;  2GA1 A;  2GZW A;  3BR0 A;  5K5O A;  5IP7 J;  1LEB A;  3E6D A;  2LKS A;  3HGY A;  2PI0 A;  1R4N B;  4LMY A;  2WAQ N;  3MFK A;  4XBF A;  1FC3 A;  3KLO A;  2VOO A;  2OTL I;  4BBR J;  4LIU A;  5M5W J;  3DTE A;  3SJM A;  1YI2 I;  4PJ0 C;  4AVP A;  2ME0 A;  3SFI A;  1RC9 A;  2GBY A;  2L3D A;  2X6O A;  1FOX A;  4KIT B;  2EQR A;  3DQV C;  1OCZ H;  5HLH A;  2PFB A;  5ED4 A;  2V1U A;  2R4G A;  3ZRG A;  1IN8 A;  1LVA A;  1W5S A;  2OAZ A;  2XAF A;  4CHU A;  2QSG X;  4EM1 A;  2HPI A;  5M3M J;  4YFN F;  5E79 C;  4N9H A;  2FXA A;  1A6Q A;  1VND A;  4GCV A;  2CQK A;  1YX5 A;  1Z21 A;  1SVL A;  3QP6 A;  2IGN A;  4CYC B;  1EH7 A;  4L9T A;  4XN3 A;  4LD5 A;  2IAI A;  4WWC A;  4XIC A;  4D1Q A;  2FOW A;  4L5I A;  2HXI A;  2NVQ J;  1Z67 A;  2NOJ B;  3LQQ A;  3CCM I;  4E7J A;  1ETY A;  2OC6 A;  3M1C A;  4J00 A;  2XPU A;  3D0S A;  2KLO A;  2FF4 A;  2F48 A;  1NH3 A;  3RYR A;  1DUX C;  4YEJ A;  2F5V A;  2CJJ A;  5ICC A;  1WJF A;  1HW1 A;  5D8K B;  1G2H A;  2VQH A;  1FMV A;  2LTP A;  2E71 A;  2B0L A;  3HOS A;  2Y0S N;  3RTR A;  1DQU A;  2KL4 A;  1ZEL A;  1W7P A;  2Y0M A;  3JSO A;  4FIS A;  1TT5 B;  5KVR A;  2R7Z J;  4RB2 C;  2EFQ A;  1SVM A;  1UG2 A;  1BC7 C;  3IWF A;  4KJZ A;  1Z7L A;  3L2W A;  4C2U A;  4IRH A;  3EYI A;  4XLH A;  4S05 A;  3R61 A;  4YII A;  1F36 A;  3SZG A;  2X48 A;  2X85 A;  3J81 Z; 
#chains in the Genus database with same CATH homology
 1B8I B;  4AC0 A;  2E2I J;  4X6A J;  3S2D J;  3H0G J;  5M3F J;  3FK7 A;  5BNG A;  2O7O A;  3IH2 A;  1B8I A;  1GT0 C;  1BL0 A;  1IG7 A;  1WI3 A;  1JUP A;  4G12 A;  3BR3 A;  1QVT A;  4XRS A;  3RKQ A;  2DMU A;  2K9S A;  2WV1 A;  5FKN A;  4XRS G;  3GTO J;  3JRC A;  4M3G A;  4C3I J;  1RPW A;  4QIW N;  2DA3 A;  3HOZ J;  2CQQ A;  1MBG A;  4A3C J;  1JGG A;  2H8R A;  1BJZ A;  2HYJ A;  1TWF J;  1MSE C;  2E2J J;  3GTG J;  4C3J J;  3PO2 J;  3LSP A;  1Y1V J;  3I4M J;  1OCP A;  5J1U A;  1TWG J;  2R5Z A;  1XS9 A;  4D5C A;  1AKH B;  2JN6 A;  2E19 A;  1B72 A;  2JK3 A;  3S2H J;  5EGO A;  2DA6 A;  3MVP A;  1AKH A;  4M3D A;  2L0K A;  3S14 J;  3RZD J;  1VI0 A;  3JRI A;  2Y2Z A;  5C3E J;  3I4N J;  3Q0U A;  2DMT A;  3GTJ J;  1A5J A;  3BG3 A;  5FKL A;  2NOG A;  2HOT A;  1P7I A;  3BG9 A;  4D7M A;  1JT6 A;  4JX4 A;  1RR7 A;  2HQ5 A;  2XRL A;  2EBI A;  2LP0 A;  4L5E A;  2LK2 A;  3TW6 A;  2DA5 A;  5FKO A;  4V2G A;  1JKR C;  2EZK A;  2XPW A;  5EEA A;  5J1Y A;  4A3E J;  2DN0 A;  2YS9 A;  4A93 J;  5F1J A;  4DYQ A;  4M3E A;  2ECB A;  3BT9 A;  1HCR A;  1E3O C;  3S1Q J;  4MO7 A;  1OFC X;  3B6C A;  3MKL A;  1UHS A;  1ETO A;  1IC8 A;  3D1N I;  3K7A J;  4ABZ A;  2NVX J;  5C44 J;  1APL C;  4DZJ A;  4XID A;  4MIM A;  3ZQI A;  1X58 A;  2OPT A;  5GPA A;  2O9L A;  3K2A A;  4MFD A;  3TW7 A;  3IV5 A;  1P7J A;  1JJ8 C;  4EEF G;  2X9D A;  3JR9 A;  1R9T J;  3HB9 A;  5M5X J;  4A3M J;  1JKO C;  3G1M A;  1TWH J;  3GTQ J;  2ECC A;  4BY7 J;  1JKP C;  2HDD A;  3HOV J;  5C4X J;  3F0C A;  3HEF A;  1ZGW A;  2DMP A;  4A3D J;  3DCF A;  5M5Y J;  4D7N A;  3OIO A;  1PUF B;  4X1E A;  5E3N A;  3HOW J;  4XK4 A;  4QTR A;  2CUF A;  3LSR A;  5E3M A;  5C4J J;  2ELK A;  5J3L A;  2Y9Z A;  3LOC A;  1BA5 A;  3E7L A;  2QF7 A;  1IUF A;  2Y9Y A;  2KDZ A;  5IYC J;  2K9Q A;  1GV5 A;  1JUM A;  1DU0 A;  1JTY A;  1HOM A;  2ID6 A;  2KT0 A;  5EZG A;  5F0H A;  4IHV A;  2JA7 J;  1WCM J;  4CYC A;  2HOS A;  1OCT C;  1SAN A;  3Q0W A;  3M3Y J;  1YRN B;  3TP3 A;  4A3I J;  4BBS J;  3A01 A;  1ITY A;  2R0Q C;  1LFU P;  1RES A;  4B4C A;  2R92 J;  2RAE A;  2VKE A;  3BR1 A;  3GTM J;  1TWA J;  2H1K A;  1O4X A;  2EZI A;  4A3G J;  1IV6 A;  4QSH A;  3HDD A;  1RKW A;  2EZH A;  4AYB N;  1GDT A;  2IBD A;  4A3L J;  2I10 A;  4RDU A;  1ZR2 A;  3M4O J;  2WB1 N;  3BTI A;  2VUM J;  5FLV A;  3O8G A;  4DYR A;  1FTZ A;  3SDG A;  2GLO A;  3UKG A;  1MSF C;  1ZKG A;  1JKQ C;  2Y30 A;  1FJL A;  1LE8 B;  5IP6 A;  4RBO A;  3ZQC A;  2L7Z A;  1Y1W J;  1K83 J;  1FIA A;  3LNQ A;  1MBK A;  3A02 A;  3ZQL A;  1Q1V A;  1NK2 P;  3OSF A;  1H8A C;  3S17 J;  2LR8 A;  3BR2 A;  2M8G X;  3JRF A;  3BR6 A;  1W0U A;  2DA1 A;  3ZQF A;  3VPR A;  5GPC A;  4GFB A;  5IPA A;  2NS7 A;  3GBG A;  4D5F A;  4DW6 A;  4FTH A;  4V2F A;  5GP9 A;  3LSG A;  3FK6 A;  2N8G A;  4I76 A;  5IP9 J;  1T33 A;  1TWC J;  5IOY A;  1IDY A;  1PUF A;  5F08 A;  5E3L A;  3G1L A;  3G1O A;  5EG0 A;  4JX6 A;  5EGO B;  2G0E A;  5EYR A;  4B3A A;  3QPS A;  1T56 A;  1GUU A;  3JRE A;  5J1R A;  1VF9 A;  4BKX A;  3BG5 A;  3IH3 A;  2MGQ A;  3C2B A;  4JX5 A;  5HOD A;  1IGN A;  4B1R A;  3GTK J;  4A69 C;  3CQZ J;  2MG4 A;  1XC5 A;  2AHQ A;  2MSY A;  1DU6 A;  3PM1 A;  1B72 B;  2O8K A;  1HDP A;  4M3F A;  3Q3S A;  2XGE A;  3BR5 A;  4UUT A;  3O8H A;  2HI3 A;  4NDL A;  2LLK A;  4FE7 A;  1QVU A;  3PO3 J;  2NS8 A;  3BTC A;  2NVT J;  2GM4 A;  4IHW A;  3CCY A;  4Y52 J;  4C3H J;  2CU7 A;  1POG A;  1FTT A;  1JT0 A;  2HOA A;  5F04 A;  5FKK A;  5K7Z A;  3FKI J;  2YU9 J;  1H88 C;  2JA8 J;  4DZP A;  3GTL J;  2R5Y A;  1JJ6 C;  2JA6 J;  3JRA A;  4UUS A;  4A3K J;  4LOC A;  3BQY A;  3HOY J;  3TP0 A;  3W6V A;  4UUS B;  2L7F P;  5EDN A;  1WPK A;  3S1N J;  4AUX A;  2R5Z B;  2JJ7 A;  2JWT A;  2DMQ A;  1X2N A;  3QQA A;  4FE4 A;  2FX0 A;  2TRT A;  3HBL A;  1HF0 A;  3CDL A;  5F27 A;  2K40 A;  5EG0 B;  3FIW A;  1ZR4 A;  2M0C A;  3FIS A;  4FCY A;  4IHX A;  1ETX A;  3BTJ A;  5JLX A;  2M34 A;  1U9O A;  3B6A A;  3S15 J;  2OF7 A;  2EZL A;  2XB5 A;  3TED A;  2D5V A;  2QCO A;  3S1M J;  1HDD C;  1ETK A;  4S0H B;  1U78 A;  2XGD A;  5IYD J;  1ETW A;  4C2M J;  3LSJ A;  3S1R J;  4XRM A;  4MLO A;  1WGX A;  2MW8 A;  2FD5 A;  1RKT A;  4BXX J;  1MBJ A;  3ZQH A;  3H3V K;  2VKV A;  2E2H J;  4W97 A;  2XGC A;  3QPL A;  1I6H J;  1F43 A;  2ZB9 A;  3WHC A;  4IHY A;  2VI6 A;  2FQ4 A;  1MH4 A;  1Z77 A;  2EH3 A;  1W0T A;  1S7E A;  3MN2 A;  3ZQG A;  4DYC A;  2XPV A;  3HM5 A;  1TC3 C;  4M3B A;  2HXO A;  2NVY J;  5K7F A;  2LFB A;  1GV2 A;  1SFO J;  1EF4 A;  2R93 J;  5FKM A;  5IOZ A;  1CQT A;  1ETQ A;  3HKZ N;  1LFB A;  2ME6 A;  1OJL A;  1I3Q J;  2DTZ A;  2VPR A;  4MFE A;  1X2M A;  1BW5 A;  2L9R A;  3OOU A;  4M6V A;  3HOX J;  1JTX A;  2PMZ N;  1HLV A;  3GTP J;  2CUE A;  3A01 B;  2E1O A;  5IYB J;  5EF6 A;  3BTL A;  1FEX A;  1RET A;  3HGG A;  2COB A;  1ZTR A;  4J19 A;  3Q0V A;  1A6I A;  4A3B J;  1VFC A;  2DA2 A;  9ANT A;  1MBF A;  1LE8 A;  3BQZ A;  5FLM J;  5FJ8 J;  2ID3 A;  3BR0 A;  1WH5 A;  1Z0X A;  1ENH A;  5IP7 J;  1AHD P;  2DA7 A;  3OSG A;  3HGY A;  3WHB A;  2WAQ N;  1NK3 P;  3S16 J;  4JYK A;  5E3O A;  2TCT A;  2JA5 J;  1XG1 A;  4BBR J;  5M5W J;  3L1P A;  3SJM A;  2CRG A;  2ME0 A;  2LY9 A;  2L7M P;  3IH4 A;  3SFI A;  3A03 A;  2GBY A;  2X6O A;  5F0C A;  2EQR A;  4BY1 J;  3CMY A;  1QPI A;  1MNM C;  3RZO J;  2M2E A;  1U8B A;  5K7H A;  3ZOB A;  1ZQ3 P;  5M3M J;  1JUS A;  2DA4 A;  3RQI A;  5F0F A;  1VND A;  1BW6 A;  2LD5 A;  2YUS A;  2XB0 X;  2CQX A;  1H89 C;  1ZK8 A;  4CYC B;  2DMN A;  2AO9 A;  1NTC A;  2IAI A;  2P81 A;  4IEJ A;  4JP0 A;  5DTD A;  4XIC A;  1YRN A;  2HXI A;  3JRG A;  2NVQ J;  5EZH A;  1ETV A;  1MBE A;  4Y7N J;  1ETY A;  2W48 A;  4HNV A;  2XPU A;  4W1U A;  3JRB A;  1AU7 A;  2IEK A;  1K61 A;  1U9N A;  1GVD A;  2CJJ A;  2R5Y B;  1IRZ A;  2JMW A;  1IDZ A;  3HOU J;  2M9H A;  1D5Y A;  1G2H A;  2LTP A;  1QRY A;  3NAR A;  3DEW A;  2Y0S N;  3NAU A;  2FJ1 A;  5JLW A;  4A3J J;  1I50 J;  2LVS A;  2XSD C;  1FIP A;  1WH7 A;  4A3F J;  1MBH A;  1MH3 A;  5DS9 A;  3JRH A;  2K9N A;  3JRD A;  1IJW C;  4FIS A;  4I6Z A;  2R7Z J;  2Y31 A;  1UG2 A;  2B63 J;  1ORK A;  2DJN A;  2LKX A;  1F36 A;  2X48 A;  1UMQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...