1I6HJ

Rna polymerase ii elongation complex
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
65
structure length
65
Chain Sequence
MIVPVRCFSCGKVVGDKWESYLNLLQEDELDEGTALSRLGLKRYCCRRMILTHVDLIEKFLRYNP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis of transcription: an RNA polymerase II elongation complex at 3.3 A resolution.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Transcription/dna-rna hybrid
molecule keywords 5'-D(P*AP*AP*AP*TP*GP*CP*CP*TP*GP*GP*TP*CP*T)-3'
total genus 17
structure length 65
sequence length 65
ec nomenclature
pdb deposition date 2001-03-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
J PF01194 RNA_pol_N RNA polymerases N / 8 kDa subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 1i6hJ00
4M3EA 1H8AC 5IPAA 5E3MA 4AUXA 3UKGA 1JKPC 1JKQC 5GPAA 2Y0SN 4BY7J 2M9HA 2ME0A 3HOVJ 3TP0A 2ME6A 1MSFC 1IGNA 5FLVA 2N8GA 3TW6A 5F1JA 1QPIA 2DA5A 2K9QA 3BR5A 3S2DJ 3WHCA 4DYCA 1SFOJ 2E2HJ 1HCRA 3M4OJ 1HLVA 2HI3A 1HF0A 1RESA 2Y30A 5IYBJ 1ZR2A 2G0EA 3FK6A 2LD5A 5C3EJ 4A3MJ 4A93J 2JMWA 1MNMC 3CDLA 3JRFA 2E19A 1IJWC 2XPUA 9ANTA 4A3JJ 2WB1N 3ZQIA 1W0TA 2CJJA 1D5YA 4IHVA 4I6ZA 1IC8A 5E3OA 1MSEC 5FKNA 2K9SA 3DEWA 3PO2J 3JRAA 2L7FP 3ZQLA 5C4JJ 2VUMJ 2CU7A 1I3QJ 3HKZN 5F0CA 1H89C 1VI0A 2HYJA 4DYQA 4CYCB 2JN6A 1AHDP 2HDDA 4AC0A 4LOCA 1FEXA 1YRNB 5EG0B 1WI3A 2XB5A 5EGOA 2KDZA 5M5YJ 5FJ8J 3S15J 1T56A 5EZHA 2IEKA 4L5EA 2QCOA 1IRZA 2LFBA 5IP7J 1I6HJ 4IHXA 2Y2ZA 1JUMA 3G1LA 2RAEA 4A3KJ 2VKEA 5C44J 3MN2A 2XRLA 2O8KA 2HXOA 3BG5A 4M3GA 3I4MJ 4RDUA 1TWHJ 3OIOA 4IHYA 1WCMJ 3LSPA 1OFCX 3BR1A 5F0FA 1K61A 3S1RJ 3BQZA 3BG9A 3F0CA 4QTRA 1B72A 5FLMJ 1WGXA 4XIDA 3NARA 2L7ZA 4M3FA 1RKTA 1B8IA 5EYRA 3RKQA 3HDDA 1HDPA 1XC5A 5FKKA 1BJZA 3S1NJ 2MG4A 3GTPJ 4NDLA 2TCTA 2L9RA 1ZK8A 3HGGA 3CMYA 2M2EA 4FE4A 4FISA 3Q0WA 2D5VA 1UMQA 2DA2A 3ZQFA 1UG2A 2HXIA 4XRMA 2R93J 1JT0A 5EF6A 4D5FA 4MIMA 2FX0A 4V2FA 1PUFA 4W1UA 5FKMA 3MKLA 3BQYA 1ZKGA 4A3BJ 2XGEA 4XRSA 2IBDA 5DTDA 3DCFA 1Z77A 4ABZA 2LTPA 3HGYA 4B3AA 1HDDC 2EBIA 4IHWA 2O9LA 1IDYA 2X48A 2B63J 3IH4A 2NVQJ 1ETYA 3JREA 2VPRA 2Y9ZA 4RBOA 1X58A 2AHQA 2LLKA 2GBYA 2R5YB 3JRIA 1FJLA 2DA3A 1WH7A 1NK2P 2CRGA 4M3DA 5IYDJ 4C2MJ 1R9TJ 2MGQA 1CQTA 3FK7A 5M5XJ 1K83J 1FIAA 3BTCA 4C3JJ 5K7ZA 4W97A 3SJMA 3VPRA 2HOSA 1EF4A 4JYKA 1E3OC 1RKWA 4HNVA 4UUSB 1XG1A 2EZHA 4BBRJ 1JUSA 3W6VA 3LSJA 5E3LA 3SDGA 4A3CJ 4IEJA 2EZKA 3I4NJ 4A3FJ 5EDNA 1G2HA 4XK4A 1QRYA 4X1EA 1TWGJ 1MH4A 3BTLA 4QSHA 1JT6A 1FIPA 5FKLA 1MBFA 2CUEA 1B72B 2LR8A 2O7OA 1LE8B 1GUUA 2ECBA 5F27A 2DJNA 3G1OA 3RZDJ 5J3LA 4A3DJ 1Q1VA 1X2MA 1BW6A 3HEFA 3HBLA 3A02A 4M6VA 2JA7J 4FTHA 4S0HB 2R0QC 4FCYA 3S1QJ 2JK3A 5EEAA 5F08A 3OOUA 4J19A 3JRCA 1PUFB 5K7FA 2DMTA 3BR6A 2NS8A 1U9NA 2XGCA 5IOZA 1ETKA 1ZR4A 1DU6A 4FE7A 3C2BA 3GTGJ 3B6CA 2YUSA 2X9DA 1JKRC 4Y52J 1NK3P 1ENHA 2LP0A 3E7LA 3H0GJ 3RZOJ 3BR2A 5M3MJ 3NAUA 1OJLA 1W0UA 1FTTA 3ZOBA 2EZLA 4DZPA 1Y1VJ 1S7EA 4DZJA 1MBHA 1VNDA 3HOWJ 4BBSJ 3JRDA 1VF9A 2L7MP 4BXXJ 1LFUP 2NVYJ 4A3IJ 2VKVA 2K9NA 5BNGA 1IUFA 5IP9J 4A3EJ 4UUSA 1WPKA 1VFCA 4A3GJ 1A6IA 4D5CA 2FJ1A 5F0HA 2DTZA 2DA7A 4XICA 1T33A 3PO3J 3GTMJ 1ETQA 1DU0A 2LK2A 2K40A 5IYCJ 1TWFJ 1B8IB 1TC3C 2HOTA 1QVUA 3HB9A 3CQZJ 3GTQJ 5EG0A 5GP9A 3GBGA 1JGGA 1YRNA 5IOYA 2EQRA 2FD5A 3H3VK 1Y1WJ 2HOAA 3A03A 5DS9A 1H88C 2ID6A 1OCTC 3LNQA 2E2IJ 2DMPA 1F36A 3HOZJ 3B6AA 2M34A 4I76A 3TP3A 2I10A 2JA5J 3BG3A 2DMQA 4D7MA 3D1NI 3BTIA 3MVPA 1F43A 3M3YJ 2WV1A 2H8RA 2AO9A 1OCPA 1MBJA 1ZTRA 1SANA 2ELKA 2ZB9A 4JX4A 3HOYJ 2CUFA 2P81A 2XSDC 2COBA 2JWTA 3HOUJ 2MW8A 1JJ6C 4JX6A 3TEDA 2YS9A 3IH3A 5HODA 4MFDA 3BR0A 2LKXA 2DMNA 2WAQN 2E1OA 1ETVA 1Z0XA 3ZQHA 2NS7A 2OPTA 1NTCA 3S1MJ 2CQQA 2IAIA 1U8BA 2ECCA 4GFBA 1ETWA 4A3LJ 1APLC 5FKOA 4A69C 3GTKJ 3GTLJ 1XS9A 2E2JJ 3OSFA 2GM4A 2JJ7A 3HM5A 2DMUA 4MLOA 3BTJA 2OF7A 2EH3A 2M0CA 5J1UA 5GPCA 4BY1J 1U78A 1IV6A 2R5ZB 5JLWA 3TW7A 1ETOA 4B4CA 2MSYA 1A5JA 3OSGA 3FIWA 2DA1A 5M5WJ 1U9OA 2DA6A 3A01A 5EGOB 1BA5A 1POGA 3JR9A 1FTZA 2R5YA 2XGDA 2NVXJ 1ZGWA 4C3IJ 4M3BA 1JJ8C 4CYCA 5M3FJ 3S17J 2JA8J 4D7NA 2NOGA 1ITYA 3PM1A 2H1KA 1RETA 3Q3SA 1AKHA 1BL0A 3IV5A 1LE8A 1ETXA 2R92J 1GDTA 3S2HJ 3G1MA 3S14J 3RQIA 5JLXA 3L1PA 5C4XJ 4JP0A 3QPLA 3JRGA 4AYBN 2W48A 2XB0X 1GVDA 2X6OA 4UUTA 1UHSA 2DA4A 3Q0UA 4V2GA 2VI6A 1LFBA 2DN0A 2R5ZA 1MBGA 4DYRA 2M8GX 2XPVA 1WH5A 1TWCJ 3WHBA 4QIWN 3QPSA 2LY9A 5E3NA 2LVSA 3FISA 3BR3A 2YU9J 4DW6A 5K7HA 1JUPA 3LSGA 3S16J 2TRTA 3FKIJ 3QQAA 2HQ5A 3O8GA 2CQXA 2Y9YA 1RR7A 1BW5A 3Q0VA 1RPWA 1JTXA 1TWAJ 1IG7A 2EZIA 1JTYA 3K7AJ 4MFEA 4X6AJ 4Y7NJ 1AU7A 5J1YA 4JX5A 5J1RA 1JKOC 3IH2A 4G12A 2Y31A 1X2NA 1GV5A 4XRSG 3BT9A 5F04A 1P7JA 2L0KA 2R7ZJ 2PMZN 1GV2A 3LSRA 1ZQ3P 5IP6A 4BKXA 3JRBA 3ZQGA 1IDZA 2JA6J 5EZGA 1ORKA 3HOXJ 3LOCA 4B1RA 3A01B 4EEFG 1O4XA 1MH3A 2NVTJ 2FQ4A 3O8HA 3GTOJ 3SFIA 1HOMA 1QVTA 1MBEA 3K2AA 2QF7A 3ZQCA 3CCYA 3GTJJ 4C3HJ 2KT0A 1I50J 2GLOA 1AKHB 2XPWA 3JRHA 2ID3A 1GT0C 1P7IA 4MO7A 1MBKA
chains in the Genus database with same CATH superfamily
1H8AC 4L9NA 1QHGA 2LKSA 1JKPC 1XX5A 2XF6A 1JKQC 2HDCA 4UB8C 4BY7J 2CUJA 2DPUA 2LG4A 2M9HA 2ZSHB 4CCJA 4HF1A 5LGNA 3LQQA 1A36A 4CCKA 2ME6A 1FX7A 5F1JA 4JQFA 1EV7A 1QPIA 5BOXA 3S2DJ 2F5CA 4DYCA 2DQLA 4UUVA 1HCRA 1J9IA 2HI3A 3O2PE 3DKWA 2JSPA 1K79A 4DBRA 1Z91A 2LD5A 2HTSA 1NG6A 4N0BA 3FBIB 2O0YA 4A93J 1SD6A 5HDGA 4E4HA 4AVPA 1A04A 5LHIA 2AXLA 2KLOA 9ANTA 5J4VA 2HFHA 3ABKH 1XSDA 4JOMA 1ZHFA 1QPMA 1VQNI 4I6ZA 3DEWA 3IWZA 5F6FA 3ZQLA 1ON1A 4BXFA 3J81K 2NXNB 3HKZN 2BW3A 3BJOA 3RTRA 2HYJA 4DYQA 4CYCB 2DO7A 3M8EA 2IJLA 4I2OA 3TOAA 3HSRA 1WI3A 5D8KB 2KDZA 1YITI 2QUFA 3DTIA 3IC7A 5FJ8J 3TO9A 4BEHB 3WU1B 3CCUI 2QCOA 1IRZA 4P55A 2LFBA 2MBFA 4HV6A 5LRSA 2HDWA 2Y2ZA 1X1BA 2CG4A 2VKEA 3GZ6A 4OU0A 5B3SH 1R4MB 4MEXF 2D1VA 2XC7A 3KYDB 2BY1A 2FEZA 2VQCA 2VJ4A 4F91B 1XCVA 3OIOA 3I71A 2F6CA 4RAFA 2Q8KA 3W2VA 4ZTJA 3QOPA 1OFCX 5F0FA 4LB6B 3BQZA 3BG9A 5FLMJ 4L5IA 4I99C 4NQWB 2L7ZA 4UVAA 3V42A 1E3PA 2R4GA 4AIKA 2DYRH 5EYRA 3RKQA 5DM7F 1B8IA 1HDPA 3HDDA 4C2UA 1QU3A 1T8IA 3M7GA 3OYCA 3FXQA 3S1NJ 2MG4A 4NDLA 2A07F 5LEKA 1ZK8A 1R5GA 1RUNA 4XLPF 1I1GA 1B1BA 3Q0WA 4FT8A 1R23A 1UMQA 3IWFA 4OAZA 4KN7X 1Y8RB 2RN7A 2L7KA 4KIBA 3BZCA 3I0TA 1WJFA 5EF6A 1SFUA 2L54A 1FWZA 2R7UA 3I4PA 4G8XA 3GZ5A 2DXIA 3KIOA 3DF8A 1ZKGA 2NNYA 4NC6A 1T39A 4LLGF 2IBDA 3HTSB 4XLAA 1U5TC 1DGWY 3OWTA 2OCCH 2O9LA 4IHWA 5DV5A 2JVHA 3DU5A 1LB2A 5DDGA 2ETHA 2QLZA 5DYMA 1BOAA 2K3PA 4RBOA 3CCQI 3PNYA 3OYIA 1X58A 3F72A 2DW4A 3JRIA 2X1EA 1P4AA 4M6XA 3I59A 4N4NB 1FMVA 5IYDJ 3H3UA 5TISC 4C2MJ 1TZLA 1UELB 2A05A 3GFJA 3BY6A 2MGQA 3GF2A 2DK5A 4EATA 3AFHA 5M5XJ 1P4XA 2PMUA 2DCEA 4HX4A 2ZXIA 1IN6A 3SJMA 1PUEE 1RR8C 1EF4A 3QWLA 2KZGA 1ZG5A 4HNVA 3RKWA 1XG1A 2BBYA 2EZHA 2R7FA 1JUSA 1PYVA 3LSJA 3W6VA 1FYLA 2GA1A 2WBMA 4J01A 3KP3A 4A3CJ 1Z7LA 4IEJA 2W82A 3ROUA 3AL0C 2FF4A 3QPHA 4XK4A 2OD5A 3KP7A 3E0JB 5HS9A 3ZMVA 4X1EA 5E1ZB 3PFIA 2IRFG 3CCEI 1TBXA 1D0YA 3BTLA 5F1RA 3Q9VA 5DCMB 1FIPA 1MBFA 2ZBKA 5FKLA 3ABTA 1E17A 3DEEA 1GUUA 2ECBA 3C2HA 2XASA 3G1OA 4NC8A 1R71A 3DBLB 4XKVA 3ZXSA 2BY0A 1TW2A 1WHUA 3F8FA 4M6VA 2XIGA 4LITA 3IRQA 1P4WA 2MA3A 4EGYA 4FCYA 3A0BC 4ZDOA 2VOOA 3S1QJ 2WB1A 4M74A 3OOUA 4YRVA 1B6AA 2BZTA 4J19A 4EJOA 5K7FA 4A5MA 3ABLH 2DMTA 4EJTA 2EFQA 3FXMA 3KLNA 1U9NA 1WI9A 5IOZA 3EYIA 1ETKA 1DU6A 2RC4A 3C2BA 2IA0A 4ZC3A 2VJJA 5E79C 2EFOA 5HLIA 1LQ1A 1O7LA 3CF5F 1NK3P 4EMSA 2ZJQF 2LF8A 2FU4A 1U0JA 5FD5A 5B66C 3BR2A 1STZA 4BUPA 3NAUA 3WG7H 3WE3A 2AQEA 3EPZA 3V7SA 2LBFB 1BIAA 1JE8A 1VTNC 4DZPA 4WK8F 4E7ZA 2PBIA 1S7EA 2K3FA 1LDDA 3FMRA 4I7HA 1KONA 4BBSJ 3JRDA 1I27A 2H6BA 2L7MP 3BROA 2QA4I 3RYRA 2NVYJ 4II3A 4A3IJ 2VKVA 1WJAA 5HOOA 2K9NA 5IP9J 4A3EJ 1X3WB 1LFPA 4UUSA 2E1MB 1C0WA 4IHTA 4YFNF 4Z2YA 1KU9A 1W7PA 5EEHA 3DPLC 1KQ8A 4WX9A 3K1PA 3U1KA 5BPIA 2TDXA 2FMYA 1KYWA 1D1BA 3HB9A 3NQOA 3F3XA 5GP9A 4MTEA 3UR3C 1FYKA 1ODDA 3R4KA 1RI7A 1G59A 3LAJA 2V79A 3SEQA 5L3BA 4RGUA 2LREA 3ABMH 1TQMA 1MNDA 1XTAA 2DMPA 3FDYA 2Y48A 3HOZJ 2BE5F 2RREA 3BG3A 2OTLI 3MVPA 4E7IA 4PJMA 3M3YJ 1R58A 1F43A 4RGXA 4D1QA 1MBJA 3HUGA 3IL2A 3E1SA 2HS5A 3LMMA 3HRMA 1ZTRA 2ELKA 2ZB9A 4JX4A 1IUYA 1ZAOA 1XN7A 1WRJA 2A6EF 4BHPA 4ZYHA 1HW2A 2WWYA 3OYGA 4RA2A 3P5JA 3VYSB 3TDUC 3IH3A 5HODA 5BS6A 3OYEA 5DD8A 4ZZLA 1BN5A 1D0ZA 1RNLA 2YPRA 3X2QH 4ESBA 2E1OA 1ETVA 1Z0XA 2JA2A 2VJ5A 4P9UA 1TP4A 4OAYA 2IAIA 5TJJA 1U8BA 3T1BA 4A12A 4CYDA 2IS6A 3LSIA 3ZMZA 2KDOA 4GFBA 1TT0A 3BZKA 1MDMA 1ETWA 1YFHA 2MLGA 2V9VA 3U2RA 3PL8A 3GTKJ 2VXZA 1SVLA 3WGHA 3KX2A 3RPUD 3OSFA 2GWRA 3BWGA 3RYPA 2WAEA 2DMUA 4MLOA 3ZPLA 3BTJA 2HWVA 2OF7A 1XGNA 2A68F 2KIQA 5J1UA 4WF2A 2QQ9A 3DTEA 1F9NA 4BY1J 2DT5A 3ULQB 1HSJA 3S93A 2R5ZB 1IV6A 1R1TA 1XDSA 2CW7A 1ETOA 3OYNA 2XROA 3OSGA 3R0AA 5M5WJ 4ESFA 3BCAA 1BA5A 3ONQA 1POGA 3JR9A 2R5YA 1XGOA 5D5WB 1JJ8C 2W1OA 2LY1A 3GZNB 2JA8J 4QPQA 3L2VA 2EFPA 2W00A 2H1KA 2KRFA 1W36D 1AKHA 3KYLA 2NVUB 1OPCA 2YR2A 4AYBA 1LE8A 1ETXA 2JVGA 1GDTA 3E6BA 3G1MA 3LAPA 3RQIA 3S2HJ 2XAFA 5C4XJ 3QPLA 3JRGA 2LOOA 1I5ZA 2KJCA 4ZDLA 4N4OB 2XB0X 4KIGA 5J4YA 2GIVA 5GAGJ 3Q0UA 3WG9A 4QWQA 4V2GA 3PJRA 2VI6A 4Y13A 3NWSA 3OYLA 5JHUA 2KIFA 3IKTA 2R5ZA 5D5VB 5KHDA 3RKYA 4CUGA 3LA7A 4F52A 1WH5A 1FOYA 4U88A 4CH7A 2V4JC 4QIWN 4F7ZA 4F93B 2LVSA 1T95A 4KT6A 3BR3A 4I98B 1BM9A 1X1AA 1R5HA 4E6KG 5K7HA 3GW2A 4R1HA 3MEXA 4PGHA 4PSXA 3QQAA 1P9QC 5JFRA 3H9JA 2DDAA 2CQXA 3Q0VA 1TWAJ 3I3LA 2EPFA 1JTYA 1I6XA 1N25A 3K7AJ 4MFEA 5DUKA 3VSKA 2HVRA 3PQJA 2CUZA 5CQGA 2EFNA 3FM5A 3FXLA 4JX5A 4IXAA 4IJAA 2RV8A 3IH2A 1MGTA 4G6TB 2GQQA 1UFMA 1P7JA 1G8XA 2L0KA 3CUQA 2E1NA 2R7ZJ 3KPHA 2M0MA 3OYJA 4DJAA 5IP6A 5HS8A 1WJ5A 4N9IA 3EDPA 2I8DA 5FFXA 1H9GA 3JRBA 2LMDA 4Y15A 2PQ8A 2JA6J 5EZGA 1ORKA 1X3ZB 4I0AA 3V4GA 3HOXJ 3CCVI 3VODA 4B1RA 1F5TA 1O4XA 3K4LA 3FXJA 4MEYF 3RI4A 2OCEA 2Y75A 4PGGA 3SFIA 1LDKB 1HOMA 5H2FC 3K6GA 1XB4A 2QF7A 3HIFA 2ZSIB 4IRHA 3CCYA 3GTJJ 2E34A 4L9JA 2KT0A 3I53A 3AG2H 2KZVA 1AKHB 4II2A 2DOFA 4XNFA 2QQ8A 1VQLI 3LSTA 4MO7A 4HAMA 4PJJA 2R7WA 4M3EA 5B1BH 2VC0A 1YE9A 5IPAA 5IT9K 5E3MA 3UKGA 2D2WA 3TBIA 2M4GA 2QBYA 1R1VA 3KZZA 5GPAA 2Y0SN 5FRNA 3FZVA 4EJVA 3HHHA 1MDMB 1GLNA 4RS8A 1KU2A 3BPXA 1OLTA 3HOVJ 3MAJA 3CUQC 3LFKA 5FLVA 1G3SA 1W7PB 2XKOA 4M9SA 3CTAA 2UXXA 1S72I 3WHCA 5DD4A 1SFOJ 3M4OJ 5CVUA 3ZMSA 4HDVA 1HLVA 3KEYA 3J7ZI 4ASNA 2RVCA 2Y30A 1ZR2A 2MYSA 2L4AA 2G0EA 3RCOA 5D8LB 4A3MJ 2A6HF 3WTYC 1Z3YA 2E19A 2KIMA 2L02A 2XPUA 2BY3A 4L9VA 5JR3A 4BXUA 5FLXK 2X6XA 3S8PA 4BEHA 1V54H 1NH3A 5KAFC 2FMLA 5E3OA 2VT2A 4FX0A 5FKNA 2K9SA 4ZTFA 1Z1DA 1QZYA 3D5RC 1S8NA 1TNSA 4HZFA 4KICA 3G6EI 3VYRB 4FQGA 1MMSA 3DKYA 2EJRA 4BE2A 4WXDA 1H89C 1VI0A 1LEBA 1AHDP 2HDDA 2Z33A 3QU3A 2VQHA 4AC0A 3VFZA 2QVOA 4LOCA 3MZYA 3NEUA 3R60A 5EG0B 5EGOA 5DM6F 2KHMA 2GXBA 3FWEA 1IV8A 3S15J 5B1AH 2IEKA 3BCBA 1KGSA 4CSWA 4IHXA 3FXRA 3KZIC 4XORA 3ERMA 2Q1ZB 4A3KJ 1ZG3A 4P1WA 3CCSI 1V5FA 2XRLA 4HSTA 2PEXA 2ACJA 1Z6TA 2ADUA 2QKLB 3HTUA 5KAIC 3I4MJ 4RDUA 4IHYA 3K4JA 1ULYA 4LMYA 2KQRA 3BR1A 1K61A 3MD2A 2W57A 1WFXA 2LF7A 3F0CA 4ZYAA 1A35A 2MC4A 4QTRA 1YQAA 1WGXA 4LIUA 2VBXA 4B3XA 1ZELA 2BVLA 2RNJA 2XGXA 4C30A 4XKWA 4IO9F 2ZMEB 3SDBA 4IVNA 4WXHA 4G6DA 2ZXWH 4A6DA 4ZH4F 3HGGA 3OS0A 3CMYA 3K9TA 5HVQC 1WJDA 4FISA 1TNTA 5E1XA 2DI3A 2ICWG 2G7HA 2DA2A 3F6OA 3DEUA 5FRMA 3W2WA 1JT0A 1IW7F 1MKMA 4H4KC 1DP3A 4MIMA 3KEOA 2IXSA 3VSLA 4DOZA 2FX0A 3K70D 1PUFA 2O8XA 3OYKA 2JRTA 5FKMA 3DBHB 1ZARA 1SMTA 3C7JA 4A3BJ 4XLCA 3OL4A 4XRSA 3KEQA 3G73A 4XKCA 3DCFA 1Z77A 1USSA 1H9TA 4ABZA 4XN0A 4B3AA 3HGYA 1G4DA 1HDDC 2EBIA 1IDYA 2X48A 3IH4A 3D5SC 4XL9A 2JQ7A 2NVQJ 1Z67A 4BU2A 2Y9ZA 2KRHA 2R7VA 3QRFF 2AHQA 4UVBA 2LLKA 2E5ZA 5ERIA 3CC2I 3J7YJ 4X0GA 2ELJA 4FETA 2CRGA 3H92A 4M3DA 1O3TA 2GXAA 5F64A 4F3QA 1R9TJ 2IGOA 2R7DA 3LSHA 4XLNF 1MMAA 1YIOA 3ZCOA 4V19K 2X6YA 3M1CA 2COMA 1K83J 2P6SA 1OKRA 4C3JJ 5E1WA 4ENJA 5ILUA 2DDBA 4HDUA 1E3OC 3FMSA 4UUSB 4BDZA 1XSVA 1SMYF 3P9IA 1HA8A 1EA3A 4CGZA 1QBJA 1N77A 2O61A 3SDGA 1HSTA 1W7PD 4PUSA 2M30A 2EV0A 2V1UA 2XVCA 3S3MA 2F48A 3ZN0A 4A3FJ 3I4NJ 4IOAF 3PNVA 1LKXA 3E6MA 4B43A 1G2HA 1LPQA 1QRYA 1F4KA 3I9V2 4LLLA 3CCRI 4BNCA 2Z3YA 1U6GA 1JT6A 4Y3OA 2R7TA 1B59A 3RIRA 3FXUA 2AQFA 2LR8A 3LFUA 3N05A 4KNYA 1EH7A 2UXNA 3JTHA 2FQ3A 2HOEA 2L9SA 5J3LA 2D1HA 4L9TA 4A3DJ 3HBLA 3A02A 3CESA 4ON0A 2JA7J 1FBUA 3MZ8A 1GXPA 2Z99A 3U9GA 2HTJA 2JTVA 4XRFA 1VQ7I 1UAAA 2P5KA 2O6GE 3HUGB 3ZN1A 1K4SA 1ZH5A 5LBQA 3CMMA 5JHFA 2XGCA 1PDNC 2EILH 1ZR4A 2FNAA 1OMIA 2LH9A 4G6QA 2HYFA 2K9LA 1QGPA 1IAWA 1Z7UA 4KA4A 3EYYA 5AIPA 2X9DA 1UHWA 3E6DA 1JKRC 5GAEJ 2O3FA 1OR7A 1Y56A 3KZYA 3E7LA 1W5TA 2PLYA 1V55H 3LQRA 5LRRA 1D8JA 4OIRF 5DCMA 2I5UA 1W0UA 3O3KA 1MNEA 3ZOBA 3DLLF 1D0XA 1MMNA 3QPTA 2HR3A 2EZLA 2JSCA 1XMAA 1Y1VJ 3CCMI 1VQ4I 1MBHA 5FB2A 4MTDA 3W6KB 4J00A 3JSPA 3HOWJ 2AS5F 3K69A 4LIVA 2PMZA 3L7WA 1ZGAA 3IUOA 3F8CA 2QENA 2PJRA 4HPQA 3QODA 2GIZA 1LNWA 2BXZA 1IUFA 2XF7A 2X1CA 1SD4A 3SEZA 5HS7A 4M72A 2L01A 3CLOA 1X1CA 3S32A 2VPLA 4D5CA 2FJ1A 5F0HA 2DA7A 1SVOA 4XICA 1AA7A 1T33A 1Z21A 3GTMJ 3ECOA 1ETQA 3E97A 2GOXB 1DU0A 1KU3A 3PO3J 1JXSA 1QHHD 1B9NA 4YIFA 3KLOA 1B8IB 1QVUA 1BOBA 2ZFUA 3CQZJ 1MIJA 2VXDA 3GBGA 1JGGA 3GWZA 1DQUA 4RMNA 1JHFA 3RJPA 3SQNA 4LLNA 2HOAA 3GLXA 5DS9A 3EUHC 4OIOF 2MH2A 5L3DA 1DGRM 1B9MA 3GMEA 2WAQA 1IF1A 3B6AA 5K5OA 4UNOA 3MCZA 1R36A 1U5TA 2MFZA 3DP7A 4NUBA 2JA5J 2DMQA 3SZGA 2P5VA 2H09A 3ZQQA 2VKHA 2M3AA 2OUMA 1YIJI 1FP2A 3EQLF 2IGMA 1T38A 3HOYJ 1YX3A 2R7XA 4GXOA 2L9VA 2PFBA 3OYMA 2K7LA 3HOUJ 2CQKA 5E18F 2F4MB 4R79A 5IY5H 2DT6A 1DP7P 3KP4A 3JSOA 4MFDA 3BJAA 2XSJC 2Y0MA 4OOIA 3FM3A 2HYGD 4BE1A 3ZQHA 4BGDA 4EGZA 2JRMA 1SAXA 3MWMA 3FKJA 2VIXA 3WU2C 3WTZA 2ECCA 3TQNA 1N78A 5D6FA 2HNHA 5TGTA 3J80K 5K5RA 4GCVA 3ZGKA 4B44A 5FKOA 4HV5A 4G7OF 4L18B 5GADJ 1ZRDA 1D8KA 3DPTA 4QPOA 1XS9A 5IT9Z 3E3VA 3I5UA 2E60A 2H6CA 3G4SI 4IKFA 2M45A 2VQLA 2DT7B 2A69F 4P9FA 3M8JA 1AOYA 3HKZA 1T98A 3C18A 4F92B 4BHCA 4RB1A 3CP2A 4RB3C 4B4CA 4AWXB 1ZREA 2DFEA 1A5JA 1QQIA 2F5VA 3KE2A 3T8TA 3A01A 2OQRA 2KKOA 2E35A 3K4CA 4Q47A 2XGDA 2P5LC 1G3YA 2Y69H 3T8RA 2OZ6A 1ZGWA 4QLCU 2IS4A 4C3IJ 1REPC 2QSHX 3CJTB 3S17J 1FPQA 5CVIA 1R5ID 2J5PA 2DOEA 2Q0OA 1OYIA 4CCOA 3FXOA 3PM1A 3VOEA 1RETA 2CW8A 1YJWI 1HXDA 4D0PA 3CP8A 5CVRA 3ELKA 2VOPA 2K4JA 5JLXA 3L1PA 4XLHA 4XQFA 3F8MA 2L4MA 1UG0A 2NNNA 2EV6A 3TGNA 3GEZA 2DA4A 1BR4A 2ESHA 2HZTA 1CF7A 2DN0A 1OR7C 2EINH 4YELA 4DYRA 2M8GX 2STWA 3RPQA 2BEOA 3T0YA 2XPVA 1FZPB 2HPMA 1W5CC 1TWCJ 2OC6A 3QPSA 5E3NA 3BG6A 4L0ZB 3VB2A 2FUG2 2EA4A 2YU9J 4DW6A 3BG7A 1SD5A 3E5QA 1TLHB 2L9NA 2ZCWA 2CFXA 3HG9A 1CF7B 4BQNA 3FX3A 3FKIJ 1MJAA 3CMAI 3ZRGA 3SYTA 3O8GA 5CQEA 1RPWA 1JTXA 3AL0B 4BAYA 2R7QA 4Y7NJ 1AU7A 2LKPA 2Z5UA 1JKOC 2HEOA 4G12A 2Y31A 3RPUA 2DU9A 1UB9A 2FBIA 1GV5A 5CKTA 4XRSG 1SD7A 2VLAA 5F04A 4PK4A 2FSWA 2VBYA 3L09A 1L3LA 2PMZN 2EB7A 3ZQGA 3AG3H 3L2WA 2XAUA 3A01B 3F9KA 5J8CA 4NBQA 2DOAA 4CA0A 1MH3A 4UHTA 4ZZDA 3ERED 1J5YA 2PJPA 4LGWA 4M6YA 3F22A 3H36A 1WQ2A 1VQ9I 2X6WA 2WY8Q 2DBBA 1KU7A 2PX9A 4PCQA 1MBEA 2BOLA 3SFZA 3TL4X 4CO8A 1U5TB 2WTEA 3I56I 3G3ZA 2GLOA 1LDJA 3E5UA 2A3SA 2DJIA 1XSXA 1U3EM 4I0BA 1P7IA 1XPXA 1P2FA 1V5GA 1DUXC 3PQKA 2WAFA 1Q1HA 3FHZA 4XMYA 4AUXA 1R00A 2Z1DA 1ONVA 5DUIA 4KJZA 3NRVA 1FLIA 4CCMA 1D1CA 1UCRA 5EEGA 1O57A 2ME0A 2DPDA 4U87A 1QNTA 3EUAA 1R6RA 2N8GA 2K9QA 3BR5A 3H5AA 1CGPA 2HQNA 2X4HA 3N97A 4RM3A 2GZWA 3QYEA 4UV9A 1HF0A 1RESA 4HF2A 3HPHA 5FGMA 1FBQA 4G7ZF 4HLYA 3FK6A 3V8KA 5CYVA 4GDFA 3KFWX 1E3HA 4Y4RA 4CXFA 3L2RA 2KP6A 2JMWA 2CH0A 4BE0A 1FYMA 1MNMC 3CDLA 4YG2F 5ICFA 3JRFA 4ESJA 1YLFA 2RDPA 4A3JJ 2WB1N 1W0TA 2EIKH 4E7HA 2CJJA 1D5YA 2P4WA 1IC8A 2XKPA 2WC2A 2BGCA 2FOKA 2H1LA 3JRAA 1ON2A 5FD6A 3GFLA 2CU7A 3H9GA 3J80Z 5F0CA 1OCZH 1W36C 3S3OA 1FBSA 3F21A 3BDDA 4M71A 4E70A 5DCFA 3P9CA 1YRNB 1S6LA 3OY9A 1FEXA 4CCNA 2F4IA 4HRIA 5K5QA 2R3SA 1TQPA 1S9HA 3KYCB 4DBQA 1EKEA 3HL2A 1T56A 2HVSA 5EZHA 1RZ4A 4L5EA 2HVQA 4XONA 1I6HJ 1UJ8A 2M4KA 2CQNA 1D3YA 1QZEA 2VONA 1JUMA 2RAEA 1MJ9A 4BQQA 2M5WA 4U0YA 4IX7A 5C44J 4ZJZA 3MN2A 1IXCA 3HJEA 2WADA 4G7HF 1ACIA 1OYYA 2H27A 4M3GA 3KP2A 1JI8A 4XLFA 2CV1A 3LSPA 2P0WA 3S1RJ 2V6EA 1WJEA 2BHZA 5LEJA 1VZ0A 2VE9A 3NARA 4Z6YA 3PSFA 3I64A 4IRGA 1RKTA 2E7XA 2ZJPF 3I54A 4HG2A 3WE2A 2E5NA 2QBYB 2V9PA 2TCTA 2L9RA 1FT9A 4RAGA 5AONA 1BR2A 5FO5A 4BS9A 3GX4X 2M2EA 3ECHA 2D5VA 2ZXJA 5KCMA 4RB2C 3ZQFA 1UG2A 3BJ6A 2WV0A 3DLAA 2CWEA 1IN5A 3F8NA 4LK0F 1PJRA 3CLQA 2KIUA 2DYSH 4D5FA 5B5EC 4V2FA 3C3WA 4W1UA 2V1XA 5ILSA 5HLTA 4OWRB 1WJBA 4AIJA 3F8BA 2ZMEC 3OYHA 4EVIA 2XGEA 4IOCF 3DU6A 1LUJB 1V4RA 1KQ0A 5ICGA 4RLQA 2B63J 4YIRX 3W2AA 1FY7A 3JREA 5E8IA 5HLHA 2QSFX 2VPRA 2HZDA 4KDPA 2E1CA 4KFCA 1OISA 1DPRA 2GBYA 4PJLA 5DEQA 1VQ5I 2A61A 3K2ZA 1J7KA 2DA3A 1FOWA 1WH7A 1NK2P 2K86A 3IP4B 2QQBA 4YEJA 1FMWA 4I09A 3H3ZA 1YJNI 1YW7A 2IW5A 3CJRB 3HOTA 3MKYB 3FK7A 3BTCA 1TT5B 2FBHA 1ZRCA 1BC8C 4YFXF 2PI0A 2NYXA 1J2XA 2JPBA 1U2WA 4U0VA 3DTKA 1QA6A 1VQKI 3CJQB 3IAM2 4BBRJ 4E7SA 5KVRA 5E3LA 3B02A 4Q4ZF 2PJRB 4ANJA 2IT0A 5AIQA 2VB6A 2OV7A 2HU9A 5EDNA 4OIQF 2ZMEA 3HRUA 4XLEA 5JI6A 2EK5A 1R49A 1MH4A 4ETSA 4Q48A 4QSHA 2CUEA 3WTSC 3L2QA 1B72B 5IT3A 4LB5A 4OIPF 4CCLA 3V8LA 1MD0A 1LE8B 2F5DA 5F27A 2DJNA 5K1YA 1O7FA 1XMKA 3RZDJ 2Z9OA 3AG1H 1RRJA 3H35A 4BHBA 1Q1VA 1X2MA 1MMGA 4FTHA 4S0HB 2QEXI 1GHCA 1NG7A 2BV6A 3HPGA 2JK3A 5EEAA 2L3DA 5F08A 4ZDPA 3SZPA 2ISYA 3M8FA 3JRCA 1PUFB 3OS1A 2IGKA 2NS8A 5E8GA 4ITVA 4KMFA 1F1ZA 4FE7A 4O6JA 3LA3A 4KT5C 1JHHA 3ML6A 1ENHA 2LP0A 4MQVA 3H0GJ 1BBYA 1JGSA 1P6RA 2E1MC 2H94A 2PN6A 2EIJH 2YX4A 4XOPA 3IRRA 4G94A 1MJBA 1OJLA 3ABUA 3ZR8X 2Y0SA 2X85A 2YSRA 2ZJ2A 3E5XA 4CZZA 4RGSA 2MD0A 1WVRA 2R7OA 1J09A 1Y8QB 4M9XA 3VWBA 3K1NA 2VODA 2W85A 3GO5A 1ZLKA 4DQ2A 4IQJA 1VF9A 2O5RA 2P6TA 3OMYA 4BXXJ 2UWMA 4ENMA 1RUOA 3OYDA 1EJ9A 2LDUA 5BNGA 1DPUA 2FBKA 5KNLA 1K6YA 3UNGC 3MFKA 1VFCA 4M9ZA 2CS3A 3ESWB 3JW4A 2DTZA 3K70C 3PIOF 1J75A 1BI2A 1T6SA 2WA0A 4B47A 5IYCJ 1TWFJ 1TC3C 1R7JA 2HOTA 3GTQJ 5EG0A 2DK8A 2MD5A 2ZFWA 1YS7A 2EQRA 4UY8I 1Y1WJ 3CDHA 2QYOA 3A03A 2DLLA 3VEPA 3V7CA 3U1DA 4L0YB 1ZG1A 2E2IJ 5CPRB 4K2EA 3J81Z 4O3MA 1F36A 3AKZA 1J0RA 1WKMA 1I3AA 2RQQA 4JK1X 4MHGA 3TP3A 2I10A 4AIHA 2HKOA 2QWWA 2QKMB 3BTIA 4UV8A 3AG4H 2WV1A 1E2XA 1NHAA 2AO9A 1XD7A 1Z6RA 4B09A 1T08B 1LVKA 1K4TA 1ZYRF 2CUFA 4ENKA 4YIIA 3GFIA 2VN2A 3WU0A 5ILVA 2CV0A 3A1YA 1T2KA 2JT1A 2JWTA 4I01A 4Y33A 2MW8A 3MKZA 1JJ6C 4JX6A 4AM3A 1Y39A 4AIDA 2XAHA 4FHTA 5GTIC 3BR0A 2LKXA 4WCGA 2DMNA 3VYTB 3N4MA 1NTCA 2DQRA 2CQQA 2LNBA 2VJIA 4BJ5C 4IQ4A 2M8EA 4DNCA 1R4NB 3TMOA 1EH8A 5BMZA 3K4KA 3M07A 1IN7A 1D5VA 3GTLJ 4IHSA 1MW7A 3MKWB 2E2JJ 1B4AA 1IZ1A 1YS6A 3CCLI 1PVEA 4HX8A 3W6JB 4L5JA 2K4BA 2V26A 3MZHA 1FSEA 2FA5A 2M0CA 5GPCA 1USTA 3L9FA 4RAZA 5J47A 4BJTA 1U78A 3HSFA 3D5LA 3OS2A 5JLWA 3PUBA 3VDXA 2MSYA 2RQPA 3D0SA 2C6YA 2WY7Q 2DA1A 4N9HA 1I39A 3C2GA 5EGOB 3OYAA 2LRDA 5D4SA 3SXYA 1T0FA 1FTZA 4BL0B 2NVXJ 1PP8F 1P92A 1OQYA 4M3BA 3KP6A 4AU7A 1G3TA 4D7NA 2NOGA 2GOMA 1HQCA 1Z3XA 2W24A 2Q2EA 3ASOH 3LA2A 5ED4A 4ZYGA 1SFXA 3CUOA 1IRFA 4TV7A 3IV5A 1BL0A 3J7AO 1FOXA 2R92J 2KL4A 2W7NA 4AVZA 4XM3A 4JP0A 3A0HC 3QYFA 4GYIA 3CC4I 2X6OA 3PUFA 1UHSA 4HYEA 4XR6A 5A2QK 3OV8A 1Y0NA 1LFBA 3ZQ7A 2JPCA 1X19A 2F4OB 4BH9A 4F55A 1Z9CA 2KJBA 5L3GA 2LY9A 2CSOA 3JTGA 2BYVE 2BVMA 4BYYA 4ZYEA 3PNTA 4PFOA 3S16J 1FOKA 2LC2A 3DPUA 2TRTA 3L2UA 2K02A 3QP6A 2P7VB 2XAGA 1PP7U 3DXJF 3K10A 1W1WE 5GTHC 5J1RA 1IRGA 3HHGA 2LBFA 3OR1C 5FROA 3W3CA 4A0ZA 1MZBA 3KETA 4U7BA 1GV2A 3LSRA 2PG4A 3K1MA 1ZQ3P 3QP5A 1FSHA 4G9YA 1XMXA 4BKXA 2F2EA 1IDZA 2B0LA 2EA2A 1FC3A 4XKBA 1YX5A 4U7DA 4CHUA 3QYBA 4EEFG 1S7AA 3K4BA 4GYGA 4BQAA 2GXGA 2VC1A 3O8HA 3GTOJ 2VBWA 1QVTA 3K2AA 2A5YB 3ZQCA 4MGRA 5D6EA 1O3RA 5D4RA 4LJZF 3KP5A 2XV4S 1I50J 4RAYA 2IS1A 2ID3A 3CUQB 4GGGA 2D45A 2QGUA 1HKSA 1MBKA 3F6VA 3L2CA 4BQOA 2V9KA 2GAUA 1LVAA 3WGGA 3K4MA 2ZXHA 1VQMI 3BLYA 1YJ9I 3FBNB 2CO5A 3OIPA 3MQ0A 2DFFA 2CV2A 4UXNA 3TP0A 2IP2A 3EUHA 1MSFC 1IGNA 3TW6A 1V5EA 2M87A 4PFPA 2DA5A 4KYWA 2E2HJ 1X4PA 3CF2A 3DWLE 4RGRA 5IYBJ 1W4MA 4KIFA 1ZLJA 2OA4A 5C3EJ 4EJUA 1K7AA 3ISPA 2G9WA 1O3SA 1IJWC 2E71A 3ZMTA 3ZQIA 1YG2A 5J6XA 1X1DA 2M7AA 4IHVA 3TO6A 3AAFA 1MSEC 1YOVB 4LK1F 3HOSA 3PO2J 3CZ6A 1SFEA 3SZTA 4A0XA 5HDNA 2BXYA 2L7FP 4C2TA 5C4JJ 2VUMJ 2YX7A 4ZYDA 4OMYA 2VQGA 4KITB 1I3QJ 2K5CA 2CW0F 4R8HA 3RSNA 2JN6A 1SEUA 3CO6C 1W5SA 4O5VA 1WZ2A 3QU6A 2L2OA 2VT3A 2XB5A 1HKQA 2HKXA 4NB5A 5M5YJ 4GRIA 1G6NA 2ZJRF 2IA2A 3B73A 2DFHA 2IPQX 3LSKA 3PSIA 5IP7J 5TRDA 3G1LA 2HQAA 4LG3A 3V8JA 1KZHA 2O8KA 4HW0A 2HXOA 3BG5A 4EV0A 2YU3A 2P7CB 2DTRA 3M1EA 2OJED 1TWHJ 3SHFA 1WCMJ 2DODA 3WTXC 2ELHA 4C9YA 1VQPI 2CQ7A 1EH6A 1HC8A 1B72A 1TTYA 1IXRC 4XIDA 3ASNH 1ZRFA 2XRNA 4M3FA 3EETA 3WTUC 4EJWA 3H0DA 2R7SA 1QZZA 2BY2A 1XC5A 3R6SA 1V3FA 2MABA 2FE3A 1BJZA 2W84A 2ZNYA 3GFMA 3I59B 5FKKA 4S05A 2Z16A 3GTPJ 2NOJB 3WTVC 3PIPF 3FHNA 1S29A 4E7JA 4FE4A 3OL3A 2HXIA 3A4CA 4XRMA 3HRTA 1WJCA 2R93J 3FMQA 1IO2A 2ZC2A 1VQ8I 5CVJA 3O6BB 5LLQA 3BC8A 3MKLA 2HGCA 3OOPA 4KMUX 3WGIA 2JUGA 1K6OA 3QOEA 3BQYA 3I55I 5H20A 2EWNA 4B8XA 4PSWA 3DKXA 4IL6C 5DTDA 3TOBA 2LTPA 4EM2A 4NHJA 2Q2EB 3JAMK 1ETYA 3P9KA 3H5NA 1Z05A 6PAXA 4E7LA 2G7UA 2R5YB 2OQGA 2XHKA 1FJLA 3G71I 4YFKF 5BPDA 5LGUA 4EM1A 4E7KA 1L0OC 1CQTA 3IKVA 1FIAA 5K7ZA 4W97A 2HOSA 3VPRA 3BOQA 5HDKA 3J7AY 4JYKA 3LSMA 1IN8A 1RKWA 1SC7A 4EM0B 3L00A 1YHQI 2V6CA 4HNUA 4A5NA 4XBFA 1A6QA 2ESNA 3T5XA 2EZKA 1IRXA 1BIBA 4BJ6C 5GAHJ 3H5RA 4KN4X 1BC7C 2OBPA 1X4OA 3GYHX 1TWGJ 3GXOA 2UV1A 4PZJA 3I58A 5H6QA 3Q9SA 1ERDA 3GLLA 1ZN2A 2CYYA 5JVGF 5H6RA 4IZZA 1U8RA 4UB6C 1RIOH 1TQIA 3NWTA 4RM2A 2MH9A 2O7OA 1VQOI 2KPMA 1A31A 1VQ6I 4EQQA 5LHHA 2V1DA 1XCBA 3FXKA 5ICCA 2VKDA 2X51A 2EIMH 1BW6A 4LD5A 2EFWA 3HEFA 2ZO4A 2W4SA 3JAMZ 2NS0A 4GO1A 3GUDA 1H0MA 4FASD 2R0QC 4HSRA 5JVTA 4XOTA 3HZJA 1YW8A 3ZMDA 4IRIA 2OU2A 1FNNA 1OCCH 5LD2C 2XAQA 3MMYB 2KFDA 3BP8A 4XSZF 4H0EA 1J59A 3BR6A 4HOBA 2Z2SB 2M1BA 2V7FA 2VL8A 4NC7A 1R22A 3GTGJ 1LJ9A 5HNHA 3B6CA 2YUSA 3GVAA 2BW3B 4Y52J 2CMPA 2FXAA 5D5XB 1YO5C 3RZOJ 2JZYA 2RNGA 2FNPA 5M3MJ 4A2UA 1GVJA 3ZMUA 2CFOA 4FX4A 1FTTA 2X0LA 3R0JA 3RKXA 3Q5FA 2IA1A 2VASA 4IPAA 1YYVA 1UHMA 4DZJA 5CVVA 4I02A 4PDKA 1VNDA 2BHYA 3OIQA 4DGWB 5J8FA 5BQTA 2PMHA 3DFGA 2OAZA 2E7WA 1HKTA 3LL7A 3RDIA 3CD6I 1LFUP 1TW3A 3QAHA 2LSOA 2V1NA 1WWXA 3IAS2 1WPKA 4A3GJ 1A6IA 3OYFA 2HPIA 1OYWA 1Y0UA 3DV8A 2NRAC 2ZNZA 2VE8A 2KRCA 3CMEI 4B48A 4DIQA 5J40A 2LK2A 2K40A 3DBRB 2VBZA 2O03A 5L3CA 3REOA 4HX7A 1X3UA 1YRNA 5IOYA 1XDUA 2FD5A 3H3VK 3E6CC 4XSXF 1H88C 2ID6A 2B7EA 1OCTC 1IN4A 3LNQA 2H8WA 3WTTC 2L5QA 1KA8A 3DQVC 4OINF 4I76A 2M34A 4LFUA 3OYBA 2RGVA 2OTJI 4D7MA 3D1NI 3P7NA 1S3JA 3HYIA 4HLXA 2FOWA 1BR1A 1SFKA 2H8RA 1OCPA 2XAJA 5FLXZ 4BACA 1SANA 1SVMA 2UZKA 2XF5A 4RLFA 2XDVA 4HNTA 4XN3A 1E0EA 2P81A 2XSDC 2M7BA 2COBA 1I1SA 4UVCA 1BI0A 1S5LC 4HF0A 2A6TA 1T0FC 2KISA 2YS9A 3CDIA 4RB0A 1QO0D 4HQEA 3TEDA 3GCMA 1Y6IA 2A5WA 2HQRA 3HRSA 5ICEA 2WAQN 1S7OA 2NS7A 2OPTA 5LFAA 4NNJA 4A6EA 4CDGA 3S1MJ 5KK1A 4IF4A 3CO7C 2EV5A 4PJNA 1HW1A 5EJCA 4NQWA 4A3LJ 1APLC 3V7RA 5LHGA 4A69C 1K78B 2R7RA 4LG0B 3WTWC 4CZCA 2B9SA 3HC7A 4HBLA 2KMUA 3PFYA 2IVMA 3M9AA 2QSGX 1D1AA 3OR2C 2GM4A 1G3WA 3ZP5A 2JJ7A 3HM5A 2MC3A 1GXQA 4WWCA 1DDNA 2EH3A 3H9QA 1R1UA 1BI1A 3CJNA 2IS2A 4JBAA 5FFZA 3G2BA 4Y17A 5CJ9A 3TW7A 2W25A 2K27A 2K9MA 3FIWA 1U9OA 2DA6A 2GA2A 3VYUB 1KQ9A 4HEA2 3RQ4A 4D9JA 3S2WA 1XGMA 3TO7A 4AD9A 4CYCA 5M3FJ 2RKHA 5D5UB 1ITYA 2P8TA 1X1PA 3JCUC 3Q3SA 2F5FA 1HW5A 3FF5A 5E20A 2K85A 3WODF 3F23A 4LG0A 1K78A 3S14J 1UZCA 3TDZC 5L3EA 4HA8A 2STTA 3KCCA 4AYBN 2W48A 1GVDA 4UUTA 2ISZA 3CCJI 5E17F 3TKYA 1OCRH 1MBGA 4P5OA 5HLGA 1O3QA 2F5EA 3BZ6A 3WHBA 1OCOH 3HSEA 4KUMA 4Q5SF 3FISA 4P96A 2QM3A 4M73A 4MNUA 2DAOA 2AXTC 1JUPA 2UUZA 3LSGA 2CGPA 3LWFA 2HQ5A 5A2QZ 2Y9YA 1BW5A 1RR7A 1BJAA 1IG7A 2EZIA 3HXLA 5HNFA 4X6AJ 4MQ9F 2X1DA 5J1YA 2LYCA 3K0LA 1TL8A 1FP1D 1N75A 3C1DA 1X2NA 2J5OA 1RC9A 2E36A 2LY2A 3A2KA 2FRHA 3BT9A 2QQAA 1LEAA 5CLSA 1AWCA 4OMZA 2ZKZA 4KISA 4S04A 1KYZA 3H1CA 3BPVA 4A0YA 1HBXG 2IGNA 3S3NA 4HQMA 3LOCA 2QZ8A 5L3FA 1WSUA 4PJ0C 1M1EB 3R61A 3U21A 2NVTJ 2FQ4A 2OZUA 4BDYA 1YTYA 1YW9A 3CC7I 4WXCA 3EUKL 3COAC 4U0WA 1XGSA 4C3HJ 2DFIA 1IXSB 2XUBA 2JUCA 3K4NA 2XPWA 1BI3A 4CICA 5LGTA 3JRHA 2MLKA 1ZGJA 3IHUA 1YI2I 1GT0C 2NAZA 1SAUA 1MMDA 4ENNA
chains in the Genus database with same CATH topology
4M3EA 1H8AC 5IPAA 5E3MA 4AUXA 3UKGA 1JKPC 1JKQC 5GPAA 2Y0SN 4BY7J 2M9HA 2ME0A 3HOVJ 3TP0A 2ME6A 1MSFC 1IGNA 5FLVA 2N8GA 3TW6A 5F1JA 1QPIA 2DA5A 2K9QA 3BR5A 3S2DJ 3WHCA 4DYCA 1SFOJ 2E2HJ 1HCRA 3M4OJ 1HLVA 2HI3A 1HF0A 1RESA 2Y30A 5IYBJ 1ZR2A 2G0EA 3FK6A 2LD5A 5C3EJ 4A3MJ 4A93J 2JMWA 1MNMC 3CDLA 3JRFA 2E19A 1IJWC 2XPUA 9ANTA 4A3JJ 2WB1N 3ZQIA 1W0TA 2CJJA 1D5YA 4IHVA 4I6ZA 1IC8A 5E3OA 1MSEC 5FKNA 2K9SA 3DEWA 3PO2J 3JRAA 2L7FP 3ZQLA 5C4JJ 2VUMJ 2CU7A 1I3QJ 3HKZN 5F0CA 1H89C 1VI0A 2HYJA 4DYQA 4CYCB 2JN6A 1AHDP 2HDDA 4AC0A 4LOCA 1FEXA 1YRNB 5EG0B 1WI3A 2XB5A 5EGOA 2KDZA 5M5YJ 5FJ8J 3S15J 1T56A 5EZHA 2IEKA 4L5EA 2QCOA 1IRZA 2LFBA 5IP7J 1I6HJ 4IHXA 2Y2ZA 1JUMA 3G1LA 2RAEA 4A3KJ 2VKEA 5C44J 3MN2A 2XRLA 2O8KA 2HXOA 3BG5A 4M3GA 3I4MJ 4RDUA 1TWHJ 3OIOA 4IHYA 1WCMJ 3LSPA 1OFCX 3BR1A 5F0FA 1K61A 3S1RJ 3BQZA 3BG9A 3F0CA 4QTRA 1B72A 5FLMJ 1WGXA 4XIDA 3NARA 2L7ZA 4M3FA 1RKTA 1B8IA 5EYRA 3RKQA 3HDDA 1HDPA 1XC5A 5FKKA 1BJZA 3S1NJ 2MG4A 3GTPJ 4NDLA 2TCTA 2L9RA 1ZK8A 3HGGA 3CMYA 2M2EA 4FE4A 4FISA 3Q0WA 2D5VA 1UMQA 2DA2A 3ZQFA 1UG2A 2HXIA 4XRMA 2R93J 1JT0A 5EF6A 4D5FA 4MIMA 2FX0A 4V2FA 1PUFA 4W1UA 5FKMA 3MKLA 3BQYA 1ZKGA 4A3BJ 2XGEA 4XRSA 2IBDA 5DTDA 3DCFA 1Z77A 4ABZA 2LTPA 3HGYA 4B3AA 1HDDC 2EBIA 4IHWA 2O9LA 1IDYA 2X48A 2B63J 3IH4A 2NVQJ 1ETYA 3JREA 2VPRA 2Y9ZA 4RBOA 1X58A 2AHQA 2LLKA 2GBYA 2R5YB 3JRIA 1FJLA 2DA3A 1WH7A 1NK2P 2CRGA 4M3DA 5IYDJ 4C2MJ 1R9TJ 2MGQA 1CQTA 3FK7A 5M5XJ 1K83J 1FIAA 3BTCA 4C3JJ 5K7ZA 4W97A 3SJMA 3VPRA 2HOSA 1EF4A 4JYKA 1E3OC 1RKWA 4HNVA 4UUSB 1XG1A 2EZHA 4BBRJ 1JUSA 3W6VA 3LSJA 5E3LA 3SDGA 4A3CJ 4IEJA 2EZKA 3I4NJ 4A3FJ 5EDNA 1G2HA 4XK4A 1QRYA 4X1EA 1TWGJ 1MH4A 3BTLA 4QSHA 1JT6A 1FIPA 5FKLA 1MBFA 2CUEA 1B72B 2LR8A 2O7OA 1LE8B 1GUUA 2ECBA 5F27A 2DJNA 3G1OA 3RZDJ 5J3LA 4A3DJ 1Q1VA 1X2MA 1BW6A 3HEFA 3HBLA 3A02A 4M6VA 2JA7J 4FTHA 4S0HB 2R0QC 4FCYA 3S1QJ 2JK3A 5EEAA 5F08A 3OOUA 4J19A 3JRCA 1PUFB 5K7FA 2DMTA 3BR6A 2NS8A 1U9NA 2XGCA 5IOZA 1ETKA 1ZR4A 1DU6A 4FE7A 3C2BA 3GTGJ 3B6CA 2YUSA 2X9DA 1JKRC 4Y52J 1NK3P 1ENHA 2LP0A 3E7LA 3H0GJ 3RZOJ 3BR2A 5M3MJ 3NAUA 1OJLA 1W0UA 1FTTA 3ZOBA 2EZLA 4DZPA 1Y1VJ 1S7EA 4DZJA 1MBHA 1VNDA 3HOWJ 4BBSJ 3JRDA 1VF9A 2L7MP 4BXXJ 1LFUP 2NVYJ 4A3IJ 2VKVA 2K9NA 5BNGA 1IUFA 5IP9J 4A3EJ 4UUSA 1WPKA 1VFCA 4A3GJ 1A6IA 4D5CA 2FJ1A 5F0HA 2DTZA 2DA7A 4XICA 1T33A 3PO3J 3GTMJ 1ETQA 1DU0A 2LK2A 2K40A 5IYCJ 1TWFJ 1B8IB 1TC3C 2HOTA 1QVUA 3HB9A 3CQZJ 3GTQJ 5EG0A 5GP9A 3GBGA 1JGGA 1YRNA 5IOYA 2EQRA 2FD5A 3H3VK 1Y1WJ 2HOAA 3A03A 5DS9A 1H88C 2ID6A 1OCTC 3LNQA 2E2IJ 2DMPA 1F36A 3HOZJ 3B6AA 2M34A 4I76A 3TP3A 2I10A 2JA5J 3BG3A 2DMQA 4D7MA 3D1NI 3BTIA 3MVPA 1F43A 3M3YJ 2WV1A 2H8RA 2AO9A 1OCPA 1MBJA 1ZTRA 1SANA 2ELKA 2ZB9A 4JX4A 3HOYJ 2CUFA 2P81A 2XSDC 2COBA 2JWTA 3HOUJ 2MW8A 1JJ6C 4JX6A 3TEDA 2YS9A 3IH3A 5HODA 4MFDA 3BR0A 2LKXA 2DMNA 2WAQN 2E1OA 1ETVA 1Z0XA 3ZQHA 2NS7A 2OPTA 1NTCA 3S1MJ 2CQQA 2IAIA 1U8BA 2ECCA 4GFBA 1ETWA 4A3LJ 1APLC 5FKOA 4A69C 3GTKJ 3GTLJ 1XS9A 2E2JJ 3OSFA 2GM4A 2JJ7A 3HM5A 2DMUA 4MLOA 3BTJA 2OF7A 2EH3A 2M0CA 5J1UA 5GPCA 4BY1J 1U78A 1IV6A 2R5ZB 5JLWA 3TW7A 1ETOA 4B4CA 2MSYA 1A5JA 3OSGA 3FIWA 2DA1A 5M5WJ 1U9OA 2DA6A 3A01A 5EGOB 1BA5A 1POGA 3JR9A 1FTZA 2R5YA 2XGDA 2NVXJ 1ZGWA 4C3IJ 4M3BA 1JJ8C 4CYCA 5M3FJ 3S17J 2JA8J 4D7NA 2NOGA 1ITYA 3PM1A 2H1KA 1RETA 3Q3SA 1AKHA 1BL0A 3IV5A 1LE8A 1ETXA 2R92J 1GDTA 3S2HJ 3G1MA 3S14J 3RQIA 5JLXA 3L1PA 5C4XJ 4JP0A 3QPLA 3JRGA 4AYBN 2W48A 2XB0X 1GVDA 2X6OA 4UUTA 1UHSA 2DA4A 3Q0UA 4V2GA 2VI6A 1LFBA 2DN0A 2R5ZA 1MBGA 4DYRA 2M8GX 2XPVA 1WH5A 1TWCJ 3WHBA 4QIWN 3QPSA 2LY9A 5E3NA 2LVSA 3FISA 3BR3A 2YU9J 4DW6A 5K7HA 1JUPA 3LSGA 3S16J 2TRTA 3FKIJ 3QQAA 2HQ5A 3O8GA 2CQXA 2Y9YA 1RR7A 1BW5A 3Q0VA 1RPWA 1JTXA 1TWAJ 1IG7A 2EZIA 1JTYA 3K7AJ 4MFEA 4X6AJ 4Y7NJ 1AU7A 5J1YA 4JX5A 5J1RA 1JKOC 3IH2A 4G12A 2Y31A 1X2NA 1GV5A 4XRSG 3BT9A 5F04A 1P7JA 2L0KA 2R7ZJ 2PMZN 1GV2A 3LSRA 1ZQ3P 5IP6A 4BKXA 3JRBA 3ZQGA 1IDZA 2JA6J 5EZGA 1ORKA 3HOXJ 3LOCA 4B1RA 3A01B 4EEFG 1O4XA 1MH3A 2NVTJ 2FQ4A 3O8HA 3GTOJ 3SFIA 1HOMA 1QVTA 1MBEA 3K2AA 2QF7A 3ZQCA 3CCYA 3GTJJ 4C3HJ 2KT0A 1I50J 2GLOA 1AKHB 2XPWA 3JRHA 2ID3A 1GT0C 1P7IA 4MO7A 1MBKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4M3E A;  1H8A C;  5IPA A;  5E3M A;  4AUX A;  3UKG A;  1JKP C;  1JKQ C;  5GPA A;  2Y0S N;  4BY7 J;  2M9H A;  2ME0 A;  3HOV J;  3TP0 A;  2ME6 A;  1MSF C;  1IGN A;  5FLV A;  2N8G A;  3TW6 A;  5F1J A;  1QPI A;  2DA5 A;  2K9Q A;  3BR5 A;  3S2D J;  3WHC A;  4DYC A;  1SFO J;  2E2H J;  1HCR A;  3M4O J;  1HLV A;  2HI3 A;  1HF0 A;  1RES A;  2Y30 A;  5IYB J;  1ZR2 A;  2G0E A;  3FK6 A;  2LD5 A;  5C3E J;  4A3M J;  4A93 J;  2JMW A;  1MNM C;  3CDL A;  3JRF A;  2E19 A;  1IJW C;  2XPU A;  9ANT A;  4A3J J;  2WB1 N;  3ZQI A;  1W0T A;  2CJJ A;  1D5Y A;  4IHV A;  4I6Z A;  1IC8 A;  5E3O A;  1MSE C;  5FKN A;  2K9S A;  3DEW A;  3PO2 J;  3JRA A;  2L7F P;  3ZQL A;  5C4J J;  2VUM J;  2CU7 A;  1I3Q J;  3HKZ N;  5F0C A;  1H89 C;  1VI0 A;  2HYJ A;  4DYQ A;  4CYC B;  2JN6 A;  1AHD P;  2HDD A;  4AC0 A;  4LOC A;  1FEX A;  1YRN B;  5EG0 B;  1WI3 A;  2XB5 A;  5EGO A;  2KDZ A;  5M5Y J;  5FJ8 J;  3S15 J;  1T56 A;  5EZH A;  2IEK A;  4L5E A;  2QCO A;  1IRZ A;  2LFB A;  5IP7 J;  1I6H J;  4IHX A;  2Y2Z A;  1JUM A;  3G1L A;  2RAE A;  4A3K J;  2VKE A;  5C44 J;  3MN2 A;  2XRL A;  2O8K A;  2HXO A;  3BG5 A;  4M3G A;  3I4M J;  4RDU A;  1TWH J;  3OIO A;  4IHY A;  1WCM J;  3LSP A;  1OFC X;  3BR1 A;  5F0F A;  1K61 A;  3S1R J;  3BQZ A;  3BG9 A;  3F0C A;  4QTR A;  1B72 A;  5FLM J;  1WGX A;  4XID A;  3NAR A;  2L7Z A;  4M3F A;  1RKT A;  1B8I A;  5EYR A;  3RKQ A;  3HDD A;  1HDP A;  1XC5 A;  5FKK A;  1BJZ A;  3S1N J;  2MG4 A;  3GTP J;  4NDL A;  2TCT A;  2L9R A;  1ZK8 A;  3HGG A;  3CMY A;  2M2E A;  4FE4 A;  4FIS A;  3Q0W A;  2D5V A;  1UMQ A;  2DA2 A;  3ZQF A;  1UG2 A;  2HXI A;  4XRM A;  2R93 J;  1JT0 A;  5EF6 A;  4D5F A;  4MIM A;  2FX0 A;  4V2F A;  1PUF A;  4W1U A;  5FKM A;  3MKL A;  3BQY A;  1ZKG A;  4A3B J;  2XGE A;  4XRS A;  2IBD A;  5DTD A;  3DCF A;  1Z77 A;  4ABZ A;  2LTP A;  3HGY A;  4B3A A;  1HDD C;  2EBI A;  4IHW A;  2O9L A;  1IDY A;  2X48 A;  2B63 J;  3IH4 A;  2NVQ J;  1ETY A;  3JRE A;  2VPR A;  2Y9Z A;  4RBO A;  1X58 A;  2AHQ A;  2LLK A;  2GBY A;  2R5Y B;  3JRI A;  1FJL A;  2DA3 A;  1WH7 A;  1NK2 P;  2CRG A;  4M3D A;  5IYD J;  4C2M J;  1R9T J;  2MGQ A;  1CQT A;  3FK7 A;  5M5X J;  1K83 J;  1FIA A;  3BTC A;  4C3J J;  5K7Z A;  4W97 A;  3SJM A;  3VPR A;  2HOS A;  1EF4 A;  4JYK A;  1E3O C;  1RKW A;  4HNV A;  4UUS B;  1XG1 A;  2EZH A;  4BBR J;  1JUS A;  3W6V A;  3LSJ A;  5E3L A;  3SDG A;  4A3C J;  4IEJ A;  2EZK A;  3I4N J;  4A3F J;  5EDN A;  1G2H A;  4XK4 A;  1QRY A;  4X1E A;  1TWG J;  1MH4 A;  3BTL A;  4QSH A;  1JT6 A;  1FIP A;  5FKL A;  1MBF A;  2CUE A;  1B72 B;  2LR8 A;  2O7O A;  1LE8 B;  1GUU A;  2ECB A;  5F27 A;  2DJN A;  3G1O A;  3RZD J;  5J3L A;  4A3D J;  1Q1V A;  1X2M A;  1BW6 A;  3HEF A;  3HBL A;  3A02 A;  4M6V A;  2JA7 J;  4FTH A;  4S0H B;  2R0Q C;  4FCY A;  3S1Q J;  2JK3 A;  5EEA A;  5F08 A;  3OOU A;  4J19 A;  3JRC A;  1PUF B;  5K7F A;  2DMT A;  3BR6 A;  2NS8 A;  1U9N A;  2XGC A;  5IOZ A;  1ETK A;  1ZR4 A;  1DU6 A;  4FE7 A;  3C2B A;  3GTG J;  3B6C A;  2YUS A;  2X9D A;  1JKR C;  4Y52 J;  1NK3 P;  1ENH A;  2LP0 A;  3E7L A;  3H0G J;  3RZO J;  3BR2 A;  5M3M J;  3NAU A;  1OJL A;  1W0U A;  1FTT A;  3ZOB A;  2EZL A;  4DZP A;  1Y1V J;  1S7E A;  4DZJ A;  1MBH A;  1VND A;  3HOW J;  4BBS J;  3JRD A;  1VF9 A;  2L7M P;  4BXX J;  1LFU P;  2NVY J;  4A3I J;  2VKV A;  2K9N A;  5BNG A;  1IUF A;  5IP9 J;  4A3E J;  4UUS A;  1WPK A;  1VFC A;  4A3G J;  1A6I A;  4D5C A;  2FJ1 A;  5F0H A;  2DTZ A;  2DA7 A;  4XIC A;  1T33 A;  3PO3 J;  3GTM J;  1ETQ A;  1DU0 A;  2LK2 A;  2K40 A;  5IYC J;  1TWF J;  1B8I B;  1TC3 C;  2HOT A;  1QVU A;  3HB9 A;  3CQZ J;  3GTQ J;  5EG0 A;  5GP9 A;  3GBG A;  1JGG A;  1YRN A;  5IOY A;  2EQR A;  2FD5 A;  3H3V K;  1Y1W J;  2HOA A;  3A03 A;  5DS9 A;  1H88 C;  2ID6 A;  1OCT C;  3LNQ A;  2E2I J;  2DMP A;  1F36 A;  3HOZ J;  3B6A A;  2M34 A;  4I76 A;  3TP3 A;  2I10 A;  2JA5 J;  3BG3 A;  2DMQ A;  4D7M A;  3D1N I;  3BTI A;  3MVP A;  1F43 A;  3M3Y J;  2WV1 A;  2H8R A;  2AO9 A;  1OCP A;  1MBJ A;  1ZTR A;  1SAN A;  2ELK A;  2ZB9 A;  4JX4 A;  3HOY J;  2CUF A;  2P81 A;  2XSD C;  2COB A;  2JWT A;  3HOU J;  2MW8 A;  1JJ6 C;  4JX6 A;  3TED A;  2YS9 A;  3IH3 A;  5HOD A;  4MFD A;  3BR0 A;  2LKX A;  2DMN A;  2WAQ N;  2E1O A;  1ETV A;  1Z0X A;  3ZQH A;  2NS7 A;  2OPT A;  1NTC A;  3S1M J;  2CQQ A;  2IAI A;  1U8B A;  2ECC A;  4GFB A;  1ETW A;  4A3L J;  1APL C;  5FKO A;  4A69 C;  3GTK J;  3GTL J;  1XS9 A;  2E2J J;  3OSF A;  2GM4 A;  2JJ7 A;  3HM5 A;  2DMU A;  4MLO A;  3BTJ A;  2OF7 A;  2EH3 A;  2M0C A;  5J1U A;  5GPC A;  4BY1 J;  1U78 A;  1IV6 A;  2R5Z B;  5JLW A;  3TW7 A;  1ETO A;  4B4C A;  2MSY A;  1A5J A;  3OSG A;  3FIW A;  2DA1 A;  5M5W J;  1U9O A;  2DA6 A;  3A01 A;  5EGO B;  1BA5 A;  1POG A;  3JR9 A;  1FTZ A;  2R5Y A;  2XGD A;  2NVX J;  1ZGW A;  4C3I J;  4M3B A;  1JJ8 C;  4CYC A;  5M3F J;  3S17 J;  2JA8 J;  4D7N A;  2NOG A;  1ITY A;  3PM1 A;  2H1K A;  1RET A;  3Q3S A;  1AKH A;  1BL0 A;  3IV5 A;  1LE8 A;  1ETX A;  2R92 J;  1GDT A;  3S2H J;  3G1M A;  3S14 J;  3RQI A;  5JLX A;  3L1P A;  5C4X J;  4JP0 A;  3QPL A;  3JRG A;  4AYB N;  2W48 A;  2XB0 X;  1GVD A;  2X6O A;  4UUT A;  1UHS A;  2DA4 A;  3Q0U A;  4V2G A;  2VI6 A;  1LFB A;  2DN0 A;  2R5Z A;  1MBG A;  4DYR A;  2M8G X;  2XPV A;  1WH5 A;  1TWC J;  3WHB A;  4QIW N;  3QPS A;  2LY9 A;  5E3N A;  2LVS A;  3FIS A;  3BR3 A;  2YU9 J;  4DW6 A;  5K7H A;  1JUP A;  3LSG A;  3S16 J;  2TRT A;  3FKI J;  3QQA A;  2HQ5 A;  3O8G A;  2CQX A;  2Y9Y A;  1RR7 A;  1BW5 A;  3Q0V A;  1RPW A;  1JTX A;  1TWA J;  1IG7 A;  2EZI A;  1JTY A;  3K7A J;  4MFE A;  4X6A J;  4Y7N J;  1AU7 A;  5J1Y A;  4JX5 A;  5J1R A;  1JKO C;  3IH2 A;  4G12 A;  2Y31 A;  1X2N A;  1GV5 A;  4XRS G;  3BT9 A;  5F04 A;  1P7J A;  2L0K A;  2R7Z J;  2PMZ N;  1GV2 A;  3LSR A;  1ZQ3 P;  5IP6 A;  4BKX A;  3JRB A;  3ZQG A;  1IDZ A;  2JA6 J;  5EZG A;  1ORK A;  3HOX J;  3LOC A;  4B1R A;  3A01 B;  4EEF G;  1O4X A;  1MH3 A;  2NVT J;  2FQ4 A;  3O8H A;  3GTO J;  3SFI A;  1HOM A;  1QVT A;  1MBE A;  3K2A A;  2QF7 A;  3ZQC A;  3CCY A;  3GTJ J;  4C3H J;  2KT0 A;  1I50 J;  2GLO A;  1AKH B;  2XPW A;  3JRH A;  2ID3 A;  1GT0 C;  1P7I A;  4MO7 A;  1MBK A; 
#chains in the Genus database with same CATH topology
 1H8A C;  4L9N A;  1QHG A;  2LKS A;  1JKP C;  1XX5 A;  2XF6 A;  1JKQ C;  2HDC A;  4UB8 C;  4BY7 J;  2CUJ A;  2DPU A;  2LG4 A;  2M9H A;  2ZSH B;  4CCJ A;  4HF1 A;  5LGN A;  3LQQ A;  1A36 A;  4CCK A;  2ME6 A;  1FX7 A;  5F1J A;  4JQF A;  1EV7 A;  1QPI A;  5BOX A;  3S2D J;  2F5C A;  4DYC A;  2DQL A;  4UUV A;  1HCR A;  1J9I A;  2HI3 A;  3O2P E;  3DKW A;  2JSP A;  1K79 A;  4DBR A;  1Z91 A;  2LD5 A;  2HTS A;  1NG6 A;  4N0B A;  3FBI B;  2O0Y A;  4A93 J;  1SD6 A;  5HDG A;  4E4H A;  4AVP A;  1A04 A;  5LHI A;  2AXL A;  2KLO A;  9ANT A;  5J4V A;  2HFH A;  3ABK H;  1XSD A;  4JOM A;  1ZHF A;  1QPM A;  1VQN I;  4I6Z A;  3DEW A;  3IWZ A;  5F6F A;  3ZQL A;  1ON1 A;  4BXF A;  3J81 K;  2NXN B;  3HKZ N;  2BW3 A;  3BJO A;  3RTR A;  2HYJ A;  4DYQ A;  4CYC B;  2DO7 A;  3M8E A;  2IJL A;  4I2O A;  3TOA A;  3HSR A;  1WI3 A;  5D8K B;  2KDZ A;  1YIT I;  2QUF A;  3DTI A;  3IC7 A;  5FJ8 J;  3TO9 A;  4BEH B;  3WU1 B;  3CCU I;  2QCO A;  1IRZ A;  4P55 A;  2LFB A;  2MBF A;  4HV6 A;  5LRS A;  2HDW A;  2Y2Z A;  1X1B A;  2CG4 A;  2VKE A;  3GZ6 A;  4OU0 A;  5B3S H;  1R4M B;  4MEX F;  2D1V A;  2XC7 A;  3KYD B;  2BY1 A;  2FEZ A;  2VQC A;  2VJ4 A;  4F91 B;  1XCV A;  3OIO A;  3I71 A;  2F6C A;  4RAF A;  2Q8K A;  3W2V A;  4ZTJ A;  3QOP A;  1OFC X;  5F0F A;  4LB6 B;  3BQZ A;  3BG9 A;  5FLM J;  4L5I A;  4I99 C;  4NQW B;  2L7Z A;  4UVA A;  3V42 A;  1E3P A;  2R4G A;  4AIK A;  2DYR H;  5EYR A;  3RKQ A;  5DM7 F;  1B8I A;  1HDP A;  3HDD A;  4C2U A;  1QU3 A;  1T8I A;  3M7G A;  3OYC A;  3FXQ A;  3S1N J;  2MG4 A;  4NDL A;  2A07 F;  5LEK A;  1ZK8 A;  1R5G A;  1RUN A;  4XLP F;  1I1G A;  1B1B A;  3Q0W A;  4FT8 A;  1R23 A;  1UMQ A;  3IWF A;  4OAZ A;  4KN7 X;  1Y8R B;  2RN7 A;  2L7K A;  4KIB A;  3BZC A;  3I0T A;  1WJF A;  5EF6 A;  1SFU A;  2L54 A;  1FWZ A;  2R7U A;  3I4P A;  4G8X A;  3GZ5 A;  2DXI A;  3KIO A;  3DF8 A;  1ZKG A;  2NNY A;  4NC6 A;  1T39 A;  4LLG F;  2IBD A;  3HTS B;  4XLA A;  1U5T C;  1DGW Y;  3OWT A;  2OCC H;  2O9L A;  4IHW A;  5DV5 A;  2JVH A;  3DU5 A;  1LB2 A;  5DDG A;  2ETH A;  2QLZ A;  5DYM A;  1BOA A;  2K3P A;  4RBO A;  3CCQ I;  3PNY A;  3OYI A;  1X58 A;  3F72 A;  2DW4 A;  3JRI A;  2X1E A;  1P4A A;  4M6X A;  3I59 A;  4N4N B;  1FMV A;  5IYD J;  3H3U A;  5TIS C;  4C2M J;  1TZL A;  1UEL B;  2A05 A;  3GFJ A;  3BY6 A;  2MGQ A;  3GF2 A;  2DK5 A;  4EAT A;  3AFH A;  5M5X J;  1P4X A;  2PMU A;  2DCE A;  4HX4 A;  2ZXI A;  1IN6 A;  3SJM A;  1PUE E;  1RR8 C;  1EF4 A;  3QWL A;  2KZG A;  1ZG5 A;  4HNV A;  3RKW A;  1XG1 A;  2BBY A;  2EZH A;  2R7F A;  1JUS A;  1PYV A;  3LSJ A;  3W6V A;  1FYL A;  2GA1 A;  2WBM A;  4J01 A;  3KP3 A;  4A3C J;  1Z7L A;  4IEJ A;  2W82 A;  3ROU A;  3AL0 C;  2FF4 A;  3QPH A;  4XK4 A;  2OD5 A;  3KP7 A;  3E0J B;  5HS9 A;  3ZMV A;  4X1E A;  5E1Z B;  3PFI A;  2IRF G;  3CCE I;  1TBX A;  1D0Y A;  3BTL A;  5F1R A;  3Q9V A;  5DCM B;  1FIP A;  1MBF A;  2ZBK A;  5FKL A;  3ABT A;  1E17 A;  3DEE A;  1GUU A;  2ECB A;  3C2H A;  2XAS A;  3G1O A;  4NC8 A;  1R71 A;  3DBL B;  4XKV A;  3ZXS A;  2BY0 A;  1TW2 A;  1WHU A;  3F8F A;  4M6V A;  2XIG A;  4LIT A;  3IRQ A;  1P4W A;  2MA3 A;  4EGY A;  4FCY A;  3A0B C;  4ZDO A;  2VOO A;  3S1Q J;  2WB1 A;  4M74 A;  3OOU A;  4YRV A;  1B6A A;  2BZT A;  4J19 A;  4EJO A;  5K7F A;  4A5M A;  3ABL H;  2DMT A;  4EJT A;  2EFQ A;  3FXM A;  3KLN A;  1U9N A;  1WI9 A;  5IOZ A;  3EYI A;  1ETK A;  1DU6 A;  2RC4 A;  3C2B A;  2IA0 A;  4ZC3 A;  2VJJ A;  5E79 C;  2EFO A;  5HLI A;  1LQ1 A;  1O7L A;  3CF5 F;  1NK3 P;  4EMS A;  2ZJQ F;  2LF8 A;  2FU4 A;  1U0J A;  5FD5 A;  5B66 C;  3BR2 A;  1STZ A;  4BUP A;  3NAU A;  3WG7 H;  3WE3 A;  2AQE A;  3EPZ A;  3V7S A;  2LBF B;  1BIA A;  1JE8 A;  1VTN C;  4DZP A;  4WK8 F;  4E7Z A;  2PBI A;  1S7E A;  2K3F A;  1LDD A;  3FMR A;  4I7H A;  1KON A;  4BBS J;  3JRD A;  1I27 A;  2H6B A;  2L7M P;  3BRO A;  2QA4 I;  3RYR A;  2NVY J;  4II3 A;  4A3I J;  2VKV A;  1WJA A;  5HOO A;  2K9N A;  5IP9 J;  4A3E J;  1X3W B;  1LFP A;  4UUS A;  2E1M B;  1C0W A;  4IHT A;  4YFN F;  4Z2Y A;  1KU9 A;  1W7P A;  5EEH A;  3DPL C;  1KQ8 A;  4WX9 A;  3K1P A;  3U1K A;  5BPI A;  2TDX A;  2FMY A;  1KYW A;  1D1B A;  3HB9 A;  3NQO A;  3F3X A;  5GP9 A;  4MTE A;  3UR3 C;  1FYK A;  1ODD A;  3R4K A;  1RI7 A;  1G59 A;  3LAJ A;  2V79 A;  3SEQ A;  5L3B A;  4RGU A;  2LRE A;  3ABM H;  1TQM A;  1MND A;  1XTA A;  2DMP A;  3FDY A;  2Y48 A;  3HOZ J;  2BE5 F;  2RRE A;  3BG3 A;  2OTL I;  3MVP A;  4E7I A;  4PJM A;  3M3Y J;  1R58 A;  1F43 A;  4RGX A;  4D1Q A;  1MBJ A;  3HUG A;  3IL2 A;  3E1S A;  2HS5 A;  3LMM A;  3HRM A;  1ZTR A;  2ELK A;  2ZB9 A;  4JX4 A;  1IUY A;  1ZAO A;  1XN7 A;  1WRJ A;  2A6E F;  4BHP A;  4ZYH A;  1HW2 A;  2WWY A;  3OYG A;  4RA2 A;  3P5J A;  3VYS B;  3TDU C;  3IH3 A;  5HOD A;  5BS6 A;  3OYE A;  5DD8 A;  4ZZL A;  1BN5 A;  1D0Z A;  1RNL A;  2YPR A;  3X2Q H;  4ESB A;  2E1O A;  1ETV A;  1Z0X A;  2JA2 A;  2VJ5 A;  4P9U A;  1TP4 A;  4OAY A;  2IAI A;  5TJJ A;  1U8B A;  3T1B A;  4A12 A;  4CYD A;  2IS6 A;  3LSI A;  3ZMZ A;  2KDO A;  4GFB A;  1TT0 A;  3BZK A;  1MDM A;  1ETW A;  1YFH A;  2MLG A;  2V9V A;  3U2R A;  3PL8 A;  3GTK J;  2VXZ A;  1SVL A;  3WGH A;  3KX2 A;  3RPU D;  3OSF A;  2GWR A;  3BWG A;  3RYP A;  2WAE A;  2DMU A;  4MLO A;  3ZPL A;  3BTJ A;  2HWV A;  2OF7 A;  1XGN A;  2A68 F;  2KIQ A;  5J1U A;  4WF2 A;  2QQ9 A;  3DTE A;  1F9N A;  4BY1 J;  2DT5 A;  3ULQ B;  1HSJ A;  3S93 A;  2R5Z B;  1IV6 A;  1R1T A;  1XDS A;  2CW7 A;  1ETO A;  3OYN A;  2XRO A;  3OSG A;  3R0A A;  5M5W J;  4ESF A;  3BCA A;  1BA5 A;  3ONQ A;  1POG A;  3JR9 A;  2R5Y A;  1XGO A;  5D5W B;  1JJ8 C;  2W1O A;  2LY1 A;  3GZN B;  2JA8 J;  4QPQ A;  3L2V A;  2EFP A;  2W00 A;  2H1K A;  2KRF A;  1W36 D;  1AKH A;  3KYL A;  2NVU B;  1OPC A;  2YR2 A;  4AYB A;  1LE8 A;  1ETX A;  2JVG A;  1GDT A;  3E6B A;  3G1M A;  3LAP A;  3RQI A;  3S2H J;  2XAF A;  5C4X J;  3QPL A;  3JRG A;  2LOO A;  1I5Z A;  2KJC A;  4ZDL A;  4N4O B;  2XB0 X;  4KIG A;  5J4Y A;  2GIV A;  5GAG J;  3Q0U A;  3WG9 A;  4QWQ A;  4V2G A;  3PJR A;  2VI6 A;  4Y13 A;  3NWS A;  3OYL A;  5JHU A;  2KIF A;  3IKT A;  2R5Z A;  5D5V B;  5KHD A;  3RKY A;  4CUG A;  3LA7 A;  4F52 A;  1WH5 A;  1FOY A;  4U88 A;  4CH7 A;  2V4J C;  4QIW N;  4F7Z A;  4F93 B;  2LVS A;  1T95 A;  4KT6 A;  3BR3 A;  4I98 B;  1BM9 A;  1X1A A;  1R5H A;  4E6K G;  5K7H A;  3GW2 A;  4R1H A;  3MEX A;  4PGH A;  4PSX A;  3QQA A;  1P9Q C;  5JFR A;  3H9J A;  2DDA A;  2CQX A;  3Q0V A;  1TWA J;  3I3L A;  2EPF A;  1JTY A;  1I6X A;  1N25 A;  3K7A J;  4MFE A;  5DUK A;  3VSK A;  2HVR A;  3PQJ A;  2CUZ A;  5CQG A;  2EFN A;  3FM5 A;  3FXL A;  4JX5 A;  4IXA A;  4IJA A;  2RV8 A;  3IH2 A;  1MGT A;  4G6T B;  2GQQ A;  1UFM A;  1P7J A;  1G8X A;  2L0K A;  3CUQ A;  2E1N A;  2R7Z J;  3KPH A;  2M0M A;  3OYJ A;  4DJA A;  5IP6 A;  5HS8 A;  1WJ5 A;  4N9I A;  3EDP A;  2I8D A;  5FFX A;  1H9G A;  3JRB A;  2LMD A;  4Y15 A;  2PQ8 A;  2JA6 J;  5EZG A;  1ORK A;  1X3Z B;  4I0A A;  3V4G A;  3HOX J;  3CCV I;  3VOD A;  4B1R A;  1F5T A;  1O4X A;  3K4L A;  3FXJ A;  4MEY F;  3RI4 A;  2OCE A;  2Y75 A;  4PGG A;  3SFI A;  1LDK B;  1HOM A;  5H2F C;  3K6G A;  1XB4 A;  2QF7 A;  3HIF A;  2ZSI B;  4IRH A;  3CCY A;  3GTJ J;  2E34 A;  4L9J A;  2KT0 A;  3I53 A;  3AG2 H;  2KZV A;  1AKH B;  4II2 A;  2DOF A;  4XNF A;  2QQ8 A;  1VQL I;  3LST A;  4MO7 A;  4HAM A;  4PJJ A;  2R7W A;  4M3E A;  5B1B H;  2VC0 A;  1YE9 A;  5IPA A;  5IT9 K;  5E3M A;  3UKG A;  2D2W A;  3TBI A;  2M4G A;  2QBY A;  1R1V A;  3KZZ A;  5GPA A;  2Y0S N;  5FRN A;  3FZV A;  4EJV A;  3HHH A;  1MDM B;  1GLN A;  4RS8 A;  1KU2 A;  3BPX A;  1OLT A;  3HOV J;  3MAJ A;  3CUQ C;  3LFK A;  5FLV A;  1G3S A;  1W7P B;  2XKO A;  4M9S A;  3CTA A;  2UXX A;  1S72 I;  3WHC A;  5DD4 A;  1SFO J;  3M4O J;  5CVU A;  3ZMS A;  4HDV A;  1HLV A;  3KEY A;  3J7Z I;  4ASN A;  2RVC A;  2Y30 A;  1ZR2 A;  2MYS A;  2L4A A;  2G0E A;  3RCO A;  5D8L B;  4A3M J;  2A6H F;  3WTY C;  1Z3Y A;  2E19 A;  2KIM A;  2L02 A;  2XPU A;  2BY3 A;  4L9V A;  5JR3 A;  4BXU A;  5FLX K;  2X6X A;  3S8P A;  4BEH A;  1V54 H;  1NH3 A;  5KAF C;  2FML A;  5E3O A;  2VT2 A;  4FX0 A;  5FKN A;  2K9S A;  4ZTF A;  1Z1D A;  1QZY A;  3D5R C;  1S8N A;  1TNS A;  4HZF A;  4KIC A;  3G6E I;  3VYR B;  4FQG A;  1MMS A;  3DKY A;  2EJR A;  4BE2 A;  4WXD A;  1H89 C;  1VI0 A;  1LEB A;  1AHD P;  2HDD A;  2Z33 A;  3QU3 A;  2VQH A;  4AC0 A;  3VFZ A;  2QVO A;  4LOC A;  3MZY A;  3NEU A;  3R60 A;  5EG0 B;  5EGO A;  5DM6 F;  2KHM A;  2GXB A;  3FWE A;  1IV8 A;  3S15 J;  5B1A H;  2IEK A;  3BCB A;  1KGS A;  4CSW A;  4IHX A;  3FXR A;  3KZI C;  4XOR A;  3ERM A;  2Q1Z B;  4A3K J;  1ZG3 A;  4P1W A;  3CCS I;  1V5F A;  2XRL A;  4HST A;  2PEX A;  2ACJ A;  1Z6T A;  2ADU A;  2QKL B;  3HTU A;  5KAI C;  3I4M J;  4RDU A;  4IHY A;  3K4J A;  1ULY A;  4LMY A;  2KQR A;  3BR1 A;  1K61 A;  3MD2 A;  2W57 A;  1WFX A;  2LF7 A;  3F0C A;  4ZYA A;  1A35 A;  2MC4 A;  4QTR A;  1YQA A;  1WGX A;  4LIU A;  2VBX A;  4B3X A;  1ZEL A;  2BVL A;  2RNJ A;  2XGX A;  4C30 A;  4XKW A;  4IO9 F;  2ZME B;  3SDB A;  4IVN A;  4WXH A;  4G6D A;  2ZXW H;  4A6D A;  4ZH4 F;  3HGG A;  3OS0 A;  3CMY A;  3K9T A;  5HVQ C;  1WJD A;  4FIS A;  1TNT A;  5E1X A;  2DI3 A;  2ICW G;  2G7H A;  2DA2 A;  3F6O A;  3DEU A;  5FRM A;  3W2W A;  1JT0 A;  1IW7 F;  1MKM A;  4H4K C;  1DP3 A;  4MIM A;  3KEO A;  2IXS A;  3VSL A;  4DOZ A;  2FX0 A;  3K70 D;  1PUF A;  2O8X A;  3OYK A;  2JRT A;  5FKM A;  3DBH B;  1ZAR A;  1SMT A;  3C7J A;  4A3B J;  4XLC A;  3OL4 A;  4XRS A;  3KEQ A;  3G73 A;  4XKC A;  3DCF A;  1Z77 A;  1USS A;  1H9T A;  4ABZ A;  4XN0 A;  4B3A A;  3HGY A;  1G4D A;  1HDD C;  2EBI A;  1IDY A;  2X48 A;  3IH4 A;  3D5S C;  4XL9 A;  2JQ7 A;  2NVQ J;  1Z67 A;  4BU2 A;  2Y9Z A;  2KRH A;  2R7V A;  3QRF F;  2AHQ A;  4UVB A;  2LLK A;  2E5Z A;  5ERI A;  3CC2 I;  3J7Y J;  4X0G A;  2ELJ A;  4FET A;  2CRG A;  3H92 A;  4M3D A;  1O3T A;  2GXA A;  5F64 A;  4F3Q A;  1R9T J;  2IGO A;  2R7D A;  3LSH A;  4XLN F;  1MMA A;  1YIO A;  3ZCO A;  4V19 K;  2X6Y A;  3M1C A;  2COM A;  1K83 J;  2P6S A;  1OKR A;  4C3J J;  5E1W A;  4ENJ A;  5ILU A;  2DDB A;  4HDU A;  1E3O C;  3FMS A;  4UUS B;  4BDZ A;  1XSV A;  1SMY F;  3P9I A;  1HA8 A;  1EA3 A;  4CGZ A;  1QBJ A;  1N77 A;  2O61 A;  3SDG A;  1HST A;  1W7P D;  4PUS A;  2M30 A;  2EV0 A;  2V1U A;  2XVC A;  3S3M A;  2F48 A;  3ZN0 A;  4A3F J;  3I4N J;  4IOA F;  3PNV A;  1LKX A;  3E6M A;  4B43 A;  1G2H A;  1LPQ A;  1QRY A;  1F4K A;  3I9V 2;  4LLL A;  3CCR I;  4BNC A;  2Z3Y A;  1U6G A;  1JT6 A;  4Y3O A;  2R7T A;  1B59 A;  3RIR A;  3FXU A;  2AQF A;  2LR8 A;  3LFU A;  3N05 A;  4KNY A;  1EH7 A;  2UXN A;  3JTH A;  2FQ3 A;  2HOE A;  2L9S A;  5J3L A;  2D1H A;  4L9T A;  4A3D J;  3HBL A;  3A02 A;  3CES A;  4ON0 A;  2JA7 J;  1FBU A;  3MZ8 A;  1GXP A;  2Z99 A;  3U9G A;  2HTJ A;  2JTV A;  4XRF A;  1VQ7 I;  1UAA A;  2P5K A;  2O6G E;  3HUG B;  3ZN1 A;  1K4S A;  1ZH5 A;  5LBQ A;  3CMM A;  5JHF A;  2XGC A;  1PDN C;  2EIL H;  1ZR4 A;  2FNA A;  1OMI A;  2LH9 A;  4G6Q A;  2HYF A;  2K9L A;  1QGP A;  1IAW A;  1Z7U A;  4KA4 A;  3EYY A;  5AIP A;  2X9D A;  1UHW A;  3E6D A;  1JKR C;  5GAE J;  2O3F A;  1OR7 A;  1Y56 A;  3KZY A;  3E7L A;  1W5T A;  2PLY A;  1V55 H;  3LQR A;  5LRR A;  1D8J A;  4OIR F;  5DCM A;  2I5U A;  1W0U A;  3O3K A;  1MNE A;  3ZOB A;  3DLL F;  1D0X A;  1MMN A;  3QPT A;  2HR3 A;  2EZL A;  2JSC A;  1XMA A;  1Y1V J;  3CCM I;  1VQ4 I;  1MBH A;  5FB2 A;  4MTD A;  3W6K B;  4J00 A;  3JSP A;  3HOW J;  2AS5 F;  3K69 A;  4LIV A;  2PMZ A;  3L7W A;  1ZGA A;  3IUO A;  3F8C A;  2QEN A;  2PJR A;  4HPQ A;  3QOD A;  2GIZ A;  1LNW A;  2BXZ A;  1IUF A;  2XF7 A;  2X1C A;  1SD4 A;  3SEZ A;  5HS7 A;  4M72 A;  2L01 A;  3CLO A;  1X1C A;  3S32 A;  2VPL A;  4D5C A;  2FJ1 A;  5F0H A;  2DA7 A;  1SVO A;  4XIC A;  1AA7 A;  1T33 A;  1Z21 A;  3GTM J;  3ECO A;  1ETQ A;  3E97 A;  2GOX B;  1DU0 A;  1KU3 A;  3PO3 J;  1JXS A;  1QHH D;  1B9N A;  4YIF A;  3KLO A;  1B8I B;  1QVU A;  1BOB A;  2ZFU A;  3CQZ J;  1MIJ A;  2VXD A;  3GBG A;  1JGG A;  3GWZ A;  1DQU A;  4RMN A;  1JHF A;  3RJP A;  3SQN A;  4LLN A;  2HOA A;  3GLX A;  5DS9 A;  3EUH C;  4OIO F;  2MH2 A;  5L3D A;  1DGR M;  1B9M A;  3GME A;  2WAQ A;  1IF1 A;  3B6A A;  5K5O A;  4UNO A;  3MCZ A;  1R36 A;  1U5T A;  2MFZ A;  3DP7 A;  4NUB A;  2JA5 J;  2DMQ A;  3SZG A;  2P5V A;  2H09 A;  3ZQQ A;  2VKH A;  2M3A A;  2OUM A;  1YIJ I;  1FP2 A;  3EQL F;  2IGM A;  1T38 A;  3HOY J;  1YX3 A;  2R7X A;  4GXO A;  2L9V A;  2PFB A;  3OYM A;  2K7L A;  3HOU J;  2CQK A;  5E18 F;  2F4M B;  4R79 A;  5IY5 H;  2DT6 A;  1DP7 P;  3KP4 A;  3JSO A;  4MFD A;  3BJA A;  2XSJ C;  2Y0M A;  4OOI A;  3FM3 A;  2HYG D;  4BE1 A;  3ZQH A;  4BGD A;  4EGZ A;  2JRM A;  1SAX A;  3MWM A;  3FKJ A;  2VIX A;  3WU2 C;  3WTZ A;  2ECC A;  3TQN A;  1N78 A;  5D6F A;  2HNH A;  5TGT A;  3J80 K;  5K5R A;  4GCV A;  3ZGK A;  4B44 A;  5FKO A;  4HV5 A;  4G7O F;  4L18 B;  5GAD J;  1ZRD A;  1D8K A;  3DPT A;  4QPO A;  1XS9 A;  5IT9 Z;  3E3V A;  3I5U A;  2E60 A;  2H6C A;  3G4S I;  4IKF A;  2M45 A;  2VQL A;  2DT7 B;  2A69 F;  4P9F A;  3M8J A;  1AOY A;  3HKZ A;  1T98 A;  3C18 A;  4F92 B;  4BHC A;  4RB1 A;  3CP2 A;  4RB3 C;  4B4C A;  4AWX B;  1ZRE A;  2DFE A;  1A5J A;  1QQI A;  2F5V A;  3KE2 A;  3T8T A;  3A01 A;  2OQR A;  2KKO A;  2E35 A;  3K4C A;  4Q47 A;  2XGD A;  2P5L C;  1G3Y A;  2Y69 H;  3T8R A;  2OZ6 A;  1ZGW A;  4QLC U;  2IS4 A;  4C3I J;  1REP C;  2QSH X;  3CJT B;  3S17 J;  1FPQ A;  5CVI A;  1R5I D;  2J5P A;  2DOE A;  2Q0O A;  1OYI A;  4CCO A;  3FXO A;  3PM1 A;  3VOE A;  1RET A;  2CW8 A;  1YJW I;  1HXD A;  4D0P A;  3CP8 A;  5CVR A;  3ELK A;  2VOP A;  2K4J A;  5JLX A;  3L1P A;  4XLH A;  4XQF A;  3F8M A;  2L4M A;  1UG0 A;  2NNN A;  2EV6 A;  3TGN A;  3GEZ A;  2DA4 A;  1BR4 A;  2ESH A;  2HZT A;  1CF7 A;  2DN0 A;  1OR7 C;  2EIN H;  4YEL A;  4DYR A;  2M8G X;  2STW A;  3RPQ A;  2BEO A;  3T0Y A;  2XPV A;  1FZP B;  2HPM A;  1W5C C;  1TWC J;  2OC6 A;  3QPS A;  5E3N A;  3BG6 A;  4L0Z B;  3VB2 A;  2FUG 2;  2EA4 A;  2YU9 J;  4DW6 A;  3BG7 A;  1SD5 A;  3E5Q A;  1TLH B;  2L9N A;  2ZCW A;  2CFX A;  3HG9 A;  1CF7 B;  4BQN A;  3FX3 A;  3FKI J;  1MJA A;  3CMA I;  3ZRG A;  3SYT A;  3O8G A;  5CQE A;  1RPW A;  1JTX A;  3AL0 B;  4BAY A;  2R7Q A;  4Y7N J;  1AU7 A;  2LKP A;  2Z5U A;  1JKO C;  2HEO A;  4G12 A;  2Y31 A;  3RPU A;  2DU9 A;  1UB9 A;  2FBI A;  1GV5 A;  5CKT A;  4XRS G;  1SD7 A;  2VLA A;  5F04 A;  4PK4 A;  2FSW A;  2VBY A;  3L09 A;  1L3L A;  2PMZ N;  2EB7 A;  3ZQG A;  3AG3 H;  3L2W A;  2XAU A;  3A01 B;  3F9K A;  5J8C A;  4NBQ A;  2DOA A;  4CA0 A;  1MH3 A;  4UHT A;  4ZZD A;  3ERE D;  1J5Y A;  2PJP A;  4LGW A;  4M6Y A;  3F22 A;  3H36 A;  1WQ2 A;  1VQ9 I;  2X6W A;  2WY8 Q;  2DBB A;  1KU7 A;  2PX9 A;  4PCQ A;  1MBE A;  2BOL A;  3SFZ A;  3TL4 X;  4CO8 A;  1U5T B;  2WTE A;  3I56 I;  3G3Z A;  2GLO A;  1LDJ A;  3E5U A;  2A3S A;  2DJI A;  1XSX A;  1U3E M;  4I0B A;  1P7I A;  1XPX A;  1P2F A;  1V5G A;  1DUX C;  3PQK A;  2WAF A;  1Q1H A;  3FHZ A;  4XMY A;  4AUX A;  1R00 A;  2Z1D A;  1ONV A;  5DUI A;  4KJZ A;  3NRV A;  1FLI A;  4CCM A;  1D1C A;  1UCR A;  5EEG A;  1O57 A;  2ME0 A;  2DPD A;  4U87 A;  1QNT A;  3EUA A;  1R6R A;  2N8G A;  2K9Q A;  3BR5 A;  3H5A A;  1CGP A;  2HQN A;  2X4H A;  3N97 A;  4RM3 A;  2GZW A;  3QYE A;  4UV9 A;  1HF0 A;  1RES A;  4HF2 A;  3HPH A;  5FGM A;  1FBQ A;  4G7Z F;  4HLY A;  3FK6 A;  3V8K A;  5CYV A;  4GDF A;  3KFW X;  1E3H A;  4Y4R A;  4CXF A;  3L2R A;  2KP6 A;  2JMW A;  2CH0 A;  4BE0 A;  1FYM A;  1MNM C;  3CDL A;  4YG2 F;  5ICF A;  3JRF A;  4ESJ A;  1YLF A;  2RDP A;  4A3J J;  2WB1 N;  1W0T A;  2EIK H;  4E7H A;  2CJJ A;  1D5Y A;  2P4W A;  1IC8 A;  2XKP A;  2WC2 A;  2BGC A;  2FOK A;  2H1L A;  3JRA A;  1ON2 A;  5FD6 A;  3GFL A;  2CU7 A;  3H9G A;  3J80 Z;  5F0C A;  1OCZ H;  1W36 C;  3S3O A;  1FBS A;  3F21 A;  3BDD A;  4M71 A;  4E70 A;  5DCF A;  3P9C A;  1YRN B;  1S6L A;  3OY9 A;  1FEX A;  4CCN A;  2F4I A;  4HRI A;  5K5Q A;  2R3S A;  1TQP A;  1S9H A;  3KYC B;  4DBQ A;  1EKE A;  3HL2 A;  1T56 A;  2HVS A;  5EZH A;  1RZ4 A;  4L5E A;  2HVQ A;  4XON A;  1I6H J;  1UJ8 A;  2M4K A;  2CQN A;  1D3Y A;  1QZE A;  2VON A;  1JUM A;  2RAE A;  1MJ9 A;  4BQQ A;  2M5W A;  4U0Y A;  4IX7 A;  5C44 J;  4ZJZ A;  3MN2 A;  1IXC A;  3HJE A;  2WAD A;  4G7H F;  1ACI A;  1OYY A;  2H27 A;  4M3G A;  3KP2 A;  1JI8 A;  4XLF A;  2CV1 A;  3LSP A;  2P0W A;  3S1R J;  2V6E A;  1WJE A;  2BHZ A;  5LEJ A;  1VZ0 A;  2VE9 A;  3NAR A;  4Z6Y A;  3PSF A;  3I64 A;  4IRG A;  1RKT A;  2E7X A;  2ZJP F;  3I54 A;  4HG2 A;  3WE2 A;  2E5N A;  2QBY B;  2V9P A;  2TCT A;  2L9R A;  1FT9 A;  4RAG A;  5AON A;  1BR2 A;  5FO5 A;  4BS9 A;  3GX4 X;  2M2E A;  3ECH A;  2D5V A;  2ZXJ A;  5KCM A;  4RB2 C;  3ZQF A;  1UG2 A;  3BJ6 A;  2WV0 A;  3DLA A;  2CWE A;  1IN5 A;  3F8N A;  4LK0 F;  1PJR A;  3CLQ A;  2KIU A;  2DYS H;  4D5F A;  5B5E C;  4V2F A;  3C3W A;  4W1U A;  2V1X A;  5ILS A;  5HLT A;  4OWR B;  1WJB A;  4AIJ A;  3F8B A;  2ZME C;  3OYH A;  4EVI A;  2XGE A;  4IOC F;  3DU6 A;  1LUJ B;  1V4R A;  1KQ0 A;  5ICG A;  4RLQ A;  2B63 J;  4YIR X;  3W2A A;  1FY7 A;  3JRE A;  5E8I A;  5HLH A;  2QSF X;  2VPR A;  2HZD A;  4KDP A;  2E1C A;  4KFC A;  1OIS A;  1DPR A;  2GBY A;  4PJL A;  5DEQ A;  1VQ5 I;  2A61 A;  3K2Z A;  1J7K A;  2DA3 A;  1FOW A;  1WH7 A;  1NK2 P;  2K86 A;  3IP4 B;  2QQB A;  4YEJ A;  1FMW A;  4I09 A;  3H3Z A;  1YJN I;  1YW7 A;  2IW5 A;  3CJR B;  3HOT A;  3MKY B;  3FK7 A;  3BTC A;  1TT5 B;  2FBH A;  1ZRC A;  1BC8 C;  4YFX F;  2PI0 A;  2NYX A;  1J2X A;  2JPB A;  1U2W A;  4U0V A;  3DTK A;  1QA6 A;  1VQK I;  3CJQ B;  3IAM 2;  4BBR J;  4E7S A;  5KVR A;  5E3L A;  3B02 A;  4Q4Z F;  2PJR B;  4ANJ A;  2IT0 A;  5AIQ A;  2VB6 A;  2OV7 A;  2HU9 A;  5EDN A;  4OIQ F;  2ZME A;  3HRU A;  4XLE A;  5JI6 A;  2EK5 A;  1R49 A;  1MH4 A;  4ETS A;  4Q48 A;  4QSH A;  2CUE A;  3WTS C;  3L2Q A;  1B72 B;  5IT3 A;  4LB5 A;  4OIP F;  4CCL A;  3V8L A;  1MD0 A;  1LE8 B;  2F5D A;  5F27 A;  2DJN A;  5K1Y A;  1O7F A;  1XMK A;  3RZD J;  2Z9O A;  3AG1 H;  1RRJ A;  3H35 A;  4BHB A;  1Q1V A;  1X2M A;  1MMG A;  4FTH A;  4S0H B;  2QEX I;  1GHC A;  1NG7 A;  2BV6 A;  3HPG A;  2JK3 A;  5EEA A;  2L3D A;  5F08 A;  4ZDP A;  3SZP A;  2ISY A;  3M8F A;  3JRC A;  1PUF B;  3OS1 A;  2IGK A;  2NS8 A;  5E8G A;  4ITV A;  4KMF A;  1F1Z A;  4FE7 A;  4O6J A;  3LA3 A;  4KT5 C;  1JHH A;  3ML6 A;  1ENH A;  2LP0 A;  4MQV A;  3H0G J;  1BBY A;  1JGS A;  1P6R A;  2E1M C;  2H94 A;  2PN6 A;  2EIJ H;  2YX4 A;  4XOP A;  3IRR A;  4G94 A;  1MJB A;  1OJL A;  3ABU A;  3ZR8 X;  2Y0S A;  2X85 A;  2YSR A;  2ZJ2 A;  3E5X A;  4CZZ A;  4RGS A;  2MD0 A;  1WVR A;  2R7O A;  1J09 A;  1Y8Q B;  4M9X A;  3VWB A;  3K1N A;  2VOD A;  2W85 A;  3GO5 A;  1ZLK A;  4DQ2 A;  4IQJ A;  1VF9 A;  2O5R A;  2P6T A;  3OMY A;  4BXX J;  2UWM A;  4ENM A;  1RUO A;  3OYD A;  1EJ9 A;  2LDU A;  5BNG A;  1DPU A;  2FBK A;  5KNL A;  1K6Y A;  3UNG C;  3MFK A;  1VFC A;  4M9Z A;  2CS3 A;  3ESW B;  3JW4 A;  2DTZ A;  3K70 C;  3PIO F;  1J75 A;  1BI2 A;  1T6S A;  2WA0 A;  4B47 A;  5IYC J;  1TWF J;  1TC3 C;  1R7J A;  2HOT A;  3GTQ J;  5EG0 A;  2DK8 A;  2MD5 A;  2ZFW A;  1YS7 A;  2EQR A;  4UY8 I;  1Y1W J;  3CDH A;  2QYO A;  3A03 A;  2DLL A;  3VEP A;  3V7C A;  3U1D A;  4L0Y B;  1ZG1 A;  2E2I J;  5CPR B;  4K2E A;  3J81 Z;  4O3M A;  1F36 A;  3AKZ A;  1J0R A;  1WKM A;  1I3A A;  2RQQ A;  4JK1 X;  4MHG A;  3TP3 A;  2I10 A;  4AIH A;  2HKO A;  2QWW A;  2QKM B;  3BTI A;  4UV8 A;  3AG4 H;  2WV1 A;  1E2X A;  1NHA A;  2AO9 A;  1XD7 A;  1Z6R A;  4B09 A;  1T08 B;  1LVK A;  1K4T A;  1ZYR F;  2CUF A;  4ENK A;  4YII A;  3GFI A;  2VN2 A;  3WU0 A;  5ILV A;  2CV0 A;  3A1Y A;  1T2K A;  2JT1 A;  2JWT A;  4I01 A;  4Y33 A;  2MW8 A;  3MKZ A;  1JJ6 C;  4JX6 A;  4AM3 A;  1Y39 A;  4AID A;  2XAH A;  4FHT A;  5GTI C;  3BR0 A;  2LKX A;  4WCG A;  2DMN A;  3VYT B;  3N4M A;  1NTC A;  2DQR A;  2CQQ A;  2LNB A;  2VJI A;  4BJ5 C;  4IQ4 A;  2M8E A;  4DNC A;  1R4N B;  3TMO A;  1EH8 A;  5BMZ A;  3K4K A;  3M07 A;  1IN7 A;  1D5V A;  3GTL J;  4IHS A;  1MW7 A;  3MKW B;  2E2J J;  1B4A A;  1IZ1 A;  1YS6 A;  3CCL I;  1PVE A;  4HX8 A;  3W6J B;  4L5J A;  2K4B A;  2V26 A;  3MZH A;  1FSE A;  2FA5 A;  2M0C A;  5GPC A;  1UST A;  3L9F A;  4RAZ A;  5J47 A;  4BJT A;  1U78 A;  3HSF A;  3D5L A;  3OS2 A;  5JLW A;  3PUB A;  3VDX A;  2MSY A;  2RQP A;  3D0S A;  2C6Y A;  2WY7 Q;  2DA1 A;  4N9H A;  1I39 A;  3C2G A;  5EGO B;  3OYA A;  2LRD A;  5D4S A;  3SXY A;  1T0F A;  1FTZ A;  4BL0 B;  2NVX J;  1PP8 F;  1P92 A;  1OQY A;  4M3B A;  3KP6 A;  4AU7 A;  1G3T A;  4D7N A;  2NOG A;  2GOM A;  1HQC A;  1Z3X A;  2W24 A;  2Q2E A;  3ASO H;  3LA2 A;  5ED4 A;  4ZYG A;  1SFX A;  3CUO A;  1IRF A;  4TV7 A;  3IV5 A;  1BL0 A;  3J7A O;  1FOX A;  2R92 J;  2KL4 A;  2W7N A;  4AVZ A;  4XM3 A;  4JP0 A;  3A0H C;  3QYF A;  4GYI A;  3CC4 I;  2X6O A;  3PUF A;  1UHS A;  4HYE A;  4XR6 A;  5A2Q K;  3OV8 A;  1Y0N A;  1LFB A;  3ZQ7 A;  2JPC A;  1X19 A;  2F4O B;  4BH9 A;  4F55 A;  1Z9C A;  2KJB A;  5L3G A;  2LY9 A;  2CSO A;  3JTG A;  2BYV E;  2BVM A;  4BYY A;  4ZYE A;  3PNT A;  4PFO A;  3S16 J;  1FOK A;  2LC2 A;  3DPU A;  2TRT A;  3L2U A;  2K02 A;  3QP6 A;  2P7V B;  2XAG A;  1PP7 U;  3DXJ F;  3K10 A;  1W1W E;  5GTH C;  5J1R A;  1IRG A;  3HHG A;  2LBF A;  3OR1 C;  5FRO A;  3W3C A;  4A0Z A;  1MZB A;  3KET A;  4U7B A;  1GV2 A;  3LSR A;  2PG4 A;  3K1M A;  1ZQ3 P;  3QP5 A;  1FSH A;  4G9Y A;  1XMX A;  4BKX A;  2F2E A;  1IDZ A;  2B0L A;  2EA2 A;  1FC3 A;  4XKB A;  1YX5 A;  4U7D A;  4CHU A;  3QYB A;  4EEF G;  1S7A A;  3K4B A;  4GYG A;  4BQA A;  2GXG A;  2VC1 A;  3O8H A;  3GTO J;  2VBW A;  1QVT A;  3K2A A;  2A5Y B;  3ZQC A;  4MGR A;  5D6E A;  1O3R A;  5D4R A;  4LJZ F;  3KP5 A;  2XV4 S;  1I50 J;  4RAY A;  2IS1 A;  2ID3 A;  3CUQ B;  4GGG A;  2D45 A;  2QGU A;  1HKS A;  1MBK A;  3F6V A;  3L2C A;  4BQO A;  2V9K A;  2GAU A;  1LVA A;  3WGG A;  3K4M A;  2ZXH A;  1VQM I;  3BLY A;  1YJ9 I;  3FBN B;  2CO5 A;  3OIP A;  3MQ0 A;  2DFF A;  2CV2 A;  4UXN A;  3TP0 A;  2IP2 A;  3EUH A;  1MSF C;  1IGN A;  3TW6 A;  1V5E A;  2M87 A;  4PFP A;  2DA5 A;  4KYW A;  2E2H J;  1X4P A;  3CF2 A;  3DWL E;  4RGR A;  5IYB J;  1W4M A;  4KIF A;  1ZLJ A;  2OA4 A;  5C3E J;  4EJU A;  1K7A A;  3ISP A;  2G9W A;  1O3S A;  1IJW C;  2E71 A;  3ZMT A;  3ZQI A;  1YG2 A;  5J6X A;  1X1D A;  2M7A A;  4IHV A;  3TO6 A;  3AAF A;  1MSE C;  1YOV B;  4LK1 F;  3HOS A;  3PO2 J;  3CZ6 A;  1SFE A;  3SZT A;  4A0X A;  5HDN A;  2BXY A;  2L7F P;  4C2T A;  5C4J J;  2VUM J;  2YX7 A;  4ZYD A;  4OMY A;  2VQG A;  4KIT B;  1I3Q J;  2K5C A;  2CW0 F;  4R8H A;  3RSN A;  2JN6 A;  1SEU A;  3CO6 C;  1W5S A;  4O5V A;  1WZ2 A;  3QU6 A;  2L2O A;  2VT3 A;  2XB5 A;  1HKQ A;  2HKX A;  4NB5 A;  5M5Y J;  4GRI A;  1G6N A;  2ZJR F;  2IA2 A;  3B73 A;  2DFH A;  2IPQ X;  3LSK A;  3PSI A;  5IP7 J;  5TRD A;  3G1L A;  2HQA A;  4LG3 A;  3V8J A;  1KZH A;  2O8K A;  4HW0 A;  2HXO A;  3BG5 A;  4EV0 A;  2YU3 A;  2P7C B;  2DTR A;  3M1E A;  2OJE D;  1TWH J;  3SHF A;  1WCM J;  2DOD A;  3WTX C;  2ELH A;  4C9Y A;  1VQP I;  2CQ7 A;  1EH6 A;  1HC8 A;  1B72 A;  1TTY A;  1IXR C;  4XID A;  3ASN H;  1ZRF A;  2XRN A;  4M3F A;  3EET A;  3WTU C;  4EJW A;  3H0D A;  2R7S A;  1QZZ A;  2BY2 A;  1XC5 A;  3R6S A;  1V3F A;  2MAB A;  2FE3 A;  1BJZ A;  2W84 A;  2ZNY A;  3GFM A;  3I59 B;  5FKK A;  4S05 A;  2Z16 A;  3GTP J;  2NOJ B;  3WTV C;  3PIP F;  3FHN A;  1S29 A;  4E7J A;  4FE4 A;  3OL3 A;  2HXI A;  3A4C A;  4XRM A;  3HRT A;  1WJC A;  2R93 J;  3FMQ A;  1IO2 A;  2ZC2 A;  1VQ8 I;  5CVJ A;  3O6B B;  5LLQ A;  3BC8 A;  3MKL A;  2HGC A;  3OOP A;  4KMU X;  3WGI A;  2JUG A;  1K6O A;  3QOE A;  3BQY A;  3I55 I;  5H20 A;  2EWN A;  4B8X A;  4PSW A;  3DKX A;  4IL6 C;  5DTD A;  3TOB A;  2LTP A;  4EM2 A;  4NHJ A;  2Q2E B;  3JAM K;  1ETY A;  3P9K A;  3H5N A;  1Z05 A;  6PAX A;  4E7L A;  2G7U A;  2R5Y B;  2OQG A;  2XHK A;  1FJL A;  3G71 I;  4YFK F;  5BPD A;  5LGU A;  4EM1 A;  4E7K A;  1L0O C;  1CQT A;  3IKV A;  1FIA A;  5K7Z A;  4W97 A;  2HOS A;  3VPR A;  3BOQ A;  5HDK A;  3J7A Y;  4JYK A;  3LSM A;  1IN8 A;  1RKW A;  1SC7 A;  4EM0 B;  3L00 A;  1YHQ I;  2V6C A;  4HNU A;  4A5N A;  4XBF A;  1A6Q A;  2ESN A;  3T5X A;  2EZK A;  1IRX A;  1BIB A;  4BJ6 C;  5GAH J;  3H5R A;  4KN4 X;  1BC7 C;  2OBP A;  1X4O A;  3GYH X;  1TWG J;  3GXO A;  2UV1 A;  4PZJ A;  3I58 A;  5H6Q A;  3Q9S A;  1ERD A;  3GLL A;  1ZN2 A;  2CYY A;  5JVG F;  5H6R A;  4IZZ A;  1U8R A;  4UB6 C;  1RIO H;  1TQI A;  3NWT A;  4RM2 A;  2MH9 A;  2O7O A;  1VQO I;  2KPM A;  1A31 A;  1VQ6 I;  4EQQ A;  5LHH A;  2V1D A;  1XCB A;  3FXK A;  5ICC A;  2VKD A;  2X51 A;  2EIM H;  1BW6 A;  4LD5 A;  2EFW A;  3HEF A;  2ZO4 A;  2W4S A;  3JAM Z;  2NS0 A;  4GO1 A;  3GUD A;  1H0M A;  4FAS D;  2R0Q C;  4HSR A;  5JVT A;  4XOT A;  3HZJ A;  1YW8 A;  3ZMD A;  4IRI A;  2OU2 A;  1FNN A;  1OCC H;  5LD2 C;  2XAQ A;  3MMY B;  2KFD A;  3BP8 A;  4XSZ F;  4H0E A;  1J59 A;  3BR6 A;  4HOB A;  2Z2S B;  2M1B A;  2V7F A;  2VL8 A;  4NC7 A;  1R22 A;  3GTG J;  1LJ9 A;  5HNH A;  3B6C A;  2YUS A;  3GVA A;  2BW3 B;  4Y52 J;  2CMP A;  2FXA A;  5D5X B;  1YO5 C;  3RZO J;  2JZY A;  2RNG A;  2FNP A;  5M3M J;  4A2U A;  1GVJ A;  3ZMU A;  2CFO A;  4FX4 A;  1FTT A;  2X0L A;  3R0J A;  3RKX A;  3Q5F A;  2IA1 A;  2VAS A;  4IPA A;  1YYV A;  1UHM A;  4DZJ A;  5CVV A;  4I02 A;  4PDK A;  1VND A;  2BHY A;  3OIQ A;  4DGW B;  5J8F A;  5BQT A;  2PMH A;  3DFG A;  2OAZ A;  2E7W A;  1HKT A;  3LL7 A;  3RDI A;  3CD6 I;  1LFU P;  1TW3 A;  3QAH A;  2LSO A;  2V1N A;  1WWX A;  3IAS 2;  1WPK A;  4A3G J;  1A6I A;  3OYF A;  2HPI A;  1OYW A;  1Y0U A;  3DV8 A;  2NRA C;  2ZNZ A;  2VE8 A;  2KRC A;  3CME I;  4B48 A;  4DIQ A;  5J40 A;  2LK2 A;  2K40 A;  3DBR B;  2VBZ A;  2O03 A;  5L3C A;  3REO A;  4HX7 A;  1X3U A;  1YRN A;  5IOY A;  1XDU A;  2FD5 A;  3H3V K;  3E6C C;  4XSX F;  1H88 C;  2ID6 A;  2B7E A;  1OCT C;  1IN4 A;  3LNQ A;  2H8W A;  3WTT C;  2L5Q A;  1KA8 A;  3DQV C;  4OIN F;  4I76 A;  2M34 A;  4LFU A;  3OYB A;  2RGV A;  2OTJ I;  4D7M A;  3D1N I;  3P7N A;  1S3J A;  3HYI A;  4HLX A;  2FOW A;  1BR1 A;  1SFK A;  2H8R A;  1OCP A;  2XAJ A;  5FLX Z;  4BAC A;  1SAN A;  1SVM A;  2UZK A;  2XF5 A;  4RLF A;  2XDV A;  4HNT A;  4XN3 A;  1E0E A;  2P81 A;  2XSD C;  2M7B A;  2COB A;  1I1S A;  4UVC A;  1BI0 A;  1S5L C;  4HF0 A;  2A6T A;  1T0F C;  2KIS A;  2YS9 A;  3CDI A;  4RB0 A;  1QO0 D;  4HQE A;  3TED A;  3GCM A;  1Y6I A;  2A5W A;  2HQR A;  3HRS A;  5ICE A;  2WAQ N;  1S7O A;  2NS7 A;  2OPT A;  5LFA A;  4NNJ A;  4A6E A;  4CDG A;  3S1M J;  5KK1 A;  4IF4 A;  3CO7 C;  2EV5 A;  4PJN A;  1HW1 A;  5EJC A;  4NQW A;  4A3L J;  1APL C;  3V7R A;  5LHG A;  4A69 C;  1K78 B;  2R7R A;  4LG0 B;  3WTW C;  4CZC A;  2B9S A;  3HC7 A;  4HBL A;  2KMU A;  3PFY A;  2IVM A;  3M9A A;  2QSG X;  1D1A A;  3OR2 C;  2GM4 A;  1G3W A;  3ZP5 A;  2JJ7 A;  3HM5 A;  2MC3 A;  1GXQ A;  4WWC A;  1DDN A;  2EH3 A;  3H9Q A;  1R1U A;  1BI1 A;  3CJN A;  2IS2 A;  4JBA A;  5FFZ A;  3G2B A;  4Y17 A;  5CJ9 A;  3TW7 A;  2W25 A;  2K27 A;  2K9M A;  3FIW A;  1U9O A;  2DA6 A;  2GA2 A;  3VYU B;  1KQ9 A;  4HEA 2;  3RQ4 A;  4D9J A;  3S2W A;  1XGM A;  3TO7 A;  4AD9 A;  4CYC A;  5M3F J;  2RKH A;  5D5U B;  1ITY A;  2P8T A;  1X1P A;  3JCU C;  3Q3S A;  2F5F A;  1HW5 A;  3FF5 A;  5E20 A;  2K85 A;  3WOD F;  3F23 A;  4LG0 A;  1K78 A;  3S14 J;  1UZC A;  3TDZ C;  5L3E A;  4HA8 A;  2STT A;  3KCC A;  4AYB N;  2W48 A;  1GVD A;  4UUT A;  2ISZ A;  3CCJ I;  5E17 F;  3TKY A;  1OCR H;  1MBG A;  4P5O A;  5HLG A;  1O3Q A;  2F5E A;  3BZ6 A;  3WHB A;  1OCO H;  3HSE A;  4KUM A;  4Q5S F;  3FIS A;  4P96 A;  2QM3 A;  4M73 A;  4MNU A;  2DAO A;  2AXT C;  1JUP A;  2UUZ A;  3LSG A;  2CGP A;  3LWF A;  2HQ5 A;  5A2Q Z;  2Y9Y A;  1BW5 A;  1RR7 A;  1BJA A;  1IG7 A;  2EZI A;  3HXL A;  5HNF A;  4X6A J;  4MQ9 F;  2X1D A;  5J1Y A;  2LYC A;  3K0L A;  1TL8 A;  1FP1 D;  1N75 A;  3C1D A;  1X2N A;  2J5O A;  1RC9 A;  2E36 A;  2LY2 A;  3A2K A;  2FRH A;  3BT9 A;  2QQA A;  1LEA A;  5CLS A;  1AWC A;  4OMZ A;  2ZKZ A;  4KIS A;  4S04 A;  1KYZ A;  3H1C A;  3BPV A;  4A0Y A;  1HBX G;  2IGN A;  3S3N A;  4HQM A;  3LOC A;  2QZ8 A;  5L3F A;  1WSU A;  4PJ0 C;  1M1E B;  3R61 A;  3U21 A;  2NVT J;  2FQ4 A;  2OZU A;  4BDY A;  1YTY A;  1YW9 A;  3CC7 I;  4WXC A;  3EUK L;  3COA C;  4U0W A;  1XGS A;  4C3H J;  2DFI A;  1IXS B;  2XUB A;  2JUC A;  3K4N A;  2XPW A;  1BI3 A;  4CIC A;  5LGT A;  3JRH A;  2MLK A;  1ZGJ A;  3IHU A;  1YI2 I;  1GT0 C;  2NAZ A;  1SAU A;  1MMD A;  4ENN A; 
#chains in the Genus database with same CATH homology
 4M3E A;  1H8A C;  5IPA A;  5E3M A;  4AUX A;  3UKG A;  1JKP C;  1JKQ C;  5GPA A;  2Y0S N;  4BY7 J;  2M9H A;  2ME0 A;  3HOV J;  3TP0 A;  2ME6 A;  1MSF C;  1IGN A;  5FLV A;  2N8G A;  3TW6 A;  5F1J A;  1QPI A;  2DA5 A;  2K9Q A;  3BR5 A;  3S2D J;  3WHC A;  4DYC A;  1SFO J;  2E2H J;  1HCR A;  3M4O J;  1HLV A;  2HI3 A;  1HF0 A;  1RES A;  2Y30 A;  5IYB J;  1ZR2 A;  2G0E A;  3FK6 A;  2LD5 A;  5C3E J;  4A3M J;  4A93 J;  2JMW A;  1MNM C;  3CDL A;  3JRF A;  2E19 A;  1IJW C;  2XPU A;  9ANT A;  4A3J J;  2WB1 N;  3ZQI A;  1W0T A;  2CJJ A;  1D5Y A;  4IHV A;  4I6Z A;  1IC8 A;  5E3O A;  1MSE C;  5FKN A;  2K9S A;  3DEW A;  3PO2 J;  3JRA A;  2L7F P;  3ZQL A;  5C4J J;  2VUM J;  2CU7 A;  1I3Q J;  3HKZ N;  5F0C A;  1H89 C;  1VI0 A;  2HYJ A;  4DYQ A;  4CYC B;  2JN6 A;  1AHD P;  2HDD A;  4AC0 A;  4LOC A;  1FEX A;  1YRN B;  5EG0 B;  1WI3 A;  2XB5 A;  5EGO A;  2KDZ A;  5M5Y J;  5FJ8 J;  3S15 J;  1T56 A;  5EZH A;  2IEK A;  4L5E A;  2QCO A;  1IRZ A;  2LFB A;  5IP7 J;  1I6H J;  4IHX A;  2Y2Z A;  1JUM A;  3G1L A;  2RAE A;  4A3K J;  2VKE A;  5C44 J;  3MN2 A;  2XRL A;  2O8K A;  2HXO A;  3BG5 A;  4M3G A;  3I4M J;  4RDU A;  1TWH J;  3OIO A;  4IHY A;  1WCM J;  3LSP A;  1OFC X;  3BR1 A;  5F0F A;  1K61 A;  3S1R J;  3BQZ A;  3BG9 A;  3F0C A;  4QTR A;  1B72 A;  5FLM J;  1WGX A;  4XID A;  3NAR A;  2L7Z A;  4M3F A;  1RKT A;  1B8I A;  5EYR A;  3RKQ A;  3HDD A;  1HDP A;  1XC5 A;  5FKK A;  1BJZ A;  3S1N J;  2MG4 A;  3GTP J;  4NDL A;  2TCT A;  2L9R A;  1ZK8 A;  3HGG A;  3CMY A;  2M2E A;  4FE4 A;  4FIS A;  3Q0W A;  2D5V A;  1UMQ A;  2DA2 A;  3ZQF A;  1UG2 A;  2HXI A;  4XRM A;  2R93 J;  1JT0 A;  5EF6 A;  4D5F A;  4MIM A;  2FX0 A;  4V2F A;  1PUF A;  4W1U A;  5FKM A;  3MKL A;  3BQY A;  1ZKG A;  4A3B J;  2XGE A;  4XRS A;  2IBD A;  5DTD A;  3DCF A;  1Z77 A;  4ABZ A;  2LTP A;  3HGY A;  4B3A A;  1HDD C;  2EBI A;  4IHW A;  2O9L A;  1IDY A;  2X48 A;  2B63 J;  3IH4 A;  2NVQ J;  1ETY A;  3JRE A;  2VPR A;  2Y9Z A;  4RBO A;  1X58 A;  2AHQ A;  2LLK A;  2GBY A;  2R5Y B;  3JRI A;  1FJL A;  2DA3 A;  1WH7 A;  1NK2 P;  2CRG A;  4M3D A;  5IYD J;  4C2M J;  1R9T J;  2MGQ A;  1CQT A;  3FK7 A;  5M5X J;  1K83 J;  1FIA A;  3BTC A;  4C3J J;  5K7Z A;  4W97 A;  3SJM A;  3VPR A;  2HOS A;  1EF4 A;  4JYK A;  1E3O C;  1RKW A;  4HNV A;  4UUS B;  1XG1 A;  2EZH A;  4BBR J;  1JUS A;  3W6V A;  3LSJ A;  5E3L A;  3SDG A;  4A3C J;  4IEJ A;  2EZK A;  3I4N J;  4A3F J;  5EDN A;  1G2H A;  4XK4 A;  1QRY A;  4X1E A;  1TWG J;  1MH4 A;  3BTL A;  4QSH A;  1JT6 A;  1FIP A;  5FKL A;  1MBF A;  2CUE A;  1B72 B;  2LR8 A;  2O7O A;  1LE8 B;  1GUU A;  2ECB A;  5F27 A;  2DJN A;  3G1O A;  3RZD J;  5J3L A;  4A3D J;  1Q1V A;  1X2M A;  1BW6 A;  3HEF A;  3HBL A;  3A02 A;  4M6V A;  2JA7 J;  4FTH A;  4S0H B;  2R0Q C;  4FCY A;  3S1Q J;  2JK3 A;  5EEA A;  5F08 A;  3OOU A;  4J19 A;  3JRC A;  1PUF B;  5K7F A;  2DMT A;  3BR6 A;  2NS8 A;  1U9N A;  2XGC A;  5IOZ A;  1ETK A;  1ZR4 A;  1DU6 A;  4FE7 A;  3C2B A;  3GTG J;  3B6C A;  2YUS A;  2X9D A;  1JKR C;  4Y52 J;  1NK3 P;  1ENH A;  2LP0 A;  3E7L A;  3H0G J;  3RZO J;  3BR2 A;  5M3M J;  3NAU A;  1OJL A;  1W0U A;  1FTT A;  3ZOB A;  2EZL A;  4DZP A;  1Y1V J;  1S7E A;  4DZJ A;  1MBH A;  1VND A;  3HOW J;  4BBS J;  3JRD A;  1VF9 A;  2L7M P;  4BXX J;  1LFU P;  2NVY J;  4A3I J;  2VKV A;  2K9N A;  5BNG A;  1IUF A;  5IP9 J;  4A3E J;  4UUS A;  1WPK A;  1VFC A;  4A3G J;  1A6I A;  4D5C A;  2FJ1 A;  5F0H A;  2DTZ A;  2DA7 A;  4XIC A;  1T33 A;  3PO3 J;  3GTM J;  1ETQ A;  1DU0 A;  2LK2 A;  2K40 A;  5IYC J;  1TWF J;  1B8I B;  1TC3 C;  2HOT A;  1QVU A;  3HB9 A;  3CQZ J;  3GTQ J;  5EG0 A;  5GP9 A;  3GBG A;  1JGG A;  1YRN A;  5IOY A;  2EQR A;  2FD5 A;  3H3V K;  1Y1W J;  2HOA A;  3A03 A;  5DS9 A;  1H88 C;  2ID6 A;  1OCT C;  3LNQ A;  2E2I J;  2DMP A;  1F36 A;  3HOZ J;  3B6A A;  2M34 A;  4I76 A;  3TP3 A;  2I10 A;  2JA5 J;  3BG3 A;  2DMQ A;  4D7M A;  3D1N I;  3BTI A;  3MVP A;  1F43 A;  3M3Y J;  2WV1 A;  2H8R A;  2AO9 A;  1OCP A;  1MBJ A;  1ZTR A;  1SAN A;  2ELK A;  2ZB9 A;  4JX4 A;  3HOY J;  2CUF A;  2P81 A;  2XSD C;  2COB A;  2JWT A;  3HOU J;  2MW8 A;  1JJ6 C;  4JX6 A;  3TED A;  2YS9 A;  3IH3 A;  5HOD A;  4MFD A;  3BR0 A;  2LKX A;  2DMN A;  2WAQ N;  2E1O A;  1ETV A;  1Z0X A;  3ZQH A;  2NS7 A;  2OPT A;  1NTC A;  3S1M J;  2CQQ A;  2IAI A;  1U8B A;  2ECC A;  4GFB A;  1ETW A;  4A3L J;  1APL C;  5FKO A;  4A69 C;  3GTK J;  3GTL J;  1XS9 A;  2E2J J;  3OSF A;  2GM4 A;  2JJ7 A;  3HM5 A;  2DMU A;  4MLO A;  3BTJ A;  2OF7 A;  2EH3 A;  2M0C A;  5J1U A;  5GPC A;  4BY1 J;  1U78 A;  1IV6 A;  2R5Z B;  5JLW A;  3TW7 A;  1ETO A;  4B4C A;  2MSY A;  1A5J A;  3OSG A;  3FIW A;  2DA1 A;  5M5W J;  1U9O A;  2DA6 A;  3A01 A;  5EGO B;  1BA5 A;  1POG A;  3JR9 A;  1FTZ A;  2R5Y A;  2XGD A;  2NVX J;  1ZGW A;  4C3I J;  4M3B A;  1JJ8 C;  4CYC A;  5M3F J;  3S17 J;  2JA8 J;  4D7N A;  2NOG A;  1ITY A;  3PM1 A;  2H1K A;  1RET A;  3Q3S A;  1AKH A;  1BL0 A;  3IV5 A;  1LE8 A;  1ETX A;  2R92 J;  1GDT A;  3S2H J;  3G1M A;  3S14 J;  3RQI A;  5JLX A;  3L1P A;  5C4X J;  4JP0 A;  3QPL A;  3JRG A;  4AYB N;  2W48 A;  2XB0 X;  1GVD A;  2X6O A;  4UUT A;  1UHS A;  2DA4 A;  3Q0U A;  4V2G A;  2VI6 A;  1LFB A;  2DN0 A;  2R5Z A;  1MBG A;  4DYR A;  2M8G X;  2XPV A;  1WH5 A;  1TWC J;  3WHB A;  4QIW N;  3QPS A;  2LY9 A;  5E3N A;  2LVS A;  3FIS A;  3BR3 A;  2YU9 J;  4DW6 A;  5K7H A;  1JUP A;  3LSG A;  3S16 J;  2TRT A;  3FKI J;  3QQA A;  2HQ5 A;  3O8G A;  2CQX A;  2Y9Y A;  1RR7 A;  1BW5 A;  3Q0V A;  1RPW A;  1JTX A;  1TWA J;  1IG7 A;  2EZI A;  1JTY A;  3K7A J;  4MFE A;  4X6A J;  4Y7N J;  1AU7 A;  5J1Y A;  4JX5 A;  5J1R A;  1JKO C;  3IH2 A;  4G12 A;  2Y31 A;  1X2N A;  1GV5 A;  4XRS G;  3BT9 A;  5F04 A;  1P7J A;  2L0K A;  2R7Z J;  2PMZ N;  1GV2 A;  3LSR A;  1ZQ3 P;  5IP6 A;  4BKX A;  3JRB A;  3ZQG A;  1IDZ A;  2JA6 J;  5EZG A;  1ORK A;  3HOX J;  3LOC A;  4B1R A;  3A01 B;  4EEF G;  1O4X A;  1MH3 A;  2NVT J;  2FQ4 A;  3O8H A;  3GTO J;  3SFI A;  1HOM A;  1QVT A;  1MBE A;  3K2A A;  2QF7 A;  3ZQC A;  3CCY A;  3GTJ J;  4C3H J;  2KT0 A;  1I50 J;  2GLO A;  1AKH B;  2XPW A;  3JRH A;  2ID3 A;  1GT0 C;  1P7I A;  4MO7 A;  1MBK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...