1I6HJ

Rna polymerase ii elongation complex
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
65
structure length
65
Chain Sequence
MIVPVRCFSCGKVVGDKWESYLNLLQEDELDEGTALSRLGLKRYCCRRMILTHVDLIEKFLRYNP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 5'-D(P*AP*AP*AP*TP*GP*CP*CP*TP*GP*GP*TP*CP*T)-3'
publication title Structural basis of transcription: an RNA polymerase II elongation complex at 3.3 A resolution.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Transcription/dna-rna hybrid
total genus 17
structure length 65
sequence length 65
ec nomenclature
pdb deposition date 2001-03-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
J PF01194 RNA_pol_N RNA polymerases N / 8 kDa subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 1i6hJ00
5EYRA 5K7ZA 2KDZA 2GM4A 1WH7A 2LTPA 4JYKA 1IDZA 4A3DJ 4I6ZA 1ZGWA 2DMUA 3GTKJ 5IYCJ 1IJWC 1Z0XA 2DTZA 1K61A 1O4XA 2H1KA 4AC0A 3JRBA 2DMQA 2DA7A 3TP0A 3BR1A 3Q0UA 5EZGA 2E2IJ 5IP9J 1MBKA 3LSJA 2GBYA 3BR0A 1WH5A 1B72A 1MSFC 3GTLJ 3G1MA 1ZTRA 2LKXA 2XSDC 2ECCA 3M3YJ 4Y7NJ 2HOSA 2NS7A 4JX4A 5J1UA 5C44J 1XS9A 2CUEA 1MBJA 3ZQIA 1XG1A 2MW8A 2WAQN 5M5WJ 3HDDA 4JX5A 3L1PA 4FCYA 1FTZA 5EDNA 3JREA 2G0EA 4D5CA 3W6VA 5C4JJ 3ZQLA 2IAIA 5M5YJ 4XRMA 4A3JJ 3A01B 1JT6A 2HI3A 2ME0A 2EQRA 5K7HA 2LD5A 2COBA 4FE4A 4W97A 4MFDA 3HGGA 4I76A 2JN6A 3I4NJ 4XRSA 9ANTA 1JKOC 1AU7A 4RDUA 2L7MP 4L5EA 2JA7J 3I4MJ 3LSGA 4EEFG 1HCRA 3ZOBA 2YUSA 2R5ZB 3JRFA 1NK2P 3Q0WA 2NS8A 3OIOA 1PUFB 3S2HJ 2AO9A 4XICA 3HOYJ 1POGA 3IH3A 1TWHJ 1APLC 3D1NI 2K9NA 2WB1N 1BJZA 4DZPA 3HGYA 2P81A 2E2JJ 1MBEA 2FJ1A 2Y30A 2M9HA 3HOXJ 1LE8A 4M3EA 1IG7A 2Y2ZA 3O8GA 2M8GX 1U8BA 5M3MJ 2DA5A 4MIMA 1B8IA 2DJNA 2XB0X 4M3DA 1ETWA 3BQYA 4DYRA 5F27A 5J1RA 4DW6A 4W1UA 1F36A 1RR7A 2JK3A 1MH4A 3DCFA 1FJLA 1UMQA 2TRTA 4MO7A 1U9NA 1JTYA 2VKVA 1H88C 2CJJA 3A02A 1TWGJ 3GTMJ 2DA3A 1QVTA 1JT0A 3CQZJ 2JWTA 1NK3P 3S1NJ 3S2DJ 3GTQJ 4DZJA 1YRNA 4UUTA 1JJ8C 3HKZN 5IYBJ 5EG0B 4C3JJ 3Q3SA 2NVXJ 3MKLA 4BY7J 1AKHA 1DU6A 4A3IJ 1HDDC 4XIDA 1CQTA 2R5YA 3G1OA 3TEDA 5C3EJ 3IV5A 1GT0C 2DN0A 5IYDJ 3IH2A 5FLVA 1T33A 2EBIA 3K7AJ 2W48A 1Z77A 2LK2A 1WPKA 5E3OA 4A3FJ 5F08A 2XB5A 4MFEA 2HXIA 2L7ZA 1BA5A 1ETOA 1SANA 3MVPA 3BG5A 2CQXA 4A93J 1IGNA 5M3FJ 2JA5J 1X2MA 1P7IA 2CQQA 3BT9A 4QSHA 2HDDA 5IP7J 1MBFA 4C3IJ 4BKXA 3O8HA 3GTJJ 2JMWA 5DS9A 2DA2A 1JKQC 3S16J 1ZR2A 1Y1VJ 2DMTA 2ZB9A 5DTDA 1T56A 2XGDA 1U78A 5EZHA 1P7JA 3BR6A 3RKQA 2WV1A 2H8RA 5HODA 3M4OJ 1IRZA 1AHDP 1JGGA 3IH4A 3DEWA 3E7LA 5JLXA 1ETQA 4C3HJ 3ZQGA 5GPAA 1FTTA 4DYCA 1JUMA 1I50J 3BR3A 1K83J 2L7FP 2AHQA 3LSPA 4JX6A 1E3OC 4S0HB 2VI6A 3BG3A 5F0HA 1UHSA 4XK4A 4MLOA 4G12A 4M3BA 1JUSA 2K9QA 2R92J 4UUSA 2DA6A 2EZHA 4M3FA 1ZK8A 5EG0A 3GTGJ 5IPAA 3UKGA 2QF7A 3BTIA 1TC3C 2X6OA 3OSFA 4LOCA 2VUMJ 2IEKA 4M3GA 1ETVA 1MH3A 1HOMA 1RETA 2D5VA 1JUPA 4FE7A 3HB9A 1VI0A 2DA4A 3BTLA 2NVYJ 3LSRA 4ABZA 4FTHA 3JRGA 4IHWA 2JA6J 4D5FA 1I3QJ 1IV6A 4CYCB 3RQIA 1VFCA 2CUFA 1QPIA 2MGQA 3S17J 2LLKA 1D5YA 2XPVA 2O9LA 2R93J 1A5JA 2MG4A 5J3LA 2OF7A 5GP9A 5E3NA 2Y9YA 1ETXA 2KT0A 5IOYA 5J1YA 2O7OA 1X2NA 3TW7A 1B72B 2X9DA 5GPCA 3GTOJ 3VPRA 4J19A 1NTCA 4B3AA 3QPLA 2M34A 4IHYA 2ID6A 2E2HJ 3S1QJ 1ZKGA 1HLVA 2YS9A 2GLOA 3FK6A 3FISA 5F04A 2HOAA 3HOWJ 1ITYA 3S15J 1VNDA 5K7FA 3GBGA 3JRIA 2NOGA 1RKWA 3A01A 1H89C 1RPWA 1ORKA 1I6HJ 1JTXA 1MSEC 3PO3J 5EGOB 4A3BJ 2TCTA 1ETYA 3FIWA 4A3MJ 4FISA 2ECBA 2L9RA 2ID3A 2XGEA 1LFBA 1S7EA 2O8KA 2EZKA 4BY1J 1TWAJ 5JLWA 4X6AJ 5F0FA 3TP3A 1WGXA 2EH3A 2HOTA 2LR8A 2R5ZA 3F0CA 2RAEA 3ZQCA 1ETKA 2IBDA 3B6CA 2ME6A 4A3KJ 1W0UA 1PUFA 4BBSJ 3CDLA 1RESA 2FQ4A 3SFIA 5C4XJ 2FX0A 3FKIJ 2LY9A 1HF0A 3BR5A 5FKKA 2K40A 2JA8J 1GVDA 2HYJA 1ZQ3P 1OJLA 1OCPA 2YU9J 1SFOJ 1GDTA 3HBLA 4CYCA 3BTJA 5E3LA 1FIAA 2Y31A 1B8IB 2DMNA 4NDLA 2I10A 3ZQHA 3HEFA 4GFBA 4IEJA 2E19A 3JRHA 5M5XJ 4A3EJ 1EF4A 2M2EA 4QIWN 1QVUA 5F1JA 2EZLA 1BW6A 4Y52J 4B1RA 5FKOA 3HM5A 3BG9A 3S14J 1HDPA 5EF6A 1TWCJ 1YRNB 4M6VA 1W0TA 4HNVA 2XPWA 1GV5A 4B4CA 4D7NA 3CMYA 1AKHB 3B6AA 3PM1A 1RKTA 1QRYA 1XC5A 2QCOA 1TWFJ 2R5YB 3MN2A 5E3MA 3A03A 2Y9ZA 4V2GA 1MBHA 4IHVA 5FJ8J 1WI3A 1JKPC 1U9OA 3G1LA 1GUUA 3BQZA 3BR2A 1GV2A 2DMPA 3NAUA 2PMZN 3HOZJ 3CCYA 2LP0A 3LOCA 2XGCA 4AUXA 4DYQA 5EGOA 3TW6A 1LFUP 2X48A 2XRLA 3PO2J 2NVTJ 1OFCX 2OPTA 5F0CA 1H8AC 2R7ZJ 2MSYA 4XRSG 3Q0VA 4V2FA 1BL0A 1WCMJ 2JJ7A 2LFBA 4QTRA 5EEAA 3H3VK 3SDGA 1R9TJ 3LNQA 2XPUA 4IHXA 2ELKA 1IDYA 3OOUA 3JRAA 4BXXJ 1ZR4A 2B63J 2DA1A 3S1MJ 1X58A 1ENHA 3GTPJ 3C2BA 4A3GJ 1IUFA 4X1EA 2CU7A 2VKEA 5IP6A 1Q1VA 1MNMC 1BW5A 1G2HA 3H0GJ 4BBRJ 3QQAA 3JRCA 2N8GA 4C2MJ 2NVQJ 3JR9A 4JP0A 1DU0A 5IOZA 3NARA 1FIPA 4UUSB 2K9SA 3RZOJ 2HQ5A 2CRGA 2HXOA 1VF9A 3HOUJ 2E1OA 3FK7A 1OCTC 4A3CJ 1IC8A 1UG2A 3ZQFA 2EZIA 2Y0SN 3S1RJ 3K2AA 1JKRC 5FKLA 3BTCA 5FKMA 4AYBN 3JRDA 3RZDJ 2L0KA 2VPRA 4D7MA 4RBOA 3WHCA 2LVSA 1F43A 3WHBA 3QPSA 3SJMA 1Y1WJ 2FD5A 1A6IA 5FLMJ 5BNGA 1JJ6C 3HOVJ 2M0CA 1FEXA 3OSGA 2R0QC 4A3LJ 4A69C 5FKNA 1MBGA 1LE8B
chains in the Genus database with same CATH superfamily
4II3A 4CCNA 1WH7A 3ABMH 3IWFA 2LTPA 5GAEJ 4BHCA 1IXSB 4NNJA 3ZGKA 2RGVA 2A05A 1KU9A 3OYIA 3ZMSA 3MZ8A 3IRRA 4BUPA 3F3XA 3GXOA 4RAZA 4MQ9F 5J4VA 4BL0B 1I1SA 3QAHA 3L7WA 2HQNA 5EZGA 2WTEA 4IVNA 3RPUD 1YO5C 2VB6A 2GBYA 3BR0A 3WGGA 1WH5A 4MNUA 5FB2A 1B72A 2ACJA 4UUVA 4XKBA 3G1MA 3HSEA 2I8DA 2P5VA 2ECCA 3M3YJ 2BHZA 4HLYA 3EYIA 4JX4A 1NH3A 4IOCF 4A5MA 4L5JA 5HS8A 2JSPA 3UR3C 1GXPA 3EYYA 3ZQIA 1XG1A 2R7DA 4XL9A 1FTZA 5DD8A 2A3SA 1OR7A 3KZZA 2A6HF 5C4JJ 3CC2I 4AU7A 4ZZLA 3CTAA 4XRMA 4A3JJ 2BEOA 2H27A 4L18B 3OYBA 2KHMA 2HI3A 4G7ZF 1ONVA 2GIVA 4FE4A 4ZYEA 5E1WA 2LY1A 1D1CA 2JN6A 2K7LA 4IHSA 3I4NJ 3A1YA 4RAYA 4E7JA 2HFHA 3KLOA 1AU7A 1BI0A 5E18F 1FP2A 1HCRA 1S3JA 2M4GA 1ODDA 1DP7P 3MFKA 1OR7C 1G3YA 3Q5FA 1QA6A 3OIOA 4EJWA 1YX5A 3K4LA 3WODF 3LSMA 2RC4A 2HYFA 3VSLA 1POGA 4LGWA 4MTDA 3GMEA 4WX9A 2JPCA 2FQ3A 2P81A 1BR2A 1BIAA 2LREA 3BZ6A 1LQ1A 2NNNA 4M72A 3HOXJ 3QYBA 4ON0A 2R3SA 3ZXSA 1N25A 3C7JA 2KJCA 5L3GA 4MIMA 2P8TA 4C9YA 2XB0X 3DTKA 1ETWA 1W1WE 3DLAA 3CP8A 4DW6A 5HLGA 2PI0A 4KT6A 2CV1A 3ZN0A 2CQKA 5B1AH 1FJLA 2VQGA 3P9KA 2K27A 2VASA 2VKVA 2KZGA 4MO7A 1PJRA 1XGMA 4RS8A 1S5LC 4YFKF 1XSDA 1DPUA 1NK3P 4HLXA 1YRNA 1FWZA 5EG0B 3PQKA 2IS1A 1MMNA 3AAFA 2IP2A 3MZHA 1DU6A 2PJPA 3BZCA 3WGIA 1BBYA 3HSRA 4RM3A 2CW8A 2M0MA 2EV6A 4IZZA 2BOLA 3FHNA 3KLNA 5FFXA 3TEDA 5IYDJ 5FLVA 4UNOA 2W48A 1Z77A 2LK2A 3QP6A 2WWYA 2V9KA 3E5QA 3E6MA 3L00A 3F6OA 1STZA 4PJJA 4YFNF 4P96A 4XR6A 2IGNA 3PL8A 1QBJA 4HX7A 2WAEA 2XUBA 4OIPF 3MVPA 4ENKA 2F2EA 2E1NA 1SFUA 2FE3A 4LITA 1IUYA 2M7BA 2V4JC 1AWCA 2R7TA 5GADJ 2ZSHB 3MAJA 4QSHA 2HS5A 4AIDA 3DFGA 2OAZA 3I59B 3O8HA 2QKMB 4PSXA 5K5RA 1ZR2A 5HLIA 4YFXF 1ZARA 5EZHA 5K5OA 1GVJA 3DEUA 3OS2A 1H9GA 2WV1A 2H8RA 1RUOA 5JFRA 4Z6YA 5E1XA 3VYUB 3DEWA 1XN7A 3MCZA 4N9IA 1B6AA 4CSWA 2GAUA 3BC8A 4XLNF 3ZQGA 3DPTA 3S3OA 5DEQA 3BR3A 3W3CA 4AIKA 2VOOA 3D5RC 1SAXA 2P5KA 4FX4A 1E3OC 4I02A 5CVJA 4S0HB 2VI6A 3BG3A 5F0HA 5BQTA 3FM3A 4ENNA 4MLOA 2CV0A 3CCMI 3DTIA 2DA6A 2DOAA 1ZK8A 5EG0A 3GTGJ 3IHUA 3UKGA 4EV0A 5D5UB 2X1EA 1VQ4I 2IRFG 2BBYA 2PG4A 3HXLA 3CF5F 3G71I 1RETA 3ERMA 2D5VA 1JUPA 4EJVA 3D5LA 1YOVB 1BJAA 3U9GA 2F48A 1MZBA 1YS6A 1HC8A 5D4SA 2IA1A 4IJAA 2DA4A 3SHFA 2DK5A 2OZ6A 1WFXA 3DXJF 1JE8A 4FTHA 3JRGA 1BC8C 1SVOA 1IV6A 4OIRF 1K78B 4LLGF 4AVPA 1VFCA 2LH9A 3BWGA 1JHHA 1QPIA 3CZ6A 2Z16A 3I59A 5ICFA 2R7SA 2LLKA 2ZXIA 4BXUA 1D5YA 5JR3A 1FYMA 3VOEA 4I0AA 2O9LA 1MJBA 1A5JA 1LPQA 2OF7A 2Y9YA 2BY3A 1KU7A 3RDIA 3HRSA 4U0YA 3BCBA 4HNTA 4UVAA 3G2BA 2CGPA 1X2NA 3CCVI 3K70C 5GPCA 3GTOJ 3VPRA 1XMAA 4MEYF 3DBRB 4BDYA 1YIOA 3VYRB 1NTCA 1G3SA 3CJTB 5CLSA 2E2HJ 3UNGC 2E5ZA 3KYDB 3ZPLA 3T5XA 1HLVA 2RQQA 3GZNB 1E17A 5ED4A 3L2VA 3AG4H 1TW2A 3HOWJ 1XSXA 2XF6A 2ZMEC 2WC2A 4B44A 3VDXA 1FOKA 5ILSA 4EATA 3HRUA 1RPWA 2XAFA 4CDGA 3QPTA 3ZR8X 1MSEC 2TCTA 2PMHA 4FISA 4ENJA 1YJWI 2ID3A 2XGEA 1WRJA 2KISA 2EZKA 3P9CA 3SZPA 4X6AJ 1S7AA 3IRQA 2EH3A 2R5ZA 3F0CA 1IF1A 5IT9K 2WY8Q 1T8IA 2ME6A 4M9SA 1W0UA 3JTHA 1LEBA 1PP7U 1RESA 3M8EA 2BY2A 2A69F 3FKIJ 2OUMA 3ABTA 2K40A 2JA8J 3VYSB 3OS0A 1ZQ3P 3RIRA 1GDTA 4L5IA 3KYCB 2ESHA 2LKSA 3V4GA 3BTJA 5E3LA 4WXDA 3GW2A 3RCOA 1QZZA 5DM6F 4NDLA 5JHFA 2D1HA 3CCLI 1A6QA 4CGZA 2HEOA 5CJ9A 3HYIA 1EF4A 4QIWN 3OYLA 2ZJRF 4XN0A 2EZLA 3I55I 4A5NA 3MMYB 4B1RA 1V55H 4ZZDA 2W1OA 4R1HA 2GXAA 1L0OC 3HM5A 3O6BB 3OYJA 3OYGA 1HDPA 5ILVA 4E7HA 2OU2A 5FD5A 2XPWA 4JK1X 3REOA 3B6AA 1W5SA 2OTLI 2QCOA 1KQ8A 3JSPA 3MN2A 3FDYA 1FYLA 4IHVA 3TO9A 1FT9A 5LHIA 1WI3A 4E7SA 1MNDA 1GUUA 5FO5A 3BR2A 2LMDA 4YELA 3OYDA 3I58A 2CUZA 4CZCA 2V26A 2L4MA 5K1YA 1YHQI 2L54A 3KX2A 4M71A 4UV9A 2JZYA 4BQAA 1TL8A 2ZJPF 3CF2A 1R22A 2L02A 2M87A 1H8AC 2PMZA 4B48A 5IT3A 4EJOA 2B9SA 3GF2A 1MIJA 1Z6TA 4LLLA 4CCLA 3J7YJ 1U8RA 5EEAA 2LFBA 3C2GA 2M8EA 2IJLA 1G6NA 2JSCA 1IZ1A 2B0LA 5DDGA 2XPUA 3L2RA 1IDYA 3OOUA 1KZHA 4BXXJ 3G73A 3DQVC 3PNTA 4JQFA 3S1MJ 4BS9A 1R36A 1ENHA 1Z3XA 1R4NB 2CYYA 4XLHA 4X1EA 4HDVA 2HR3A 2VKEA 1IW7F 4R79A 3HRMA 2X51A 2ZFUA 4KJZA 1X3ZB 2N8GA 3BPVA 5D6FA 2LNBA 1HW2A 4KNYA 2L9NA 4IQJA 4JP0A 1WJ5A 5IOZA 3OMYA 3J81Z 1ON1A 2BE5F 3BCAA 4UY8I 2HQ5A 2CRGA 2P7VB 4A3CJ 3WU0A 3R0AA 5J47A 1UAAA 2XAQA 2EZIA 2Y0SN 4HA8A 3K2AA 1IV8A 5FKLA 1CF7A 3RZDJ 4BJTA 5AIQA 1X4PA 4D7MA 4KN7X 2ADUA 4EJTA 4M9ZA 2QVOA 4NQWA 5GTIC 3QPSA 2FD5A 1V3FA 4HSRA 3LSIA 5ICGA 2QM3A 1Y39A 3F72A 3HOVJ 3OYFA 2FBIA 2A6EF 2PEXA 2FXAA 1FEXA 4RB3C 4A3LJ 3WTTC 3M8FA 5FKNA 1LE8B 2FMYA 4UVBA 2KDZA 4PFOA 1Z9CA 1JGSA 4E7ZA 1ZGWA 4XLAA 2DMUA 5IYCJ 2H09A 1HBXG 2DTZA 1K61A 4U0VA 1O4XA 2H1KA 2XIGA 4AC0A 4PJ0C 3BY6A 3JRBA 3RSNA 2DMQA 4P9FA 2VONA 5DCMA 3TP0A 1UHWA 5ICCA 1QHHD 1USTA 4GYIA 5D5VB 2VOPA 1MBKA 1VQPI 1K6OA 3HOTA 2QENA 2CH0A 2FSWA 1X1CA 1MDMB 2HGCA 1HQCA 2F4IA 1ZTRA 4Y17A 4QLCU 4G7HF 1OLTA 1C0WA 3WE3A 1VQKI 5DUKA 1QHGA 2IGMA 2RDPA 3F8CA 5TRDA 3N4MA 3LWFA 5AONA 5CVIA 1Z7LA 4AD9A 4HX4A 3RI4A 1F5TA 2LKPA 3CUQB 2EIKH 2L2OA 6PAXA 4HOBA 4F55A 1TQPA 2G9WA 3FF5A 1EJ9A 1ZREA 3AFHA 1F1ZA 1JT6A 3PSIA 2E34A 3I71A 5J6XA 5BOXA 1OISA 1HKQA 2GWRA 4W97A 4HAMA 4XRSA 1JKOC 2EIJH 3E5XA 2Q2EA 3WTYC 2LY2A 2ESNA 2FOKA 3E97A 3LFKA 2P7CB 2ETHA 3LSKA 3MKZA 2EIMH 2HPIA 3H3ZA 2NS8A 3FBNB 1PUFB 3S2HJ 3EUHA 4XICA 1RUNA 2XAUA 2P5LC 1S8NA 2OCEA 3DKWA 3D1NI 2K9NA 3ECOA 1HW5A 1BJZA 1YW8A 2LYCA 3RYPA 4GGGA 1ZELA 1MBEA 1B59A 2HVQA 2M9HA 3HC7A 1ERDA 1LE8A 1IG7A 3O8GA 3FWEA 5M3MJ 1ZG3A 2DA5A 1B8IA 2TDXA 5D5WB 5GAHJ 1IXCA 4M3DA 4XLFA 5HLTA 1IN7A 4HBLA 3EUHC 3GLXA 1F36A 1FP1D 1MH4A 4IO9F 3J7AO 1U9NA 1H88C 2EA4A 2H1LA 2VT2A 4BQOA 4MEXF 4ANJA 2QUFA 3I53A 3V8JA 3K4JA 1WJFA 2DA3A 2CWEA 4DBQA 1FOWA 4PGHA 2JWTA 1G3TA 1X1PA 4F52A 2QSFX 5IYBJ 4C3JJ 5DYMA 3KEOA 2QQ8A 4XKVA 4PFPA 1P2FA 1AKHA 4KN4X 1YQAA 4A3IJ 1A36A 1BM9A 2BXYA 3J7ZI 1CQTA 3O3KA 3TO6A 2RN7A 2R7WA 4HDUA 2R5YA 4NUBA 1BI1A 5C3EJ 3IV5A 5L3CA 1X3WB 3CCRI 3HKZA 4XLPF 3K7AJ 5E3OA 4OINF 5F08A 4MFEA 1T39A 2HXIA 2DQRA 2VC1A 3KE2A 4UB6C 3CDHA 1YFHA 1IGNA 3RYRA 2CFXA 3ESWB 2HDWA 2CQQA 3IKVA 4F7ZA 1ZH5A 4ZYDA 1ZRCA 2HDDA 1FSEA 3EETA 4BKXA 2ZCWA 5LEKA 2DYSH 3GTJJ 4CICA 4HF0A 1L3LA 3QU3A 2BVLA 1Y1VJ 2DMTA 2X85A 3WTXC 1T56A 4XN3A 1LB2A 2EFOA 3W2VA 3H5NA 2F4OB 3BG7A 4BEHB 4LFUA 3U21A 2X6YA 1SC7A 1I5ZA 1IRZA 2VKHA 2IPQX 3K69A 4ESFA 4RB1A 1YX3A 3E1SA 1ETQA 4EJUA 1TP4A 4Q4ZF 4C3HJ 2M30A 2JVHA 3VWBA 5TISC 4BQQA 3MZYA 4PSWA 1SMYF 1KGSA 4HW0A 3QRFF 4E7IA 4DYCA 3J7AY 2RREA 1XGOA 2L7FP 2AHQA 1FZPB 3LSPA 4WCGA 3HTSB 3ZMUA 2BV6A 1YJ9I 2W84A 3H1CA 1WJCA 3MEXA 1DQUA 1R5ID 2IVMA 2ZC2A 3BZKA 3ELKA 3F6VA 4M9XA 4XK4A 4RLQA 1MMDA 4G12A 3MWMA 1JUSA 2EB7A 2VQHA 4RGRA 2R92J 1D5VA 1DGRM 2VODA 4M3FA 5CVRA 4DOZA 2W7NA 2QF7A 5KVRA 2X6OA 4LOCA 3KP5A 5BPDA 2DOFA 1ETVA 2NXNB 3F8MA 3BG6A 4I0BA 1HOMA 4B43A 2VQLA 3TOBA 1OYWA 3ZRGA 1N75A 2FNPA 1ZYRF 4FE7A 3PJRA 1N78A 1QU3A 2HYGD 3TQNA 1VI0A 1BR1A 2E7XA 3L09A 2VJIA 4D0PA 3BTLA 1FOYA 1R1TA 2VXZA 4HG2A 3M7GA 4LB6B 2CSOA 2HVRA 2UV1A 2GXBA 2XF5A 4IHWA 3A2KA 1D8JA 1LJ9A 1I3QJ 1FMWA 2ZFWA 3EPZA 4OOIA 2CUFA 2KRHA 1UELB 2KIUA 4ZDPA 2MGQA 1BR4A 2C6YA 3S17J 4WWCA 2P6SA 3H5RA 3W2WA 3CMMA 3GX4X 4BH9A 2R93J 2MG4A 3I64A 4ZYGA 2O6GE 1ETXA 4N4OB 5IOYA 3GYHX 5J1YA 3WU2C 5J8CA 2O7OA 5CVUA 5EJCA 2AXTC 2W00A 2Z33A 1PVEA 2KMUA 2RNGA 3CDIA 1BI3A 2KIQA 2LF8A 1Y6IA 3HJEA 2Y0MA 3KETA 2OD5A 1ZHFA 2ID6A 2J5OA 2Q1ZB 3S1QJ 4S05A 1IXRC 1ZKGA 1XTAA 4LK0F 2YS9A 1PUEE 5HDGA 5F04A 4EM0B 1EKEA 4IOAF 5ILUA 3GBGA 2Z9OA 1P92A 1RKWA 5LGNA 1ORKA 3IKTA 3PQJA 4HV6A 4IX7A 3O2PE 4KMUX 1XCBA 2X6XA 3FIWA 1YTYA 2ECBA 2L9RA 1MMGA 2O8KA 5LGUA 5JLWA 5F0FA 1W7PB 1WGXA 3TP3A 4XOPA 2LR8A 2VJ4A 4G7OF 2RAEA 3OS1A 2IBDA 2HVSA 2K02A 4A3KJ 1WVRA 4P1WA 3CDLA 1V5EA 4BBSJ 2JTVA 5DM7F 4XKWA 2P6TA 2IXSA 3BR5A 4HQMA 5FKKA 1E3HA 1GVDA 1XGNA 1SFOJ 3HBLA 4UV8A 2MA3A 1WJEA 2XDVA 2Y31A 2DXIA 3ABLH 4EVIA 2QWWA 4EM1A 4IEJA 2E60A 4A3EJ 4NC8A 3DU5A 2DAOA 1EV7A 5L3EA 1IN5A 2R7QA 5FKOA 4KUMA 1VQ5I 2W4SA 1Z6RA 5D4RA 1T2KA 1V4RA 2E5NA 3T0YA 1W4MA 3U2RA 5J4YA 3C3WA 2ZNYA 3DPUA 3W6JB 5EF6A 1TWCJ 3CCJI 4UXNA 3CCQI 4B4CA 3R61A 3J81K 3E6CC 2W24A 3PM1A 2JUCA 3M8JA 1OCZH 1EA3A 3QOPA 1XC5A 2I5UA 4ASNA 4L9VA 4I01A 2DFFA 4YG2F 4J01A 4E6KG 1TWFJ 2LF7A 1DP3A 3JCUC 4ITVA 1T38A 2OA4A 5E3MA 3ZQQA 1EH8A 2CMPA 4V2GA 5LD2C 1FNNA 3VFZA 3JTGA 3RPQA 3BQZA 4II2A 4UVCA 4IXAA 4PCQA 1W36C 2PMZN 1O7LA 3PSFA 2QEXI 2R7FA 3LOCA 3E6BA 2FOWA 3OYCA 2D45A 1LFUP 2X48A 2XRLA 2R7VA 2HKOA 2NVTJ 1OFCX 3I54A 3OY9A 2K85A 2VBXA 4KIBA 4BQNA 1B9NA 3VB2A 2R7ZJ 2MSYA 4OIOF 5CQGA 4X0GA 2XV4S 3PFIA 1BL0A 1WCMJ 2QBYB 1VQ9I 1XMKA 5BS6A 1R9TJ 2F5EA 3BJAA 3H9QA 4A6EA 2UWMA 1KONA 3LSTA 2B63J 2AXLA 1UG0A 4HZFA 3FXUA 1LKXA 3GZ5A 4FX0A 2VL8A 3GTPJ 3WTSC 1IUFA 1ZGAA 4IL6C 5B66C 4ZJZA 1GHCA 1Q1VA 3BPXA 4OIQF 3LL7A 1LFPA 1OMIA 3Q9VA 4JOMA 1BW5A 1G2HA 2V1NA 5IY5H 4BBRJ 3WU1B 2X6WA 2DT5A 2FNAA 3JRCA 4RB2C 2FF4A 2E1MB 4ESJA 2LBFB 3JR9A 4A6DA 4EM2A 3NARA 4UUSB 3GVAA 2MC4A 4GRIA 3RZOJ 1DPRA 3M07A 4XKCA 3FXRA 4WXHA 1OCTC 3DTEA 2HQRA 2BZTA 3FXOA 3S1RJ 3S93A 4XOTA 1I1GA 3QP5A 3K1PA 1TQMA 1Y0NA 5FKMA 3DKXA 3T8RA 3RKWA 2L0KA 5E8IA 2L01A 3BDDA 3OYHA 2JPBA 2BYVE 1SVMA 3DBLB 2IW5A 3G3ZA 3JAMZ 5FLMJ 1JJ6C 1HKTA 2MC3A 2EPFA 5DD4A 3LA7A 1S6LA 4AYBA 1SFXA 2RKHA 1MBGA 3H9GA 2FBHA 5EYRA 4C30A 3RKXA 2GM4A 4FHTA 1K78A 1JI8A 1IDZA 4A3DJ 1WI9A 1YITI 3PUFA 4OAZA 3RTRA 4OU0A 3FX3A 2VBWA 2LOOA 1UHMA 3AKZA 3EUKL 2VE9A 3CCSI 3K1NA 2QBYA 1CGPA 3BR1A 3Q0UA 2R4GA 3GUDA 3TBIA 3FMSA 4LB5A 1YW9A 1UZCA 3ZMZA 1VQNI 4BYYA 1B1BA 4EGYA 1YIJI 5B5EC 1E3PA 1UB9A 2XASA 3GWZA 5JI6A 1X1BA 3SZTA 3GTLJ 4AVZA 3CMEI 4F93B 2LKXA 1MW7A 2KP6A 2ZNZA 2XSDC 4XORA 1O3SA 4Y7NJ 4B3XA 3H9JA 3S3NA 2HOSA 2DFIA 3DV8A 2ZXJA 5C44J 1XS9A 2Z1DA 5LRRA 5HDKA 3SQNA 1MNEA 1QGPA 5A2QZ 3HDDA 4JX5A 3L1PA 1Z21A 5EDNA 3JREA 1SAUA 2K3PA 2K9LA 4D5CA 1K79A 3RPUA 3CLOA 5E79C 2LBFA 3A01B 2V7FA 1P6RA 2ZKZA 2AQFA 4BHBA 2LD5A 2ME0A 2STTA 2COBA 1QPMA 2WAQA 5E1ZB 1R5HA 4MFDA 3HGGA 1HSJA 3FXJA 4LLNA 4RDUA 2JA7J 4L5EA 2G7HA 2XC7A 1R00A 4EEFG 3QWLA 2OV7A 3ZOBA 2YUSA 2OTJI 3E0JB 1NK2P 3Q0WA 3ISPA 2AO9A 2UUZA 2E1MC 1W5TA 1LDJA 4M6YA 4BXFA 3HOYJ 1APLC 5AIPA 1WZ2A 3K4CA 4EQQA 2E2JJ 2FJ1A 3AL0B 3C2HA 4OMYA 4M3EA 2EINH 2WV0A 2M8GX 3WTVC 2NNYA 1BIBA 2ZJQF 2R7UA 2CQ7A 1LEAA 3TKYA 2WB1A 4G6DA 3BQYA 4FETA 5J1RA 3JW4A 1TT5B 4W1UA 3F8BA 1RR7A 2JK3A 2HNHA 3DCFA 3KP2A 1UMQA 2TRTA 3KEQA 4ENMA 1JTYA 2CJJA 2DI3A 3A02A 1J7KA 2O8XA 1SFKA 2DYRH 3CLQA 4KIFA 1QVTA 2YPRA 4GDFA 1UFMA 4AIJA 1IRGA 3S1NJ 3GTQJ 4L9NA 1O7FA 2DJIA 4KISA 3H0DA 2JRTA 1JJ8C 3HKZN 1WWXA 1TT0A 3Q3SA 1VTNC 1HSTA 3QODA 3MKLA 2K4JA 2VN2A 1R6RA 4PJNA 1HDDC 4KFCA 2K3FA 5FLXZ 1ZLJA 4LG0B 3ULQB 4HF2A 1U5TB 3OR1C 1GT0C 2DN0A 3IH2A 5CPRB 3TDUC 4ZTJA 2DOEA 3OIQA 2EBIA 2VBYA 1WPKA 1KQ9A 1WJBA 3HUGB 2UXNA 1Z3YA 2XB5A 3NEUA 2DFEA 2L7ZA 3DPLC 1QQIA 3HRTA 3VYTB 1BA5A 3D5SC 2DFHA 1EH7A 3BG5A 1B4AA 2CQXA 1FBQA 3DU6A 2JA5J 1X2MA 3OYNA 3COAC 1MMAA 4XQFA 2LRDA 2NS0A 2ZXHA 2B7EA 3BT9A 1MBFA 1MD0A 2JMWA 5DS9A 2DA2A 1I6XA 2J5PA 3S16J 1A04A 2ZB9A 2Z3YA 5DTDA 3ZQ7A 2VJ5A 3BLYA 4M6XA 2XGDA 2KIFA 1P7JA 3BR6A 2YX7A 3RKQA 4IPAA 4I2OA 2XKOA 1AHDP 2M7AA 4CH7A 3GLLA 2BY0A 5DCFA 2VBZA 2H94A 3E7LA 4S04A 1YS7A 4LK1F 2VIXA 1VQ6I 2KKOA 1FTTA 2MLKA 1JUMA 1I50J 1Y8QB 1WKMA 3HTUA 3WTZA 1K83J 3L9FA 4KMFA 3ECHA 4OAYA 3H36A 5KK1A 1FMVA 2KRCA 3U1KA 2CW7A 2HZDA 4IHTA 1TBXA 1XX5A 5D8LB 1FC3A 4KIGA 1IRFA 5FRNA 1UHSA 1YJNI 4M3BA 4LIVA 2JA2A 2BW3B 2Q8KA 1KU2A 1PYVA 2XHKA 1I3AA 5IPAA 5LHHA 1J5YA 2LG4A 4KYWA 1TC3C 3K70D 2IEKA 4PJMA 4M3GA 2QQ9A 5DV5A 4LG0A 1R7JA 3DKYA 2L5QA 3ZCOA 1T98A 3HIFA 4K2EA 4HQEA 1MJAA 3J80Z 2DQLA 2QSGX 3HB9A 1IRXA 2KQRA 4F92B 3F8FA 1O3RA 3N97A 1LVAA 3DP7A 1TQIA 4YIRX 2PMUA 2NVYJ 4FT8A 3NWTA 3LSRA 3X2QH 4ABZA 2JA6J 3RQIA 2HKXA 4MTEA 2YU3A 2LDUA 3CUOA 1VZ0A 1ZAOA 2V79A 1SD7A 2VKDA 2MYSA 1R1VA 2XPVA 2LSOA 5B1BH 5J3LA 5E3NA 4I99C 4Y13A 2KT0A 3ABKH 3V7RA 4DIQA 2M4KA 1S7OA 4GO1A 1BC7C 1X19A 3PIPF 1IAWA 4IRHA 1ZLKA 1Y0UA 3R6SA 4NC6A 2X9DA 1MDMA 1B72B 1Z91A 1AA7A 4WK8F 1OQYA 3R0JA 3L2WA 2F5FA 1I39A 3TOAA 2H6BA 4YEJA 3AG3H 2CUJA 2W82A 2YX4A 3P7NA 3VEPA 4B3AA 2M34A 4IHYA 1X3UA 4PK4A 4ZDOA 1OCOH 3EQLF 2HZTA 2IA0A 2MABA 1Q1HA 2Y69H 3WG7H 2HOAA 2HQAA 3CUQA 3F8NA 1ITYA 2NAZA 1QO0D 1VNDA 3JRIA 4AIHA 2NOGA 2L3DA 4HSTA 4NB5A 3WE2A 1I6HJ 2M3AA 4HEA2 1F4KA 4XMYA 5D8KB 2IT0A 1X1DA 3A0HC 3CMAI 3PO3J 2K86A 1SEUA 3IP4B 3JSOA 1SFEA 4FASD 1ETYA 3DF8A 4A3BJ 4O3MA 2M45A 1D0XA 3PNYA 3SFZA 1LFBA 1S7EA 1WSUA 4BY1J 4Q48A 3SDBA 1HW1A 2PLYA 2KRFA 3WTUC 4IQ4A 3ZQCA 1ETKA 4L0ZB 2L4AA 3CO6C 3CUQC 1PUFA 4P55A 2FQ4A 3NWSA 2FX0A 4BHPA 5HVQC 2LY9A 2MH9A 1HF0A 1J75A 4CYDA 5H2FC 3H92A 4Y33A 4ZC3A 2XAJA 4XSXF 1OJLA 2YU9J 1VQLI 3S2WA 2ELHA 1LNWA 5LBQA 1SD6A 1SVLA 1R1UA 2I10A 2G7UA 4B47A 5JHUA 3ZQHA 1RNLA 2E19A 1I27A 5M5XJ 1JXSA 3GZ6A 4QPQA 1QVUA 2BGCA 1LUJB 3R4KA 3SEZA 4TV7A 1FY7A 3QYEA 3ABUA 2DBBA 1USSA 2ICWG 1BOAA 4AWXB 3S14J 2DTRA 2X0LA 2VQCA 3LQQA 5HDNA 3LA2A 3RJPA 1R4MB 2MD0A 2COMA 3RQ4A 1U6GA 1DDNA 1TNTA 4RGUA 1N77A 1YRNB 4HNVA 2ZSIB 1GV5A 5H6QA 1WHUA 2F4MB 3LAJA 1NG6A 3K6GA 1K7AA 1ZRDA 4IKFA 1RKTA 1QRYA 5BPIA 4BDZA 2WA0A 1R49A 2PBIA 1V54H 1VQ8I 1MBHA 5FJ8J 1U9OA 4BE2A 1GV2A 2DMPA 3IC7A 3M1EA 4HPQA 4U0WA 2OQGA 3OV8A 3CCYA 3E3VA 4DGWB 3HOZJ 2F6CA 2LP0A 2O0YA 1A35A 2MFZA 1XSVA 4Y4RA 4E7LA 4AUXA 3ML6A 4DYQA 1M1EB 3TW6A 4MHGA 3JAMK 2RV8A 1D1BA 4HX8A 2IGOA 1XPXA 4U7BA 2H6CA 3PO2J 5F0CA 4WXCA 2HTJA 2O03A 2EFPA 5F6FA 4XRSG 3OYAA 3Q0VA 2MD5A 4V2FA 4A0YA 4E70A 1J09A 1BOBA 2KIMA 4N9HA 1G59A 4BEHA 1XB4A 1XCVA 2ELKA 1S9HA 1REPC 3JRAA 1KYWA 1WQ2A 4LMYA 2DDAA 1D0YA 1GXQA 1PDNC 1X58A 3RKYA 4A3GJ 1J0RA 4EMSA 4RMNA 1T0FA 1YW7A 1MNMC 3BP8A 4N4NB 2NOJB 5HS7A 3P5JA 2BY1A 4L0YB 1K4TA 2KZVA 3EDPA 2A5WA 3EUAA 3QQAA 3BJ6A 1D1AA 3GFLA 5A2QK 1RIOH 3FBIB 5HS9A 2NYXA 1G4DA 4C2MJ 3FXLA 2DU9A 2EA2A 1DU0A 2GOMA 4RGXA 3GEZA 1KA8A 1XD7A 3F23A 3G6EI 2A61A 3HHHA 4LG3A 2D2WA 1HA8A 1T95A 2HXOA 4EGZA 2ISZA 4P5OA 3HOUJ 2JT1A 2A68F 2E1OA 3FK7A 4IF4A 2FEZA 1IC8A 1T0FC 5FROA 1FSHA 2Q0OA 1FX7A 3QPHA 4F3QA 3I9V2 4AYBN 3JRDA 3L2UA 1U0JA 1J2XA 2PQ8A 2VPRA 3S3MA 2E71A 2RQPA 4XONA 2CG4A 1D3YA 3DWLE 1Y56A 3A4CA 3WHBA 1Y1WJ 3SJMA 2QA4I 1F43A 3OYMA 3C18A 4RAGA 2GXGA 4O5VA 2GQQA 2VPLA 4H0EA 3OSGA 3IWZA 3NQOA 3MD2A 1MKMA 3C1DA 3LA3A 2ELJA 5K7ZA 2LC2A 4LD5A 4JYKA 2AQEA 4I6ZA 5TJJA 1VQ7I 3PNVA 1BN5A 4LJZF 3GTKJ 2MBFA 4UHTA 1IJWC 1XGSA 1Z0XA 4JBAA 3ERED 4UB8C 1SMTA 1OCCH 3WG9A 5JVGF 4CCOA 2DA7A 4IRIA 2GIZA 2ZMEB 2E2IJ 1KQ0A 1P4WA 5IP9J 3E6DA 3K4NA 3V7CA 3LSJA 4V19K 1TNSA 1MSFC 1HXDA 2CV2A 2F5DA 5LHGA 2L9SA 2HTSA 4NHJA 2VXDA 3MKWB 3L2CA 3M1CA 1UCRA 2DODA 1E2XA 3I0TA 1FBSA 2NS7A 1YLFA 4CXFA 5J1UA 1QZEA 2JQ7A 3CJQB 2O61A 2CUEA 1MBJA 1FBUA 2OCCH 4U87A 2MW8A 2WAQN 3H35A 2WY7Q 5FD6A 5M5WJ 4FCYA 5FLXK 3AG1H 5L3BA 2G0EA 1ZN2A 3W6VA 3F9KA 3ZQLA 3HSFA 2EFWA 3D0SA 1MGTA 2HU9A 3V42A 5LFAA 2IAIA 5M5YJ 1LVKA 3Q9SA 5K7HA 2EQRA 1AOYA 3K0LA 4I76A 5JVTA 2HOEA 3R60A 1YYVA 1ZG5A 2ZO4A 4RB0A 4A0XA 4M74A 1TW3A 4Q5SF 3CD6I 9ANTA 2UXXA 2VT3A 3I4MJ 2L7MP 3WGHA 5HLHA 2AS5F 3LSGA 1W7PA 2WADA 2R5ZB 2JRMA 3JRFA 3ZP5A 3OL3A 1IO2A 2E36A 2FUG2 2R7RA 1P9QC 1YE9A 2OBPA 2NVUB 3IH3A 1TWHJ 1VQOI 2X4HA 5D5XB 2EJRA 2WB1N 4DZPA 4H4KC 2QZ8A 3HGYA 4E7KA 2WBMA 4B8XA 1Z7UA 3S32A 2Y30A 3LQRA 4YIFA 2QSHX 2FMLA 3CJNA 4XLEA 1XMXA 2Y2ZA 1FYKA 1O57A 1U8BA 2DT7B 4CUGA 3FXQA 2DJNA 2D1VA 2XAGA 3IAM2 2ZJ2A 4HF1A 4DYRA 4ESBA 5F27A 3HG9A 5GTHC 4N0BA 5LEJA 4XLCA 3I3LA 2KFDA 3A0BC 1FPQA 2WAFA 1TWGJ 2CFOA 2O3FA 2V1XA 2JVGA 5KAIC 2ZMEA 3AG2H 5LLQA 3GTMJ 2X1DA 4QWQA 5F64A 1JT0A 3K2ZA 3CQZJ 3KCCA 3S2DJ 3SEQA 4A12A 3HOSA 4DZJA 4RM2A 4UUTA 5BMZA 5FGMA 4DBRA 2DLLA 2NVXJ 4BY7J 2FU4A 3FZVA 1OCRH 3FXKA 2XAHA 2BXZA 4I98B 4XIDA 1JHFA 4NBQA 3HHGA 4C2TA 3G1OA 4G8XA 1TZLA 4NC7A 1V5GA 4GXOA 4XNFA 2PJRB 4L9TA 1T33A 4KITB 3DBHB 4A3FJ 3ZMDA 1D8KA 3J80K 2IS4A 2K9MA 2RVCA 2K5CA 3VSKA 4BJ5C 2F5CA 2DW4A 3ZMTA 2QQBA 4E4HA 3B02A 1ETOA 2XGXA 1SANA 1OPCA 4MGRA 4U7DA 2QGUA 2IA2A 4A93J 5M3FJ 5E8GA 5K5QA 1P7IA 1Y8RB 3LAPA 4L9JA 4CZZA 3KZYA 2L7KA 2XVCA 5IP7J 3K10A 4C3IJ 1OYIA 3NRVA 3W2AA 2FRHA 1JKQC 2Y48A 3S8PA 3TGNA 3L2QA 1PP8F 4G9YA 5LRSA 3FHZA 1U78A 1ZG1A 5LGTA 5HODA 2E1CA 3M4OJ 4BACA 1JGGA 1LDDA 4OMZA 1ULYA 2O5RA 4QPOA 5H6RA 3FMQA 1G3WA 3I5UA 3IH4A 1RR8C 3FM5A 4OWRB 5JLXA 5HNFA 3T1BA 1S72I 3B73A 2V9VA 5GPAA 2DDBA 5GAGJ 3IAS2 5KHDA 2DPDA 3K1MA 3FKJA 2OQRA 1OYYA 2ZBKA 2PFBA 2HDCA 3I56I 4JX6A 1QZYA 2KLOA 3KP4A 4AM3A 1W5CC 4DQ2A 1NG7A 4G94A 5J8FA 2NRAC 2K9QA 4I09A 3DLLF 2EV0A 4UUSA 2EZHA 3GCMA 2M5WA 5CYVA 3KP7A 1EH6A 4BNCA 3GFJA 2DK8A 5EEGA 3ROUA 3BTIA 4PGGA 3KFWX 2Z5UA 1MMSA 4HV5A 3OSFA 1R58A 2VUMJ 4FQGA 3SYTA 2BVMA 1MH3A 2V1UA 1CF7B 2EWNA 3N05A 2PJRA 2BHYA 1IN4A 2VC0A 4NQWB 4ZDLA 4BU2A 3K4MA 4XRFA 2HWVA 2QKLB 5HOOA 4KA4A 2XF7A 5B3SH 5H20A 2DCEA 4J00A 1U3EM 2EFQA 3LSHA 3FXMA 4BJ6C 4D5FA 3KP6A 4CYCB 1YG2A 4B09A 3ZMVA 2KL4A 2XSJC 5E20A 2YR2A 4PZJA 3CCEI 4RAFA 4ZH4F 4CO8A 1XDUA 2XKPA 4RGSA 4M73A 5L3DA 3HZJA 4KT5C 5GP9A 1RC9A 5DCMB 4I7HA 2OJED 1IN6A 3V8LA 4D9JA 2DO7A 2H8WA 4G6QA 1S29A 5KCMA 4ZTFA 3TW7A 3HL2A 2A07F 1A31A 3M9AA 5ERIA 3OYKA 2YSRA 1RI7A 1LDKB 3V8KA 2HPMA 3BJOA 4J19A 1U2WA 3SXYA 1O3QA 3OL4A 3QPLA 4YIIA 2X1CA 4DNCA 4KDPA 2R7XA 5J40A 2QLZA 3KYLA 2GLOA 3FK6A 3FISA 5TGTA 1FLIA 4GCVA 1TLHB 3S15J 1HKSA 3E5UA 1H9TA 5K7FA 3A01A 1H89C 2VLAA 2F5VA 1JTXA 3F22A 2DPUA 4HRIA 4RLFA 3TO7A 3HPGA 5EGOB 4A3MJ 5L3FA 5FRMA 2L9VA 1OKRA 2KPMA 3CJRB 3SZGA 5KNLA 2GOXB 4D1QA 2ISYA 2CQNA 2Q2EB 1IN8A 1TWAJ 1P4AA 1GLNA 4CCMA 5FFZA 4PJLA 4PDKA 3G4SI 2HOTA 3KIOA 4Q47A 4CA0A 1F9NA 4XSZF 3IUOA 4BGDA 3B6CA 1D0ZA 4CCKA 5E17F 4BE0A 3CC4I 3SFIA 3QU6A 5C4XJ 3DEEA 2CO5A 4R8HA 3GO5A 3ASNH 2W85A 2XRNA 2HYJA 3OOPA 1WJDA 3ASOH 1OCPA 2GA1A 3CO7C 2EK5A 2W25A 1W36D 1R71A 4HYEA 2PX9A 2P0WA 2KDOA 2ZXWH 5ICEA 4CYCA 1FIAA 2M1BA 3K9TA 2DMNA 1B8IB 1J9IA 2A5YB 3HEFA 4GFBA 4XM3A 3JRHA 4Y3OA 1Z67A 2M2EA 3P9IA 4BE1A 5F1JA 4Z2YA 4MQVA 1BW6A 4IRGA 4Y52J 4WF2A 1G8XA 2RNJA 5D6EA 2Y75A 1MJ9A 3BG9A 3MQ0A 1KYZA 2E7WA 2V9PA 3AL0C 5CQEA 3TDZC 1ZRFA 3OR2C 1X1AA 4M6VA 4RA2A 1W0TA 5F1RA 4D7NA 2EV5A 3CMYA 2KJBA 1H0MA 1AKHB 1BI2A 2P4WA 1X4OA 1VQMI 2XROA 4ZYHA 2R5YB 1SD5A 1U5TA 1DGWY 2EILH 1W7PD 2MLGA 2VJJA 3I4PA 4HNUA 3A03A 2Y9ZA 1T6SA 3U1DA 3LMMA 1JKPC 3OWTA 3V7SA 3G1LA 3IL2A 5KAFC 3NAUA 3HUGA 1TTYA 4XBFA 3FMRA 5CKTA 1P4XA 3ZN1A 2QYOA 1ACIA 3GFMA 2XGCA 5EGOA 1R23A 3VODA 2OPTA 5IT9Z 1U5TC 1ON2A 2MH2A 3KPHA 3PUBA 4U88A 2CW0F 3PFYA 4BAYA 3LFUA 3TMOA 2STWA 1R5GA 2JJ7A 3H3UA 3K4BA 4Y15A 4G6TB 2E35A 4QTRA 3H3VK 2W57A 2Z99A 3KEYA 3SDGA 3CC7I 1Z1DA 2K4BA 3LNQA 2QQAA 4IHXA 3T8TA 3K4KA 3KP3A 3GFIA 1UJ8A 1Z05A 5DUIA 3BROA 1RZ4A 1ZR4A 1O3TA 2DA1A 5EEHA 2IS6A 1V5FA 3C2BA 3H5AA 2CU7A 3BOQA 3QOEA 2CS3A 2GA2A 5IP6A 2A6TA 1FOXA 4O6JA 1ZGJA 2IGKA 4CHUA 3H0GJ 3OIPA 2VE8A 1E0EA 2R7OA 3ONQA 4PUSA 4P9UA 3F21A 2JUGA 1KU3A 2OC6A 1T08B 2DT6A 3KZIC 4GYGA 4KICA 4A0ZA 1YI2I 3HPHA 3PIOF 1DUXC 4LIUA 2IS2A 2NVQJ 1SD4A 2Z2SB 3TL4X 2FA5A 2BW3A 4CCJA 2UZKA 2V6EA 1FIPA 2K9SA 2PN6A 4A2UA 1WJAA 2EFNA 3CESA 1VF9A 3WTWC 3MKYB 4ETSA 2V1DA 5HNHA 1UG2A 3ZQFA 3OYEA 1K4SA 4YRVA 1NHAA 1QNTA 1K6YA 4DJAA 1JKRC 2OZUA 4C2UA 3BTCA 4RBOA 1B9MA 2GZWA 3WHCA 2LVSA 1RRJA 3CCUI 2Y0SA 2V6CA 1A6IA 5BNGA 4ZYAA 1XDSA 2M0CA 3W6KB 3CP2A 1J59A 2R0QC 4A69C 2FBKA 4F91B 5CVVA 3QYFA
chains in the Genus database with same CATH topology
5EYRA 5K7ZA 2KDZA 2GM4A 1WH7A 2LTPA 4JYKA 1IDZA 4A3DJ 4I6ZA 1ZGWA 2DMUA 3GTKJ 5IYCJ 1IJWC 1Z0XA 2DTZA 1K61A 1O4XA 2H1KA 4AC0A 3JRBA 2DMQA 2DA7A 3TP0A 3BR1A 3Q0UA 5EZGA 2E2IJ 5IP9J 1MBKA 3LSJA 2GBYA 3BR0A 1WH5A 1B72A 1MSFC 3GTLJ 3G1MA 1ZTRA 2LKXA 2XSDC 2ECCA 3M3YJ 4Y7NJ 2HOSA 2NS7A 4JX4A 5J1UA 5C44J 1XS9A 2CUEA 1MBJA 3ZQIA 1XG1A 2MW8A 2WAQN 5M5WJ 3HDDA 4JX5A 3L1PA 4FCYA 1FTZA 5EDNA 3JREA 2G0EA 4D5CA 3W6VA 5C4JJ 3ZQLA 2IAIA 5M5YJ 4XRMA 4A3JJ 3A01B 1JT6A 2HI3A 2ME0A 2EQRA 5K7HA 2LD5A 2COBA 4FE4A 4W97A 4MFDA 3HGGA 4I76A 2JN6A 3I4NJ 4XRSA 9ANTA 1JKOC 1AU7A 4RDUA 2L7MP 4L5EA 2JA7J 3I4MJ 3LSGA 4EEFG 1HCRA 3ZOBA 2YUSA 2R5ZB 3JRFA 1NK2P 3Q0WA 2NS8A 3OIOA 1PUFB 3S2HJ 2AO9A 4XICA 3HOYJ 1POGA 3IH3A 1TWHJ 1APLC 3D1NI 2K9NA 2WB1N 1BJZA 4DZPA 3HGYA 2P81A 2E2JJ 1MBEA 2FJ1A 2Y30A 2M9HA 3HOXJ 1LE8A 4M3EA 1IG7A 2Y2ZA 3O8GA 2M8GX 1U8BA 5M3MJ 2DA5A 4MIMA 1B8IA 2DJNA 2XB0X 4M3DA 1ETWA 3BQYA 4DYRA 5F27A 5J1RA 4DW6A 4W1UA 1F36A 1RR7A 2JK3A 1MH4A 3DCFA 1FJLA 1UMQA 2TRTA 4MO7A 1U9NA 1JTYA 2VKVA 1H88C 2CJJA 3A02A 1TWGJ 3GTMJ 2DA3A 1QVTA 1JT0A 3CQZJ 2JWTA 1NK3P 3S1NJ 3S2DJ 3GTQJ 4DZJA 1YRNA 4UUTA 1JJ8C 3HKZN 5IYBJ 5EG0B 4C3JJ 3Q3SA 2NVXJ 3MKLA 4BY7J 1AKHA 1DU6A 4A3IJ 1HDDC 4XIDA 1CQTA 2R5YA 3G1OA 3TEDA 5C3EJ 3IV5A 1GT0C 2DN0A 5IYDJ 3IH2A 5FLVA 1T33A 2EBIA 3K7AJ 2W48A 1Z77A 2LK2A 1WPKA 5E3OA 4A3FJ 5F08A 2XB5A 4MFEA 2HXIA 2L7ZA 1BA5A 1ETOA 1SANA 3MVPA 3BG5A 2CQXA 4A93J 1IGNA 5M3FJ 2JA5J 1X2MA 1P7IA 2CQQA 3BT9A 4QSHA 2HDDA 5IP7J 1MBFA 4C3IJ 4BKXA 3O8HA 3GTJJ 2JMWA 5DS9A 2DA2A 1JKQC 3S16J 1ZR2A 1Y1VJ 2DMTA 2ZB9A 5DTDA 1T56A 2XGDA 1U78A 5EZHA 1P7JA 3BR6A 3RKQA 2WV1A 2H8RA 5HODA 3M4OJ 1IRZA 1AHDP 1JGGA 3IH4A 3DEWA 3E7LA 5JLXA 1ETQA 4C3HJ 3ZQGA 5GPAA 1FTTA 4DYCA 1JUMA 1I50J 3BR3A 1K83J 2L7FP 2AHQA 3LSPA 4JX6A 1E3OC 4S0HB 2VI6A 3BG3A 5F0HA 1UHSA 4XK4A 4MLOA 4G12A 4M3BA 1JUSA 2K9QA 2R92J 4UUSA 2DA6A 2EZHA 4M3FA 1ZK8A 5EG0A 3GTGJ 5IPAA 3UKGA 2QF7A 3BTIA 1TC3C 2X6OA 3OSFA 4LOCA 2VUMJ 2IEKA 4M3GA 1ETVA 1MH3A 1HOMA 1RETA 2D5VA 1JUPA 4FE7A 3HB9A 1VI0A 2DA4A 3BTLA 2NVYJ 3LSRA 4ABZA 4FTHA 3JRGA 4IHWA 2JA6J 4D5FA 1I3QJ 1IV6A 4CYCB 3RQIA 1VFCA 2CUFA 1QPIA 2MGQA 3S17J 2LLKA 1D5YA 2XPVA 2O9LA 2R93J 1A5JA 2MG4A 5J3LA 2OF7A 5GP9A 5E3NA 2Y9YA 1ETXA 2KT0A 5IOYA 5J1YA 2O7OA 1X2NA 3TW7A 1B72B 2X9DA 5GPCA 3GTOJ 3VPRA 4J19A 1NTCA 4B3AA 3QPLA 2M34A 4IHYA 2ID6A 2E2HJ 3S1QJ 1ZKGA 1HLVA 2YS9A 2GLOA 3FK6A 3FISA 5F04A 2HOAA 3HOWJ 1ITYA 3S15J 1VNDA 5K7FA 3GBGA 3JRIA 2NOGA 1RKWA 3A01A 1H89C 1RPWA 1ORKA 1I6HJ 1JTXA 1MSEC 3PO3J 5EGOB 4A3BJ 2TCTA 1ETYA 3FIWA 4A3MJ 4FISA 2ECBA 2L9RA 2ID3A 2XGEA 1LFBA 1S7EA 2O8KA 2EZKA 4BY1J 1TWAJ 5JLWA 4X6AJ 5F0FA 3TP3A 1WGXA 2EH3A 2HOTA 2LR8A 2R5ZA 3F0CA 2RAEA 3ZQCA 1ETKA 2IBDA 3B6CA 2ME6A 4A3KJ 1W0UA 1PUFA 4BBSJ 3CDLA 1RESA 2FQ4A 3SFIA 5C4XJ 2FX0A 3FKIJ 2LY9A 1HF0A 3BR5A 5FKKA 2K40A 2JA8J 1GVDA 2HYJA 1ZQ3P 1OJLA 1OCPA 2YU9J 1SFOJ 1GDTA 3HBLA 4CYCA 3BTJA 5E3LA 1FIAA 2Y31A 1B8IB 2DMNA 4NDLA 2I10A 3ZQHA 3HEFA 4GFBA 4IEJA 2E19A 3JRHA 5M5XJ 4A3EJ 1EF4A 2M2EA 4QIWN 1QVUA 5F1JA 2EZLA 1BW6A 4Y52J 4B1RA 5FKOA 3HM5A 3BG9A 3S14J 1HDPA 5EF6A 1TWCJ 1YRNB 4M6VA 1W0TA 4HNVA 2XPWA 1GV5A 4B4CA 4D7NA 3CMYA 1AKHB 3B6AA 3PM1A 1RKTA 1QRYA 1XC5A 2QCOA 1TWFJ 2R5YB 3MN2A 5E3MA 3A03A 2Y9ZA 4V2GA 1MBHA 4IHVA 5FJ8J 1WI3A 1JKPC 1U9OA 3G1LA 1GUUA 3BQZA 3BR2A 1GV2A 2DMPA 3NAUA 2PMZN 3HOZJ 3CCYA 2LP0A 3LOCA 2XGCA 4AUXA 4DYQA 5EGOA 3TW6A 1LFUP 2X48A 2XRLA 3PO2J 2NVTJ 1OFCX 2OPTA 5F0CA 1H8AC 2R7ZJ 2MSYA 4XRSG 3Q0VA 4V2FA 1BL0A 1WCMJ 2JJ7A 2LFBA 4QTRA 5EEAA 3H3VK 3SDGA 1R9TJ 3LNQA 2XPUA 4IHXA 2ELKA 1IDYA 3OOUA 3JRAA 4BXXJ 1ZR4A 2B63J 2DA1A 3S1MJ 1X58A 1ENHA 3GTPJ 3C2BA 4A3GJ 1IUFA 4X1EA 2CU7A 2VKEA 5IP6A 1Q1VA 1MNMC 1BW5A 1G2HA 3H0GJ 4BBRJ 3QQAA 3JRCA 2N8GA 4C2MJ 2NVQJ 3JR9A 4JP0A 1DU0A 5IOZA 3NARA 1FIPA 4UUSB 2K9SA 3RZOJ 2HQ5A 2CRGA 2HXOA 1VF9A 3HOUJ 2E1OA 3FK7A 1OCTC 4A3CJ 1IC8A 1UG2A 3ZQFA 2EZIA 2Y0SN 3S1RJ 3K2AA 1JKRC 5FKLA 3BTCA 5FKMA 4AYBN 3JRDA 3RZDJ 2L0KA 2VPRA 4D7MA 4RBOA 3WHCA 2LVSA 1F43A 3WHBA 3QPSA 3SJMA 1Y1WJ 2FD5A 1A6IA 5FLMJ 5BNGA 1JJ6C 3HOVJ 2M0CA 1FEXA 3OSGA 2R0QC 4A3LJ 4A69C 5FKNA 1MBGA 1LE8B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5EYR A;  5K7Z A;  2KDZ A;  2GM4 A;  1WH7 A;  2LTP A;  4JYK A;  1IDZ A;  4A3D J;  4I6Z A;  1ZGW A;  2DMU A;  3GTK J;  5IYC J;  1IJW C;  1Z0X A;  2DTZ A;  1K61 A;  1O4X A;  2H1K A;  4AC0 A;  3JRB A;  2DMQ A;  2DA7 A;  3TP0 A;  3BR1 A;  3Q0U A;  5EZG A;  2E2I J;  5IP9 J;  1MBK A;  3LSJ A;  2GBY A;  3BR0 A;  1WH5 A;  1B72 A;  1MSF C;  3GTL J;  3G1M A;  1ZTR A;  2LKX A;  2XSD C;  2ECC A;  3M3Y J;  4Y7N J;  2HOS A;  2NS7 A;  4JX4 A;  5J1U A;  5C44 J;  1XS9 A;  2CUE A;  1MBJ A;  3ZQI A;  1XG1 A;  2MW8 A;  2WAQ N;  5M5W J;  3HDD A;  4JX5 A;  3L1P A;  4FCY A;  1FTZ A;  5EDN A;  3JRE A;  2G0E A;  4D5C A;  3W6V A;  5C4J J;  3ZQL A;  2IAI A;  5M5Y J;  4XRM A;  4A3J J;  3A01 B;  1JT6 A;  2HI3 A;  2ME0 A;  2EQR A;  5K7H A;  2LD5 A;  2COB A;  4FE4 A;  4W97 A;  4MFD A;  3HGG A;  4I76 A;  2JN6 A;  3I4N J;  4XRS A;  9ANT A;  1JKO C;  1AU7 A;  4RDU A;  2L7M P;  4L5E A;  2JA7 J;  3I4M J;  3LSG A;  4EEF G;  1HCR A;  3ZOB A;  2YUS A;  2R5Z B;  3JRF A;  1NK2 P;  3Q0W A;  2NS8 A;  3OIO A;  1PUF B;  3S2H J;  2AO9 A;  4XIC A;  3HOY J;  1POG A;  3IH3 A;  1TWH J;  1APL C;  3D1N I;  2K9N A;  2WB1 N;  1BJZ A;  4DZP A;  3HGY A;  2P81 A;  2E2J J;  1MBE A;  2FJ1 A;  2Y30 A;  2M9H A;  3HOX J;  1LE8 A;  4M3E A;  1IG7 A;  2Y2Z A;  3O8G A;  2M8G X;  1U8B A;  5M3M J;  2DA5 A;  4MIM A;  1B8I A;  2DJN A;  2XB0 X;  4M3D A;  1ETW A;  3BQY A;  4DYR A;  5F27 A;  5J1R A;  4DW6 A;  4W1U A;  1F36 A;  1RR7 A;  2JK3 A;  1MH4 A;  3DCF A;  1FJL A;  1UMQ A;  2TRT A;  4MO7 A;  1U9N A;  1JTY A;  2VKV A;  1H88 C;  2CJJ A;  3A02 A;  1TWG J;  3GTM J;  2DA3 A;  1QVT A;  1JT0 A;  3CQZ J;  2JWT A;  1NK3 P;  3S1N J;  3S2D J;  3GTQ J;  4DZJ A;  1YRN A;  4UUT A;  1JJ8 C;  3HKZ N;  5IYB J;  5EG0 B;  4C3J J;  3Q3S A;  2NVX J;  3MKL A;  4BY7 J;  1AKH A;  1DU6 A;  4A3I J;  1HDD C;  4XID A;  1CQT A;  2R5Y A;  3G1O A;  3TED A;  5C3E J;  3IV5 A;  1GT0 C;  2DN0 A;  5IYD J;  3IH2 A;  5FLV A;  1T33 A;  2EBI A;  3K7A J;  2W48 A;  1Z77 A;  2LK2 A;  1WPK A;  5E3O A;  4A3F J;  5F08 A;  2XB5 A;  4MFE A;  2HXI A;  2L7Z A;  1BA5 A;  1ETO A;  1SAN A;  3MVP A;  3BG5 A;  2CQX A;  4A93 J;  1IGN A;  5M3F J;  2JA5 J;  1X2M A;  1P7I A;  2CQQ A;  3BT9 A;  4QSH A;  2HDD A;  5IP7 J;  1MBF A;  4C3I J;  4BKX A;  3O8H A;  3GTJ J;  2JMW A;  5DS9 A;  2DA2 A;  1JKQ C;  3S16 J;  1ZR2 A;  1Y1V J;  2DMT A;  2ZB9 A;  5DTD A;  1T56 A;  2XGD A;  1U78 A;  5EZH A;  1P7J A;  3BR6 A;  3RKQ A;  2WV1 A;  2H8R A;  5HOD A;  3M4O J;  1IRZ A;  1AHD P;  1JGG A;  3IH4 A;  3DEW A;  3E7L A;  5JLX A;  1ETQ A;  4C3H J;  3ZQG A;  5GPA A;  1FTT A;  4DYC A;  1JUM A;  1I50 J;  3BR3 A;  1K83 J;  2L7F P;  2AHQ A;  3LSP A;  4JX6 A;  1E3O C;  4S0H B;  2VI6 A;  3BG3 A;  5F0H A;  1UHS A;  4XK4 A;  4MLO A;  4G12 A;  4M3B A;  1JUS A;  2K9Q A;  2R92 J;  4UUS A;  2DA6 A;  2EZH A;  4M3F A;  1ZK8 A;  5EG0 A;  3GTG J;  5IPA A;  3UKG A;  2QF7 A;  3BTI A;  1TC3 C;  2X6O A;  3OSF A;  4LOC A;  2VUM J;  2IEK A;  4M3G A;  1ETV A;  1MH3 A;  1HOM A;  1RET A;  2D5V A;  1JUP A;  4FE7 A;  3HB9 A;  1VI0 A;  2DA4 A;  3BTL A;  2NVY J;  3LSR A;  4ABZ A;  4FTH A;  3JRG A;  4IHW A;  2JA6 J;  4D5F A;  1I3Q J;  1IV6 A;  4CYC B;  3RQI A;  1VFC A;  2CUF A;  1QPI A;  2MGQ A;  3S17 J;  2LLK A;  1D5Y A;  2XPV A;  2O9L A;  2R93 J;  1A5J A;  2MG4 A;  5J3L A;  2OF7 A;  5GP9 A;  5E3N A;  2Y9Y A;  1ETX A;  2KT0 A;  5IOY A;  5J1Y A;  2O7O A;  1X2N A;  3TW7 A;  1B72 B;  2X9D A;  5GPC A;  3GTO J;  3VPR A;  4J19 A;  1NTC A;  4B3A A;  3QPL A;  2M34 A;  4IHY A;  2ID6 A;  2E2H J;  3S1Q J;  1ZKG A;  1HLV A;  2YS9 A;  2GLO A;  3FK6 A;  3FIS A;  5F04 A;  2HOA A;  3HOW J;  1ITY A;  3S15 J;  1VND A;  5K7F A;  3GBG A;  3JRI A;  2NOG A;  1RKW A;  3A01 A;  1H89 C;  1RPW A;  1ORK A;  1I6H J;  1JTX A;  1MSE C;  3PO3 J;  5EGO B;  4A3B J;  2TCT A;  1ETY A;  3FIW A;  4A3M J;  4FIS A;  2ECB A;  2L9R A;  2ID3 A;  2XGE A;  1LFB A;  1S7E A;  2O8K A;  2EZK A;  4BY1 J;  1TWA J;  5JLW A;  4X6A J;  5F0F A;  3TP3 A;  1WGX A;  2EH3 A;  2HOT A;  2LR8 A;  2R5Z A;  3F0C A;  2RAE A;  3ZQC A;  1ETK A;  2IBD A;  3B6C A;  2ME6 A;  4A3K J;  1W0U A;  1PUF A;  4BBS J;  3CDL A;  1RES A;  2FQ4 A;  3SFI A;  5C4X J;  2FX0 A;  3FKI J;  2LY9 A;  1HF0 A;  3BR5 A;  5FKK A;  2K40 A;  2JA8 J;  1GVD A;  2HYJ A;  1ZQ3 P;  1OJL A;  1OCP A;  2YU9 J;  1SFO J;  1GDT A;  3HBL A;  4CYC A;  3BTJ A;  5E3L A;  1FIA A;  2Y31 A;  1B8I B;  2DMN A;  4NDL A;  2I10 A;  3ZQH A;  3HEF A;  4GFB A;  4IEJ A;  2E19 A;  3JRH A;  5M5X J;  4A3E J;  1EF4 A;  2M2E A;  4QIW N;  1QVU A;  5F1J A;  2EZL A;  1BW6 A;  4Y52 J;  4B1R A;  5FKO A;  3HM5 A;  3BG9 A;  3S14 J;  1HDP A;  5EF6 A;  1TWC J;  1YRN B;  4M6V A;  1W0T A;  4HNV A;  2XPW A;  1GV5 A;  4B4C A;  4D7N A;  3CMY A;  1AKH B;  3B6A A;  3PM1 A;  1RKT A;  1QRY A;  1XC5 A;  2QCO A;  1TWF J;  2R5Y B;  3MN2 A;  5E3M A;  3A03 A;  2Y9Z A;  4V2G A;  1MBH A;  4IHV A;  5FJ8 J;  1WI3 A;  1JKP C;  1U9O A;  3G1L A;  1GUU A;  3BQZ A;  3BR2 A;  1GV2 A;  2DMP A;  3NAU A;  2PMZ N;  3HOZ J;  3CCY A;  2LP0 A;  3LOC A;  2XGC A;  4AUX A;  4DYQ A;  5EGO A;  3TW6 A;  1LFU P;  2X48 A;  2XRL A;  3PO2 J;  2NVT J;  1OFC X;  2OPT A;  5F0C A;  1H8A C;  2R7Z J;  2MSY A;  4XRS G;  3Q0V A;  4V2F A;  1BL0 A;  1WCM J;  2JJ7 A;  2LFB A;  4QTR A;  5EEA A;  3H3V K;  3SDG A;  1R9T J;  3LNQ A;  2XPU A;  4IHX A;  2ELK A;  1IDY A;  3OOU A;  3JRA A;  4BXX J;  1ZR4 A;  2B63 J;  2DA1 A;  3S1M J;  1X58 A;  1ENH A;  3GTP J;  3C2B A;  4A3G J;  1IUF A;  4X1E A;  2CU7 A;  2VKE A;  5IP6 A;  1Q1V A;  1MNM C;  1BW5 A;  1G2H A;  3H0G J;  4BBR J;  3QQA A;  3JRC A;  2N8G A;  4C2M J;  2NVQ J;  3JR9 A;  4JP0 A;  1DU0 A;  5IOZ A;  3NAR A;  1FIP A;  4UUS B;  2K9S A;  3RZO J;  2HQ5 A;  2CRG A;  2HXO A;  1VF9 A;  3HOU J;  2E1O A;  3FK7 A;  1OCT C;  4A3C J;  1IC8 A;  1UG2 A;  3ZQF A;  2EZI A;  2Y0S N;  3S1R J;  3K2A A;  1JKR C;  5FKL A;  3BTC A;  5FKM A;  4AYB N;  3JRD A;  3RZD J;  2L0K A;  2VPR A;  4D7M A;  4RBO A;  3WHC A;  2LVS A;  1F43 A;  3WHB A;  3QPS A;  3SJM A;  1Y1W J;  2FD5 A;  1A6I A;  5FLM J;  5BNG A;  1JJ6 C;  3HOV J;  2M0C A;  1FEX A;  3OSG A;  2R0Q C;  4A3L J;  4A69 C;  5FKN A;  1MBG A;  1LE8 B; 
#chains in the Genus database with same CATH topology
 4II3 A;  4CCN A;  1WH7 A;  3ABM H;  3IWF A;  2LTP A;  5GAE J;  4BHC A;  1IXS B;  4NNJ A;  3ZGK A;  2RGV A;  2A05 A;  1KU9 A;  3OYI A;  3ZMS A;  3MZ8 A;  3IRR A;  4BUP A;  3F3X A;  3GXO A;  4RAZ A;  4MQ9 F;  5J4V A;  4BL0 B;  1I1S A;  3QAH A;  3L7W A;  2HQN A;  5EZG A;  2WTE A;  4IVN A;  3RPU D;  1YO5 C;  2VB6 A;  2GBY A;  3BR0 A;  3WGG A;  1WH5 A;  4MNU A;  5FB2 A;  1B72 A;  2ACJ A;  4UUV A;  4XKB A;  3G1M A;  3HSE A;  2I8D A;  2P5V A;  2ECC A;  3M3Y J;  2BHZ A;  4HLY A;  3EYI A;  4JX4 A;  1NH3 A;  4IOC F;  4A5M A;  4L5J A;  5HS8 A;  2JSP A;  3UR3 C;  1GXP A;  3EYY A;  3ZQI A;  1XG1 A;  2R7D A;  4XL9 A;  1FTZ A;  5DD8 A;  2A3S A;  1OR7 A;  3KZZ A;  2A6H F;  5C4J J;  3CC2 I;  4AU7 A;  4ZZL A;  3CTA A;  4XRM A;  4A3J J;  2BEO A;  2H27 A;  4L18 B;  3OYB A;  2KHM A;  2HI3 A;  4G7Z F;  1ONV A;  2GIV A;  4FE4 A;  4ZYE A;  5E1W A;  2LY1 A;  1D1C A;  2JN6 A;  2K7L A;  4IHS A;  3I4N J;  3A1Y A;  4RAY A;  4E7J A;  2HFH A;  3KLO A;  1AU7 A;  1BI0 A;  5E18 F;  1FP2 A;  1HCR A;  1S3J A;  2M4G A;  1ODD A;  1DP7 P;  3MFK A;  1OR7 C;  1G3Y A;  3Q5F A;  1QA6 A;  3OIO A;  4EJW A;  1YX5 A;  3K4L A;  3WOD F;  3LSM A;  2RC4 A;  2HYF A;  3VSL A;  1POG A;  4LGW A;  4MTD A;  3GME A;  4WX9 A;  2JPC A;  2FQ3 A;  2P81 A;  1BR2 A;  1BIA A;  2LRE A;  3BZ6 A;  1LQ1 A;  2NNN A;  4M72 A;  3HOX J;  3QYB A;  4ON0 A;  2R3S A;  3ZXS A;  1N25 A;  3C7J A;  2KJC A;  5L3G A;  4MIM A;  2P8T A;  4C9Y A;  2XB0 X;  3DTK A;  1ETW A;  1W1W E;  3DLA A;  3CP8 A;  4DW6 A;  5HLG A;  2PI0 A;  4KT6 A;  2CV1 A;  3ZN0 A;  2CQK A;  5B1A H;  1FJL A;  2VQG A;  3P9K A;  2K27 A;  2VAS A;  2VKV A;  2KZG A;  4MO7 A;  1PJR A;  1XGM A;  4RS8 A;  1S5L C;  4YFK F;  1XSD A;  1DPU A;  1NK3 P;  4HLX A;  1YRN A;  1FWZ A;  5EG0 B;  3PQK A;  2IS1 A;  1MMN A;  3AAF A;  2IP2 A;  3MZH A;  1DU6 A;  2PJP A;  3BZC A;  3WGI A;  1BBY A;  3HSR A;  4RM3 A;  2CW8 A;  2M0M A;  2EV6 A;  4IZZ A;  2BOL A;  3FHN A;  3KLN A;  5FFX A;  3TED A;  5IYD J;  5FLV A;  4UNO A;  2W48 A;  1Z77 A;  2LK2 A;  3QP6 A;  2WWY A;  2V9K A;  3E5Q A;  3E6M A;  3L00 A;  3F6O A;  1STZ A;  4PJJ A;  4YFN F;  4P96 A;  4XR6 A;  2IGN A;  3PL8 A;  1QBJ A;  4HX7 A;  2WAE A;  2XUB A;  4OIP F;  3MVP A;  4ENK A;  2F2E A;  2E1N A;  1SFU A;  2FE3 A;  4LIT A;  1IUY A;  2M7B A;  2V4J C;  1AWC A;  2R7T A;  5GAD J;  2ZSH B;  3MAJ A;  4QSH A;  2HS5 A;  4AID A;  3DFG A;  2OAZ A;  3I59 B;  3O8H A;  2QKM B;  4PSX A;  5K5R A;  1ZR2 A;  5HLI A;  4YFX F;  1ZAR A;  5EZH A;  5K5O A;  1GVJ A;  3DEU A;  3OS2 A;  1H9G A;  2WV1 A;  2H8R A;  1RUO A;  5JFR A;  4Z6Y A;  5E1X A;  3VYU B;  3DEW A;  1XN7 A;  3MCZ A;  4N9I A;  1B6A A;  4CSW A;  2GAU A;  3BC8 A;  4XLN F;  3ZQG A;  3DPT A;  3S3O A;  5DEQ A;  3BR3 A;  3W3C A;  4AIK A;  2VOO A;  3D5R C;  1SAX A;  2P5K A;  4FX4 A;  1E3O C;  4I02 A;  5CVJ A;  4S0H B;  2VI6 A;  3BG3 A;  5F0H A;  5BQT A;  3FM3 A;  4ENN A;  4MLO A;  2CV0 A;  3CCM I;  3DTI A;  2DA6 A;  2DOA A;  1ZK8 A;  5EG0 A;  3GTG J;  3IHU A;  3UKG A;  4EV0 A;  5D5U B;  2X1E A;  1VQ4 I;  2IRF G;  2BBY A;  2PG4 A;  3HXL A;  3CF5 F;  3G71 I;  1RET A;  3ERM A;  2D5V A;  1JUP A;  4EJV A;  3D5L A;  1YOV B;  1BJA A;  3U9G A;  2F48 A;  1MZB A;  1YS6 A;  1HC8 A;  5D4S A;  2IA1 A;  4IJA A;  2DA4 A;  3SHF A;  2DK5 A;  2OZ6 A;  1WFX A;  3DXJ F;  1JE8 A;  4FTH A;  3JRG A;  1BC8 C;  1SVO A;  1IV6 A;  4OIR F;  1K78 B;  4LLG F;  4AVP A;  1VFC A;  2LH9 A;  3BWG A;  1JHH A;  1QPI A;  3CZ6 A;  2Z16 A;  3I59 A;  5ICF A;  2R7S A;  2LLK A;  2ZXI A;  4BXU A;  1D5Y A;  5JR3 A;  1FYM A;  3VOE A;  4I0A A;  2O9L A;  1MJB A;  1A5J A;  1LPQ A;  2OF7 A;  2Y9Y A;  2BY3 A;  1KU7 A;  3RDI A;  3HRS A;  4U0Y A;  3BCB A;  4HNT A;  4UVA A;  3G2B A;  2CGP A;  1X2N A;  3CCV I;  3K70 C;  5GPC A;  3GTO J;  3VPR A;  1XMA A;  4MEY F;  3DBR B;  4BDY A;  1YIO A;  3VYR B;  1NTC A;  1G3S A;  3CJT B;  5CLS A;  2E2H J;  3UNG C;  2E5Z A;  3KYD B;  3ZPL A;  3T5X A;  1HLV A;  2RQQ A;  3GZN B;  1E17 A;  5ED4 A;  3L2V A;  3AG4 H;  1TW2 A;  3HOW J;  1XSX A;  2XF6 A;  2ZME C;  2WC2 A;  4B44 A;  3VDX A;  1FOK A;  5ILS A;  4EAT A;  3HRU A;  1RPW A;  2XAF A;  4CDG A;  3QPT A;  3ZR8 X;  1MSE C;  2TCT A;  2PMH A;  4FIS A;  4ENJ A;  1YJW I;  2ID3 A;  2XGE A;  1WRJ A;  2KIS A;  2EZK A;  3P9C A;  3SZP A;  4X6A J;  1S7A A;  3IRQ A;  2EH3 A;  2R5Z A;  3F0C A;  1IF1 A;  5IT9 K;  2WY8 Q;  1T8I A;  2ME6 A;  4M9S A;  1W0U A;  3JTH A;  1LEB A;  1PP7 U;  1RES A;  3M8E A;  2BY2 A;  2A69 F;  3FKI J;  2OUM A;  3ABT A;  2K40 A;  2JA8 J;  3VYS B;  3OS0 A;  1ZQ3 P;  3RIR A;  1GDT A;  4L5I A;  3KYC B;  2ESH A;  2LKS A;  3V4G A;  3BTJ A;  5E3L A;  4WXD A;  3GW2 A;  3RCO A;  1QZZ A;  5DM6 F;  4NDL A;  5JHF A;  2D1H A;  3CCL I;  1A6Q A;  4CGZ A;  2HEO A;  5CJ9 A;  3HYI A;  1EF4 A;  4QIW N;  3OYL A;  2ZJR F;  4XN0 A;  2EZL A;  3I55 I;  4A5N A;  3MMY B;  4B1R A;  1V55 H;  4ZZD A;  2W1O A;  4R1H A;  2GXA A;  1L0O C;  3HM5 A;  3O6B B;  3OYJ A;  3OYG A;  1HDP A;  5ILV A;  4E7H A;  2OU2 A;  5FD5 A;  2XPW A;  4JK1 X;  3REO A;  3B6A A;  1W5S A;  2OTL I;  2QCO A;  1KQ8 A;  3JSP A;  3MN2 A;  3FDY A;  1FYL A;  4IHV A;  3TO9 A;  1FT9 A;  5LHI A;  1WI3 A;  4E7S A;  1MND A;  1GUU A;  5FO5 A;  3BR2 A;  2LMD A;  4YEL A;  3OYD A;  3I58 A;  2CUZ A;  4CZC A;  2V26 A;  2L4M A;  5K1Y A;  1YHQ I;  2L54 A;  3KX2 A;  4M71 A;  4UV9 A;  2JZY A;  4BQA A;  1TL8 A;  2ZJP F;  3CF2 A;  1R22 A;  2L02 A;  2M87 A;  1H8A C;  2PMZ A;  4B48 A;  5IT3 A;  4EJO A;  2B9S A;  3GF2 A;  1MIJ A;  1Z6T A;  4LLL A;  4CCL A;  3J7Y J;  1U8R A;  5EEA A;  2LFB A;  3C2G A;  2M8E A;  2IJL A;  1G6N A;  2JSC A;  1IZ1 A;  2B0L A;  5DDG A;  2XPU A;  3L2R A;  1IDY A;  3OOU A;  1KZH A;  4BXX J;  3G73 A;  3DQV C;  3PNT A;  4JQF A;  3S1M J;  4BS9 A;  1R36 A;  1ENH A;  1Z3X A;  1R4N B;  2CYY A;  4XLH A;  4X1E A;  4HDV A;  2HR3 A;  2VKE A;  1IW7 F;  4R79 A;  3HRM A;  2X51 A;  2ZFU A;  4KJZ A;  1X3Z B;  2N8G A;  3BPV A;  5D6F A;  2LNB A;  1HW2 A;  4KNY A;  2L9N A;  4IQJ A;  4JP0 A;  1WJ5 A;  5IOZ A;  3OMY A;  3J81 Z;  1ON1 A;  2BE5 F;  3BCA A;  4UY8 I;  2HQ5 A;  2CRG A;  2P7V B;  4A3C J;  3WU0 A;  3R0A A;  5J47 A;  1UAA A;  2XAQ A;  2EZI A;  2Y0S N;  4HA8 A;  3K2A A;  1IV8 A;  5FKL A;  1CF7 A;  3RZD J;  4BJT A;  5AIQ A;  1X4P A;  4D7M A;  4KN7 X;  2ADU A;  4EJT A;  4M9Z A;  2QVO A;  4NQW A;  5GTI C;  3QPS A;  2FD5 A;  1V3F A;  4HSR A;  3LSI A;  5ICG A;  2QM3 A;  1Y39 A;  3F72 A;  3HOV J;  3OYF A;  2FBI A;  2A6E F;  2PEX A;  2FXA A;  1FEX A;  4RB3 C;  4A3L J;  3WTT C;  3M8F A;  5FKN A;  1LE8 B;  2FMY A;  4UVB A;  2KDZ A;  4PFO A;  1Z9C A;  1JGS A;  4E7Z A;  1ZGW A;  4XLA A;  2DMU A;  5IYC J;  2H09 A;  1HBX G;  2DTZ A;  1K61 A;  4U0V A;  1O4X A;  2H1K A;  2XIG A;  4AC0 A;  4PJ0 C;  3BY6 A;  3JRB A;  3RSN A;  2DMQ A;  4P9F A;  2VON A;  5DCM A;  3TP0 A;  1UHW A;  5ICC A;  1QHH D;  1UST A;  4GYI A;  5D5V B;  2VOP A;  1MBK A;  1VQP I;  1K6O A;  3HOT A;  2QEN A;  2CH0 A;  2FSW A;  1X1C A;  1MDM B;  2HGC A;  1HQC A;  2F4I A;  1ZTR A;  4Y17 A;  4QLC U;  4G7H F;  1OLT A;  1C0W A;  3WE3 A;  1VQK I;  5DUK A;  1QHG A;  2IGM A;  2RDP A;  3F8C A;  5TRD A;  3N4M A;  3LWF A;  5AON A;  5CVI A;  1Z7L A;  4AD9 A;  4HX4 A;  3RI4 A;  1F5T A;  2LKP A;  3CUQ B;  2EIK H;  2L2O A;  6PAX A;  4HOB A;  4F55 A;  1TQP A;  2G9W A;  3FF5 A;  1EJ9 A;  1ZRE A;  3AFH A;  1F1Z A;  1JT6 A;  3PSI A;  2E34 A;  3I71 A;  5J6X A;  5BOX A;  1OIS A;  1HKQ A;  2GWR A;  4W97 A;  4HAM A;  4XRS A;  1JKO C;  2EIJ H;  3E5X A;  2Q2E A;  3WTY C;  2LY2 A;  2ESN A;  2FOK A;  3E97 A;  3LFK A;  2P7C B;  2ETH A;  3LSK A;  3MKZ A;  2EIM H;  2HPI A;  3H3Z A;  2NS8 A;  3FBN B;  1PUF B;  3S2H J;  3EUH A;  4XIC A;  1RUN A;  2XAU A;  2P5L C;  1S8N A;  2OCE A;  3DKW A;  3D1N I;  2K9N A;  3ECO A;  1HW5 A;  1BJZ A;  1YW8 A;  2LYC A;  3RYP A;  4GGG A;  1ZEL A;  1MBE A;  1B59 A;  2HVQ A;  2M9H A;  3HC7 A;  1ERD A;  1LE8 A;  1IG7 A;  3O8G A;  3FWE A;  5M3M J;  1ZG3 A;  2DA5 A;  1B8I A;  2TDX A;  5D5W B;  5GAH J;  1IXC A;  4M3D A;  4XLF A;  5HLT A;  1IN7 A;  4HBL A;  3EUH C;  3GLX A;  1F36 A;  1FP1 D;  1MH4 A;  4IO9 F;  3J7A O;  1U9N A;  1H88 C;  2EA4 A;  2H1L A;  2VT2 A;  4BQO A;  4MEX F;  4ANJ A;  2QUF A;  3I53 A;  3V8J A;  3K4J A;  1WJF A;  2DA3 A;  2CWE A;  4DBQ A;  1FOW A;  4PGH A;  2JWT A;  1G3T A;  1X1P A;  4F52 A;  2QSF X;  5IYB J;  4C3J J;  5DYM A;  3KEO A;  2QQ8 A;  4XKV A;  4PFP A;  1P2F A;  1AKH A;  4KN4 X;  1YQA A;  4A3I J;  1A36 A;  1BM9 A;  2BXY A;  3J7Z I;  1CQT A;  3O3K A;  3TO6 A;  2RN7 A;  2R7W A;  4HDU A;  2R5Y A;  4NUB A;  1BI1 A;  5C3E J;  3IV5 A;  5L3C A;  1X3W B;  3CCR I;  3HKZ A;  4XLP F;  3K7A J;  5E3O A;  4OIN F;  5F08 A;  4MFE A;  1T39 A;  2HXI A;  2DQR A;  2VC1 A;  3KE2 A;  4UB6 C;  3CDH A;  1YFH A;  1IGN A;  3RYR A;  2CFX A;  3ESW B;  2HDW A;  2CQQ A;  3IKV A;  4F7Z A;  1ZH5 A;  4ZYD A;  1ZRC A;  2HDD A;  1FSE A;  3EET A;  4BKX A;  2ZCW A;  5LEK A;  2DYS H;  3GTJ J;  4CIC A;  4HF0 A;  1L3L A;  3QU3 A;  2BVL A;  1Y1V J;  2DMT A;  2X85 A;  3WTX C;  1T56 A;  4XN3 A;  1LB2 A;  2EFO A;  3W2V A;  3H5N A;  2F4O B;  3BG7 A;  4BEH B;  4LFU A;  3U21 A;  2X6Y A;  1SC7 A;  1I5Z A;  1IRZ A;  2VKH A;  2IPQ X;  3K69 A;  4ESF A;  4RB1 A;  1YX3 A;  3E1S A;  1ETQ A;  4EJU A;  1TP4 A;  4Q4Z F;  4C3H J;  2M30 A;  2JVH A;  3VWB A;  5TIS C;  4BQQ A;  3MZY A;  4PSW A;  1SMY F;  1KGS A;  4HW0 A;  3QRF F;  4E7I A;  4DYC A;  3J7A Y;  2RRE A;  1XGO A;  2L7F P;  2AHQ A;  1FZP B;  3LSP A;  4WCG A;  3HTS B;  3ZMU A;  2BV6 A;  1YJ9 I;  2W84 A;  3H1C A;  1WJC A;  3MEX A;  1DQU A;  1R5I D;  2IVM A;  2ZC2 A;  3BZK A;  3ELK A;  3F6V A;  4M9X A;  4XK4 A;  4RLQ A;  1MMD A;  4G12 A;  3MWM A;  1JUS A;  2EB7 A;  2VQH A;  4RGR A;  2R92 J;  1D5V A;  1DGR M;  2VOD A;  4M3F A;  5CVR A;  4DOZ A;  2W7N A;  2QF7 A;  5KVR A;  2X6O A;  4LOC A;  3KP5 A;  5BPD A;  2DOF A;  1ETV A;  2NXN B;  3F8M A;  3BG6 A;  4I0B A;  1HOM A;  4B43 A;  2VQL A;  3TOB A;  1OYW A;  3ZRG A;  1N75 A;  2FNP A;  1ZYR F;  4FE7 A;  3PJR A;  1N78 A;  1QU3 A;  2HYG D;  3TQN A;  1VI0 A;  1BR1 A;  2E7X A;  3L09 A;  2VJI A;  4D0P A;  3BTL A;  1FOY A;  1R1T A;  2VXZ A;  4HG2 A;  3M7G A;  4LB6 B;  2CSO A;  2HVR A;  2UV1 A;  2GXB A;  2XF5 A;  4IHW A;  3A2K A;  1D8J A;  1LJ9 A;  1I3Q J;  1FMW A;  2ZFW A;  3EPZ A;  4OOI A;  2CUF A;  2KRH A;  1UEL B;  2KIU A;  4ZDP A;  2MGQ A;  1BR4 A;  2C6Y A;  3S17 J;  4WWC A;  2P6S A;  3H5R A;  3W2W A;  3CMM A;  3GX4 X;  4BH9 A;  2R93 J;  2MG4 A;  3I64 A;  4ZYG A;  2O6G E;  1ETX A;  4N4O B;  5IOY A;  3GYH X;  5J1Y A;  3WU2 C;  5J8C A;  2O7O A;  5CVU A;  5EJC A;  2AXT C;  2W00 A;  2Z33 A;  1PVE A;  2KMU A;  2RNG A;  3CDI A;  1BI3 A;  2KIQ A;  2LF8 A;  1Y6I A;  3HJE A;  2Y0M A;  3KET A;  2OD5 A;  1ZHF A;  2ID6 A;  2J5O A;  2Q1Z B;  3S1Q J;  4S05 A;  1IXR C;  1ZKG A;  1XTA A;  4LK0 F;  2YS9 A;  1PUE E;  5HDG A;  5F04 A;  4EM0 B;  1EKE A;  4IOA F;  5ILU A;  3GBG A;  2Z9O A;  1P92 A;  1RKW A;  5LGN A;  1ORK A;  3IKT A;  3PQJ A;  4HV6 A;  4IX7 A;  3O2P E;  4KMU X;  1XCB A;  2X6X A;  3FIW A;  1YTY A;  2ECB A;  2L9R A;  1MMG A;  2O8K A;  5LGU A;  5JLW A;  5F0F A;  1W7P B;  1WGX A;  3TP3 A;  4XOP A;  2LR8 A;  2VJ4 A;  4G7O F;  2RAE A;  3OS1 A;  2IBD A;  2HVS A;  2K02 A;  4A3K J;  1WVR A;  4P1W A;  3CDL A;  1V5E A;  4BBS J;  2JTV A;  5DM7 F;  4XKW A;  2P6T A;  2IXS A;  3BR5 A;  4HQM A;  5FKK A;  1E3H A;  1GVD A;  1XGN A;  1SFO J;  3HBL A;  4UV8 A;  2MA3 A;  1WJE A;  2XDV A;  2Y31 A;  2DXI A;  3ABL H;  4EVI A;  2QWW A;  4EM1 A;  4IEJ A;  2E60 A;  4A3E J;  4NC8 A;  3DU5 A;  2DAO A;  1EV7 A;  5L3E A;  1IN5 A;  2R7Q A;  5FKO A;  4KUM A;  1VQ5 I;  2W4S A;  1Z6R A;  5D4R A;  1T2K A;  1V4R A;  2E5N A;  3T0Y A;  1W4M A;  3U2R A;  5J4Y A;  3C3W A;  2ZNY A;  3DPU A;  3W6J B;  5EF6 A;  1TWC J;  3CCJ I;  4UXN A;  3CCQ I;  4B4C A;  3R61 A;  3J81 K;  3E6C C;  2W24 A;  3PM1 A;  2JUC A;  3M8J A;  1OCZ H;  1EA3 A;  3QOP A;  1XC5 A;  2I5U A;  4ASN A;  4L9V A;  4I01 A;  2DFF A;  4YG2 F;  4J01 A;  4E6K G;  1TWF J;  2LF7 A;  1DP3 A;  3JCU C;  4ITV A;  1T38 A;  2OA4 A;  5E3M A;  3ZQQ A;  1EH8 A;  2CMP A;  4V2G A;  5LD2 C;  1FNN A;  3VFZ A;  3JTG A;  3RPQ A;  3BQZ A;  4II2 A;  4UVC A;  4IXA A;  4PCQ A;  1W36 C;  2PMZ N;  1O7L A;  3PSF A;  2QEX I;  2R7F A;  3LOC A;  3E6B A;  2FOW A;  3OYC A;  2D45 A;  1LFU P;  2X48 A;  2XRL A;  2R7V A;  2HKO A;  2NVT J;  1OFC X;  3I54 A;  3OY9 A;  2K85 A;  2VBX A;  4KIB A;  4BQN A;  1B9N A;  3VB2 A;  2R7Z J;  2MSY A;  4OIO F;  5CQG A;  4X0G A;  2XV4 S;  3PFI A;  1BL0 A;  1WCM J;  2QBY B;  1VQ9 I;  1XMK A;  5BS6 A;  1R9T J;  2F5E A;  3BJA A;  3H9Q A;  4A6E A;  2UWM A;  1KON A;  3LST A;  2B63 J;  2AXL A;  1UG0 A;  4HZF A;  3FXU A;  1LKX A;  3GZ5 A;  4FX0 A;  2VL8 A;  3GTP J;  3WTS C;  1IUF A;  1ZGA A;  4IL6 C;  5B66 C;  4ZJZ A;  1GHC A;  1Q1V A;  3BPX A;  4OIQ F;  3LL7 A;  1LFP A;  1OMI A;  3Q9V A;  4JOM A;  1BW5 A;  1G2H A;  2V1N A;  5IY5 H;  4BBR J;  3WU1 B;  2X6W A;  2DT5 A;  2FNA A;  3JRC A;  4RB2 C;  2FF4 A;  2E1M B;  4ESJ A;  2LBF B;  3JR9 A;  4A6D A;  4EM2 A;  3NAR A;  4UUS B;  3GVA A;  2MC4 A;  4GRI A;  3RZO J;  1DPR A;  3M07 A;  4XKC A;  3FXR A;  4WXH A;  1OCT C;  3DTE A;  2HQR A;  2BZT A;  3FXO A;  3S1R J;  3S93 A;  4XOT A;  1I1G A;  3QP5 A;  3K1P A;  1TQM A;  1Y0N A;  5FKM A;  3DKX A;  3T8R A;  3RKW A;  2L0K A;  5E8I A;  2L01 A;  3BDD A;  3OYH A;  2JPB A;  2BYV E;  1SVM A;  3DBL B;  2IW5 A;  3G3Z A;  3JAM Z;  5FLM J;  1JJ6 C;  1HKT A;  2MC3 A;  2EPF A;  5DD4 A;  3LA7 A;  1S6L A;  4AYB A;  1SFX A;  2RKH A;  1MBG A;  3H9G A;  2FBH A;  5EYR A;  4C30 A;  3RKX A;  2GM4 A;  4FHT A;  1K78 A;  1JI8 A;  1IDZ A;  4A3D J;  1WI9 A;  1YIT I;  3PUF A;  4OAZ A;  3RTR A;  4OU0 A;  3FX3 A;  2VBW A;  2LOO A;  1UHM A;  3AKZ A;  3EUK L;  2VE9 A;  3CCS I;  3K1N A;  2QBY A;  1CGP A;  3BR1 A;  3Q0U A;  2R4G A;  3GUD A;  3TBI A;  3FMS A;  4LB5 A;  1YW9 A;  1UZC A;  3ZMZ A;  1VQN I;  4BYY A;  1B1B A;  4EGY A;  1YIJ I;  5B5E C;  1E3P A;  1UB9 A;  2XAS A;  3GWZ A;  5JI6 A;  1X1B A;  3SZT A;  3GTL J;  4AVZ A;  3CME I;  4F93 B;  2LKX A;  1MW7 A;  2KP6 A;  2ZNZ A;  2XSD C;  4XOR A;  1O3S A;  4Y7N J;  4B3X A;  3H9J A;  3S3N A;  2HOS A;  2DFI A;  3DV8 A;  2ZXJ A;  5C44 J;  1XS9 A;  2Z1D A;  5LRR A;  5HDK A;  3SQN A;  1MNE A;  1QGP A;  5A2Q Z;  3HDD A;  4JX5 A;  3L1P A;  1Z21 A;  5EDN A;  3JRE A;  1SAU A;  2K3P A;  2K9L A;  4D5C A;  1K79 A;  3RPU A;  3CLO A;  5E79 C;  2LBF A;  3A01 B;  2V7F A;  1P6R A;  2ZKZ A;  2AQF A;  4BHB A;  2LD5 A;  2ME0 A;  2STT A;  2COB A;  1QPM A;  2WAQ A;  5E1Z B;  1R5H A;  4MFD A;  3HGG A;  1HSJ A;  3FXJ A;  4LLN A;  4RDU A;  2JA7 J;  4L5E A;  2G7H A;  2XC7 A;  1R00 A;  4EEF G;  3QWL A;  2OV7 A;  3ZOB A;  2YUS A;  2OTJ I;  3E0J B;  1NK2 P;  3Q0W A;  3ISP A;  2AO9 A;  2UUZ A;  2E1M C;  1W5T A;  1LDJ A;  4M6Y A;  4BXF A;  3HOY J;  1APL C;  5AIP A;  1WZ2 A;  3K4C A;  4EQQ A;  2E2J J;  2FJ1 A;  3AL0 B;  3C2H A;  4OMY A;  4M3E A;  2EIN H;  2WV0 A;  2M8G X;  3WTV C;  2NNY A;  1BIB A;  2ZJQ F;  2R7U A;  2CQ7 A;  1LEA A;  3TKY A;  2WB1 A;  4G6D A;  3BQY A;  4FET A;  5J1R A;  3JW4 A;  1TT5 B;  4W1U A;  3F8B A;  1RR7 A;  2JK3 A;  2HNH A;  3DCF A;  3KP2 A;  1UMQ A;  2TRT A;  3KEQ A;  4ENM A;  1JTY A;  2CJJ A;  2DI3 A;  3A02 A;  1J7K A;  2O8X A;  1SFK A;  2DYR H;  3CLQ A;  4KIF A;  1QVT A;  2YPR A;  4GDF A;  1UFM A;  4AIJ A;  1IRG A;  3S1N J;  3GTQ J;  4L9N A;  1O7F A;  2DJI A;  4KIS A;  3H0D A;  2JRT A;  1JJ8 C;  3HKZ N;  1WWX A;  1TT0 A;  3Q3S A;  1VTN C;  1HST A;  3QOD A;  3MKL A;  2K4J A;  2VN2 A;  1R6R A;  4PJN A;  1HDD C;  4KFC A;  2K3F A;  5FLX Z;  1ZLJ A;  4LG0 B;  3ULQ B;  4HF2 A;  1U5T B;  3OR1 C;  1GT0 C;  2DN0 A;  3IH2 A;  5CPR B;  3TDU C;  4ZTJ A;  2DOE A;  3OIQ A;  2EBI A;  2VBY A;  1WPK A;  1KQ9 A;  1WJB A;  3HUG B;  2UXN A;  1Z3Y A;  2XB5 A;  3NEU A;  2DFE A;  2L7Z A;  3DPL C;  1QQI A;  3HRT A;  3VYT B;  1BA5 A;  3D5S C;  2DFH A;  1EH7 A;  3BG5 A;  1B4A A;  2CQX A;  1FBQ A;  3DU6 A;  2JA5 J;  1X2M A;  3OYN A;  3COA C;  1MMA A;  4XQF A;  2LRD A;  2NS0 A;  2ZXH A;  2B7E A;  3BT9 A;  1MBF A;  1MD0 A;  2JMW A;  5DS9 A;  2DA2 A;  1I6X A;  2J5P A;  3S16 J;  1A04 A;  2ZB9 A;  2Z3Y A;  5DTD A;  3ZQ7 A;  2VJ5 A;  3BLY A;  4M6X A;  2XGD A;  2KIF A;  1P7J A;  3BR6 A;  2YX7 A;  3RKQ A;  4IPA A;  4I2O A;  2XKO A;  1AHD P;  2M7A A;  4CH7 A;  3GLL A;  2BY0 A;  5DCF A;  2VBZ A;  2H94 A;  3E7L A;  4S04 A;  1YS7 A;  4LK1 F;  2VIX A;  1VQ6 I;  2KKO A;  1FTT A;  2MLK A;  1JUM A;  1I50 J;  1Y8Q B;  1WKM A;  3HTU A;  3WTZ A;  1K83 J;  3L9F A;  4KMF A;  3ECH A;  4OAY A;  3H36 A;  5KK1 A;  1FMV A;  2KRC A;  3U1K A;  2CW7 A;  2HZD A;  4IHT A;  1TBX A;  1XX5 A;  5D8L B;  1FC3 A;  4KIG A;  1IRF A;  5FRN A;  1UHS A;  1YJN I;  4M3B A;  4LIV A;  2JA2 A;  2BW3 B;  2Q8K A;  1KU2 A;  1PYV A;  2XHK A;  1I3A A;  5IPA A;  5LHH A;  1J5Y A;  2LG4 A;  4KYW A;  1TC3 C;  3K70 D;  2IEK A;  4PJM A;  4M3G A;  2QQ9 A;  5DV5 A;  4LG0 A;  1R7J A;  3DKY A;  2L5Q A;  3ZCO A;  1T98 A;  3HIF A;  4K2E A;  4HQE A;  1MJA A;  3J80 Z;  2DQL A;  2QSG X;  3HB9 A;  1IRX A;  2KQR A;  4F92 B;  3F8F A;  1O3R A;  3N97 A;  1LVA A;  3DP7 A;  1TQI A;  4YIR X;  2PMU A;  2NVY J;  4FT8 A;  3NWT A;  3LSR A;  3X2Q H;  4ABZ A;  2JA6 J;  3RQI A;  2HKX A;  4MTE A;  2YU3 A;  2LDU A;  3CUO A;  1VZ0 A;  1ZAO A;  2V79 A;  1SD7 A;  2VKD A;  2MYS A;  1R1V A;  2XPV A;  2LSO A;  5B1B H;  5J3L A;  5E3N A;  4I99 C;  4Y13 A;  2KT0 A;  3ABK H;  3V7R A;  4DIQ A;  2M4K A;  1S7O A;  4GO1 A;  1BC7 C;  1X19 A;  3PIP F;  1IAW A;  4IRH A;  1ZLK A;  1Y0U A;  3R6S A;  4NC6 A;  2X9D A;  1MDM A;  1B72 B;  1Z91 A;  1AA7 A;  4WK8 F;  1OQY A;  3R0J A;  3L2W A;  2F5F A;  1I39 A;  3TOA A;  2H6B A;  4YEJ A;  3AG3 H;  2CUJ A;  2W82 A;  2YX4 A;  3P7N A;  3VEP A;  4B3A A;  2M34 A;  4IHY A;  1X3U A;  4PK4 A;  4ZDO A;  1OCO H;  3EQL F;  2HZT A;  2IA0 A;  2MAB A;  1Q1H A;  2Y69 H;  3WG7 H;  2HOA A;  2HQA A;  3CUQ A;  3F8N A;  1ITY A;  2NAZ A;  1QO0 D;  1VND A;  3JRI A;  4AIH A;  2NOG A;  2L3D A;  4HST A;  4NB5 A;  3WE2 A;  1I6H J;  2M3A A;  4HEA 2;  1F4K A;  4XMY A;  5D8K B;  2IT0 A;  1X1D A;  3A0H C;  3CMA I;  3PO3 J;  2K86 A;  1SEU A;  3IP4 B;  3JSO A;  1SFE A;  4FAS D;  1ETY A;  3DF8 A;  4A3B J;  4O3M A;  2M45 A;  1D0X A;  3PNY A;  3SFZ A;  1LFB A;  1S7E A;  1WSU A;  4BY1 J;  4Q48 A;  3SDB A;  1HW1 A;  2PLY A;  2KRF A;  3WTU C;  4IQ4 A;  3ZQC A;  1ETK A;  4L0Z B;  2L4A A;  3CO6 C;  3CUQ C;  1PUF A;  4P55 A;  2FQ4 A;  3NWS A;  2FX0 A;  4BHP A;  5HVQ C;  2LY9 A;  2MH9 A;  1HF0 A;  1J75 A;  4CYD A;  5H2F C;  3H92 A;  4Y33 A;  4ZC3 A;  2XAJ A;  4XSX F;  1OJL A;  2YU9 J;  1VQL I;  3S2W A;  2ELH A;  1LNW A;  5LBQ A;  1SD6 A;  1SVL A;  1R1U A;  2I10 A;  2G7U A;  4B47 A;  5JHU A;  3ZQH A;  1RNL A;  2E19 A;  1I27 A;  5M5X J;  1JXS A;  3GZ6 A;  4QPQ A;  1QVU A;  2BGC A;  1LUJ B;  3R4K A;  3SEZ A;  4TV7 A;  1FY7 A;  3QYE A;  3ABU A;  2DBB A;  1USS A;  2ICW G;  1BOA A;  4AWX B;  3S14 J;  2DTR A;  2X0L A;  2VQC A;  3LQQ A;  5HDN A;  3LA2 A;  3RJP A;  1R4M B;  2MD0 A;  2COM A;  3RQ4 A;  1U6G A;  1DDN A;  1TNT A;  4RGU A;  1N77 A;  1YRN B;  4HNV A;  2ZSI B;  1GV5 A;  5H6Q A;  1WHU A;  2F4M B;  3LAJ A;  1NG6 A;  3K6G A;  1K7A A;  1ZRD A;  4IKF A;  1RKT A;  1QRY A;  5BPI A;  4BDZ A;  2WA0 A;  1R49 A;  2PBI A;  1V54 H;  1VQ8 I;  1MBH A;  5FJ8 J;  1U9O A;  4BE2 A;  1GV2 A;  2DMP A;  3IC7 A;  3M1E A;  4HPQ A;  4U0W A;  2OQG A;  3OV8 A;  3CCY A;  3E3V A;  4DGW B;  3HOZ J;  2F6C A;  2LP0 A;  2O0Y A;  1A35 A;  2MFZ A;  1XSV A;  4Y4R A;  4E7L A;  4AUX A;  3ML6 A;  4DYQ A;  1M1E B;  3TW6 A;  4MHG A;  3JAM K;  2RV8 A;  1D1B A;  4HX8 A;  2IGO A;  1XPX A;  4U7B A;  2H6C A;  3PO2 J;  5F0C A;  4WXC A;  2HTJ A;  2O03 A;  2EFP A;  5F6F A;  4XRS G;  3OYA A;  3Q0V A;  2MD5 A;  4V2F A;  4A0Y A;  4E70 A;  1J09 A;  1BOB A;  2KIM A;  4N9H A;  1G59 A;  4BEH A;  1XB4 A;  1XCV A;  2ELK A;  1S9H A;  1REP C;  3JRA A;  1KYW A;  1WQ2 A;  4LMY A;  2DDA A;  1D0Y A;  1GXQ A;  1PDN C;  1X58 A;  3RKY A;  4A3G J;  1J0R A;  4EMS A;  4RMN A;  1T0F A;  1YW7 A;  1MNM C;  3BP8 A;  4N4N B;  2NOJ B;  5HS7 A;  3P5J A;  2BY1 A;  4L0Y B;  1K4T A;  2KZV A;  3EDP A;  2A5W A;  3EUA A;  3QQA A;  3BJ6 A;  1D1A A;  3GFL A;  5A2Q K;  1RIO H;  3FBI B;  5HS9 A;  2NYX A;  1G4D A;  4C2M J;  3FXL A;  2DU9 A;  2EA2 A;  1DU0 A;  2GOM A;  4RGX A;  3GEZ A;  1KA8 A;  1XD7 A;  3F23 A;  3G6E I;  2A61 A;  3HHH A;  4LG3 A;  2D2W A;  1HA8 A;  1T95 A;  2HXO A;  4EGZ A;  2ISZ A;  4P5O A;  3HOU J;  2JT1 A;  2A68 F;  2E1O A;  3FK7 A;  4IF4 A;  2FEZ A;  1IC8 A;  1T0F C;  5FRO A;  1FSH A;  2Q0O A;  1FX7 A;  3QPH A;  4F3Q A;  3I9V 2;  4AYB N;  3JRD A;  3L2U A;  1U0J A;  1J2X A;  2PQ8 A;  2VPR A;  3S3M A;  2E71 A;  2RQP A;  4XON A;  2CG4 A;  1D3Y A;  3DWL E;  1Y56 A;  3A4C A;  3WHB A;  1Y1W J;  3SJM A;  2QA4 I;  1F43 A;  3OYM A;  3C18 A;  4RAG A;  2GXG A;  4O5V A;  2GQQ A;  2VPL A;  4H0E A;  3OSG A;  3IWZ A;  3NQO A;  3MD2 A;  1MKM A;  3C1D A;  3LA3 A;  2ELJ A;  5K7Z A;  2LC2 A;  4LD5 A;  4JYK A;  2AQE A;  4I6Z A;  5TJJ A;  1VQ7 I;  3PNV A;  1BN5 A;  4LJZ F;  3GTK J;  2MBF A;  4UHT A;  1IJW C;  1XGS A;  1Z0X A;  4JBA A;  3ERE D;  4UB8 C;  1SMT A;  1OCC H;  3WG9 A;  5JVG F;  4CCO A;  2DA7 A;  4IRI A;  2GIZ A;  2ZME B;  2E2I J;  1KQ0 A;  1P4W A;  5IP9 J;  3E6D A;  3K4N A;  3V7C A;  3LSJ A;  4V19 K;  1TNS A;  1MSF C;  1HXD A;  2CV2 A;  2F5D A;  5LHG A;  2L9S A;  2HTS A;  4NHJ A;  2VXD A;  3MKW B;  3L2C A;  3M1C A;  1UCR A;  2DOD A;  1E2X A;  3I0T A;  1FBS A;  2NS7 A;  1YLF A;  4CXF A;  5J1U A;  1QZE A;  2JQ7 A;  3CJQ B;  2O61 A;  2CUE A;  1MBJ A;  1FBU A;  2OCC H;  4U87 A;  2MW8 A;  2WAQ N;  3H35 A;  2WY7 Q;  5FD6 A;  5M5W J;  4FCY A;  5FLX K;  3AG1 H;  5L3B A;  2G0E A;  1ZN2 A;  3W6V A;  3F9K A;  3ZQL A;  3HSF A;  2EFW A;  3D0S A;  1MGT A;  2HU9 A;  3V42 A;  5LFA A;  2IAI A;  5M5Y J;  1LVK A;  3Q9S A;  5K7H A;  2EQR A;  1AOY A;  3K0L A;  4I76 A;  5JVT A;  2HOE A;  3R60 A;  1YYV A;  1ZG5 A;  2ZO4 A;  4RB0 A;  4A0X A;  4M74 A;  1TW3 A;  4Q5S F;  3CD6 I;  9ANT A;  2UXX A;  2VT3 A;  3I4M J;  2L7M P;  3WGH A;  5HLH A;  2AS5 F;  3LSG A;  1W7P A;  2WAD A;  2R5Z B;  2JRM A;  3JRF A;  3ZP5 A;  3OL3 A;  1IO2 A;  2E36 A;  2FUG 2;  2R7R A;  1P9Q C;  1YE9 A;  2OBP A;  2NVU B;  3IH3 A;  1TWH J;  1VQO I;  2X4H A;  5D5X B;  2EJR A;  2WB1 N;  4DZP A;  4H4K C;  2QZ8 A;  3HGY A;  4E7K A;  2WBM A;  4B8X A;  1Z7U A;  3S32 A;  2Y30 A;  3LQR A;  4YIF A;  2QSH X;  2FML A;  3CJN A;  4XLE A;  1XMX A;  2Y2Z A;  1FYK A;  1O57 A;  1U8B A;  2DT7 B;  4CUG A;  3FXQ A;  2DJN A;  2D1V A;  2XAG A;  3IAM 2;  2ZJ2 A;  4HF1 A;  4DYR A;  4ESB A;  5F27 A;  3HG9 A;  5GTH C;  4N0B A;  5LEJ A;  4XLC A;  3I3L A;  2KFD A;  3A0B C;  1FPQ A;  2WAF A;  1TWG J;  2CFO A;  2O3F A;  2V1X A;  2JVG A;  5KAI C;  2ZME A;  3AG2 H;  5LLQ A;  3GTM J;  2X1D A;  4QWQ A;  5F64 A;  1JT0 A;  3K2Z A;  3CQZ J;  3KCC A;  3S2D J;  3SEQ A;  4A12 A;  3HOS A;  4DZJ A;  4RM2 A;  4UUT A;  5BMZ A;  5FGM A;  4DBR A;  2DLL A;  2NVX J;  4BY7 J;  2FU4 A;  3FZV A;  1OCR H;  3FXK A;  2XAH A;  2BXZ A;  4I98 B;  4XID A;  1JHF A;  4NBQ A;  3HHG A;  4C2T A;  3G1O A;  4G8X A;  1TZL A;  4NC7 A;  1V5G A;  4GXO A;  4XNF A;  2PJR B;  4L9T A;  1T33 A;  4KIT B;  3DBH B;  4A3F J;  3ZMD A;  1D8K A;  3J80 K;  2IS4 A;  2K9M A;  2RVC A;  2K5C A;  3VSK A;  4BJ5 C;  2F5C A;  2DW4 A;  3ZMT A;  2QQB A;  4E4H A;  3B02 A;  1ETO A;  2XGX A;  1SAN A;  1OPC A;  4MGR A;  4U7D A;  2QGU A;  2IA2 A;  4A93 J;  5M3F J;  5E8G A;  5K5Q A;  1P7I A;  1Y8R B;  3LAP A;  4L9J A;  4CZZ A;  3KZY A;  2L7K A;  2XVC A;  5IP7 J;  3K10 A;  4C3I J;  1OYI A;  3NRV A;  3W2A A;  2FRH A;  1JKQ C;  2Y48 A;  3S8P A;  3TGN A;  3L2Q A;  1PP8 F;  4G9Y A;  5LRS A;  3FHZ A;  1U78 A;  1ZG1 A;  5LGT A;  5HOD A;  2E1C A;  3M4O J;  4BAC A;  1JGG A;  1LDD A;  4OMZ A;  1ULY A;  2O5R A;  4QPO A;  5H6R A;  3FMQ A;  1G3W A;  3I5U A;  3IH4 A;  1RR8 C;  3FM5 A;  4OWR B;  5JLX A;  5HNF A;  3T1B A;  1S72 I;  3B73 A;  2V9V A;  5GPA A;  2DDB A;  5GAG J;  3IAS 2;  5KHD A;  2DPD A;  3K1M A;  3FKJ A;  2OQR A;  1OYY A;  2ZBK A;  2PFB A;  2HDC A;  3I56 I;  4JX6 A;  1QZY A;  2KLO A;  3KP4 A;  4AM3 A;  1W5C C;  4DQ2 A;  1NG7 A;  4G94 A;  5J8F A;  2NRA C;  2K9Q A;  4I09 A;  3DLL F;  2EV0 A;  4UUS A;  2EZH A;  3GCM A;  2M5W A;  5CYV A;  3KP7 A;  1EH6 A;  4BNC A;  3GFJ A;  2DK8 A;  5EEG A;  3ROU A;  3BTI A;  4PGG A;  3KFW X;  2Z5U A;  1MMS A;  4HV5 A;  3OSF A;  1R58 A;  2VUM J;  4FQG A;  3SYT A;  2BVM A;  1MH3 A;  2V1U A;  1CF7 B;  2EWN A;  3N05 A;  2PJR A;  2BHY A;  1IN4 A;  2VC0 A;  4NQW B;  4ZDL A;  4BU2 A;  3K4M A;  4XRF A;  2HWV A;  2QKL B;  5HOO A;  4KA4 A;  2XF7 A;  5B3S H;  5H20 A;  2DCE A;  4J00 A;  1U3E M;  2EFQ A;  3LSH A;  3FXM A;  4BJ6 C;  4D5F A;  3KP6 A;  4CYC B;  1YG2 A;  4B09 A;  3ZMV A;  2KL4 A;  2XSJ C;  5E20 A;  2YR2 A;  4PZJ A;  3CCE I;  4RAF A;  4ZH4 F;  4CO8 A;  1XDU A;  2XKP A;  4RGS A;  4M73 A;  5L3D A;  3HZJ A;  4KT5 C;  5GP9 A;  1RC9 A;  5DCM B;  4I7H A;  2OJE D;  1IN6 A;  3V8L A;  4D9J A;  2DO7 A;  2H8W A;  4G6Q A;  1S29 A;  5KCM A;  4ZTF A;  3TW7 A;  3HL2 A;  2A07 F;  1A31 A;  3M9A A;  5ERI A;  3OYK A;  2YSR A;  1RI7 A;  1LDK B;  3V8K A;  2HPM A;  3BJO A;  4J19 A;  1U2W A;  3SXY A;  1O3Q A;  3OL4 A;  3QPL A;  4YII A;  2X1C A;  4DNC A;  4KDP A;  2R7X A;  5J40 A;  2QLZ A;  3KYL A;  2GLO A;  3FK6 A;  3FIS A;  5TGT A;  1FLI A;  4GCV A;  1TLH B;  3S15 J;  1HKS A;  3E5U A;  1H9T A;  5K7F A;  3A01 A;  1H89 C;  2VLA A;  2F5V A;  1JTX A;  3F22 A;  2DPU A;  4HRI A;  4RLF A;  3TO7 A;  3HPG A;  5EGO B;  4A3M J;  5L3F A;  5FRM A;  2L9V A;  1OKR A;  2KPM A;  3CJR B;  3SZG A;  5KNL A;  2GOX B;  4D1Q A;  2ISY A;  2CQN A;  2Q2E B;  1IN8 A;  1TWA J;  1P4A A;  1GLN A;  4CCM A;  5FFZ A;  4PJL A;  4PDK A;  3G4S I;  2HOT A;  3KIO A;  4Q47 A;  4CA0 A;  1F9N A;  4XSZ F;  3IUO A;  4BGD A;  3B6C A;  1D0Z A;  4CCK A;  5E17 F;  4BE0 A;  3CC4 I;  3SFI A;  3QU6 A;  5C4X J;  3DEE A;  2CO5 A;  4R8H A;  3GO5 A;  3ASN H;  2W85 A;  2XRN A;  2HYJ A;  3OOP A;  1WJD A;  3ASO H;  1OCP A;  2GA1 A;  3CO7 C;  2EK5 A;  2W25 A;  1W36 D;  1R71 A;  4HYE A;  2PX9 A;  2P0W A;  2KDO A;  2ZXW H;  5ICE A;  4CYC A;  1FIA A;  2M1B A;  3K9T A;  2DMN A;  1B8I B;  1J9I A;  2A5Y B;  3HEF A;  4GFB A;  4XM3 A;  3JRH A;  4Y3O A;  1Z67 A;  2M2E A;  3P9I A;  4BE1 A;  5F1J A;  4Z2Y A;  4MQV A;  1BW6 A;  4IRG A;  4Y52 J;  4WF2 A;  1G8X A;  2RNJ A;  5D6E A;  2Y75 A;  1MJ9 A;  3BG9 A;  3MQ0 A;  1KYZ A;  2E7W A;  2V9P A;  3AL0 C;  5CQE A;  3TDZ C;  1ZRF A;  3OR2 C;  1X1A A;  4M6V A;  4RA2 A;  1W0T A;  5F1R A;  4D7N A;  2EV5 A;  3CMY A;  2KJB A;  1H0M A;  1AKH B;  1BI2 A;  2P4W A;  1X4O A;  1VQM I;  2XRO A;  4ZYH A;  2R5Y B;  1SD5 A;  1U5T A;  1DGW Y;  2EIL H;  1W7P D;  2MLG A;  2VJJ A;  3I4P A;  4HNU A;  3A03 A;  2Y9Z A;  1T6S A;  3U1D A;  3LMM A;  1JKP C;  3OWT A;  3V7S A;  3G1L A;  3IL2 A;  5KAF C;  3NAU A;  3HUG A;  1TTY A;  4XBF A;  3FMR A;  5CKT A;  1P4X A;  3ZN1 A;  2QYO A;  1ACI A;  3GFM A;  2XGC A;  5EGO A;  1R23 A;  3VOD A;  2OPT A;  5IT9 Z;  1U5T C;  1ON2 A;  2MH2 A;  3KPH A;  3PUB A;  4U88 A;  2CW0 F;  3PFY A;  4BAY A;  3LFU A;  3TMO A;  2STW A;  1R5G A;  2JJ7 A;  3H3U A;  3K4B A;  4Y15 A;  4G6T B;  2E35 A;  4QTR A;  3H3V K;  2W57 A;  2Z99 A;  3KEY A;  3SDG A;  3CC7 I;  1Z1D A;  2K4B A;  3LNQ A;  2QQA A;  4IHX A;  3T8T A;  3K4K A;  3KP3 A;  3GFI A;  1UJ8 A;  1Z05 A;  5DUI A;  3BRO A;  1RZ4 A;  1ZR4 A;  1O3T A;  2DA1 A;  5EEH A;  2IS6 A;  1V5F A;  3C2B A;  3H5A A;  2CU7 A;  3BOQ A;  3QOE A;  2CS3 A;  2GA2 A;  5IP6 A;  2A6T A;  1FOX A;  4O6J A;  1ZGJ A;  2IGK A;  4CHU A;  3H0G J;  3OIP A;  2VE8 A;  1E0E A;  2R7O A;  3ONQ A;  4PUS A;  4P9U A;  3F21 A;  2JUG A;  1KU3 A;  2OC6 A;  1T08 B;  2DT6 A;  3KZI C;  4GYG A;  4KIC A;  4A0Z A;  1YI2 I;  3HPH A;  3PIO F;  1DUX C;  4LIU A;  2IS2 A;  2NVQ J;  1SD4 A;  2Z2S B;  3TL4 X;  2FA5 A;  2BW3 A;  4CCJ A;  2UZK A;  2V6E A;  1FIP A;  2K9S A;  2PN6 A;  4A2U A;  1WJA A;  2EFN A;  3CES A;  1VF9 A;  3WTW C;  3MKY B;  4ETS A;  2V1D A;  5HNH A;  1UG2 A;  3ZQF A;  3OYE A;  1K4S A;  4YRV A;  1NHA A;  1QNT A;  1K6Y A;  4DJA A;  1JKR C;  2OZU A;  4C2U A;  3BTC A;  4RBO A;  1B9M A;  2GZW A;  3WHC A;  2LVS A;  1RRJ A;  3CCU I;  2Y0S A;  2V6C A;  1A6I A;  5BNG A;  4ZYA A;  1XDS A;  2M0C A;  3W6K B;  3CP2 A;  1J59 A;  2R0Q C;  4A69 C;  2FBK A;  4F91 B;  5CVV A;  3QYF A; 
#chains in the Genus database with same CATH homology
 5EYR A;  5K7Z A;  2KDZ A;  2GM4 A;  1WH7 A;  2LTP A;  4JYK A;  1IDZ A;  4A3D J;  4I6Z A;  1ZGW A;  2DMU A;  3GTK J;  5IYC J;  1IJW C;  1Z0X A;  2DTZ A;  1K61 A;  1O4X A;  2H1K A;  4AC0 A;  3JRB A;  2DMQ A;  2DA7 A;  3TP0 A;  3BR1 A;  3Q0U A;  5EZG A;  2E2I J;  5IP9 J;  1MBK A;  3LSJ A;  2GBY A;  3BR0 A;  1WH5 A;  1B72 A;  1MSF C;  3GTL J;  3G1M A;  1ZTR A;  2LKX A;  2XSD C;  2ECC A;  3M3Y J;  4Y7N J;  2HOS A;  2NS7 A;  4JX4 A;  5J1U A;  5C44 J;  1XS9 A;  2CUE A;  1MBJ A;  3ZQI A;  1XG1 A;  2MW8 A;  2WAQ N;  5M5W J;  3HDD A;  4JX5 A;  3L1P A;  4FCY A;  1FTZ A;  5EDN A;  3JRE A;  2G0E A;  4D5C A;  3W6V A;  5C4J J;  3ZQL A;  2IAI A;  5M5Y J;  4XRM A;  4A3J J;  3A01 B;  1JT6 A;  2HI3 A;  2ME0 A;  2EQR A;  5K7H A;  2LD5 A;  2COB A;  4FE4 A;  4W97 A;  4MFD A;  3HGG A;  4I76 A;  2JN6 A;  3I4N J;  4XRS A;  9ANT A;  1JKO C;  1AU7 A;  4RDU A;  2L7M P;  4L5E A;  2JA7 J;  3I4M J;  3LSG A;  4EEF G;  1HCR A;  3ZOB A;  2YUS A;  2R5Z B;  3JRF A;  1NK2 P;  3Q0W A;  2NS8 A;  3OIO A;  1PUF B;  3S2H J;  2AO9 A;  4XIC A;  3HOY J;  1POG A;  3IH3 A;  1TWH J;  1APL C;  3D1N I;  2K9N A;  2WB1 N;  1BJZ A;  4DZP A;  3HGY A;  2P81 A;  2E2J J;  1MBE A;  2FJ1 A;  2Y30 A;  2M9H A;  3HOX J;  1LE8 A;  4M3E A;  1IG7 A;  2Y2Z A;  3O8G A;  2M8G X;  1U8B A;  5M3M J;  2DA5 A;  4MIM A;  1B8I A;  2DJN A;  2XB0 X;  4M3D A;  1ETW A;  3BQY A;  4DYR A;  5F27 A;  5J1R A;  4DW6 A;  4W1U A;  1F36 A;  1RR7 A;  2JK3 A;  1MH4 A;  3DCF A;  1FJL A;  1UMQ A;  2TRT A;  4MO7 A;  1U9N A;  1JTY A;  2VKV A;  1H88 C;  2CJJ A;  3A02 A;  1TWG J;  3GTM J;  2DA3 A;  1QVT A;  1JT0 A;  3CQZ J;  2JWT A;  1NK3 P;  3S1N J;  3S2D J;  3GTQ J;  4DZJ A;  1YRN A;  4UUT A;  1JJ8 C;  3HKZ N;  5IYB J;  5EG0 B;  4C3J J;  3Q3S A;  2NVX J;  3MKL A;  4BY7 J;  1AKH A;  1DU6 A;  4A3I J;  1HDD C;  4XID A;  1CQT A;  2R5Y A;  3G1O A;  3TED A;  5C3E J;  3IV5 A;  1GT0 C;  2DN0 A;  5IYD J;  3IH2 A;  5FLV A;  1T33 A;  2EBI A;  3K7A J;  2W48 A;  1Z77 A;  2LK2 A;  1WPK A;  5E3O A;  4A3F J;  5F08 A;  2XB5 A;  4MFE A;  2HXI A;  2L7Z A;  1BA5 A;  1ETO A;  1SAN A;  3MVP A;  3BG5 A;  2CQX A;  4A93 J;  1IGN A;  5M3F J;  2JA5 J;  1X2M A;  1P7I A;  2CQQ A;  3BT9 A;  4QSH A;  2HDD A;  5IP7 J;  1MBF A;  4C3I J;  4BKX A;  3O8H A;  3GTJ J;  2JMW A;  5DS9 A;  2DA2 A;  1JKQ C;  3S16 J;  1ZR2 A;  1Y1V J;  2DMT A;  2ZB9 A;  5DTD A;  1T56 A;  2XGD A;  1U78 A;  5EZH A;  1P7J A;  3BR6 A;  3RKQ A;  2WV1 A;  2H8R A;  5HOD A;  3M4O J;  1IRZ A;  1AHD P;  1JGG A;  3IH4 A;  3DEW A;  3E7L A;  5JLX A;  1ETQ A;  4C3H J;  3ZQG A;  5GPA A;  1FTT A;  4DYC A;  1JUM A;  1I50 J;  3BR3 A;  1K83 J;  2L7F P;  2AHQ A;  3LSP A;  4JX6 A;  1E3O C;  4S0H B;  2VI6 A;  3BG3 A;  5F0H A;  1UHS A;  4XK4 A;  4MLO A;  4G12 A;  4M3B A;  1JUS A;  2K9Q A;  2R92 J;  4UUS A;  2DA6 A;  2EZH A;  4M3F A;  1ZK8 A;  5EG0 A;  3GTG J;  5IPA A;  3UKG A;  2QF7 A;  3BTI A;  1TC3 C;  2X6O A;  3OSF A;  4LOC A;  2VUM J;  2IEK A;  4M3G A;  1ETV A;  1MH3 A;  1HOM A;  1RET A;  2D5V A;  1JUP A;  4FE7 A;  3HB9 A;  1VI0 A;  2DA4 A;  3BTL A;  2NVY J;  3LSR A;  4ABZ A;  4FTH A;  3JRG A;  4IHW A;  2JA6 J;  4D5F A;  1I3Q J;  1IV6 A;  4CYC B;  3RQI A;  1VFC A;  2CUF A;  1QPI A;  2MGQ A;  3S17 J;  2LLK A;  1D5Y A;  2XPV A;  2O9L A;  2R93 J;  1A5J A;  2MG4 A;  5J3L A;  2OF7 A;  5GP9 A;  5E3N A;  2Y9Y A;  1ETX A;  2KT0 A;  5IOY A;  5J1Y A;  2O7O A;  1X2N A;  3TW7 A;  1B72 B;  2X9D A;  5GPC A;  3GTO J;  3VPR A;  4J19 A;  1NTC A;  4B3A A;  3QPL A;  2M34 A;  4IHY A;  2ID6 A;  2E2H J;  3S1Q J;  1ZKG A;  1HLV A;  2YS9 A;  2GLO A;  3FK6 A;  3FIS A;  5F04 A;  2HOA A;  3HOW J;  1ITY A;  3S15 J;  1VND A;  5K7F A;  3GBG A;  3JRI A;  2NOG A;  1RKW A;  3A01 A;  1H89 C;  1RPW A;  1ORK A;  1I6H J;  1JTX A;  1MSE C;  3PO3 J;  5EGO B;  4A3B J;  2TCT A;  1ETY A;  3FIW A;  4A3M J;  4FIS A;  2ECB A;  2L9R A;  2ID3 A;  2XGE A;  1LFB A;  1S7E A;  2O8K A;  2EZK A;  4BY1 J;  1TWA J;  5JLW A;  4X6A J;  5F0F A;  3TP3 A;  1WGX A;  2EH3 A;  2HOT A;  2LR8 A;  2R5Z A;  3F0C A;  2RAE A;  3ZQC A;  1ETK A;  2IBD A;  3B6C A;  2ME6 A;  4A3K J;  1W0U A;  1PUF A;  4BBS J;  3CDL A;  1RES A;  2FQ4 A;  3SFI A;  5C4X J;  2FX0 A;  3FKI J;  2LY9 A;  1HF0 A;  3BR5 A;  5FKK A;  2K40 A;  2JA8 J;  1GVD A;  2HYJ A;  1ZQ3 P;  1OJL A;  1OCP A;  2YU9 J;  1SFO J;  1GDT A;  3HBL A;  4CYC A;  3BTJ A;  5E3L A;  1FIA A;  2Y31 A;  1B8I B;  2DMN A;  4NDL A;  2I10 A;  3ZQH A;  3HEF A;  4GFB A;  4IEJ A;  2E19 A;  3JRH A;  5M5X J;  4A3E J;  1EF4 A;  2M2E A;  4QIW N;  1QVU A;  5F1J A;  2EZL A;  1BW6 A;  4Y52 J;  4B1R A;  5FKO A;  3HM5 A;  3BG9 A;  3S14 J;  1HDP A;  5EF6 A;  1TWC J;  1YRN B;  4M6V A;  1W0T A;  4HNV A;  2XPW A;  1GV5 A;  4B4C A;  4D7N A;  3CMY A;  1AKH B;  3B6A A;  3PM1 A;  1RKT A;  1QRY A;  1XC5 A;  2QCO A;  1TWF J;  2R5Y B;  3MN2 A;  5E3M A;  3A03 A;  2Y9Z A;  4V2G A;  1MBH A;  4IHV A;  5FJ8 J;  1WI3 A;  1JKP C;  1U9O A;  3G1L A;  1GUU A;  3BQZ A;  3BR2 A;  1GV2 A;  2DMP A;  3NAU A;  2PMZ N;  3HOZ J;  3CCY A;  2LP0 A;  3LOC A;  2XGC A;  4AUX A;  4DYQ A;  5EGO A;  3TW6 A;  1LFU P;  2X48 A;  2XRL A;  3PO2 J;  2NVT J;  1OFC X;  2OPT A;  5F0C A;  1H8A C;  2R7Z J;  2MSY A;  4XRS G;  3Q0V A;  4V2F A;  1BL0 A;  1WCM J;  2JJ7 A;  2LFB A;  4QTR A;  5EEA A;  3H3V K;  3SDG A;  1R9T J;  3LNQ A;  2XPU A;  4IHX A;  2ELK A;  1IDY A;  3OOU A;  3JRA A;  4BXX J;  1ZR4 A;  2B63 J;  2DA1 A;  3S1M J;  1X58 A;  1ENH A;  3GTP J;  3C2B A;  4A3G J;  1IUF A;  4X1E A;  2CU7 A;  2VKE A;  5IP6 A;  1Q1V A;  1MNM C;  1BW5 A;  1G2H A;  3H0G J;  4BBR J;  3QQA A;  3JRC A;  2N8G A;  4C2M J;  2NVQ J;  3JR9 A;  4JP0 A;  1DU0 A;  5IOZ A;  3NAR A;  1FIP A;  4UUS B;  2K9S A;  3RZO J;  2HQ5 A;  2CRG A;  2HXO A;  1VF9 A;  3HOU J;  2E1O A;  3FK7 A;  1OCT C;  4A3C J;  1IC8 A;  1UG2 A;  3ZQF A;  2EZI A;  2Y0S N;  3S1R J;  3K2A A;  1JKR C;  5FKL A;  3BTC A;  5FKM A;  4AYB N;  3JRD A;  3RZD J;  2L0K A;  2VPR A;  4D7M A;  4RBO A;  3WHC A;  2LVS A;  1F43 A;  3WHB A;  3QPS A;  3SJM A;  1Y1W J;  2FD5 A;  1A6I A;  5FLM J;  5BNG A;  1JJ6 C;  3HOV J;  2M0C A;  1FEX A;  3OSG A;  2R0Q C;  4A3L J;  4A69 C;  5FKN A;  1MBG A;  1LE8 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...