1I6HJ

Rna polymerase ii elongation complex
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
65
structure length
65
Chain Sequence
b'MIVPVRCFSCGKVVGDKWESYLNLLQEDELDEGTALSRLGLKRYCCRRMILTHVDLIEKFLRYNP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 5'-D(P*AP*AP*AP*TP*GP*CP*CP*TP*GP*GP*TP*CP*T)-3'
publication title Structural basis of transcription: an RNA polymerase II elongation complex at 3.3 A resolution.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Transcription/dna-rna hybrid
total genus 17
structure length 65
sequence length 65
ec nomenclature
pdb deposition date 2001-03-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
J PF01194 RNA_pol_N RNA polymerases N / 8 kDa subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 1i6hJ00
3A01B 1MNMC 4QSHA 1ZTRA 3OSFA 1TC3C 1PUFB 4AC0A 2YUSA 1EF4A 4QTRA 2FQ4A 4A3GJ 2HYJA 2XSDC 2K9NA 3LOCA 3S1NJ 3TP0A 3ZQLA 5F04A 5EDNA 1WGXA 1TWFJ 5C44J 3RZDJ 1G2HA 5FKMA 4Y52J 3CCYA 5DS9A 4ABZA 3K2AA 2O9LA 5FKNA 1WH7A 1ZR4A 4MFEA 3BR6A 5M5WJ 4JX6A 2GM4A 1F43A 2MSYA 1JKOC 3HOXJ 3DCFA 2NVQJ 1WPKA 3HM5A 3A01A 1T33A 3JRDA 1PUFA 3HGYA 3PO2J 3QPSA 1S7EA 3H0GJ 4M3DA 5IPAA 1RR7A 1NK3P 1HDPA 4D5FA 4A3MJ 5GP9A 2VPRA 4I6ZA 2WV1A 4FISA 1FJLA 2JMWA 5FLVA 1IC8A 2XB5A 2M34A 1BW6A 2JA8J 3S16J 1U8BA 5BNGA 1TWHJ 2JA7J 3S2DJ 1AU7A 2CRGA 5EEAA 3FK6A 3I4NJ 3E7LA 1H88C 2R92J 3K7AJ 1W0UA 5IOZA 3HBLA 4B3AA 2M8GX 2XPWA 5K7ZA 2DMNA 2R0QC 4RDUA 4V2GA 3S1QJ 2EH3A 1ZQ3P 3B6AA 2XPVA 1NK2P 1ETKA 2TCTA 2DMTA 2M2EA 1K61A 1OJLA 2H1KA 2AO9A 2GLOA 3RQIA 1APLC 1H8AC 3IH4A 5F0HA 1RKTA 3I4MJ 1FIAA 1JGGA 2EZHA 2HDDA 1BJZA 2E2JJ 1ZR2A 1IJWC 1HCRA 1OCTC 1IRZA 3G1LA 4FE7A 2LY9A 3FISA 2FJ1A 4W97A 4FCYA 1OFCX 1MBEA 3BG9A 4A3LJ 4A69C 2VUMJ 1GDTA 3OIOA 1YRNB 2IEKA 2ELKA 1O4XA 4M3EA 1MH4A 1Q1VA 2LKXA 4CYCB 3LSPA 3W6VA 2HQ5A 5M5YJ 4XRSA 2R93J 2O7OA 3JRIA 3MN2A 4A3KJ 4BKXA 2DMPA 5FKKA 4V2FA 3HDDA 3FKIJ 4NDLA 1MBFA 2DA2A 2LK2A 4XK4A 3BT9A 1FIPA 2R5YB 1LFBA 2ECCA 5J3LA 5M3FJ 1FEXA 3Q3SA 2MW8A 1QVTA 4DYRA 5K7FA 1UHSA 5M5XJ 2JK3A 5J1UA 3FIWA 3BTLA 4X1EA 4XRSG 1YRNA 2RAEA 3GTJJ 2FD5A 1I3QJ 1W0TA 2MG4A 4CYCA 2K40A 3QPLA 1FTTA 2NVTJ 1P7JA 3HKZN 2ZB9A 1NTCA 3A03A 1JKQC 4DZPA 3DEWA 4W1UA 1SFOJ 4XRMA 4AUXA 5EYRA 5EZHA 2R5YA 2CUEA 3ZQHA 2QF7A 1GUUA 2E2IJ 3BQZA 1IUFA 3JRBA 2E19A 3GTOJ 1HOMA 1ZKGA 2DA6A 4M3BA 4UUTA 4XIDA 2LFBA 2XGCA 3HOZJ 5J1RA 2VKEA 2NOGA 2IAIA 4M6VA 5C3EJ 2XRLA 1Z0XA 3JRHA 1JKRC 5E3MA 5JLWA 1IDZA 1WI3A 4M3FA 3CMYA 3ZQCA 2P81A 3BR2A 3L1PA 5E3NA 3RKQA 3GTGJ 2EQRA 3LSGA 4A3IJ 2B63J 2DA4A 4IHVA 3BG3A 3JREA 3OOUA 2DN0A 4DW6A 1JJ8C 1SANA 1TWAJ 1IDYA 2PMZN 3IV5A 1XC5A 1E3OC 1RKWA 1HF0A 3Q0WA 5IYDJ 4DYQA 3LNQA 5IP6A 2XB0X 5DTDA 3TP3A 3ZQGA 2ECBA 3GTPJ 1TWGJ 1I6HJ 4JP0A 1GV5A 1Y1WJ 1B8IB 5C4XJ 2MGQA 1ENHA 2DA1A 1B72B 3S2HJ 3LSRA 4MFDA 3PO3J 4MO7A 2DA3A 3GBGA 4UUSB 2DTZA 2HOTA 4BXXJ 1U9NA 2X6OA 5J1YA 1HDDC 3HOUJ 4S0HB 2K9SA 2M9HA 5IYBJ 5EZGA 4BBRJ 3JR9A 3GTKJ 4FE4A 3G1OA 4LOCA 1JUMA 2H8RA 4IHXA 4MIMA 4A3EJ 3CQZJ 2LR8A 9ANTA 4JX4A 4IHWA 1WCMJ 5JLXA 2M0CA 2L7ZA 1Z77A 2X48A 3S14J 1B8IA 2DA7A 2ME0A 2HXIA 5F0FA 4XICA 3NAUA 1B72A 2XPUA 1ETQA 5EF6A 3RZOJ 3Q0VA 4UUSA 1VNDA 3BR0A 1JJ6C 2HI3A 3GTMJ 5K7HA 1A6IA 3O8GA 4C3HJ 2Y9ZA 1TWCJ 2I10A 2ID3A 3S17J 3HOYJ 3HOVJ 2WB1N 1MSFC 4X6AJ 1AHDP 3MVPA 2CUFA 2JN6A 5FJ8J 5C4JJ 3HGGA 1U9OA 5FKLA 1I50J 1BA5A 4A3DJ 1DU0A 4Y7NJ 2DMUA 4I76A 3VPRA 3M3YJ 2JJ7A 2LVSA 1F36A 1JKPC 5F0CA 2CQQA 1ITYA 2ID6A 1MBJA 3SJMA 2Y30A 3JRFA 4GFBA 1R9TJ 4B4CA 3BG5A 2NS7A 3HEFA 1JT0A 5M3MJ 2EZLA 3BTCA 5FKOA 5IP7J 2XGEA 2LP0A 3C2BA 2OF7A 4M3GA 2LD5A 1U78A 1ZK8A 2Y2ZA 2IBDA 1UMQA 1X58A 3BR3A 1MSEC 1Y1VJ 1MBHA 1LFUP 2Y31A 5IOYA 2R5ZB 1RPWA 1ORKA 2G0EA 2TRTA 2E1OA 2DJNA 2NVXJ 2W48A 1QPIA 3ZQIA 2X9DA 3ZQFA 4DYCA 1AKHB 3NARA 3BTJA 2KDZA 1JUPA 2WAQN 3S1RJ 3UKGA 5IP9J 2JA5J 4A3BJ 2L9RA 2E2HJ 3WHCA 4C3IJ 4D7NA 3S1MJ 2NS8A 3OSGA 1JT6A 1D5YA 5F27A 1QVUA 1ETWA 1LE8B 1FTZA 4AYBN 2OPTA 3TW7A 4D5CA 3A02A 1QRYA 1ZGWA 2CU7A 2R5ZA 2O8KA 1K83J 3IH3A 1T56A 2Y0SN 1VI0A 2HOSA 4A3CJ 2CQXA 2DMQA 1DU6A 2AHQA 2COBA 3H3VK 3JRGA 4QIWN 1A5JA 3SDGA 3F0CA 3B6CA 1OCPA 5E3LA 1XS9A 2ME6A 2HOAA 4DZJA 1AKHA 2L7MP 4L5EA 4D7MA 4FTHA 5GPCA 1MBKA 4BY1J 4EEFG 2L7FP 3MKLA 3HOWJ 5EGOB 1HLVA 2GBYA 2L0KA 3GTLJ 1GV2A 1VF9A 3IH2A 5FLMJ 4BBSJ 3TEDA 3BR5A 2Y9YA 3JRAA 3GTQJ 3G1MA 1X2MA 1LE8A 4RBOA 2K9QA 3FK7A 3TW6A 2JA6J 3BR1A 1GVDA 2VI6A 5IYCJ 4A3FJ 1JTXA 1MH3A 4A3JJ 1MBGA 2EBIA 3M4OJ 2KT0A 4JYKA 5HODA 1ETVA 1IV6A 5F1JA 2YS9A 4B1RA 2R7ZJ 3JRCA 4J19A 3Q0UA 1JTYA 4IHYA 4A93J 1BW5A 1IGNA 4JX5A 1ETOA 2LTPA 2CJJA 5EG0B 3D1NI 1ETYA 3LSJA 5GPAA 3ZOBA 4MLOA 3BTIA 1JUSA 3O8HA 1GT0C 3CDLA 1WH5A 2LLKA 4C3JJ 2VKVA 5EGOA 1P7IA 2YU9J 2XGDA 3SFIA 1BL0A 1IG7A 1XG1A 3QQAA 4HNVA 1RETA 2HXOA 2EZIA 4C2MJ 2D5VA 1VFCA 4IEJA 3HB9A 5E3OA 2DA5A 1POGA 2NVYJ 1UG2A 3PM1A 2FX0A 2N8GA 5F08A 4G12A 1ETXA 2QCOA 2JWTA 3BQYA 3S15J 1H89C 4BY7J 1RESA 2EZKA 3WHBA 1CQTA 1X2NA 5EG0A
chains in the Genus database with same CATH superfamily
2X51A 3A01B 1MNMC 2XVCA 4RGRA 3OSFA 1BIAA 1PUFB 4AVZA 5J8FA 5ICGA 4A3GJ 3QYBA 1I3AA 1BM9A 3QAHA 3H36A 2DQLA 2K4JA 4BQNA 5JI6A 3KP4A 3JSPA 1MDMB 4ZH4F 1B59A 3ASNH 2VODA 1BC8C 2XHKA 2EWNA 2KQRA 3CCYA 4AVPA 3M07A 3F8BA 5CYVA 1WI9A 3QYEA 2O9LA 2WTEA 3P9CA 3LWFA 5CQGA 2CO5A 2VC0A 1ZR4A 4RGSA 1IXSB 1LEBA 5E1WA 3SZTA 2X6WA 3C2HA 1J7KA 5L3BA 4DGWB 3L2RA 3CCMI 2NVQJ 2JT1A 3A01A 2V79A 3ABKH 2HQNA 1FBQA 2W00A 1PUFA 3PO2J 2XAQA 3P5JA 2HVSA 3FDYA 3QPSA 4KJZA 2ZNZA 5FLXZ 2A5WA 4M3DA 1WJCA 3D5LA 1I39A 4UNOA 3RPQA 4B3XA 5J8CA 2F5FA 2FSWA 1MDMA 2HS5A 1FJLA 1Z3XA 4YELA 2JMWA 2R7RA 4HOBA 5DM7F 1IC8A 3BC8A 2M4KA 1T39A 1OCOH 1M1EB 1BW6A 1OMIA 2WBMA 3JCUC 2QYOA 4IOAF 1R1VA 4FQGA 1AU7A 2PFBA 2CUZA 3ELKA 2L9SA 2O0YA 4JBAA 2L5QA 2MD0A 3TMOA 1H88C 2PI0A 5CVIA 1TNTA 2H09A 3N97A 1BR4A 2B0LA 1B4AA 3NEUA 4L9TA 2H1LA 2V6CA 1GXPA 4ZTJA 1FLIA 2XV4S 5D8KB 4ENMA 1FYKA 3R0AA 3FXOA 5K7ZA 2R0QC 2XASA 4V2GA 3IC7A 2IS6A 2EH3A 1ZQ3P 3B6AA 2XPVA 1ETKA 2EFWA 2P5KA 2DTRA 2AO9A 3HIFA 4NNJA 4PJNA 4Z2YA 2F48A 4M72A 2DFIA 3GYHX 3RQIA 3DBLB 1H8AC 2OCCH 3IH4A 3QPTA 4UV9A 4CYDA 3PSIA 5F0HA 2AXLA 5B66C 1JGGA 4OOIA 2OD5A 4O3MA 1YX3A 5HDNA 1IUYA 2E2JJ 1BIBA 1IN6A 4RM2A 4WWCA 3FF5A 1IRZA 1P6RA 2V4JC 4XKWA 2M45A 1ZGAA 3DF8A 4XLCA 3CC2I 3AL0C 3OIOA 4M71A 1YRNB 2OUMA 2KIQA 2CQKA 3M8JA 4M3EA 2A6TA 3OYGA 1NHAA 3Q9SA 2LKXA 1IF1A 1PVEA 2CYYA 2DBBA 2OU2A 1KU7A 2O7OA 2XF5A 4LD5A 1VQNI 1TT5B 3CJNA 4A3KJ 3SYTA 4BXUA 2KFDA 4KISA 3OOPA 1LVAA 1DQUA 2DMPA 5FKKA 2R7SA 2DA2A 3K6GA 2R5YB 3WE2A 1S8NA 1QQIA 3GO5A 1QHHD 5AONA 1ZRCA 3HRUA 3Q3SA 1FEXA 2MW8A 2IA1A 1UHSA 5M5XJ 2CSOA 5J1UA 2HR3A 5LHHA 4X1EA 3K1PA 1YRNA 1Z7UA 3GTJJ 4ESJA 3L2QA 1MJ9A 2MLGA 3OIQA 3ZMVA 4CCOA 1W7PD 5FB2A 4A6EA 1X1CA 3WTUC 1N25A 4IHSA 1ZARA 5KK1A 2IT0A 4ZDOA 3QPLA 4RLFA 3DV8A 2XAUA 3DU5A 1K4TA 2AS5F 3REOA 1SEUA 1LDDA 1ON1A 2ZB9A 1NTCA 2F6CA 3A03A 1JKQC 1YYVA 1TBXA 2X85A 4DZPA 3DEWA 3EQLF 3MFKA 2ELJA 4G8XA 4XRMA 4AUXA 3LSHA 3WTVC 3FHZA 2R5YA 1LJ9A 3FXKA 3DLAA 2ZFUA 1MMDA 5JFRA 4RB0A 2V1DA 4P96A 4BDYA 3GTOJ 3GXOA 1ZKGA 4LB5A 2VJIA 4PJJA 4XIDA 2CFOA 2LFBA 3KP6A 2VKEA 2QBYB 4IRHA 2EFQA 2ZXJA 3KETA 2Z33A 2ZBKA 1Z0XA 3S8PA 3GMEA 5JHFA 1OR7A 2PJRB 4M3FA 3CMYA 3BROA 3BR2A 4XOTA 4UB6C 4MQVA 2H6CA 1VQPI 3GTGJ 4CSWA 1QA6A 2ADUA 4E7HA 1VTNC 2XRNA 2EB7A 4MTDA 1WFXA 3TOBA 4KMUX 2KHMA 3W2AA 4BE0A 2FU4A 2H6BA 3PL8A 2DN0A 1TWAJ 1IDYA 2VC1A 2VQLA 4IX7A 1FWZA 2QKMB 2XF6A 1HF0A 4NHJA 3H92A 5IYDJ 4F55A 3EUKL 1FP2A 2HQRA 4OAYA 4KDPA 2QBYA 3ZQGA 3GTPJ 4JP0A 1EH8A 2EJRA 4QLCU 1SD4A 1YOVB 2M5WA 1XX5A 2NOJB 3I5UA 4F52A 3TO7A 3SXYA 3S2HJ 4C2UA 2F5VA 4MO7A 2PBIA 3M1EA 2PJRA 1U9NA 4I09A 4XOPA 4RAGA 4U0WA 2W4SA 4S0HB 3CTAA 1O7FA 2KPMA 2JUCA 3V8KA 2EILH 2HDWA 4P1WA 1K4SA 3IAS2 2LF8A 4FE4A 3DU6A 4DJAA 2ZMEC 3CJQB 5HVQC 4RB2C 1JUMA 4PJMA 5LBQA 1KQ9A 4S05A 1HW2A 4A3EJ 4IZZA 1J75A 2BZTA 2LOOA 3QU6A 3N4MA 2WWYA 1MNEA 3LSTA 5E8IA 1Z77A 2QSGX 4A0XA 3A1YA 1LUJB 4PGHA 3K2ZA 2J5OA 3L2WA 2MFZA 2XF7A 2M30A 1IRFA 4OMZA 2A3SA 3BR0A 1Z21A 1IO2A 1XD7A 2HI3A 3RCOA 3F6OA 5K7HA 5DM6F 3ZXSA 2Y9ZA 2CWEA 2ID3A 3CMAI 5ICEA 2LG4A 3OYMA 1VQ7I 2NRAC 2WB1N 4GGGA 1MSFC 3HOYJ 1ZAOA 3WGIA 3LFUA 3ABMH 2IGMA 2D2WA 1RI7A 4KMFA 2JN6A 4HSTA 3LQRA 5J47A 1RUNA 2GXBA 1N75A 1U9OA 2OZUA 2M7BA 4L9JA 3WU0A 3DLLF 5EJCA 2DFEA 4IL6C 1IZ1A 1AWCA 3UNGC 3CCSI 4E4HA 1UAAA 4XLEA 3VPRA 2WB1A 3V7SA 4XKBA 1F36A 1BR2A 1Z1DA 2K27A 2VOPA 1XMKA 1WJEA 3D0SA 3SEZA 2F2EA 2RGVA 3SJMA 2VE8A 2R7OA 4B4CA 2E1MB 3QP5A 3HEFA 3PNYA 5M3MJ 1T95A 3HC7A 5D6EA 5FKOA 5IP7J 2XGEA 3AG3H 2P7CB 2HVQA 3KP2A 5HDGA 3OYHA 3HTSB 1U78A 1YW9A 2IBDA 4C9YA 1UMQA 1RZ4A 3R60A 4OWRB 2R4GA 4CH7A 4P9FA 1FMVA 1MSEC 4HZFA 1MBHA 2QM3A 3U1DA 1SD6A 1JGSA 2FMLA 3FXJA 3GEZA 1RPWA 3NRVA 1G4DA 2IA2A 3OR1C 4KITB 4IO9F 1CF7B 2VBYA 4BL0B 4KICA 4HF0A 3T0YA 2CFXA 4EATA 1WHUA 3E6DA 4E7ZA 4PUSA 2Z16A 4M9XA 1O3RA 4Y17A 3ZQFA 3NARA 1S29A 5IT3A 3BTJA 2KDZA 2Z1DA 1JUPA 2WAQN 4LLNA 1OCZH 2JA5J 2E2HJ 4XSXF 3WHCA 2GXAA 3ZMDA 2X1CA 4OIOF 3S1MJ 1FBUA 2BHZA 4HEA2 1JT6A 2OTJI 1TW3A 3PJRA 5GADJ 5F27A 2LREA 5B1AH 2MYSA 4F92B 1LEAA 1FTZA 3TW7A 2ESNA 2MC4A 2KRCA 1ZGWA 3J80K 1J59A 4M6YA 4HF2A 2O8KA 2QUFA 2Y48A 1BC7C 1CF7A 1TP4A 2DMQA 2DW4A 2R7DA 3SEQA 2COBA 3PUBA 3ONQA 4QIWN 1OCRH 3WE3A 3F0CA 4XLFA 2LH9A 1UHMA 3ESWB 4A5MA 1ZRFA 2MLKA 1I1SA 3MKLA 2M8EA 3H1CA 4CHUA 1X3UA 2X6XA 3IH2A 5JHUA 4BBSJ 3TEDA 4N0BA 3OYAA 3J80Z 1TQPA 2PQ8A 2CV0A 3SZPA 3E5UA 1T8IA 2E1CA 1MNDA 4UUVA 1BI1A 3G4SI 5IYCJ 1L0OC 5FFZA 3OY9A 5E1XA 4A3JJ 3QODA 1VQKI 1ETVA 2IJLA 1ON2A 3BG6A 4CCKA 4J19A 1PYVA 3CLOA 1H9TA 3MKWB 2CJJA 1Y6IA 2QZ8A 3O8HA 1KU2A 3CDLA 1S3JA 1P4WA 4C3JJ 3DTEA 1V5GA 3W6KB 3PNVA 1XGNA 5CQEA 2YU9J 3LA2A 1IG7A 1VQOI 3QQAA 2EZIA 4YIRX 3Q9VA 3AAFA 3W6JB 3HB9A 5E3OA 4XMYA 4RA2A 1UG2A 3E6BA 5HLHA 4B43A 2N8GA 2VXZA 3AG2H 3H9GA 1WKMA 2BXYA 4G12A 4ZZLA 1JE8A 4PSWA 4C2TA 3OV8A 4UB8C 1SFXA 2W84A 3H35A 1FX7A 2V7FA 4I2OA 1CQTA 2NYXA 2HKXA 4EJOA 1K78B 3JAMK 1ZTRA 3H5RA 2F4MB 2ZNYA 2O5RA 3OS1A 1X4PA 2CGPA 4E7JA 2YUSA 4L9NA 3S3MA 3CCQI 1IN7A 3VOEA 1R36A 1DGWY 1HXDA 1XN7A 1FZPB 2XSDC 2K9NA 3ERMA 2FXAA 2CW7A 3LMMA 4LGWA 4ANJA 1LFPA 2JTVA 3KYDB 3R0JA 3KEOA 2ZKZA 3M7GA 3RZDJ 1G2HA 1D1BA 4LIUA 5BPDA 4Y52J 5DS9A 4ABZA 3HOSA 3OYBA 1YS6A 3I3LA 3IUOA 1WH7A 3JAMZ 1LDJA 1V54H 2CUJA 2L4MA 3BR6A 2IS2A 2XC7A 5F1RA 2GM4A 5HS8A 1JKOC 2A07F 3HOXJ 3IKTA 1C0WA 4WXHA 2QKLB 5GAHJ 1K78A 3HM5A 2WY7Q 1S9HA 4E70A 2DOFA 2XDVA 3HGYA 2GIZA 5DV5A 2DJIA 3I55I 2ZXHA 2F5DA 2Q1ZB 5HDKA 4RB3C 1FYMA 3DKXA 1UJ8A 5GP9A 2GXGA 1A6QA 3OYEA 5DUKA 3A2KA 2CG4A 4QPOA 2YX7A 3T8RA 4BJTA 3EYIA 2CW0F 2AXTC 2BW3B 2M34A 1IN4A 3JTHA 3O6BB 3ZMZA 2JA8J 3E6MA 3LL7A 3B02A 1TWHJ 4UHTA 5E17F 1YI2I 1X1AA 4GRIA 1YJNI 1QBJA 2YU3A 5KCMA 4DNCA 3K7AJ 1W0UA 3K69A 1X1DA 4U7DA 1YTYA 5D5UB 2VJJA 1NK2P 4N9IA 1LQ1A 2DMTA 1K61A 3WTTC 3FBNB 2RQPA 3F8NA 1E2XA 3FXMA 1BJAA 4EJVA 1APLC 1F1ZA 3I4MJ 5K5OA 4F7ZA 2EZHA 2BW3A 1BJZA 4LITA 4O6JA 4EV0A 1OYWA 1IJWC 3GF2A 4CCJA 2OA4A 3X2QH 2K9LA 4M9ZA 2ZSIB 3G1LA 5DEQA 1DGRM 2LY9A 1B1BA 2Z3YA 4BQQA 2QSFX 2QGUA 4A3LJ 5K1YA 2HGCA 4A69C 3DFGA 3LA3A 4LG3A 4RAFA 1T38A 2A68F 1E17A 3CJTB 2M1BA 3ABTA 2EA2A 4CO8A 1O4XA 4YG2F 2HTSA 2L9NA 2X1EA 4NC6A 1Y39A 3ROUA 2RC4A 3W6VA 2HQ5A 4XRSA 2E36A 3PSFA 5EEGA 2ICWG 2P4WA 1P92A 4WK8F 2VASA 3O2PE 2GQQA 5LHGA 4V2FA 4KT5C 1RIOH 4NDLA 2FOWA 1IW7F 3BT9A 1O3SA 5D5VB 1FIPA 2CQ7A 4KIFA 3ABUA 3I56I 5DD8A 4AM3A 2BYVE 4OAZA 4ZYEA 3GCMA 2EIJH 1QVTA 2CS3A 1T08B 2QQBA 3C2GA 3F72A 3LSKA 5K7FA 4I01A 4FHTA 1OISA 2E5NA 3T5XA 4XRSG 3E97A 4P55A 2ZC2A 2E5ZA 3ZMSA 3E1SA 1MMSA 3K70C 2ZJRF 2IGOA 1X1BA 1FTTA 2NVTJ 1P7JA 2OTLI 3AG4H 1P9QC 4KIGA 1R4NB 1XMAA 1Y0NA 1R23A 2G7HA 4EM0B 2ACJA 2KIMA 2CV2A 1I6XA 3ECHA 4BJ6C 2V9KA 4FT8A 2QF7A 3BQZA 4BQOA 4BGDA 1TW2A 2X0LA 3IRQA 3HZJA 3AFHA 2QA4I 4CGZA 5J1RA 2R7UA 2JA2A 3MEXA 5H2FC 3H0DA 3CO7C 1WJBA 2GZWA 2KZGA 2DI3A 2HPIA 4R8HA 4M6VA 4DBQA 1R22A 2E1MC 3S2WA 4UVAA 1W4MA 2ELHA 3JTGA 2P5LC 1GVJA 5E3MA 4E7LA 3OS0A 1IDZA 1WI3A 2PN6A 1R4MB 4RAYA 1QPMA 2LKPA 3TL4X 1FPQA 2P81A 2DOEA 2DLLA 3J7YJ 3LSGA 4A3IJ 2P5VA 1YO5C 2LMDA 1O3QA 3TO9A 1XTAA 4RLQA 4HRIA 1VQMI 1PP8F 2A69F 3OOUA 1Z7LA 4DW6A 1JJ8C 4L0YB 1SANA 2STTA 5LRRA 2A05A 2PMZN 4ENJA 3IV5A 1XC5A 3VYRB 3BDDA 1RKWA 3Q0WA 2FE3A 4HG2A 3S3OA 2V1XA 2XB0X 4GDFA 1TWGJ 1GV5A 3FZVA 1FP1D 3WU2C 2XAGA 2RQQA 3BWGA 1B8IB 4UXNA 2W1OA 3HPHA 2COMA 2FF4A 4IOCF 1B72B 2FNAA 3GBGA 4A0ZA 4UUSB 1R58A 2DTZA 1YW8A 2I8DA 2M4GA 3LAJA 2HOTA 1EA3A 4BXXJ 5CVUA 1Y8QB 4NC8A 5D4RA 5ILSA 3GWZA 1SFUA 2K9SA 5IYBJ 2OZ6A 5EZGA 1PUEE 1UG0A 3ERED 1A36A 3GTKJ 4N4NB 5CVJA 2P0WA 1XGOA 4LOCA 3HRSA 1FOXA 2H8RA 1HA8A 4HNTA 4C30A 2BV6A 2UXXA 3WTYC 3CQZJ 2LR8A 3K4NA 4G9YA 4ZYHA 4JX4A 1WCMJ 5IY5H 3CCLI 4PFPA 1B9NA 1B8IA 1DDNA 2ZJ2A 3EUHC 4XICA 2JVGA 1B72A 1MMGA 3RZOJ 4UUSA 1VNDA 4LB6B 3OMYA 1K6OA 4CZZA 3O8GA 3HHHA 1KYZA 3KYLA 4BE2A 2K3FA 3S17J 3BY6A 2QSHX 1I5ZA 4X6AJ 4ZTFA 3MVPA 2E71A 3OL3A 4YFKF 3KLNA 1JXSA 2VT3A 3JW4A 1H9GA 3WTWC 3HGGA 2GOMA 2E35A 2R3SA 4Y13A 1S6LA 2TDXA 2HOEA 5CJ9A 1BA5A 3RPUA 2RKHA 4WXCA 2XAHA 4GYGA 2LVSA 3J7ZI 1LKXA 2CQQA 3FHNA 2RREA 5FD6A 3D5SC 3OYNA 2FNPA 4ENKA 2Y30A 1TTYA 1MGTA 4GFBA 3C3WA 3BG5A 2NS7A 2QWWA 1W1WE 3DBRB 4HX8A 3BJ6A 2OV7A 4XM3A 4PFOA 2WY8Q 4ESFA 4CCNA 4L0ZB 1Y0UA 2Z99A 4IRIA 4OINF 2LP0A 4M3GA 2LD5A 4I99C 2VJ5A 1ZK8A 4LFUA 3GFIA 1P2FA 4AIKA 5ILUA 3R6SA 1BI2A 4PZJA 5HLTA 5KVRA 3BR3A 4EJWA 1Y1VJ 5LGNA 1LFUP 2DXIA 2Y31A 2R5ZB 3U9GA 3OYJA 1ORKA 2BVLA 2WV0A 2YX4A 3VYSB 2E1OA 2C6YA 2DJNA 4YFNF 5JVTA 2X9DA 4XRFA 3WTZA 5GAGJ 3ZMUA 3VB2A 1FOYA 2V6EA 4IXAA 1U5TC 2ZO4A 5IP9J 4B48A 3UKGA 4C3IJ 4D7NA 4KNYA 3BZCA 2NS8A 3L2VA 4XKVA 1QVUA 5E18F 3KZZA 1P4AA 4M6XA 4HQMA 1V5FA 2VN2A 1LE8B 3LAPA 5GTIC 1KGSA 3A02A 3I53A 1QRYA 4BS9A 1H0MA 4EJUA 1BOAA 5TGTA 2LC2A 3F6VA 4U0YA 2IGNA 2CU7A 2R5ZA 1G6NA 1LDKB 1X3WB 2WADA 4D0PA 5GAEJ 3RI4A 1T56A 2BE5F 2Y0SN 1VI0A 2HOSA 2CQXA 3WGHA 4HA8A 1Z9CA 3VDXA 2AHQA 4YIIA 3H3VK 2LY2A 2D45A 3B6CA 1V3FA 1XS9A 2HKOA 2L7MP 5KAIC 2BY2A 2ETHA 2YPRA 3HTUA 1QHGA 3QRFF 4EEFG 2KJBA 4IQ4A 2EIKH 3HOWJ 2VONA 3B73A 3E5XA 3KPHA 3KE2A 1GV2A 4ZYGA 5FLMJ 2VOOA 1OKRA 1TZLA 1IN8A 1B9MA 2AQFA 1YG2A 3DKWA 1VZ0A 2KIFA 2JUGA 3G1MA 3GTQJ 1LE8A 4RBOA 4IPAA 3IRRA 2K9QA 1FT9A 4N4OB 3DWLE 2VI6A 4B44A 3VYTB 3MQ0A 3KYCB 3COAC 4I98B 1MH3A 5IT9K 1MBGA 3M4OJ 1D1CA 5F64A 4JYKA 4ZDLA 5D6FA 2L4AA 3FX3A 1ZELA 2R7ZJ 3IKVA 3BP8A 2AQEA 3JRCA 3Q0UA 4HPQA 2JVHA 4IHYA 5H6QA 2L9VA 3KLOA 1OYYA 1U0JA 2LTPA 3CUQB 4XL9A 3HL2A 2LBFB 3I54A 2LKSA 3GFLA 3BTIA 1GT0C 3HG9A 2LSOA 2W57A 4AIJA 2K5CA 5LLQA 3FWEA 5HOOA 1ZG3A 2VKVA 1R6RA 1YJWI 1P7IA 2W25A 3IP4B 1XMXA 4YRVA 3SFIA 2HWVA 1XCVA 1RETA 4C2MJ 2XAFA 4IEJA 1PJRA 5IT9Z 2NVYJ 4MGRA 2FX0A 4FASD 3PUFA 3BJOA 1EH7A 3GW2A 3SHFA 1MMNA 1N77A 1H89C 3U21A 3VFZA 1RESA 1VQLI 2NS0A 2EZKA 3M9AA 2B9SA 3TQNA 3RKYA 4RS8A 3RIRA 1CGPA 3EETA 4YFXF 1X2NA 4LLLA 3CUQA 4JOMA 2OBPA 1ZGJA 2DFHA 1E3HA 2LBFA 1DP7P 4UVCA 3G73A 1EF4A 3RYRA 1WJ5A 4QTRA 2FQ4A 3F23A 4U88A 1K6YA 3MKZA 4WF2A 3MAJA 3FXLA 2VXDA 4ETSA 4PGGA 5F04A 1TWFJ 3ZQ7A 4XORA 4S04A 3V8JA 2M0MA 5FKMA 1ZRDA 5KNLA 3K2AA 1WJDA 5FKNA 3RDIA 3LA7A 5J6XA 1FSEA 4JX6A 2O3FA 4CCMA 4DQ2A 2LNBA 4DOZA 2X1DA 3DCFA 2GWRA 5BPIA 2W7NA 4Y3OA 3OYFA 3JRDA 1R00A 4EGZA 2ZFWA 4XLHA 3QOEA 4X0GA 2XAJA 2VBWA 2WAFA 2OJED 5TJJA 3H0GJ 5LGTA 3KFWX 1QZYA 5IPAA 1KQ0A 3VODA 1NK3P 2JQ7A 3MD2A 4A3MJ 4D5FA 1YITI 2CMPA 2EPFA 1LPQA 1F4KA 2WV1A 2FEZA 3EYYA 3OYKA 1TQMA 2WAQA 1Z05A 1U2WA 2MH9A 4L9VA 5B1BH 1FSHA 5KHDA 2K3PA 3EDPA 3S16J 1U8BA 3M8EA 3I58A 2ZJPF 2BY3A 2EINH 3S2DJ 4I0BA 4HLYA 5EEAA 1WJAA 3CDHA 1BOBA 3CESA 2IGKA 5L3GA 2R92J 2P6TA 1SMYF 2M8GX 4FETA 2DFFA 2XPWA 3ABLH 3DKYA 3DXJF 3GZNB 2ISYA 3OS2A 2DMNA 4RDUA 4J01A 3S1QJ 3CC7I 4ZJZA 2TCTA 1OJLA 4N9HA 3PIPF 2H1KA 2GOXB 2VIXA 3TO6A 3F8CA 2DK8A 5DCMB 2GLOA 3G71I 3IAM2 4WX9A 1XSDA 3ZP5A 1FIAA 4PJ0C 2HDDA 4EM1A 4DBRA 3J81K 3RPUD 4KIBA 5HLIA 1HCRA 4MHGA 3ASOH 1WSUA 4A6DA 1O3TA 2X6YA 2FJ1A 4W97A 4FCYA 1OFCX 1MBEA 3BG9A 3EUHA 1UFMA 3E3VA 1HSTA 4O5VA 2FBIA 3KCCA 3F8FA 3FMQA 3BCBA 4BEHB 1Q1VA 3LSPA 1F5TA 1A35A 2F4OB 2R93J 4F93B 2RV8A 3QYFA 1HKQA 2HPMA 4BKXA 3J81Z 2K85A 3FXUA 1GLNA 5DCMA 2DPDA 3HDDA 2IPQX 3DEUA 3FKIJ 4GYIA 3RTRA 2RN7A 1LB2A 1EH6A 3DBHB 4HSRA 3LSIA 2ECCA 2RDPA 5LHIA 4LK0F 3CJRB 5M3FJ 5E20A 4Q48A 1TL8A 4DYRA 1XGSA 1T98A 5BQTA 4LIVA 2KKOA 1AA7A 5DDGA 3FIWA 1YX5A 2L2OA 1QU3A 2ZXIA 3L09A 2K9MA 3FM5A 1K79A 1W0TA 2BEOA 1U5TB 2KJCA 4BEHA 3GLLA 3CP8A 2K40A 3NWTA 5KAFC 2W24A 3EPZA 1FC3A 4OMYA 1OCCH 3DP7A 3LSMA 2PJPA 3HKZN 4J00A 4BUPA 2LY1A 5FO5A 4BAYA 1Z67A 2F5CA 2Z5UA 3CCJI 5EZHA 2JSCA 3SFZA 3DTKA 3GUDA 2DAOA 1W5SA 3JRBA 1AOYA 1DP3A 2VKHA 3A0HC 4M3BA 4Q5SF 2XGCA 5K5RA 4MNUA 1WJFA 5J40A 2V9PA 1OQYA 2NOGA 2Y75A 3HPGA 5C3EJ 2XSJC 1U5TA 2XRLA 3L2UA 4XSZF 4DIQA 2L01A 2DCEA 3JRHA 4OIPF 1KA8A 4MQ9F 3BG7A 1V5EA 1X19A 2HQAA 2JPCA 4NB5A 3L1PA 4KFCA 1KU3A 5E3NA 3RKQA 1Z3YA 2Z2SB 1S72I 4BHPA 4XQFA 3KX2A 3MKYB 2V9VA 3MWMA 2ZCWA 3BG3A 3JREA 2Y69H 2EFNA 4G7HF 1WQ2A 4KUMA 5D8LB 1G3WA 1ZG5A 5LFAA 1D5VA 3OYIA 1E3OC 2VKDA 4BHCA 4DYQA 4HW0A 5ICCA 3LNQA 3TP3A 1ACIA 3I71A 4IVNA 1I6HJ 1WWXA 3W3CA 1HBXG 1REPC 1W36D 1Y1WJ 5C4XJ 3CZ6A 2MGQA 1ENHA 2E1NA 3K1MA 3V8LA 5J4YA 3LSRA 2D1HA 1BR1A 4UY8I 2DA3A 4IF4A 1R5GA 3K9TA 2VQHA 2BY1A 3GZ6A 1TQIA 1HDDC 1BBYA 5TISC 3K1NA 4PDKA 2MBFA 3CF5F 4BBRJ 1KQ8A 1J5YA 4RGUA 5CKTA 3G1OA 1WRJA 1VQ9I 4BACA 3V4GA 1DUXC 4CICA 3K70D 4XBFA 2M0CA 2L7ZA 1HKTA 2X48A 2Q2EB 2DA7A 1IXRC 4G94A 2IXSA 3ZGKA 1W36C 2VBZA 2BBYA 2KLOA 3NAUA 3DPUA 2XPUA 1ETQA 4F3QA 5EF6A 1MIJA 3ZRGA 2LDUA 4RMNA 1JJ6C 3GTMJ 2VPLA 3ZQQA 3R4KA 2ZSHB 4C3HJ 1TWCJ 2I10A 2R7VA 3T1BA 4B47A 1XCBA 2PEXA 4ASNA 3GLXA 1X1PA 1Q1HA 3L9FA 1G59A 4A2UA 5FJ8J 2EK5A 1ZLJA 1SMTA 4Y33A 2PG4A 2MA3A 1PDNC 2J5PA 4A3DJ 1YIJI 1DU0A 4H0EA 2K7LA 2DMUA 2M7AA 3M3YJ 2KL4A 2JJ7A 1JKPC 5EEHA 4BJ5C 3I59B 3CUQC 2Q0OA 1IRGA 1ITYA 2Q2EA 3OYLA 1MBJA 3CMEI 3ZCOA 4HDVA 1FBSA 1J2XA 2DYSH 3V7RA 1BN5A 5TRDA 1S7AA 2M87A 2EV5A 2DT5A 3ML6A 1JT0A 3BTCA 2DDBA 2LYCA 2RNGA 1HQCA 2O6GE 3F8MA 4OIQF 2OF7A 4B09A 1YQAA 1X58A 2NVUB 2KRHA 1SFEA 2VB6A 4JK1X 4E6KG 1U3EM 5FROA 3KP3A 2E34A 5FLXK 3TDUC 3CUOA 5IOYA 3K4CA 2GIVA 2L7KA 2UV1A 2VLAA 1IRXA 1O57A 2TRTA 2P6SA 3NQOA 1W5TA 3K4JA 4G6QA 1GHCA 5E79C 2H27A 3CD6I 4XLPF 3I59A 1KZHA 1QO0D 2NVXJ 6PAXA 1QPIA 3ZQIA 3HOTA 2VQCA 2K02A 3ZN0A 4DYCA 1AKHB 1D1AA 1MW7A 3I9V2 3CDIA 3L7WA 3BCAA 3S1RJ 1NG7A 2XROA 4A3BJ 2L9RA 3MZYA 3MZ8A 3C7JA 1YHQI 2L3DA 3S93A 4AWXB 1D5YA 2PMUA 4BYYA 4HYEA 3TKYA 1ETWA 3S32A 3VWBA 2JRTA 1F9NA 2BGCA 2OPTA 2W82A 2FMYA 3E6CC 1R7JA 2R7QA 1RNLA 4HX7A 5L3DA 2NAZA 3KP7A 3WG9A 3MZHA 3IH3A 4IRGA 1UHWA 4BHBA 4A3CJ 1L3LA 4ZYDA 2P8TA 3JRGA 2BY0A 4ITVA 3SDGA 1ULYA 2PMZA 1OCPA 1Z6TA 5E3LA 3F3XA 3WGGA 2ME6A 2BXZA 2HOAA 1AKHA 5B5EC 4RAZA 3WTSC 4D7MA 4FTHA 2HYFA 1KONA 4FX4A 4ENNA 2L7FP 2M3AA 5EGOB 1V4RA 1HLVA 3HRMA 1S7OA 2L0KA 4H4KC 3GTLJ 3KP5A 1YE9A 1ERDA 4G6TB 2I5UA 2FBHA 3BR5A 2MD5A 2GA1A 4XKCA 1A04A 4U7BA 1NH3A 3FK7A 3R61A 1UB9A 2G9WA 3BR1A 5HS9A 1R49A 1FNNA 4BXFA 1YS7A 1MZBA 2X4HA 4IQJA 1JTXA 1DPRA 2D1VA 2EBIA 4MEXF 5BOXA 5F6FA 5HODA 1T0FA 3FMRA 3RJPA 1IV6A 5F1JA 2YS9A 3I0TA 1XDSA 4A93J 1IGNA 5EG0B 1ETOA 2OAZA 2PX9A 3V7CA 3D1NI 1ETYA 4ON0A 5GPAA 3ZOBA 4MLOA 4BDZA 2E7XA 1JUSA 5E1ZB 1SC7A 1WH5A 2DQRA 3AKZA 1YLFA 5EGOA 3M1CA 3MMYB 5ICFA 2CH0A 2D5VA 1VFCA 4A0YA 1J9IA 4OIRF 2DA5A 4CCLA 1POGA 4HX4A 2CQNA 2IVMA 2FA5A 2NNYA 3PM1A 3FMSA 4EMSA 2STWA 5LGUA 4QWQA 1O7LA 3CLQA 3CCUI 2QENA 4G6DA 3BQYA 2VL8A 3GFMA 2W85A 3OYDA 3F21A 3DPTA 4LMYA 1JHHA 3W2VA 2Y0MA 1ZH5A 2QQAA 1FY7A 3TOAA 1VQ5I 1JHFA 3M8FA 4HAMA 2UUZA 4AIHA 3RKXA 5EG0A 4WXDA 2EV6A 4QSHA 3KEQA 1BI0A 1TC3C 2PMHA 1MKMA 4IHTA 4AC0A 2XIGA 2LF7A 2HYJA 1SFKA 3H5AA 3LOCA 3WTXC 3U1KA 2CW8A 4CZCA 4LG0B 1V55H 3S1NJ 3TP0A 4R79A 4XONA 1B6AA 3ZQLA 4ZDPA 1WGXA 5EDNA 3IWFA 2KRFA 5C44J 1STZA 2FBKA 2XUBA 3W2WA 3L2CA 4HF1A 1Y8RB 4P5OA 2H8WA 4PK4A 1KYWA 1HKSA 4MFEA 4P9UA 4L5JA 4EQQA 3NWSA 5M5WJ 1F43A 3HYIA 1LVKA 2MSYA 2HDCA 4V19K 3AG1H 2HNHA 3HJEA 1WPKA 2OC6A 1EV7A 1MD0A 4AD9A 1T33A 1HW5A 1R1UA 1R1TA 4A12A 3QOPA 1S7EA 2DDAA 3ZPLA 2MC3A 3K0LA 1IAWA 3K4KA 1RR7A 1X3ZB 2XKPA 4LG0A 1HDPA 2IA0A 5ED4A 2DK5A 2O8XA 3WG7H 5L3CA 2R7TA 2VPRA 4I6ZA 2K4BA 2YSRA 4E7IA 4FISA 5FLVA 4G7OF 2NNNA 3E0JB 2XB5A 3GZ5A 5CVVA 3VSKA 5L3EA 3DTIA 2R7XA 5BNGA 1XSXA 2JA7J 1D8KA 3BJAA 3MCZA 5DCFA 2CRGA 4U87A 3FK6A 2O61A 3I4NJ 3E7LA 1J0RA 3G2BA 1E0EA 1NG6A 5CLSA 5IOZA 3HBLA 3D5RC 4B3AA 1J09A 4G7ZF 2V1NA 2Y0SA 3P7NA 1OPCA 4IKFA 4HBLA 2QVOA 5FD5A 3CCRI 1TT0A 1G3TA 1QNTA 2EFPA 2M2EA 1XB4A 5FRNA 1K7AA 4XN0A 3OWTA 1HSJA 3J7AO 3SQNA 4XNFA 4I02A 4QPQA 2L02A 1FOKA 4E7KA 1RKTA 3CCVI 3FM3A 3KZYA 1D0XA 1ZR2A 2H94A 1OCTC 3A4CA 4FE7A 1I27A 5CPRB 1IV8A 3FISA 2QEXI 2IP2A 2NXNB 3O3KA 1ODDA 1EJ9A 4NC7A 4XN3A 2VUMJ 1GDTA 2IEKA 2UXNA 1Z6RA 2UZKA 2ELKA 3DEEA 4AIDA 1MH4A 5D5WB 4CYCB 2FUG2 5M5YJ 1VQ6I 3BPXA 1HW1A 2K86A 3JRIA 3HRTA 3MN2A 3L00A 1R5HA 1IXCA 1G3YA 3CF2A 1R71A 2DYRH 1MBFA 2A61A 2LK2A 4E7SA 4XK4A 5A2QK 2BOLA 2ISZA 1LFBA 3LFKA 3Q5FA 5J3LA 2GAUA 4LJZF 3GFJA 2VE9A 2HEOA 2JK3A 2WA0A 4CA0A 1OYIA 2R7FA 1MJAA 2Z9OA 3BTLA 5D4SA 2RAEA 2EFOA 1I3QJ 2A6EF 2FD5A 4KT6A 4LLGF 2QQ9A 2MG4A 5FRMA 4LK1F 1IN5A 1EKEA 2RNJA 4CYCA 1ZYRF 4Q4ZF 3VSLA 5A2QZ 2QLZA 4GO1A 3TDZC 4L18B 2DOAA 1VQ8I 1ZLKA 2OQGA 2BHYA 2MH2A 3H9QA 4W1UA 2HYGD 2KIUA 5AIPA 1ZN2A 1SFOJ 2FOKA 3OYCA 5EYRA 3E5QA 3RSNA 1E3PA 2IRFG 2CUEA 4K2EA 3ZQHA 1GUUA 2E2IJ 4NBQA 1IUFA 2ESHA 4XR6A 3K4LA 2E19A 1HOMA 2DA6A 4UUTA 4ZZDA 4A5NA 5CVRA 3HOZJ 4II2A 1YW7A 3T8TA 1MMAA 4HNUA 4KYWA 1FOWA 3ZMTA 3CO6C 2KMUA 2IAIA 4AU7A 2IS1A 4KN7X 3ZN1A 2KP6A 3BPVA 4EM2A 5JLWA 1JKRC 2EV0A 2XKOA 4ZYAA 1G8XA 1WZ2A 2Q8KA 3ZQCA 1YIOA 1MJBA 3QPHA 1UZCA 2VQGA 3VEPA 1QZZA 4M73A 5ERIA 2EQRA 5DUIA 2HFHA 2WC2A 1ZG1A 1U8RA 4EVIA 2B63J 2DA4A 1LNWA 3QU3A 5BMZA 4IHVA 3VYUB 4HV6A 4Y4RA 1RR8C 4MEYF 3RKWA 3PFYA 4R1HA 1VQ4I 3HUGB 4UVBA 5DD4A 1T2KA 3UR3C 5LEJA 3PQJA 3C18A 5IP6A 1ZHFA 3I64A 5DTDA 1SVMA 2ECBA 5AIQA 4B8XA 4RM3A 1FYLA 2B7EA 2OQRA 3AL0B 4NQWB 3K4BA 2V1UA 4GCVA 3PNTA 2DA1A 3DPLC 4MFDA 3PO3J 1USSA 4HV5A 4OU0A 2VJ4A 4U0VA 4PJLA 2X6OA 5J1YA 4BQAA 3HOUJ 4Q47A 2QQ8A 2WAEA 2A5YB 2M9HA 1ONVA 2KZVA 3JR9A 4EGYA 2DODA 2DO7A 1ZREA 5BS6A 3HUGA 4L5IA 4IHXA 4MIMA 3WU1B 1T0FC 1DPUA 4BE1A 1OLTA 9ANTA 2VT2A 3C1DA 4IHWA 4M9SA 1D3YA 5JLXA 3HSFA 2A6HF 1KU9A 1QZEA 3S14J 4NQWA 2ME0A 2HXIA 3K10A 2BVMA 3ECOA 5F0FA 4HDUA 5HNHA 1SD7A 1SVLA 3Q0VA 4Z6YA 1A6IA 3P9IA 3ULQB 4RGXA 1XPXA 2JPBA 2CV1A 3HOVJ 1AHDP 2GA2A 4JQFA 4CDGA 2CUFA 3H5NA 3K4MA 5C4JJ 1SAXA 5FKLA 3LQQA 2MABA 2VBXA 2JRMA 1I50J 1P4XA 4IJAA 4NUBA 2O03A 5LRSA 3S3NA 4Y7NJ 4I76A 1UCRA 5DYMA 2UWMA 2E60A 3WODF 5F0CA 3F9KA 4BU2A 1HC8A 2ID6A 1XGMA 4EJTA 4Y15A 4UV8A 4XLAA 1WVRA 3JRFA 2F5EA 1R9TJ 1A31A 3HHGA 1JI8A 4RB1A 1W7PB 2EZLA 5GTHC 1S5LC 2XGXA 4YEJA 4PSXA 3FKJA 2DT6A 5H6RA 3BLYA 1X4OA 5LEKA 2HVRA 3C2BA 4F91B 1UELB 3A0BC 2Y2ZA 3F22A 3SDBA 4II3A 3DQVC 4WCGA 1Z91A 3SZGA 4M74A 3TBIA 3ZR8X 5FFXA 1R5ID 3GX4X 1RUOA 3I4PA 5JR3A 3HKZA 3H9JA 3ISPA 5HLGA 1T6SA 2DT7B 3H3UA 3CCEI 1USTA 5HS7A 2G0EA 4D9JA 2E7WA 1YFHA 2IS4A 2FQ3A 5L3FA 2KISA 2W48A 3GVAA 3HSRA 2HZDA 4CUGA 4YIFA 1SD5A 2V26A 3KIOA 3FBIB 1W7PA 1QGPA 5FGMA 3BZ6A 1D8JA 3OIPA 1BI3A 2HU9A 3OSGA 1OR7C 3V42A 3JSOA 1D0ZA 3BOQA 3IWZA 3CP2A 2DU9A 2ZXWH 4GXOA 4AYBN 3PQKA 4D5CA 2OCEA 2F4IA 4CXFA 1SVOA 1PP7U 2ZMEB 1XDUA 4PCQA 4MTEA 1K83J 3G6EI 3J7AY 3IL2A 3FXQA 4I7HA 1DU6A 3BZKA 3IHUA 2YR2A 4HLXA 1A5JA 4AYBA 3CMMA 4DZJA 2JSPA 1G3SA 1D0YA 3HXLA 3CC4I 4L5EA 1GXQA 5HNFA 5GPCA 1MBKA 4BY1J 4XLNF 3TGNA 1N78A 3OR2C 3PIOF 2JZYA 2GBYA 2KDOA 1I1GA 1VF9A 3HSEA 1TLHB 2Y9YA 3JRAA 3OL4A 1FMWA 1X2MA 4BNCA 1YJ9I 2L54A 3TW6A 2JA6J 1GVDA 3RYPA 4A3FJ 2ZMEA 5ILVA 2IW5A 2KT0A 3FXRA 4TV7A 4B1RA 3G3ZA 2LRDA 2HZTA 1JTYA 1BW5A 1Y56A 5JVGF 4JX5A 3N05A 4FX0A 3LSJA 5H20A 1U6GA 3QWLA 4BH9A 4D1QA 2PLYA 2LLKA 2EIMH 5D5XB 2P7VB 2FRHA 3U2RA 1RC9A 4ESBA 5B3SH 2RVCA 2XGDA 1BL0A 3PFIA 1XG1A 3RQ4A 4HNVA 2HXOA 4KA4A 2ZJQF 1SAUA 3P9KA 5LD2C 4KN4X 5E8GA 3H3ZA 3KZIC 5K5QA 2HTJA 4I0AA 5F08A 1ETXA 2QCOA 2JWTA 4HQEA 3S15J 3KEYA 4ZC3A 2G7UA 4BY7J 1RRJA 3QP6A 1W5CC 3WHBA 1TNSA 5J4VA 2DPUA 1XSVA 2EA4A 3EUAA 2R7WA
chains in the Genus database with same CATH topology
3A01B 1MNMC 4QSHA 1ZTRA 3OSFA 1TC3C 1PUFB 4AC0A 2YUSA 1EF4A 4QTRA 2FQ4A 4A3GJ 2HYJA 2XSDC 2K9NA 3LOCA 3S1NJ 3TP0A 3ZQLA 5F04A 5EDNA 1WGXA 1TWFJ 5C44J 3RZDJ 1G2HA 5FKMA 4Y52J 3CCYA 5DS9A 4ABZA 3K2AA 2O9LA 5FKNA 1WH7A 1ZR4A 4MFEA 3BR6A 5M5WJ 4JX6A 2GM4A 1F43A 2MSYA 1JKOC 3HOXJ 3DCFA 2NVQJ 1WPKA 3HM5A 3A01A 1T33A 3JRDA 1PUFA 3HGYA 3PO2J 3QPSA 1S7EA 3H0GJ 4M3DA 5IPAA 1RR7A 1NK3P 1HDPA 4D5FA 4A3MJ 5GP9A 2VPRA 4I6ZA 2WV1A 4FISA 1FJLA 2JMWA 5FLVA 1IC8A 2XB5A 2M34A 1BW6A 2JA8J 3S16J 1U8BA 5BNGA 1TWHJ 2JA7J 3S2DJ 1AU7A 2CRGA 5EEAA 3FK6A 3I4NJ 3E7LA 1H88C 2R92J 3K7AJ 1W0UA 5IOZA 3HBLA 4B3AA 2M8GX 2XPWA 5K7ZA 2DMNA 2R0QC 4RDUA 4V2GA 3S1QJ 2EH3A 1ZQ3P 3B6AA 2XPVA 1NK2P 1ETKA 2TCTA 2DMTA 2M2EA 1K61A 1OJLA 2H1KA 2AO9A 2GLOA 3RQIA 1APLC 1H8AC 3IH4A 5F0HA 1RKTA 3I4MJ 1FIAA 1JGGA 2EZHA 2HDDA 1BJZA 2E2JJ 1ZR2A 1IJWC 1HCRA 1OCTC 1IRZA 3G1LA 4FE7A 2LY9A 3FISA 2FJ1A 4W97A 4FCYA 1OFCX 1MBEA 3BG9A 4A3LJ 4A69C 2VUMJ 1GDTA 3OIOA 1YRNB 2IEKA 2ELKA 1O4XA 4M3EA 1MH4A 1Q1VA 2LKXA 4CYCB 3LSPA 3W6VA 2HQ5A 5M5YJ 4XRSA 2R93J 2O7OA 3JRIA 3MN2A 4A3KJ 4BKXA 2DMPA 5FKKA 4V2FA 3HDDA 3FKIJ 4NDLA 1MBFA 2DA2A 2LK2A 4XK4A 3BT9A 1FIPA 2R5YB 1LFBA 2ECCA 5J3LA 5M3FJ 1FEXA 3Q3SA 2MW8A 1QVTA 4DYRA 5K7FA 1UHSA 5M5XJ 2JK3A 5J1UA 3FIWA 3BTLA 4X1EA 4XRSG 1YRNA 2RAEA 3GTJJ 2FD5A 1I3QJ 1W0TA 2MG4A 4CYCA 2K40A 3QPLA 1FTTA 2NVTJ 1P7JA 3HKZN 2ZB9A 1NTCA 3A03A 1JKQC 4DZPA 3DEWA 4W1UA 1SFOJ 4XRMA 4AUXA 5EYRA 5EZHA 2R5YA 2CUEA 3ZQHA 2QF7A 1GUUA 2E2IJ 3BQZA 1IUFA 3JRBA 2E19A 3GTOJ 1HOMA 1ZKGA 2DA6A 4M3BA 4UUTA 4XIDA 2LFBA 2XGCA 3HOZJ 5J1RA 2VKEA 2NOGA 2IAIA 4M6VA 5C3EJ 2XRLA 1Z0XA 3JRHA 1JKRC 5E3MA 5JLWA 1IDZA 1WI3A 4M3FA 3CMYA 3ZQCA 2P81A 3BR2A 3L1PA 5E3NA 3RKQA 3GTGJ 2EQRA 3LSGA 4A3IJ 2B63J 2DA4A 4IHVA 3BG3A 3JREA 3OOUA 2DN0A 4DW6A 1JJ8C 1SANA 1TWAJ 1IDYA 2PMZN 3IV5A 1XC5A 1E3OC 1RKWA 1HF0A 3Q0WA 5IYDJ 4DYQA 3LNQA 5IP6A 2XB0X 5DTDA 3TP3A 3ZQGA 2ECBA 3GTPJ 1TWGJ 1I6HJ 4JP0A 1GV5A 1Y1WJ 1B8IB 5C4XJ 2MGQA 1ENHA 2DA1A 1B72B 3S2HJ 3LSRA 4MFDA 3PO3J 4MO7A 2DA3A 3GBGA 4UUSB 2DTZA 2HOTA 4BXXJ 1U9NA 2X6OA 5J1YA 1HDDC 3HOUJ 4S0HB 2K9SA 2M9HA 5IYBJ 5EZGA 4BBRJ 3JR9A 3GTKJ 4FE4A 3G1OA 4LOCA 1JUMA 2H8RA 4IHXA 4MIMA 4A3EJ 3CQZJ 2LR8A 9ANTA 4JX4A 4IHWA 1WCMJ 5JLXA 2M0CA 2L7ZA 1Z77A 2X48A 3S14J 1B8IA 2DA7A 2ME0A 2HXIA 5F0FA 4XICA 3NAUA 1B72A 2XPUA 1ETQA 5EF6A 3RZOJ 3Q0VA 4UUSA 1VNDA 3BR0A 1JJ6C 2HI3A 3GTMJ 5K7HA 1A6IA 3O8GA 4C3HJ 2Y9ZA 1TWCJ 2I10A 2ID3A 3S17J 3HOYJ 3HOVJ 2WB1N 1MSFC 4X6AJ 1AHDP 3MVPA 2CUFA 2JN6A 5FJ8J 5C4JJ 3HGGA 1U9OA 5FKLA 1I50J 1BA5A 4A3DJ 1DU0A 4Y7NJ 2DMUA 4I76A 3VPRA 3M3YJ 2JJ7A 2LVSA 1F36A 1JKPC 5F0CA 2CQQA 1ITYA 2ID6A 1MBJA 3SJMA 2Y30A 3JRFA 4GFBA 1R9TJ 4B4CA 3BG5A 2NS7A 3HEFA 1JT0A 5M3MJ 2EZLA 3BTCA 5FKOA 5IP7J 2XGEA 2LP0A 3C2BA 2OF7A 4M3GA 2LD5A 1U78A 1ZK8A 2Y2ZA 2IBDA 1UMQA 1X58A 3BR3A 1MSEC 1Y1VJ 1MBHA 1LFUP 2Y31A 5IOYA 2R5ZB 1RPWA 1ORKA 2G0EA 2TRTA 2E1OA 2DJNA 2NVXJ 2W48A 1QPIA 3ZQIA 2X9DA 3ZQFA 4DYCA 1AKHB 3NARA 3BTJA 2KDZA 1JUPA 2WAQN 3S1RJ 3UKGA 5IP9J 2JA5J 4A3BJ 2L9RA 2E2HJ 3WHCA 4C3IJ 4D7NA 3S1MJ 2NS8A 3OSGA 1JT6A 1D5YA 5F27A 1QVUA 1ETWA 1LE8B 1FTZA 4AYBN 2OPTA 3TW7A 4D5CA 3A02A 1QRYA 1ZGWA 2CU7A 2R5ZA 2O8KA 1K83J 3IH3A 1T56A 2Y0SN 1VI0A 2HOSA 4A3CJ 2CQXA 2DMQA 1DU6A 2AHQA 2COBA 3H3VK 3JRGA 4QIWN 1A5JA 3SDGA 3F0CA 3B6CA 1OCPA 5E3LA 1XS9A 2ME6A 2HOAA 4DZJA 1AKHA 2L7MP 4L5EA 4D7MA 4FTHA 5GPCA 1MBKA 4BY1J 4EEFG 2L7FP 3MKLA 3HOWJ 5EGOB 1HLVA 2GBYA 2L0KA 3GTLJ 1GV2A 1VF9A 3IH2A 5FLMJ 4BBSJ 3TEDA 3BR5A 2Y9YA 3JRAA 3GTQJ 3G1MA 1X2MA 1LE8A 4RBOA 2K9QA 3FK7A 3TW6A 2JA6J 3BR1A 1GVDA 2VI6A 5IYCJ 4A3FJ 1JTXA 1MH3A 4A3JJ 1MBGA 2EBIA 3M4OJ 2KT0A 4JYKA 5HODA 1ETVA 1IV6A 5F1JA 2YS9A 4B1RA 2R7ZJ 3JRCA 4J19A 3Q0UA 1JTYA 4IHYA 4A93J 1BW5A 1IGNA 4JX5A 1ETOA 2LTPA 2CJJA 5EG0B 3D1NI 1ETYA 3LSJA 5GPAA 3ZOBA 4MLOA 3BTIA 1JUSA 3O8HA 1GT0C 3CDLA 1WH5A 2LLKA 4C3JJ 2VKVA 5EGOA 1P7IA 2YU9J 2XGDA 3SFIA 1BL0A 1IG7A 1XG1A 3QQAA 4HNVA 1RETA 2HXOA 2EZIA 4C2MJ 2D5VA 1VFCA 4IEJA 3HB9A 5E3OA 2DA5A 1POGA 2NVYJ 1UG2A 3PM1A 2FX0A 2N8GA 5F08A 4G12A 1ETXA 2QCOA 2JWTA 3BQYA 3S15J 1H89C 4BY7J 1RESA 2EZKA 3WHBA 1CQTA 1X2NA 5EG0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3A01 B;  1MNM C;  4QSH A;  1ZTR A;  3OSF A;  1TC3 C;  1PUF B;  4AC0 A;  2YUS A;  1EF4 A;  4QTR A;  2FQ4 A;  4A3G J;  2HYJ A;  2XSD C;  2K9N A;  3LOC A;  3S1N J;  3TP0 A;  3ZQL A;  5F04 A;  5EDN A;  1WGX A;  1TWF J;  5C44 J;  3RZD J;  1G2H A;  5FKM A;  4Y52 J;  3CCY A;  5DS9 A;  4ABZ A;  3K2A A;  2O9L A;  5FKN A;  1WH7 A;  1ZR4 A;  4MFE A;  3BR6 A;  5M5W J;  4JX6 A;  2GM4 A;  1F43 A;  2MSY A;  1JKO C;  3HOX J;  3DCF A;  2NVQ J;  1WPK A;  3HM5 A;  3A01 A;  1T33 A;  3JRD A;  1PUF A;  3HGY A;  3PO2 J;  3QPS A;  1S7E A;  3H0G J;  4M3D A;  5IPA A;  1RR7 A;  1NK3 P;  1HDP A;  4D5F A;  4A3M J;  5GP9 A;  2VPR A;  4I6Z A;  2WV1 A;  4FIS A;  1FJL A;  2JMW A;  5FLV A;  1IC8 A;  2XB5 A;  2M34 A;  1BW6 A;  2JA8 J;  3S16 J;  1U8B A;  5BNG A;  1TWH J;  2JA7 J;  3S2D J;  1AU7 A;  2CRG A;  5EEA A;  3FK6 A;  3I4N J;  3E7L A;  1H88 C;  2R92 J;  3K7A J;  1W0U A;  5IOZ A;  3HBL A;  4B3A A;  2M8G X;  2XPW A;  5K7Z A;  2DMN A;  2R0Q C;  4RDU A;  4V2G A;  3S1Q J;  2EH3 A;  1ZQ3 P;  3B6A A;  2XPV A;  1NK2 P;  1ETK A;  2TCT A;  2DMT A;  2M2E A;  1K61 A;  1OJL A;  2H1K A;  2AO9 A;  2GLO A;  3RQI A;  1APL C;  1H8A C;  3IH4 A;  5F0H A;  1RKT A;  3I4M J;  1FIA A;  1JGG A;  2EZH A;  2HDD A;  1BJZ A;  2E2J J;  1ZR2 A;  1IJW C;  1HCR A;  1OCT C;  1IRZ A;  3G1L A;  4FE7 A;  2LY9 A;  3FIS A;  2FJ1 A;  4W97 A;  4FCY A;  1OFC X;  1MBE A;  3BG9 A;  4A3L J;  4A69 C;  2VUM J;  1GDT A;  3OIO A;  1YRN B;  2IEK A;  2ELK A;  1O4X A;  4M3E A;  1MH4 A;  1Q1V A;  2LKX A;  4CYC B;  3LSP A;  3W6V A;  2HQ5 A;  5M5Y J;  4XRS A;  2R93 J;  2O7O A;  3JRI A;  3MN2 A;  4A3K J;  4BKX A;  2DMP A;  5FKK A;  4V2F A;  3HDD A;  3FKI J;  4NDL A;  1MBF A;  2DA2 A;  2LK2 A;  4XK4 A;  3BT9 A;  1FIP A;  2R5Y B;  1LFB A;  2ECC A;  5J3L A;  5M3F J;  1FEX A;  3Q3S A;  2MW8 A;  1QVT A;  4DYR A;  5K7F A;  1UHS A;  5M5X J;  2JK3 A;  5J1U A;  3FIW A;  3BTL A;  4X1E A;  4XRS G;  1YRN A;  2RAE A;  3GTJ J;  2FD5 A;  1I3Q J;  1W0T A;  2MG4 A;  4CYC A;  2K40 A;  3QPL A;  1FTT A;  2NVT J;  1P7J A;  3HKZ N;  2ZB9 A;  1NTC A;  3A03 A;  1JKQ C;  4DZP A;  3DEW A;  4W1U A;  1SFO J;  4XRM A;  4AUX A;  5EYR A;  5EZH A;  2R5Y A;  2CUE A;  3ZQH A;  2QF7 A;  1GUU A;  2E2I J;  3BQZ A;  1IUF A;  3JRB A;  2E19 A;  3GTO J;  1HOM A;  1ZKG A;  2DA6 A;  4M3B A;  4UUT A;  4XID A;  2LFB A;  2XGC A;  3HOZ J;  5J1R A;  2VKE A;  2NOG A;  2IAI A;  4M6V A;  5C3E J;  2XRL A;  1Z0X A;  3JRH A;  1JKR C;  5E3M A;  5JLW A;  1IDZ A;  1WI3 A;  4M3F A;  3CMY A;  3ZQC A;  2P81 A;  3BR2 A;  3L1P A;  5E3N A;  3RKQ A;  3GTG J;  2EQR A;  3LSG A;  4A3I J;  2B63 J;  2DA4 A;  4IHV A;  3BG3 A;  3JRE A;  3OOU A;  2DN0 A;  4DW6 A;  1JJ8 C;  1SAN A;  1TWA J;  1IDY A;  2PMZ N;  3IV5 A;  1XC5 A;  1E3O C;  1RKW A;  1HF0 A;  3Q0W A;  5IYD J;  4DYQ A;  3LNQ A;  5IP6 A;  2XB0 X;  5DTD A;  3TP3 A;  3ZQG A;  2ECB A;  3GTP J;  1TWG J;  1I6H J;  4JP0 A;  1GV5 A;  1Y1W J;  1B8I B;  5C4X J;  2MGQ A;  1ENH A;  2DA1 A;  1B72 B;  3S2H J;  3LSR A;  4MFD A;  3PO3 J;  4MO7 A;  2DA3 A;  3GBG A;  4UUS B;  2DTZ A;  2HOT A;  4BXX J;  1U9N A;  2X6O A;  5J1Y A;  1HDD C;  3HOU J;  4S0H B;  2K9S A;  2M9H A;  5IYB J;  5EZG A;  4BBR J;  3JR9 A;  3GTK J;  4FE4 A;  3G1O A;  4LOC A;  1JUM A;  2H8R A;  4IHX A;  4MIM A;  4A3E J;  3CQZ J;  2LR8 A;  9ANT A;  4JX4 A;  4IHW A;  1WCM J;  5JLX A;  2M0C A;  2L7Z A;  1Z77 A;  2X48 A;  3S14 J;  1B8I A;  2DA7 A;  2ME0 A;  2HXI A;  5F0F A;  4XIC A;  3NAU A;  1B72 A;  2XPU A;  1ETQ A;  5EF6 A;  3RZO J;  3Q0V A;  4UUS A;  1VND A;  3BR0 A;  1JJ6 C;  2HI3 A;  3GTM J;  5K7H A;  1A6I A;  3O8G A;  4C3H J;  2Y9Z A;  1TWC J;  2I10 A;  2ID3 A;  3S17 J;  3HOY J;  3HOV J;  2WB1 N;  1MSF C;  4X6A J;  1AHD P;  3MVP A;  2CUF A;  2JN6 A;  5FJ8 J;  5C4J J;  3HGG A;  1U9O A;  5FKL A;  1I50 J;  1BA5 A;  4A3D J;  1DU0 A;  4Y7N J;  2DMU A;  4I76 A;  3VPR A;  3M3Y J;  2JJ7 A;  2LVS A;  1F36 A;  1JKP C;  5F0C A;  2CQQ A;  1ITY A;  2ID6 A;  1MBJ A;  3SJM A;  2Y30 A;  3JRF A;  4GFB A;  1R9T J;  4B4C A;  3BG5 A;  2NS7 A;  3HEF A;  1JT0 A;  5M3M J;  2EZL A;  3BTC A;  5FKO A;  5IP7 J;  2XGE A;  2LP0 A;  3C2B A;  2OF7 A;  4M3G A;  2LD5 A;  1U78 A;  1ZK8 A;  2Y2Z A;  2IBD A;  1UMQ A;  1X58 A;  3BR3 A;  1MSE C;  1Y1V J;  1MBH A;  1LFU P;  2Y31 A;  5IOY A;  2R5Z B;  1RPW A;  1ORK A;  2G0E A;  2TRT A;  2E1O A;  2DJN A;  2NVX J;  2W48 A;  1QPI A;  3ZQI A;  2X9D A;  3ZQF A;  4DYC A;  1AKH B;  3NAR A;  3BTJ A;  2KDZ A;  1JUP A;  2WAQ N;  3S1R J;  3UKG A;  5IP9 J;  2JA5 J;  4A3B J;  2L9R A;  2E2H J;  3WHC A;  4C3I J;  4D7N A;  3S1M J;  2NS8 A;  3OSG A;  1JT6 A;  1D5Y A;  5F27 A;  1QVU A;  1ETW A;  1LE8 B;  1FTZ A;  4AYB N;  2OPT A;  3TW7 A;  4D5C A;  3A02 A;  1QRY A;  1ZGW A;  2CU7 A;  2R5Z A;  2O8K A;  1K83 J;  3IH3 A;  1T56 A;  2Y0S N;  1VI0 A;  2HOS A;  4A3C J;  2CQX A;  2DMQ A;  1DU6 A;  2AHQ A;  2COB A;  3H3V K;  3JRG A;  4QIW N;  1A5J A;  3SDG A;  3F0C A;  3B6C A;  1OCP A;  5E3L A;  1XS9 A;  2ME6 A;  2HOA A;  4DZJ A;  1AKH A;  2L7M P;  4L5E A;  4D7M A;  4FTH A;  5GPC A;  1MBK A;  4BY1 J;  4EEF G;  2L7F P;  3MKL A;  3HOW J;  5EGO B;  1HLV A;  2GBY A;  2L0K A;  3GTL J;  1GV2 A;  1VF9 A;  3IH2 A;  5FLM J;  4BBS J;  3TED A;  3BR5 A;  2Y9Y A;  3JRA A;  3GTQ J;  3G1M A;  1X2M A;  1LE8 A;  4RBO A;  2K9Q A;  3FK7 A;  3TW6 A;  2JA6 J;  3BR1 A;  1GVD A;  2VI6 A;  5IYC J;  4A3F J;  1JTX A;  1MH3 A;  4A3J J;  1MBG A;  2EBI A;  3M4O J;  2KT0 A;  4JYK A;  5HOD A;  1ETV A;  1IV6 A;  5F1J A;  2YS9 A;  4B1R A;  2R7Z J;  3JRC A;  4J19 A;  3Q0U A;  1JTY A;  4IHY A;  4A93 J;  1BW5 A;  1IGN A;  4JX5 A;  1ETO A;  2LTP A;  2CJJ A;  5EG0 B;  3D1N I;  1ETY A;  3LSJ A;  5GPA A;  3ZOB A;  4MLO A;  3BTI A;  1JUS A;  3O8H A;  1GT0 C;  3CDL A;  1WH5 A;  2LLK A;  4C3J J;  2VKV A;  5EGO A;  1P7I A;  2YU9 J;  2XGD A;  3SFI A;  1BL0 A;  1IG7 A;  1XG1 A;  3QQA A;  4HNV A;  1RET A;  2HXO A;  2EZI A;  4C2M J;  2D5V A;  1VFC A;  4IEJ A;  3HB9 A;  5E3O A;  2DA5 A;  1POG A;  2NVY J;  1UG2 A;  3PM1 A;  2FX0 A;  2N8G A;  5F08 A;  4G12 A;  1ETX A;  2QCO A;  2JWT A;  3BQY A;  3S15 J;  1H89 C;  4BY7 J;  1RES A;  2EZK A;  3WHB A;  1CQT A;  1X2N A;  5EG0 A; 
#chains in the Genus database with same CATH topology
 2X51 A;  3A01 B;  1MNM C;  2XVC A;  4RGR A;  3OSF A;  1BIA A;  1PUF B;  4AVZ A;  5J8F A;  5ICG A;  4A3G J;  3QYB A;  1I3A A;  1BM9 A;  3QAH A;  3H36 A;  2DQL A;  2K4J A;  4BQN A;  5JI6 A;  3KP4 A;  3JSP A;  1MDM B;  4ZH4 F;  1B59 A;  3ASN H;  2VOD A;  1BC8 C;  2XHK A;  2EWN A;  2KQR A;  3CCY A;  4AVP A;  3M07 A;  3F8B A;  5CYV A;  1WI9 A;  3QYE A;  2O9L A;  2WTE A;  3P9C A;  3LWF A;  5CQG A;  2CO5 A;  2VC0 A;  1ZR4 A;  4RGS A;  1IXS B;  1LEB A;  5E1W A;  3SZT A;  2X6W A;  3C2H A;  1J7K A;  5L3B A;  4DGW B;  3L2R A;  3CCM I;  2NVQ J;  2JT1 A;  3A01 A;  2V79 A;  3ABK H;  2HQN A;  1FBQ A;  2W00 A;  1PUF A;  3PO2 J;  2XAQ A;  3P5J A;  2HVS A;  3FDY A;  3QPS A;  4KJZ A;  2ZNZ A;  5FLX Z;  2A5W A;  4M3D A;  1WJC A;  3D5L A;  1I39 A;  4UNO A;  3RPQ A;  4B3X A;  5J8C A;  2F5F A;  2FSW A;  1MDM A;  2HS5 A;  1FJL A;  1Z3X A;  4YEL A;  2JMW A;  2R7R A;  4HOB A;  5DM7 F;  1IC8 A;  3BC8 A;  2M4K A;  1T39 A;  1OCO H;  1M1E B;  1BW6 A;  1OMI A;  2WBM A;  3JCU C;  2QYO A;  4IOA F;  1R1V A;  4FQG A;  1AU7 A;  2PFB A;  2CUZ A;  3ELK A;  2L9S A;  2O0Y A;  4JBA A;  2L5Q A;  2MD0 A;  3TMO A;  1H88 C;  2PI0 A;  5CVI A;  1TNT A;  2H09 A;  3N97 A;  1BR4 A;  2B0L A;  1B4A A;  3NEU A;  4L9T A;  2H1L A;  2V6C A;  1GXP A;  4ZTJ A;  1FLI A;  2XV4 S;  5D8K B;  4ENM A;  1FYK A;  3R0A A;  3FXO A;  5K7Z A;  2R0Q C;  2XAS A;  4V2G A;  3IC7 A;  2IS6 A;  2EH3 A;  1ZQ3 P;  3B6A A;  2XPV A;  1ETK A;  2EFW A;  2P5K A;  2DTR A;  2AO9 A;  3HIF A;  4NNJ A;  4PJN A;  4Z2Y A;  2F48 A;  4M72 A;  2DFI A;  3GYH X;  3RQI A;  3DBL B;  1H8A C;  2OCC H;  3IH4 A;  3QPT A;  4UV9 A;  4CYD A;  3PSI A;  5F0H A;  2AXL A;  5B66 C;  1JGG A;  4OOI A;  2OD5 A;  4O3M A;  1YX3 A;  5HDN A;  1IUY A;  2E2J J;  1BIB A;  1IN6 A;  4RM2 A;  4WWC A;  3FF5 A;  1IRZ A;  1P6R A;  2V4J C;  4XKW A;  2M45 A;  1ZGA A;  3DF8 A;  4XLC A;  3CC2 I;  3AL0 C;  3OIO A;  4M71 A;  1YRN B;  2OUM A;  2KIQ A;  2CQK A;  3M8J A;  4M3E A;  2A6T A;  3OYG A;  1NHA A;  3Q9S A;  2LKX A;  1IF1 A;  1PVE A;  2CYY A;  2DBB A;  2OU2 A;  1KU7 A;  2O7O A;  2XF5 A;  4LD5 A;  1VQN I;  1TT5 B;  3CJN A;  4A3K J;  3SYT A;  4BXU A;  2KFD A;  4KIS A;  3OOP A;  1LVA A;  1DQU A;  2DMP A;  5FKK A;  2R7S A;  2DA2 A;  3K6G A;  2R5Y B;  3WE2 A;  1S8N A;  1QQI A;  3GO5 A;  1QHH D;  5AON A;  1ZRC A;  3HRU A;  3Q3S A;  1FEX A;  2MW8 A;  2IA1 A;  1UHS A;  5M5X J;  2CSO A;  5J1U A;  2HR3 A;  5LHH A;  4X1E A;  3K1P A;  1YRN A;  1Z7U A;  3GTJ J;  4ESJ A;  3L2Q A;  1MJ9 A;  2MLG A;  3OIQ A;  3ZMV A;  4CCO A;  1W7P D;  5FB2 A;  4A6E A;  1X1C A;  3WTU C;  1N25 A;  4IHS A;  1ZAR A;  5KK1 A;  2IT0 A;  4ZDO A;  3QPL A;  4RLF A;  3DV8 A;  2XAU A;  3DU5 A;  1K4T A;  2AS5 F;  3REO A;  1SEU A;  1LDD A;  1ON1 A;  2ZB9 A;  1NTC A;  2F6C A;  3A03 A;  1JKQ C;  1YYV A;  1TBX A;  2X85 A;  4DZP A;  3DEW A;  3EQL F;  3MFK A;  2ELJ A;  4G8X A;  4XRM A;  4AUX A;  3LSH A;  3WTV C;  3FHZ A;  2R5Y A;  1LJ9 A;  3FXK A;  3DLA A;  2ZFU A;  1MMD A;  5JFR A;  4RB0 A;  2V1D A;  4P96 A;  4BDY A;  3GTO J;  3GXO A;  1ZKG A;  4LB5 A;  2VJI A;  4PJJ A;  4XID A;  2CFO A;  2LFB A;  3KP6 A;  2VKE A;  2QBY B;  4IRH A;  2EFQ A;  2ZXJ A;  3KET A;  2Z33 A;  2ZBK A;  1Z0X A;  3S8P A;  3GME A;  5JHF A;  1OR7 A;  2PJR B;  4M3F A;  3CMY A;  3BRO A;  3BR2 A;  4XOT A;  4UB6 C;  4MQV A;  2H6C A;  1VQP I;  3GTG J;  4CSW A;  1QA6 A;  2ADU A;  4E7H A;  1VTN C;  2XRN A;  2EB7 A;  4MTD A;  1WFX A;  3TOB A;  4KMU X;  2KHM A;  3W2A A;  4BE0 A;  2FU4 A;  2H6B A;  3PL8 A;  2DN0 A;  1TWA J;  1IDY A;  2VC1 A;  2VQL A;  4IX7 A;  1FWZ A;  2QKM B;  2XF6 A;  1HF0 A;  4NHJ A;  3H92 A;  5IYD J;  4F55 A;  3EUK L;  1FP2 A;  2HQR A;  4OAY A;  4KDP A;  2QBY A;  3ZQG A;  3GTP J;  4JP0 A;  1EH8 A;  2EJR A;  4QLC U;  1SD4 A;  1YOV B;  2M5W A;  1XX5 A;  2NOJ B;  3I5U A;  4F52 A;  3TO7 A;  3SXY A;  3S2H J;  4C2U A;  2F5V A;  4MO7 A;  2PBI A;  3M1E A;  2PJR A;  1U9N A;  4I09 A;  4XOP A;  4RAG A;  4U0W A;  2W4S A;  4S0H B;  3CTA A;  1O7F A;  2KPM A;  2JUC A;  3V8K A;  2EIL H;  2HDW A;  4P1W A;  1K4S A;  3IAS 2;  2LF8 A;  4FE4 A;  3DU6 A;  4DJA A;  2ZME C;  3CJQ B;  5HVQ C;  4RB2 C;  1JUM A;  4PJM A;  5LBQ A;  1KQ9 A;  4S05 A;  1HW2 A;  4A3E J;  4IZZ A;  1J75 A;  2BZT A;  2LOO A;  3QU6 A;  3N4M A;  2WWY A;  1MNE A;  3LST A;  5E8I A;  1Z77 A;  2QSG X;  4A0X A;  3A1Y A;  1LUJ B;  4PGH A;  3K2Z A;  2J5O A;  3L2W A;  2MFZ A;  2XF7 A;  2M30 A;  1IRF A;  4OMZ A;  2A3S A;  3BR0 A;  1Z21 A;  1IO2 A;  1XD7 A;  2HI3 A;  3RCO A;  3F6O A;  5K7H A;  5DM6 F;  3ZXS A;  2Y9Z A;  2CWE A;  2ID3 A;  3CMA I;  5ICE A;  2LG4 A;  3OYM A;  1VQ7 I;  2NRA C;  2WB1 N;  4GGG A;  1MSF C;  3HOY J;  1ZAO A;  3WGI A;  3LFU A;  3ABM H;  2IGM A;  2D2W A;  1RI7 A;  4KMF A;  2JN6 A;  4HST A;  3LQR A;  5J47 A;  1RUN A;  2GXB A;  1N75 A;  1U9O A;  2OZU A;  2M7B A;  4L9J A;  3WU0 A;  3DLL F;  5EJC A;  2DFE A;  4IL6 C;  1IZ1 A;  1AWC A;  3UNG C;  3CCS I;  4E4H A;  1UAA A;  4XLE A;  3VPR A;  2WB1 A;  3V7S A;  4XKB A;  1F36 A;  1BR2 A;  1Z1D A;  2K27 A;  2VOP A;  1XMK A;  1WJE A;  3D0S A;  3SEZ A;  2F2E A;  2RGV A;  3SJM A;  2VE8 A;  2R7O A;  4B4C A;  2E1M B;  3QP5 A;  3HEF A;  3PNY A;  5M3M J;  1T95 A;  3HC7 A;  5D6E A;  5FKO A;  5IP7 J;  2XGE A;  3AG3 H;  2P7C B;  2HVQ A;  3KP2 A;  5HDG A;  3OYH A;  3HTS B;  1U78 A;  1YW9 A;  2IBD A;  4C9Y A;  1UMQ A;  1RZ4 A;  3R60 A;  4OWR B;  2R4G A;  4CH7 A;  4P9F A;  1FMV A;  1MSE C;  4HZF A;  1MBH A;  2QM3 A;  3U1D A;  1SD6 A;  1JGS A;  2FML A;  3FXJ A;  3GEZ A;  1RPW A;  3NRV A;  1G4D A;  2IA2 A;  3OR1 C;  4KIT B;  4IO9 F;  1CF7 B;  2VBY A;  4BL0 B;  4KIC A;  4HF0 A;  3T0Y A;  2CFX A;  4EAT A;  1WHU A;  3E6D A;  4E7Z A;  4PUS A;  2Z16 A;  4M9X A;  1O3R A;  4Y17 A;  3ZQF A;  3NAR A;  1S29 A;  5IT3 A;  3BTJ A;  2KDZ A;  2Z1D A;  1JUP A;  2WAQ N;  4LLN A;  1OCZ H;  2JA5 J;  2E2H J;  4XSX F;  3WHC A;  2GXA A;  3ZMD A;  2X1C A;  4OIO F;  3S1M J;  1FBU A;  2BHZ A;  4HEA 2;  1JT6 A;  2OTJ I;  1TW3 A;  3PJR A;  5GAD J;  5F27 A;  2LRE A;  5B1A H;  2MYS A;  4F92 B;  1LEA A;  1FTZ A;  3TW7 A;  2ESN A;  2MC4 A;  2KRC A;  1ZGW A;  3J80 K;  1J59 A;  4M6Y A;  4HF2 A;  2O8K A;  2QUF A;  2Y48 A;  1BC7 C;  1CF7 A;  1TP4 A;  2DMQ A;  2DW4 A;  2R7D A;  3SEQ A;  2COB A;  3PUB A;  3ONQ A;  4QIW N;  1OCR H;  3WE3 A;  3F0C A;  4XLF A;  2LH9 A;  1UHM A;  3ESW B;  4A5M A;  1ZRF A;  2MLK A;  1I1S A;  3MKL A;  2M8E A;  3H1C A;  4CHU A;  1X3U A;  2X6X A;  3IH2 A;  5JHU A;  4BBS J;  3TED A;  4N0B A;  3OYA A;  3J80 Z;  1TQP A;  2PQ8 A;  2CV0 A;  3SZP A;  3E5U A;  1T8I A;  2E1C A;  1MND A;  4UUV A;  1BI1 A;  3G4S I;  5IYC J;  1L0O C;  5FFZ A;  3OY9 A;  5E1X A;  4A3J J;  3QOD A;  1VQK I;  1ETV A;  2IJL A;  1ON2 A;  3BG6 A;  4CCK A;  4J19 A;  1PYV A;  3CLO A;  1H9T A;  3MKW B;  2CJJ A;  1Y6I A;  2QZ8 A;  3O8H A;  1KU2 A;  3CDL A;  1S3J A;  1P4W A;  4C3J J;  3DTE A;  1V5G A;  3W6K B;  3PNV A;  1XGN A;  5CQE A;  2YU9 J;  3LA2 A;  1IG7 A;  1VQO I;  3QQA A;  2EZI A;  4YIR X;  3Q9V A;  3AAF A;  3W6J B;  3HB9 A;  5E3O A;  4XMY A;  4RA2 A;  1UG2 A;  3E6B A;  5HLH A;  4B43 A;  2N8G A;  2VXZ A;  3AG2 H;  3H9G A;  1WKM A;  2BXY A;  4G12 A;  4ZZL A;  1JE8 A;  4PSW A;  4C2T A;  3OV8 A;  4UB8 C;  1SFX A;  2W84 A;  3H35 A;  1FX7 A;  2V7F A;  4I2O A;  1CQT A;  2NYX A;  2HKX A;  4EJO A;  1K78 B;  3JAM K;  1ZTR A;  3H5R A;  2F4M B;  2ZNY A;  2O5R A;  3OS1 A;  1X4P A;  2CGP A;  4E7J A;  2YUS A;  4L9N A;  3S3M A;  3CCQ I;  1IN7 A;  3VOE A;  1R36 A;  1DGW Y;  1HXD A;  1XN7 A;  1FZP B;  2XSD C;  2K9N A;  3ERM A;  2FXA A;  2CW7 A;  3LMM A;  4LGW A;  4ANJ A;  1LFP A;  2JTV A;  3KYD B;  3R0J A;  3KEO A;  2ZKZ A;  3M7G A;  3RZD J;  1G2H A;  1D1B A;  4LIU A;  5BPD A;  4Y52 J;  5DS9 A;  4ABZ A;  3HOS A;  3OYB A;  1YS6 A;  3I3L A;  3IUO A;  1WH7 A;  3JAM Z;  1LDJ A;  1V54 H;  2CUJ A;  2L4M A;  3BR6 A;  2IS2 A;  2XC7 A;  5F1R A;  2GM4 A;  5HS8 A;  1JKO C;  2A07 F;  3HOX J;  3IKT A;  1C0W A;  4WXH A;  2QKL B;  5GAH J;  1K78 A;  3HM5 A;  2WY7 Q;  1S9H A;  4E70 A;  2DOF A;  2XDV A;  3HGY A;  2GIZ A;  5DV5 A;  2DJI A;  3I55 I;  2ZXH A;  2F5D A;  2Q1Z B;  5HDK A;  4RB3 C;  1FYM A;  3DKX A;  1UJ8 A;  5GP9 A;  2GXG A;  1A6Q A;  3OYE A;  5DUK A;  3A2K A;  2CG4 A;  4QPO A;  2YX7 A;  3T8R A;  4BJT A;  3EYI A;  2CW0 F;  2AXT C;  2BW3 B;  2M34 A;  1IN4 A;  3JTH A;  3O6B B;  3ZMZ A;  2JA8 J;  3E6M A;  3LL7 A;  3B02 A;  1TWH J;  4UHT A;  5E17 F;  1YI2 I;  1X1A A;  4GRI A;  1YJN I;  1QBJ A;  2YU3 A;  5KCM A;  4DNC A;  3K7A J;  1W0U A;  3K69 A;  1X1D A;  4U7D A;  1YTY A;  5D5U B;  2VJJ A;  1NK2 P;  4N9I A;  1LQ1 A;  2DMT A;  1K61 A;  3WTT C;  3FBN B;  2RQP A;  3F8N A;  1E2X A;  3FXM A;  1BJA A;  4EJV A;  1APL C;  1F1Z A;  3I4M J;  5K5O A;  4F7Z A;  2EZH A;  2BW3 A;  1BJZ A;  4LIT A;  4O6J A;  4EV0 A;  1OYW A;  1IJW C;  3GF2 A;  4CCJ A;  2OA4 A;  3X2Q H;  2K9L A;  4M9Z A;  2ZSI B;  3G1L A;  5DEQ A;  1DGR M;  2LY9 A;  1B1B A;  2Z3Y A;  4BQQ A;  2QSF X;  2QGU A;  4A3L J;  5K1Y A;  2HGC A;  4A69 C;  3DFG A;  3LA3 A;  4LG3 A;  4RAF A;  1T38 A;  2A68 F;  1E17 A;  3CJT B;  2M1B A;  3ABT A;  2EA2 A;  4CO8 A;  1O4X A;  4YG2 F;  2HTS A;  2L9N A;  2X1E A;  4NC6 A;  1Y39 A;  3ROU A;  2RC4 A;  3W6V A;  2HQ5 A;  4XRS A;  2E36 A;  3PSF A;  5EEG A;  2ICW G;  2P4W A;  1P92 A;  4WK8 F;  2VAS A;  3O2P E;  2GQQ A;  5LHG A;  4V2F A;  4KT5 C;  1RIO H;  4NDL A;  2FOW A;  1IW7 F;  3BT9 A;  1O3S A;  5D5V B;  1FIP A;  2CQ7 A;  4KIF A;  3ABU A;  3I56 I;  5DD8 A;  4AM3 A;  2BYV E;  4OAZ A;  4ZYE A;  3GCM A;  2EIJ H;  1QVT A;  2CS3 A;  1T08 B;  2QQB A;  3C2G A;  3F72 A;  3LSK A;  5K7F A;  4I01 A;  4FHT A;  1OIS A;  2E5N A;  3T5X A;  4XRS G;  3E97 A;  4P55 A;  2ZC2 A;  2E5Z A;  3ZMS A;  3E1S A;  1MMS A;  3K70 C;  2ZJR F;  2IGO A;  1X1B A;  1FTT A;  2NVT J;  1P7J A;  2OTL I;  3AG4 H;  1P9Q C;  4KIG A;  1R4N B;  1XMA A;  1Y0N A;  1R23 A;  2G7H A;  4EM0 B;  2ACJ A;  2KIM A;  2CV2 A;  1I6X A;  3ECH A;  4BJ6 C;  2V9K A;  4FT8 A;  2QF7 A;  3BQZ A;  4BQO A;  4BGD A;  1TW2 A;  2X0L A;  3IRQ A;  3HZJ A;  3AFH A;  2QA4 I;  4CGZ A;  5J1R A;  2R7U A;  2JA2 A;  3MEX A;  5H2F C;  3H0D A;  3CO7 C;  1WJB A;  2GZW A;  2KZG A;  2DI3 A;  2HPI A;  4R8H A;  4M6V A;  4DBQ A;  1R22 A;  2E1M C;  3S2W A;  4UVA A;  1W4M A;  2ELH A;  3JTG A;  2P5L C;  1GVJ A;  5E3M A;  4E7L A;  3OS0 A;  1IDZ A;  1WI3 A;  2PN6 A;  1R4M B;  4RAY A;  1QPM A;  2LKP A;  3TL4 X;  1FPQ A;  2P81 A;  2DOE A;  2DLL A;  3J7Y J;  3LSG A;  4A3I J;  2P5V A;  1YO5 C;  2LMD A;  1O3Q A;  3TO9 A;  1XTA A;  4RLQ A;  4HRI A;  1VQM I;  1PP8 F;  2A69 F;  3OOU A;  1Z7L A;  4DW6 A;  1JJ8 C;  4L0Y B;  1SAN A;  2STT A;  5LRR A;  2A05 A;  2PMZ N;  4ENJ A;  3IV5 A;  1XC5 A;  3VYR B;  3BDD A;  1RKW A;  3Q0W A;  2FE3 A;  4HG2 A;  3S3O A;  2V1X A;  2XB0 X;  4GDF A;  1TWG J;  1GV5 A;  3FZV A;  1FP1 D;  3WU2 C;  2XAG A;  2RQQ A;  3BWG A;  1B8I B;  4UXN A;  2W1O A;  3HPH A;  2COM A;  2FF4 A;  4IOC F;  1B72 B;  2FNA A;  3GBG A;  4A0Z A;  4UUS B;  1R58 A;  2DTZ A;  1YW8 A;  2I8D A;  2M4G A;  3LAJ A;  2HOT A;  1EA3 A;  4BXX J;  5CVU A;  1Y8Q B;  4NC8 A;  5D4R A;  5ILS A;  3GWZ A;  1SFU A;  2K9S A;  5IYB J;  2OZ6 A;  5EZG A;  1PUE E;  1UG0 A;  3ERE D;  1A36 A;  3GTK J;  4N4N B;  5CVJ A;  2P0W A;  1XGO A;  4LOC A;  3HRS A;  1FOX A;  2H8R A;  1HA8 A;  4HNT A;  4C30 A;  2BV6 A;  2UXX A;  3WTY C;  3CQZ J;  2LR8 A;  3K4N A;  4G9Y A;  4ZYH A;  4JX4 A;  1WCM J;  5IY5 H;  3CCL I;  4PFP A;  1B9N A;  1B8I A;  1DDN A;  2ZJ2 A;  3EUH C;  4XIC A;  2JVG A;  1B72 A;  1MMG A;  3RZO J;  4UUS A;  1VND A;  4LB6 B;  3OMY A;  1K6O A;  4CZZ A;  3O8G A;  3HHH A;  1KYZ A;  3KYL A;  4BE2 A;  2K3F A;  3S17 J;  3BY6 A;  2QSH X;  1I5Z A;  4X6A J;  4ZTF A;  3MVP A;  2E71 A;  3OL3 A;  4YFK F;  3KLN A;  1JXS A;  2VT3 A;  3JW4 A;  1H9G A;  3WTW C;  3HGG A;  2GOM A;  2E35 A;  2R3S A;  4Y13 A;  1S6L A;  2TDX A;  2HOE A;  5CJ9 A;  1BA5 A;  3RPU A;  2RKH A;  4WXC A;  2XAH A;  4GYG A;  2LVS A;  3J7Z I;  1LKX A;  2CQQ A;  3FHN A;  2RRE A;  5FD6 A;  3D5S C;  3OYN A;  2FNP A;  4ENK A;  2Y30 A;  1TTY A;  1MGT A;  4GFB A;  3C3W A;  3BG5 A;  2NS7 A;  2QWW A;  1W1W E;  3DBR B;  4HX8 A;  3BJ6 A;  2OV7 A;  4XM3 A;  4PFO A;  2WY8 Q;  4ESF A;  4CCN A;  4L0Z B;  1Y0U A;  2Z99 A;  4IRI A;  4OIN F;  2LP0 A;  4M3G A;  2LD5 A;  4I99 C;  2VJ5 A;  1ZK8 A;  4LFU A;  3GFI A;  1P2F A;  4AIK A;  5ILU A;  3R6S A;  1BI2 A;  4PZJ A;  5HLT A;  5KVR A;  3BR3 A;  4EJW A;  1Y1V J;  5LGN A;  1LFU P;  2DXI A;  2Y31 A;  2R5Z B;  3U9G A;  3OYJ A;  1ORK A;  2BVL A;  2WV0 A;  2YX4 A;  3VYS B;  2E1O A;  2C6Y A;  2DJN A;  4YFN F;  5JVT A;  2X9D A;  4XRF A;  3WTZ A;  5GAG J;  3ZMU A;  3VB2 A;  1FOY A;  2V6E A;  4IXA A;  1U5T C;  2ZO4 A;  5IP9 J;  4B48 A;  3UKG A;  4C3I J;  4D7N A;  4KNY A;  3BZC A;  2NS8 A;  3L2V A;  4XKV A;  1QVU A;  5E18 F;  3KZZ A;  1P4A A;  4M6X A;  4HQM A;  1V5F A;  2VN2 A;  1LE8 B;  3LAP A;  5GTI C;  1KGS A;  3A02 A;  3I53 A;  1QRY A;  4BS9 A;  1H0M A;  4EJU A;  1BOA A;  5TGT A;  2LC2 A;  3F6V A;  4U0Y A;  2IGN A;  2CU7 A;  2R5Z A;  1G6N A;  1LDK B;  1X3W B;  2WAD A;  4D0P A;  5GAE J;  3RI4 A;  1T56 A;  2BE5 F;  2Y0S N;  1VI0 A;  2HOS A;  2CQX A;  3WGH A;  4HA8 A;  1Z9C A;  3VDX A;  2AHQ A;  4YII A;  3H3V K;  2LY2 A;  2D45 A;  3B6C A;  1V3F A;  1XS9 A;  2HKO A;  2L7M P;  5KAI C;  2BY2 A;  2ETH A;  2YPR A;  3HTU A;  1QHG A;  3QRF F;  4EEF G;  2KJB A;  4IQ4 A;  2EIK H;  3HOW J;  2VON A;  3B73 A;  3E5X A;  3KPH A;  3KE2 A;  1GV2 A;  4ZYG A;  5FLM J;  2VOO A;  1OKR A;  1TZL A;  1IN8 A;  1B9M A;  2AQF A;  1YG2 A;  3DKW A;  1VZ0 A;  2KIF A;  2JUG A;  3G1M A;  3GTQ J;  1LE8 A;  4RBO A;  4IPA A;  3IRR A;  2K9Q A;  1FT9 A;  4N4O B;  3DWL E;  2VI6 A;  4B44 A;  3VYT B;  3MQ0 A;  3KYC B;  3COA C;  4I98 B;  1MH3 A;  5IT9 K;  1MBG A;  3M4O J;  1D1C A;  5F64 A;  4JYK A;  4ZDL A;  5D6F A;  2L4A A;  3FX3 A;  1ZEL A;  2R7Z J;  3IKV A;  3BP8 A;  2AQE A;  3JRC A;  3Q0U A;  4HPQ A;  2JVH A;  4IHY A;  5H6Q A;  2L9V A;  3KLO A;  1OYY A;  1U0J A;  2LTP A;  3CUQ B;  4XL9 A;  3HL2 A;  2LBF B;  3I54 A;  2LKS A;  3GFL A;  3BTI A;  1GT0 C;  3HG9 A;  2LSO A;  2W57 A;  4AIJ A;  2K5C A;  5LLQ A;  3FWE A;  5HOO A;  1ZG3 A;  2VKV A;  1R6R A;  1YJW I;  1P7I A;  2W25 A;  3IP4 B;  1XMX A;  4YRV A;  3SFI A;  2HWV A;  1XCV A;  1RET A;  4C2M J;  2XAF A;  4IEJ A;  1PJR A;  5IT9 Z;  2NVY J;  4MGR A;  2FX0 A;  4FAS D;  3PUF A;  3BJO A;  1EH7 A;  3GW2 A;  3SHF A;  1MMN A;  1N77 A;  1H89 C;  3U21 A;  3VFZ A;  1RES A;  1VQL I;  2NS0 A;  2EZK A;  3M9A A;  2B9S A;  3TQN A;  3RKY A;  4RS8 A;  3RIR A;  1CGP A;  3EET A;  4YFX F;  1X2N A;  4LLL A;  3CUQ A;  4JOM A;  2OBP A;  1ZGJ A;  2DFH A;  1E3H A;  2LBF A;  1DP7 P;  4UVC A;  3G73 A;  1EF4 A;  3RYR A;  1WJ5 A;  4QTR A;  2FQ4 A;  3F23 A;  4U88 A;  1K6Y A;  3MKZ A;  4WF2 A;  3MAJ A;  3FXL A;  2VXD A;  4ETS A;  4PGG A;  5F04 A;  1TWF J;  3ZQ7 A;  4XOR A;  4S04 A;  3V8J A;  2M0M A;  5FKM A;  1ZRD A;  5KNL A;  3K2A A;  1WJD A;  5FKN A;  3RDI A;  3LA7 A;  5J6X A;  1FSE A;  4JX6 A;  2O3F A;  4CCM A;  4DQ2 A;  2LNB A;  4DOZ A;  2X1D A;  3DCF A;  2GWR A;  5BPI A;  2W7N A;  4Y3O A;  3OYF A;  3JRD A;  1R00 A;  4EGZ A;  2ZFW A;  4XLH A;  3QOE A;  4X0G A;  2XAJ A;  2VBW A;  2WAF A;  2OJE D;  5TJJ A;  3H0G J;  5LGT A;  3KFW X;  1QZY A;  5IPA A;  1KQ0 A;  3VOD A;  1NK3 P;  2JQ7 A;  3MD2 A;  4A3M J;  4D5F A;  1YIT I;  2CMP A;  2EPF A;  1LPQ A;  1F4K A;  2WV1 A;  2FEZ A;  3EYY A;  3OYK A;  1TQM A;  2WAQ A;  1Z05 A;  1U2W A;  2MH9 A;  4L9V A;  5B1B H;  1FSH A;  5KHD A;  2K3P A;  3EDP A;  3S16 J;  1U8B A;  3M8E A;  3I58 A;  2ZJP F;  2BY3 A;  2EIN H;  3S2D J;  4I0B A;  4HLY A;  5EEA A;  1WJA A;  3CDH A;  1BOB A;  3CES A;  2IGK A;  5L3G A;  2R92 J;  2P6T A;  1SMY F;  2M8G X;  4FET A;  2DFF A;  2XPW A;  3ABL H;  3DKY A;  3DXJ F;  3GZN B;  2ISY A;  3OS2 A;  2DMN A;  4RDU A;  4J01 A;  3S1Q J;  3CC7 I;  4ZJZ A;  2TCT A;  1OJL A;  4N9H A;  3PIP F;  2H1K A;  2GOX B;  2VIX A;  3TO6 A;  3F8C A;  2DK8 A;  5DCM B;  2GLO A;  3G71 I;  3IAM 2;  4WX9 A;  1XSD A;  3ZP5 A;  1FIA A;  4PJ0 C;  2HDD A;  4EM1 A;  4DBR A;  3J81 K;  3RPU D;  4KIB A;  5HLI A;  1HCR A;  4MHG A;  3ASO H;  1WSU A;  4A6D A;  1O3T A;  2X6Y A;  2FJ1 A;  4W97 A;  4FCY A;  1OFC X;  1MBE A;  3BG9 A;  3EUH A;  1UFM A;  3E3V A;  1HST A;  4O5V A;  2FBI A;  3KCC A;  3F8F A;  3FMQ A;  3BCB A;  4BEH B;  1Q1V A;  3LSP A;  1F5T A;  1A35 A;  2F4O B;  2R93 J;  4F93 B;  2RV8 A;  3QYF A;  1HKQ A;  2HPM A;  4BKX A;  3J81 Z;  2K85 A;  3FXU A;  1GLN A;  5DCM A;  2DPD A;  3HDD A;  2IPQ X;  3DEU A;  3FKI J;  4GYI A;  3RTR A;  2RN7 A;  1LB2 A;  1EH6 A;  3DBH B;  4HSR A;  3LSI A;  2ECC A;  2RDP A;  5LHI A;  4LK0 F;  3CJR B;  5M3F J;  5E20 A;  4Q48 A;  1TL8 A;  4DYR A;  1XGS A;  1T98 A;  5BQT A;  4LIV A;  2KKO A;  1AA7 A;  5DDG A;  3FIW A;  1YX5 A;  2L2O A;  1QU3 A;  2ZXI A;  3L09 A;  2K9M A;  3FM5 A;  1K79 A;  1W0T A;  2BEO A;  1U5T B;  2KJC A;  4BEH A;  3GLL A;  3CP8 A;  2K40 A;  3NWT A;  5KAF C;  2W24 A;  3EPZ A;  1FC3 A;  4OMY A;  1OCC H;  3DP7 A;  3LSM A;  2PJP A;  3HKZ N;  4J00 A;  4BUP A;  2LY1 A;  5FO5 A;  4BAY A;  1Z67 A;  2F5C A;  2Z5U A;  3CCJ I;  5EZH A;  2JSC A;  3SFZ A;  3DTK A;  3GUD A;  2DAO A;  1W5S A;  3JRB A;  1AOY A;  1DP3 A;  2VKH A;  3A0H C;  4M3B A;  4Q5S F;  2XGC A;  5K5R A;  4MNU A;  1WJF A;  5J40 A;  2V9P A;  1OQY A;  2NOG A;  2Y75 A;  3HPG A;  5C3E J;  2XSJ C;  1U5T A;  2XRL A;  3L2U A;  4XSZ F;  4DIQ A;  2L01 A;  2DCE A;  3JRH A;  4OIP F;  1KA8 A;  4MQ9 F;  3BG7 A;  1V5E A;  1X19 A;  2HQA A;  2JPC A;  4NB5 A;  3L1P A;  4KFC A;  1KU3 A;  5E3N A;  3RKQ A;  1Z3Y A;  2Z2S B;  1S72 I;  4BHP A;  4XQF A;  3KX2 A;  3MKY B;  2V9V A;  3MWM A;  2ZCW A;  3BG3 A;  3JRE A;  2Y69 H;  2EFN A;  4G7H F;  1WQ2 A;  4KUM A;  5D8L B;  1G3W A;  1ZG5 A;  5LFA A;  1D5V A;  3OYI A;  1E3O C;  2VKD A;  4BHC A;  4DYQ A;  4HW0 A;  5ICC A;  3LNQ A;  3TP3 A;  1ACI A;  3I71 A;  4IVN A;  1I6H J;  1WWX A;  3W3C A;  1HBX G;  1REP C;  1W36 D;  1Y1W J;  5C4X J;  3CZ6 A;  2MGQ A;  1ENH A;  2E1N A;  3K1M A;  3V8L A;  5J4Y A;  3LSR A;  2D1H A;  1BR1 A;  4UY8 I;  2DA3 A;  4IF4 A;  1R5G A;  3K9T A;  2VQH A;  2BY1 A;  3GZ6 A;  1TQI A;  1HDD C;  1BBY A;  5TIS C;  3K1N A;  4PDK A;  2MBF A;  3CF5 F;  4BBR J;  1KQ8 A;  1J5Y A;  4RGU A;  5CKT A;  3G1O A;  1WRJ A;  1VQ9 I;  4BAC A;  3V4G A;  1DUX C;  4CIC A;  3K70 D;  4XBF A;  2M0C A;  2L7Z A;  1HKT A;  2X48 A;  2Q2E B;  2DA7 A;  1IXR C;  4G94 A;  2IXS A;  3ZGK A;  1W36 C;  2VBZ A;  2BBY A;  2KLO A;  3NAU A;  3DPU A;  2XPU A;  1ETQ A;  4F3Q A;  5EF6 A;  1MIJ A;  3ZRG A;  2LDU A;  4RMN A;  1JJ6 C;  3GTM J;  2VPL A;  3ZQQ A;  3R4K A;  2ZSH B;  4C3H J;  1TWC J;  2I10 A;  2R7V A;  3T1B A;  4B47 A;  1XCB A;  2PEX A;  4ASN A;  3GLX A;  1X1P A;  1Q1H A;  3L9F A;  1G59 A;  4A2U A;  5FJ8 J;  2EK5 A;  1ZLJ A;  1SMT A;  4Y33 A;  2PG4 A;  2MA3 A;  1PDN C;  2J5P A;  4A3D J;  1YIJ I;  1DU0 A;  4H0E A;  2K7L A;  2DMU A;  2M7A A;  3M3Y J;  2KL4 A;  2JJ7 A;  1JKP C;  5EEH A;  4BJ5 C;  3I59 B;  3CUQ C;  2Q0O A;  1IRG A;  1ITY A;  2Q2E A;  3OYL A;  1MBJ A;  3CME I;  3ZCO A;  4HDV A;  1FBS A;  1J2X A;  2DYS H;  3V7R A;  1BN5 A;  5TRD A;  1S7A A;  2M87 A;  2EV5 A;  2DT5 A;  3ML6 A;  1JT0 A;  3BTC A;  2DDB A;  2LYC A;  2RNG A;  1HQC A;  2O6G E;  3F8M A;  4OIQ F;  2OF7 A;  4B09 A;  1YQA A;  1X58 A;  2NVU B;  2KRH A;  1SFE A;  2VB6 A;  4JK1 X;  4E6K G;  1U3E M;  5FRO A;  3KP3 A;  2E34 A;  5FLX K;  3TDU C;  3CUO A;  5IOY A;  3K4C A;  2GIV A;  2L7K A;  2UV1 A;  2VLA A;  1IRX A;  1O57 A;  2TRT A;  2P6S A;  3NQO A;  1W5T A;  3K4J A;  4G6Q A;  1GHC A;  5E79 C;  2H27 A;  3CD6 I;  4XLP F;  3I59 A;  1KZH A;  1QO0 D;  2NVX J;  6PAX A;  1QPI A;  3ZQI A;  3HOT A;  2VQC A;  2K02 A;  3ZN0 A;  4DYC A;  1AKH B;  1D1A A;  1MW7 A;  3I9V 2;  3CDI A;  3L7W A;  3BCA A;  3S1R J;  1NG7 A;  2XRO A;  4A3B J;  2L9R A;  3MZY A;  3MZ8 A;  3C7J A;  1YHQ I;  2L3D A;  3S93 A;  4AWX B;  1D5Y A;  2PMU A;  4BYY A;  4HYE A;  3TKY A;  1ETW A;  3S32 A;  3VWB A;  2JRT A;  1F9N A;  2BGC A;  2OPT A;  2W82 A;  2FMY A;  3E6C C;  1R7J A;  2R7Q A;  1RNL A;  4HX7 A;  5L3D A;  2NAZ A;  3KP7 A;  3WG9 A;  3MZH A;  3IH3 A;  4IRG A;  1UHW A;  4BHB A;  4A3C J;  1L3L A;  4ZYD A;  2P8T A;  3JRG A;  2BY0 A;  4ITV A;  3SDG A;  1ULY A;  2PMZ A;  1OCP A;  1Z6T A;  5E3L A;  3F3X A;  3WGG A;  2ME6 A;  2BXZ A;  2HOA A;  1AKH A;  5B5E C;  4RAZ A;  3WTS C;  4D7M A;  4FTH A;  2HYF A;  1KON A;  4FX4 A;  4ENN A;  2L7F P;  2M3A A;  5EGO B;  1V4R A;  1HLV A;  3HRM A;  1S7O A;  2L0K A;  4H4K C;  3GTL J;  3KP5 A;  1YE9 A;  1ERD A;  4G6T B;  2I5U A;  2FBH A;  3BR5 A;  2MD5 A;  2GA1 A;  4XKC A;  1A04 A;  4U7B A;  1NH3 A;  3FK7 A;  3R61 A;  1UB9 A;  2G9W A;  3BR1 A;  5HS9 A;  1R49 A;  1FNN A;  4BXF A;  1YS7 A;  1MZB A;  2X4H A;  4IQJ A;  1JTX A;  1DPR A;  2D1V A;  2EBI A;  4MEX F;  5BOX A;  5F6F A;  5HOD A;  1T0F A;  3FMR A;  3RJP A;  1IV6 A;  5F1J A;  2YS9 A;  3I0T A;  1XDS A;  4A93 J;  1IGN A;  5EG0 B;  1ETO A;  2OAZ A;  2PX9 A;  3V7C A;  3D1N I;  1ETY A;  4ON0 A;  5GPA A;  3ZOB A;  4MLO A;  4BDZ A;  2E7X A;  1JUS A;  5E1Z B;  1SC7 A;  1WH5 A;  2DQR A;  3AKZ A;  1YLF A;  5EGO A;  3M1C A;  3MMY B;  5ICF A;  2CH0 A;  2D5V A;  1VFC A;  4A0Y A;  1J9I A;  4OIR F;  2DA5 A;  4CCL A;  1POG A;  4HX4 A;  2CQN A;  2IVM A;  2FA5 A;  2NNY A;  3PM1 A;  3FMS A;  4EMS A;  2STW A;  5LGU A;  4QWQ A;  1O7L A;  3CLQ A;  3CCU I;  2QEN A;  4G6D A;  3BQY A;  2VL8 A;  3GFM A;  2W85 A;  3OYD A;  3F21 A;  3DPT A;  4LMY A;  1JHH A;  3W2V A;  2Y0M A;  1ZH5 A;  2QQA A;  1FY7 A;  3TOA A;  1VQ5 I;  1JHF A;  3M8F A;  4HAM A;  2UUZ A;  4AIH A;  3RKX A;  5EG0 A;  4WXD A;  2EV6 A;  4QSH A;  3KEQ A;  1BI0 A;  1TC3 C;  2PMH A;  1MKM A;  4IHT A;  4AC0 A;  2XIG A;  2LF7 A;  2HYJ A;  1SFK A;  3H5A A;  3LOC A;  3WTX C;  3U1K A;  2CW8 A;  4CZC A;  4LG0 B;  1V55 H;  3S1N J;  3TP0 A;  4R79 A;  4XON A;  1B6A A;  3ZQL A;  4ZDP A;  1WGX A;  5EDN A;  3IWF A;  2KRF A;  5C44 J;  1STZ A;  2FBK A;  2XUB A;  3W2W A;  3L2C A;  4HF1 A;  1Y8R B;  4P5O A;  2H8W A;  4PK4 A;  1KYW A;  1HKS A;  4MFE A;  4P9U A;  4L5J A;  4EQQ A;  3NWS A;  5M5W J;  1F43 A;  3HYI A;  1LVK A;  2MSY A;  2HDC A;  4V19 K;  3AG1 H;  2HNH A;  3HJE A;  1WPK A;  2OC6 A;  1EV7 A;  1MD0 A;  4AD9 A;  1T33 A;  1HW5 A;  1R1U A;  1R1T A;  4A12 A;  3QOP A;  1S7E A;  2DDA A;  3ZPL A;  2MC3 A;  3K0L A;  1IAW A;  3K4K A;  1RR7 A;  1X3Z B;  2XKP A;  4LG0 A;  1HDP A;  2IA0 A;  5ED4 A;  2DK5 A;  2O8X A;  3WG7 H;  5L3C A;  2R7T A;  2VPR A;  4I6Z A;  2K4B A;  2YSR A;  4E7I A;  4FIS A;  5FLV A;  4G7O F;  2NNN A;  3E0J B;  2XB5 A;  3GZ5 A;  5CVV A;  3VSK A;  5L3E A;  3DTI A;  2R7X A;  5BNG A;  1XSX A;  2JA7 J;  1D8K A;  3BJA A;  3MCZ A;  5DCF A;  2CRG A;  4U87 A;  3FK6 A;  2O61 A;  3I4N J;  3E7L A;  1J0R A;  3G2B A;  1E0E A;  1NG6 A;  5CLS A;  5IOZ A;  3HBL A;  3D5R C;  4B3A A;  1J09 A;  4G7Z F;  2V1N A;  2Y0S A;  3P7N A;  1OPC A;  4IKF A;  4HBL A;  2QVO A;  5FD5 A;  3CCR I;  1TT0 A;  1G3T A;  1QNT A;  2EFP A;  2M2E A;  1XB4 A;  5FRN A;  1K7A A;  4XN0 A;  3OWT A;  1HSJ A;  3J7A O;  3SQN A;  4XNF A;  4I02 A;  4QPQ A;  2L02 A;  1FOK A;  4E7K A;  1RKT A;  3CCV I;  3FM3 A;  3KZY A;  1D0X A;  1ZR2 A;  2H94 A;  1OCT C;  3A4C A;  4FE7 A;  1I27 A;  5CPR B;  1IV8 A;  3FIS A;  2QEX I;  2IP2 A;  2NXN B;  3O3K A;  1ODD A;  1EJ9 A;  4NC7 A;  4XN3 A;  2VUM J;  1GDT A;  2IEK A;  2UXN A;  1Z6R A;  2UZK A;  2ELK A;  3DEE A;  4AID A;  1MH4 A;  5D5W B;  4CYC B;  2FUG 2;  5M5Y J;  1VQ6 I;  3BPX A;  1HW1 A;  2K86 A;  3JRI A;  3HRT A;  3MN2 A;  3L00 A;  1R5H A;  1IXC A;  1G3Y A;  3CF2 A;  1R71 A;  2DYR H;  1MBF A;  2A61 A;  2LK2 A;  4E7S A;  4XK4 A;  5A2Q K;  2BOL A;  2ISZ A;  1LFB A;  3LFK A;  3Q5F A;  5J3L A;  2GAU A;  4LJZ F;  3GFJ A;  2VE9 A;  2HEO A;  2JK3 A;  2WA0 A;  4CA0 A;  1OYI A;  2R7F A;  1MJA A;  2Z9O A;  3BTL A;  5D4S A;  2RAE A;  2EFO A;  1I3Q J;  2A6E F;  2FD5 A;  4KT6 A;  4LLG F;  2QQ9 A;  2MG4 A;  5FRM A;  4LK1 F;  1IN5 A;  1EKE A;  2RNJ A;  4CYC A;  1ZYR F;  4Q4Z F;  3VSL A;  5A2Q Z;  2QLZ A;  4GO1 A;  3TDZ C;  4L18 B;  2DOA A;  1VQ8 I;  1ZLK A;  2OQG A;  2BHY A;  2MH2 A;  3H9Q A;  4W1U A;  2HYG D;  2KIU A;  5AIP A;  1ZN2 A;  1SFO J;  2FOK A;  3OYC A;  5EYR A;  3E5Q A;  3RSN A;  1E3P A;  2IRF G;  2CUE A;  4K2E A;  3ZQH A;  1GUU A;  2E2I J;  4NBQ A;  1IUF A;  2ESH A;  4XR6 A;  3K4L A;  2E19 A;  1HOM A;  2DA6 A;  4UUT A;  4ZZD A;  4A5N A;  5CVR A;  3HOZ J;  4II2 A;  1YW7 A;  3T8T A;  1MMA A;  4HNU A;  4KYW A;  1FOW A;  3ZMT A;  3CO6 C;  2KMU A;  2IAI A;  4AU7 A;  2IS1 A;  4KN7 X;  3ZN1 A;  2KP6 A;  3BPV A;  4EM2 A;  5JLW A;  1JKR C;  2EV0 A;  2XKO A;  4ZYA A;  1G8X A;  1WZ2 A;  2Q8K A;  3ZQC A;  1YIO A;  1MJB A;  3QPH A;  1UZC A;  2VQG A;  3VEP A;  1QZZ A;  4M73 A;  5ERI A;  2EQR A;  5DUI A;  2HFH A;  2WC2 A;  1ZG1 A;  1U8R A;  4EVI A;  2B63 J;  2DA4 A;  1LNW A;  3QU3 A;  5BMZ A;  4IHV A;  3VYU B;  4HV6 A;  4Y4R A;  1RR8 C;  4MEY F;  3RKW A;  3PFY A;  4R1H A;  1VQ4 I;  3HUG B;  4UVB A;  5DD4 A;  1T2K A;  3UR3 C;  5LEJ A;  3PQJ A;  3C18 A;  5IP6 A;  1ZHF A;  3I64 A;  5DTD A;  1SVM A;  2ECB A;  5AIQ A;  4B8X A;  4RM3 A;  1FYL A;  2B7E A;  2OQR A;  3AL0 B;  4NQW B;  3K4B A;  2V1U A;  4GCV A;  3PNT A;  2DA1 A;  3DPL C;  4MFD A;  3PO3 J;  1USS A;  4HV5 A;  4OU0 A;  2VJ4 A;  4U0V A;  4PJL A;  2X6O A;  5J1Y A;  4BQA A;  3HOU J;  4Q47 A;  2QQ8 A;  2WAE A;  2A5Y B;  2M9H A;  1ONV A;  2KZV A;  3JR9 A;  4EGY A;  2DOD A;  2DO7 A;  1ZRE A;  5BS6 A;  3HUG A;  4L5I A;  4IHX A;  4MIM A;  3WU1 B;  1T0F C;  1DPU A;  4BE1 A;  1OLT A;  9ANT A;  2VT2 A;  3C1D A;  4IHW A;  4M9S A;  1D3Y A;  5JLX A;  3HSF A;  2A6H F;  1KU9 A;  1QZE A;  3S14 J;  4NQW A;  2ME0 A;  2HXI A;  3K10 A;  2BVM A;  3ECO A;  5F0F A;  4HDU A;  5HNH A;  1SD7 A;  1SVL A;  3Q0V A;  4Z6Y A;  1A6I A;  3P9I A;  3ULQ B;  4RGX A;  1XPX A;  2JPB A;  2CV1 A;  3HOV J;  1AHD P;  2GA2 A;  4JQF A;  4CDG A;  2CUF A;  3H5N A;  3K4M A;  5C4J J;  1SAX A;  5FKL A;  3LQQ A;  2MAB A;  2VBX A;  2JRM A;  1I50 J;  1P4X A;  4IJA A;  4NUB A;  2O03 A;  5LRS A;  3S3N A;  4Y7N J;  4I76 A;  1UCR A;  5DYM A;  2UWM A;  2E60 A;  3WOD F;  5F0C A;  3F9K A;  4BU2 A;  1HC8 A;  2ID6 A;  1XGM A;  4EJT A;  4Y15 A;  4UV8 A;  4XLA A;  1WVR A;  3JRF A;  2F5E A;  1R9T J;  1A31 A;  3HHG A;  1JI8 A;  4RB1 A;  1W7P B;  2EZL A;  5GTH C;  1S5L C;  2XGX A;  4YEJ A;  4PSX A;  3FKJ A;  2DT6 A;  5H6R A;  3BLY A;  1X4O A;  5LEK A;  2HVR A;  3C2B A;  4F91 B;  1UEL B;  3A0B C;  2Y2Z A;  3F22 A;  3SDB A;  4II3 A;  3DQV C;  4WCG A;  1Z91 A;  3SZG A;  4M74 A;  3TBI A;  3ZR8 X;  5FFX A;  1R5I D;  3GX4 X;  1RUO A;  3I4P A;  5JR3 A;  3HKZ A;  3H9J A;  3ISP A;  5HLG A;  1T6S A;  2DT7 B;  3H3U A;  3CCE I;  1UST A;  5HS7 A;  2G0E A;  4D9J A;  2E7W A;  1YFH A;  2IS4 A;  2FQ3 A;  5L3F A;  2KIS A;  2W48 A;  3GVA A;  3HSR A;  2HZD A;  4CUG A;  4YIF A;  1SD5 A;  2V26 A;  3KIO A;  3FBI B;  1W7P A;  1QGP A;  5FGM A;  3BZ6 A;  1D8J A;  3OIP A;  1BI3 A;  2HU9 A;  3OSG A;  1OR7 C;  3V42 A;  3JSO A;  1D0Z A;  3BOQ A;  3IWZ A;  3CP2 A;  2DU9 A;  2ZXW H;  4GXO A;  4AYB N;  3PQK A;  4D5C A;  2OCE A;  2F4I A;  4CXF A;  1SVO A;  1PP7 U;  2ZME B;  1XDU A;  4PCQ A;  4MTE A;  1K83 J;  3G6E I;  3J7A Y;  3IL2 A;  3FXQ A;  4I7H A;  1DU6 A;  3BZK A;  3IHU A;  2YR2 A;  4HLX A;  1A5J A;  4AYB A;  3CMM A;  4DZJ A;  2JSP A;  1G3S A;  1D0Y A;  3HXL A;  3CC4 I;  4L5E A;  1GXQ A;  5HNF A;  5GPC A;  1MBK A;  4BY1 J;  4XLN F;  3TGN A;  1N78 A;  3OR2 C;  3PIO F;  2JZY A;  2GBY A;  2KDO A;  1I1G A;  1VF9 A;  3HSE A;  1TLH B;  2Y9Y A;  3JRA A;  3OL4 A;  1FMW A;  1X2M A;  4BNC A;  1YJ9 I;  2L54 A;  3TW6 A;  2JA6 J;  1GVD A;  3RYP A;  4A3F J;  2ZME A;  5ILV A;  2IW5 A;  2KT0 A;  3FXR A;  4TV7 A;  4B1R A;  3G3Z A;  2LRD A;  2HZT A;  1JTY A;  1BW5 A;  1Y56 A;  5JVG F;  4JX5 A;  3N05 A;  4FX0 A;  3LSJ A;  5H20 A;  1U6G A;  3QWL A;  4BH9 A;  4D1Q A;  2PLY A;  2LLK A;  2EIM H;  5D5X B;  2P7V B;  2FRH A;  3U2R A;  1RC9 A;  4ESB A;  5B3S H;  2RVC A;  2XGD A;  1BL0 A;  3PFI A;  1XG1 A;  3RQ4 A;  4HNV A;  2HXO A;  4KA4 A;  2ZJQ F;  1SAU A;  3P9K A;  5LD2 C;  4KN4 X;  5E8G A;  3H3Z A;  3KZI C;  5K5Q A;  2HTJ A;  4I0A A;  5F08 A;  1ETX A;  2QCO A;  2JWT A;  4HQE A;  3S15 J;  3KEY A;  4ZC3 A;  2G7U A;  4BY7 J;  1RRJ A;  3QP6 A;  1W5C C;  3WHB A;  1TNS A;  5J4V A;  2DPU A;  1XSV A;  2EA4 A;  3EUA A;  2R7W A; 
#chains in the Genus database with same CATH homology
 3A01 B;  1MNM C;  4QSH A;  1ZTR A;  3OSF A;  1TC3 C;  1PUF B;  4AC0 A;  2YUS A;  1EF4 A;  4QTR A;  2FQ4 A;  4A3G J;  2HYJ A;  2XSD C;  2K9N A;  3LOC A;  3S1N J;  3TP0 A;  3ZQL A;  5F04 A;  5EDN A;  1WGX A;  1TWF J;  5C44 J;  3RZD J;  1G2H A;  5FKM A;  4Y52 J;  3CCY A;  5DS9 A;  4ABZ A;  3K2A A;  2O9L A;  5FKN A;  1WH7 A;  1ZR4 A;  4MFE A;  3BR6 A;  5M5W J;  4JX6 A;  2GM4 A;  1F43 A;  2MSY A;  1JKO C;  3HOX J;  3DCF A;  2NVQ J;  1WPK A;  3HM5 A;  3A01 A;  1T33 A;  3JRD A;  1PUF A;  3HGY A;  3PO2 J;  3QPS A;  1S7E A;  3H0G J;  4M3D A;  5IPA A;  1RR7 A;  1NK3 P;  1HDP A;  4D5F A;  4A3M J;  5GP9 A;  2VPR A;  4I6Z A;  2WV1 A;  4FIS A;  1FJL A;  2JMW A;  5FLV A;  1IC8 A;  2XB5 A;  2M34 A;  1BW6 A;  2JA8 J;  3S16 J;  1U8B A;  5BNG A;  1TWH J;  2JA7 J;  3S2D J;  1AU7 A;  2CRG A;  5EEA A;  3FK6 A;  3I4N J;  3E7L A;  1H88 C;  2R92 J;  3K7A J;  1W0U A;  5IOZ A;  3HBL A;  4B3A A;  2M8G X;  2XPW A;  5K7Z A;  2DMN A;  2R0Q C;  4RDU A;  4V2G A;  3S1Q J;  2EH3 A;  1ZQ3 P;  3B6A A;  2XPV A;  1NK2 P;  1ETK A;  2TCT A;  2DMT A;  2M2E A;  1K61 A;  1OJL A;  2H1K A;  2AO9 A;  2GLO A;  3RQI A;  1APL C;  1H8A C;  3IH4 A;  5F0H A;  1RKT A;  3I4M J;  1FIA A;  1JGG A;  2EZH A;  2HDD A;  1BJZ A;  2E2J J;  1ZR2 A;  1IJW C;  1HCR A;  1OCT C;  1IRZ A;  3G1L A;  4FE7 A;  2LY9 A;  3FIS A;  2FJ1 A;  4W97 A;  4FCY A;  1OFC X;  1MBE A;  3BG9 A;  4A3L J;  4A69 C;  2VUM J;  1GDT A;  3OIO A;  1YRN B;  2IEK A;  2ELK A;  1O4X A;  4M3E A;  1MH4 A;  1Q1V A;  2LKX A;  4CYC B;  3LSP A;  3W6V A;  2HQ5 A;  5M5Y J;  4XRS A;  2R93 J;  2O7O A;  3JRI A;  3MN2 A;  4A3K J;  4BKX A;  2DMP A;  5FKK A;  4V2F A;  3HDD A;  3FKI J;  4NDL A;  1MBF A;  2DA2 A;  2LK2 A;  4XK4 A;  3BT9 A;  1FIP A;  2R5Y B;  1LFB A;  2ECC A;  5J3L A;  5M3F J;  1FEX A;  3Q3S A;  2MW8 A;  1QVT A;  4DYR A;  5K7F A;  1UHS A;  5M5X J;  2JK3 A;  5J1U A;  3FIW A;  3BTL A;  4X1E A;  4XRS G;  1YRN A;  2RAE A;  3GTJ J;  2FD5 A;  1I3Q J;  1W0T A;  2MG4 A;  4CYC A;  2K40 A;  3QPL A;  1FTT A;  2NVT J;  1P7J A;  3HKZ N;  2ZB9 A;  1NTC A;  3A03 A;  1JKQ C;  4DZP A;  3DEW A;  4W1U A;  1SFO J;  4XRM A;  4AUX A;  5EYR A;  5EZH A;  2R5Y A;  2CUE A;  3ZQH A;  2QF7 A;  1GUU A;  2E2I J;  3BQZ A;  1IUF A;  3JRB A;  2E19 A;  3GTO J;  1HOM A;  1ZKG A;  2DA6 A;  4M3B A;  4UUT A;  4XID A;  2LFB A;  2XGC A;  3HOZ J;  5J1R A;  2VKE A;  2NOG A;  2IAI A;  4M6V A;  5C3E J;  2XRL A;  1Z0X A;  3JRH A;  1JKR C;  5E3M A;  5JLW A;  1IDZ A;  1WI3 A;  4M3F A;  3CMY A;  3ZQC A;  2P81 A;  3BR2 A;  3L1P A;  5E3N A;  3RKQ A;  3GTG J;  2EQR A;  3LSG A;  4A3I J;  2B63 J;  2DA4 A;  4IHV A;  3BG3 A;  3JRE A;  3OOU A;  2DN0 A;  4DW6 A;  1JJ8 C;  1SAN A;  1TWA J;  1IDY A;  2PMZ N;  3IV5 A;  1XC5 A;  1E3O C;  1RKW A;  1HF0 A;  3Q0W A;  5IYD J;  4DYQ A;  3LNQ A;  5IP6 A;  2XB0 X;  5DTD A;  3TP3 A;  3ZQG A;  2ECB A;  3GTP J;  1TWG J;  1I6H J;  4JP0 A;  1GV5 A;  1Y1W J;  1B8I B;  5C4X J;  2MGQ A;  1ENH A;  2DA1 A;  1B72 B;  3S2H J;  3LSR A;  4MFD A;  3PO3 J;  4MO7 A;  2DA3 A;  3GBG A;  4UUS B;  2DTZ A;  2HOT A;  4BXX J;  1U9N A;  2X6O A;  5J1Y A;  1HDD C;  3HOU J;  4S0H B;  2K9S A;  2M9H A;  5IYB J;  5EZG A;  4BBR J;  3JR9 A;  3GTK J;  4FE4 A;  3G1O A;  4LOC A;  1JUM A;  2H8R A;  4IHX A;  4MIM A;  4A3E J;  3CQZ J;  2LR8 A;  9ANT A;  4JX4 A;  4IHW A;  1WCM J;  5JLX A;  2M0C A;  2L7Z A;  1Z77 A;  2X48 A;  3S14 J;  1B8I A;  2DA7 A;  2ME0 A;  2HXI A;  5F0F A;  4XIC A;  3NAU A;  1B72 A;  2XPU A;  1ETQ A;  5EF6 A;  3RZO J;  3Q0V A;  4UUS A;  1VND A;  3BR0 A;  1JJ6 C;  2HI3 A;  3GTM J;  5K7H A;  1A6I A;  3O8G A;  4C3H J;  2Y9Z A;  1TWC J;  2I10 A;  2ID3 A;  3S17 J;  3HOY J;  3HOV J;  2WB1 N;  1MSF C;  4X6A J;  1AHD P;  3MVP A;  2CUF A;  2JN6 A;  5FJ8 J;  5C4J J;  3HGG A;  1U9O A;  5FKL A;  1I50 J;  1BA5 A;  4A3D J;  1DU0 A;  4Y7N J;  2DMU A;  4I76 A;  3VPR A;  3M3Y J;  2JJ7 A;  2LVS A;  1F36 A;  1JKP C;  5F0C A;  2CQQ A;  1ITY A;  2ID6 A;  1MBJ A;  3SJM A;  2Y30 A;  3JRF A;  4GFB A;  1R9T J;  4B4C A;  3BG5 A;  2NS7 A;  3HEF A;  1JT0 A;  5M3M J;  2EZL A;  3BTC A;  5FKO A;  5IP7 J;  2XGE A;  2LP0 A;  3C2B A;  2OF7 A;  4M3G A;  2LD5 A;  1U78 A;  1ZK8 A;  2Y2Z A;  2IBD A;  1UMQ A;  1X58 A;  3BR3 A;  1MSE C;  1Y1V J;  1MBH A;  1LFU P;  2Y31 A;  5IOY A;  2R5Z B;  1RPW A;  1ORK A;  2G0E A;  2TRT A;  2E1O A;  2DJN A;  2NVX J;  2W48 A;  1QPI A;  3ZQI A;  2X9D A;  3ZQF A;  4DYC A;  1AKH B;  3NAR A;  3BTJ A;  2KDZ A;  1JUP A;  2WAQ N;  3S1R J;  3UKG A;  5IP9 J;  2JA5 J;  4A3B J;  2L9R A;  2E2H J;  3WHC A;  4C3I J;  4D7N A;  3S1M J;  2NS8 A;  3OSG A;  1JT6 A;  1D5Y A;  5F27 A;  1QVU A;  1ETW A;  1LE8 B;  1FTZ A;  4AYB N;  2OPT A;  3TW7 A;  4D5C A;  3A02 A;  1QRY A;  1ZGW A;  2CU7 A;  2R5Z A;  2O8K A;  1K83 J;  3IH3 A;  1T56 A;  2Y0S N;  1VI0 A;  2HOS A;  4A3C J;  2CQX A;  2DMQ A;  1DU6 A;  2AHQ A;  2COB A;  3H3V K;  3JRG A;  4QIW N;  1A5J A;  3SDG A;  3F0C A;  3B6C A;  1OCP A;  5E3L A;  1XS9 A;  2ME6 A;  2HOA A;  4DZJ A;  1AKH A;  2L7M P;  4L5E A;  4D7M A;  4FTH A;  5GPC A;  1MBK A;  4BY1 J;  4EEF G;  2L7F P;  3MKL A;  3HOW J;  5EGO B;  1HLV A;  2GBY A;  2L0K A;  3GTL J;  1GV2 A;  1VF9 A;  3IH2 A;  5FLM J;  4BBS J;  3TED A;  3BR5 A;  2Y9Y A;  3JRA A;  3GTQ J;  3G1M A;  1X2M A;  1LE8 A;  4RBO A;  2K9Q A;  3FK7 A;  3TW6 A;  2JA6 J;  3BR1 A;  1GVD A;  2VI6 A;  5IYC J;  4A3F J;  1JTX A;  1MH3 A;  4A3J J;  1MBG A;  2EBI A;  3M4O J;  2KT0 A;  4JYK A;  5HOD A;  1ETV A;  1IV6 A;  5F1J A;  2YS9 A;  4B1R A;  2R7Z J;  3JRC A;  4J19 A;  3Q0U A;  1JTY A;  4IHY A;  4A93 J;  1BW5 A;  1IGN A;  4JX5 A;  1ETO A;  2LTP A;  2CJJ A;  5EG0 B;  3D1N I;  1ETY A;  3LSJ A;  5GPA A;  3ZOB A;  4MLO A;  3BTI A;  1JUS A;  3O8H A;  1GT0 C;  3CDL A;  1WH5 A;  2LLK A;  4C3J J;  2VKV A;  5EGO A;  1P7I A;  2YU9 J;  2XGD A;  3SFI A;  1BL0 A;  1IG7 A;  1XG1 A;  3QQA A;  4HNV A;  1RET A;  2HXO A;  2EZI A;  4C2M J;  2D5V A;  1VFC A;  4IEJ A;  3HB9 A;  5E3O A;  2DA5 A;  1POG A;  2NVY J;  1UG2 A;  3PM1 A;  2FX0 A;  2N8G A;  5F08 A;  4G12 A;  1ETX A;  2QCO A;  2JWT A;  3BQY A;  3S15 J;  1H89 C;  4BY7 J;  1RES A;  2EZK A;  3WHB A;  1CQT A;  1X2N A;  5EG0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...