1I6NA

1.8 a crystal structure of ioli protein with a binding zinc atom
Total Genus 111
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
111
sequence length
278
structure length
278
Chain Sequence
MKLCFNEATTLENSNLKLDLELCEKHGYDYIEIRTMDKLPEYLKDHSLDDLAEYFQTHHIKPLALNALVFFNNRDEKGHNEIITEFKGMMETCKTLGVKYVVAVPLVTEQKIVKEEIKKSSVDVLTELSDIAEPYGVKIALEFVGHPQCTVNTFEQAYEIVNTVNRDNVGLVLDSFHFHAMGSNIESLKQADGKKIFIYHIDDTEDFPIGFLTDEDRVWPGQGAIDLDAHLSALKEIGFSDVVSVELFRPEYYKLTAEEAIQTAKKTTVDVVSKYFSM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of Bacillus subtilis ioli shows endonuclase IV fold with altered Zn binding.
pubmed doi rcsb
source organism Bacillus subtilis
molecule tags Structural genomics, unknown function
molecule keywords IOLI PROTEIN
total genus 111
structure length 278
sequence length 278
ec nomenclature ec 5.3.99.11: 2-keto-myo-inositol isomerase.
pdb deposition date 2001-03-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01261 AP_endonuc_2 Xylose isomerase-like TIM barrel
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.150 Alpha Beta Alpha-Beta Barrel TIM Barrel Divalent-metal-dependent TIM barrel enzymes 1i6nA00
4EACA 3KCLA 4LNCA 1A0EA 3LMZA 4J4KA 4YTQA 2GUBA 2ZVRA 5EMJA 3P6LA 3P14A 4G56A 2QUMA 2QULA 4QE4A 4XKMA 4DVOA 1A0CA 4YTUA 2G0WA 1XLCA 3KBMA 2QW5A 3M0VA 1XIHA 4PGLA 4HHLA 3VNLA 3TVAA 1XINA 5C9ZA 5XINA 3L23A 4HHMA 2GVEA 3ITTA 4A8NA 5TNVA 1XLEA 3VNIA 4GJJA 1CLKA 2XINA 4PFHA 1BXCA 3KBWA 1XLAA 4A8IA 2GYIA 1XYLA 4ZB2A 1DE6A 4GQBA 2HK1A 4K1GA 3C0QA 4YTSA 1S5MA 1GW9A 4KW2A 2G4JA 9XIAA 2NQ9A 4A8RA 1MNZA 1XLBA 3XINA 4XSMA 1XLFA 1XIIA 3M0LA 3VNMA 2NQJA 2XIMA 5XIMA 2XISA 4HGXA 3FVMA 3UA4A 1XLLA 1D8WA 3ITLA 1XIJA 8XIAA 4QEHA 1YX1A 1S5NA 3BANA 4W4QA 2X7WA 2OU4A 1XLMA 5EMMA 4K3ZA 1XIGA 3M0XA 3BDKA 8XIMA 6XIMA 5EMLA 3C0LA 3IUDA 5J8LA 3M0YA 1DXIA 1QT1A 4QEEA 3QYSA 4OVXA 1OADA 3M0HA 4US6A 3JU2A 5XIAA 2GLKA 1QUMA 4QE1A 3U0HA 3KBVA 1TZ9A 4QDWA 4YTRA 3U3HA 3ITVA 3BZJA 3NGFA 1XICA 4QDPA 1O1HA 3AYVA 5B80A 4EAYA 3XIMA 4QE5A 3ITXA 3KTCA 4E3VA 1K77A 3KBJA 4A8LA 3QZAA 2HK0A 2ZDSA 2QUNA 1XIDA 3C0SA 3KBSA 5B7ZA 3KCJA 4X61A 1XIBA 3QC0A 3UXIA 1XIEA 4ZB0A 3VYLA 2X7VA 3IUIA 4GJIA 3CQIA 1QTWA 1XYCA 3N4AA 1XP3A 1XLIA 3KCOA 4XIMA 4YTTA 3UVAA 2J6VA 1DE5A 5AVNA 4ZBCA 2I56A 1MUWA 5B7YA 3UU0A 1I60A 3GNXA 3OBEA 3TC3A 4GLEA 1I6NA 1XIMA 3KWSA 1XYBA 3BZGA 4XIAA 1XYMA 3VNJA 3XISA 9XIMA 3ITOA 1XLKA 4DUOA 5FA5A 2I57A 3DBNA 6XIAA 3IUHA 1DIEA 3AYTA 1BXBA 3AALA 4ZB5A 4Q7IA 3KBNA 5EMKA 2Q02A 1XLDA 3BWWA 4XSLA 1XIFA 1DIDA 4X60A 3DX5A 3CQKA 3QXBA 5H1WA 1XYAA 3CQHA 4X63A 1XISA 3VNKA 1XLJA 3CQJA 5H6HA 3UA3A 3AAMA 4XISA 1XLHA 3ITYA 4HNOA 3WQOA 1A0DA 1XLGA 3CNYA 3M0MA 2HCVA 5I7GA 3CWHA 5AVHA 7XIMA 2NQHA
chains in the Genus database with same CATH superfamily
1NWTA 1DJHA 1WOBA 3WDJA 4YTQA 3AS1A 1QO2A 3KUMA 4AD1A 2Y7DA 3NZGA 5H91A 4I9MA 5TAOA 4YPJA 4O53A 3WIJA 2DJXA 4XZHA 1PAMA 1V6UA 3NO3A 5A1AA 2E8ZA 1B9BA 1PWLA 1F73A 3LHYA 4GGBA 1H7NA 4YTSA 2AQVA 9XIAA 2A3LA 2OEJA 2R6OA 4W8AA 1KV8A 1LL4A 1MRAA 3D3FA 1J0JA 2ISWA 2BXZA 3NEHA 4PEKA 1TO3A 1HT6A 2G97A 2Z2UA 3RITA 3QC3A 4LF1A 2V3GA 4AXNA 1RBLA 1IEWA 4DBDA 3S42A 1KTNA 5H8PA 3BMXA 4DUWA 3TXZA 4FPSA 4JTRA 5GQBA 3TYDA 4MY8A 2I16A 3LPPA 2DIEA 5LNUA 3WELA 3WK0A 1VYSX 5C0QA 1OSEA 1Z48A 4JQ3A 4CNTA 2HDJA 1XUUA 4FLQA 5IBXA 3RPTA 4C6FA 4PH6A 1MW1A 1O7AA 4C6DA 4EAMA 1OWQA 4UQ9A 5E0KA 4DELA 5C2GA 3V18A 2HQAA 3W2JA 4ICCX 4FXFA 4IQLA 5AHIA 1A0DA 1WBJA 1A5SA 1CZ1A 4ML9A 3PWGA 4UMAA 3ZFHA 1DIKA 1F3TA 2OXNA 2Q71A 5LGZA 1B0IA 1B3YA 3F2DA 3SAZA 4WY0B 2X41A 3ITTA 5C9WA 3VNIA 3RM9A 2PTZA 3G1DA 3FJ6A 3PBYA 3AIBA 3P93A 5TD4A 5F4SA 3KE0A 1Q8AA 3WJSA 1VYRA 3CL6A 1S5NA 3MSYA 1F05A 1Z44A 4L7ZA 1BSLA 1F5ZA 4MB4A 4WJEA 1Q65A 4DYKA 2OO0A 3JZUA 3PUDA 4OVXA 4W84A 4NX5A 3B0YA 3KBVA 4TTUA 4G1NA 4YTRA 1HW6A 4KEMA 4XZMX 4H4IA 1VHNA 3WK1A 3WEZA 5I5RA 2FGZA 4YU1A 1QI0A 2EJ1A 3N4AA 4QIUA 3U2ZA 2YA1A 2QCHA 3GD6A 3A4AA 4J3SA 4IJCA 3U5UA 1M04A 1S2CA 1VBGA 1I0BA 3CZEA 3TZFA 5LSMA 3S2CA 4Q7NA 4UTMA 2ZUWA 3R5EA 4O19A 2P88A 2FZMA 5C2XA 3V0TA 1XUZA 2PS2A 4CUCA 1M01A 3RRAA 2XDFA 5G2WA 3CU2A 3EWUA 1I1WA 2XUCA 4LVGA 2XZ9A 2ZVRA 2OX4A 2PBOA 2ZWZA 4GWEA 3A3XA 1KTBA 5XINA 5BROA 2RHGA 1J5SA 4FNSA 4C6NA 2Z00A 1ESWA 3KVMA 2VEIA 2O7SA 3CUJA 5HUOA 3M43A 2WZMA 4JYDA 1V4YA 3LPGA 3PULA 2VC7A 3VOIA 1JDEA 1X97A 2PLCA 5ABGA 3ZR6A 3CV6A 3ITLA 3KS5A 3W7RA 4QDMA 1LLOA 1ONWA 1F2JA 1DJWA 1W2VA 2YCJA 2G5WA 3TYZA 1ZBKA 1EHNA 1FHDA 4Z2JA 3SIZA 1U83A 2WQPA 1QASA 1IT7A 2PDQA 1G4PA 2PD9A 2V5KA 1MXSA 5DQPA 2QHAA 1HNYA 1XBVA 2PA6A 3W53A 2GGGA 1XRFA 2J25A 5TF0A 3A9IA 4GBUA 3SJNA 4NKCA 2FQIA 1BGAA 3E3HA 3G3DA 1EYEA 1ZCOA 2X0HA 2FHFA 3ARPA 3UXLA 2DP3A 3E2RA 3GG0A 4IGMA 1KBLA 1R3RA 1A47A 4MG4A 5JBEA 1QNSA 1BVNP 1UW9A 1RV8A 9CGTA 3U7BA 1X1NA 4FS9A 9RUBA 3EB4A 4TTGA 2BWGA 2ZTKA 5F2IA 3NQCA 2IKHA 4DXKA 1IV8A 4W85A 3ZM8A 4H01A 4GZ7A 1AMYA 1A5NC 1C92A 1EIXA 1B3WA 1PX8A 4XD6A 1CB2A 3H4WA 1Y8BA 2FFIA 5DANA 4JS3A 1JPKA 1CLKA 2DZVA 2W0UA 5DT7A 3DEQA 4S2BA 3FKKA 3GIPA 1F3WA 4ADSA 4MWAD 3L5MA 2CBUA 4H9VA 1EF2A 1JZ6A 1QOXA 5FF3A 3W86A 2X2GA 5KZDA 1EO7A 3W76A 4ZSUA 3OU8A 5KMYA 2QGHA 4EWJA 3ABSA 5GJPA 1GOMA 3I65A 4JY9A 4I5XA 4Z2HA 3LTSA 3Q4DA 3MJMA 3TW9A 4WHBA 1UWAA 1RQHA 4JL2A 3HOJA 2JKAA 3UXDA 4UFIA 4PTNA 4O15A 1OIFA 3TQPA 1XYMA 1FFRA 1B3OA 2V9DA 2DEPA 3DBPA 2QJMA 4GOAA 2C14A 3W26A 4NHVA 2WVVB 3N34A 4GPNA 3W7JA 4TX9A 2Y63A 4JIQA 2C71A 1XFBA 3UG5A 3SCRA 2J77A 4QSFA 4H2HA 1QPOA 3IRDA 1FHUA 4O0QA 1IXOA 4N6FA 4Y9AA 4XVEA 1UJPA 3FDGA 4DVOA 3QQ1A 4NJJA 3BICA 5CPMA 4C7FA 3PAJA 3AS0A 3J7HA 5K4ZA 1VJSA 4CCZA 5GNYA 2X1IA 3QTGA 3QJAA 4DNHA 4AQLA 1QXLA 1FXPA 1EP3A 3VKBA 3W75A 3WQGA 1K02A 1IEXA 4O12A 3USBA 5A95A 4JQ4A 5CZKA 1XCFA 1GT8A 1SZFA 3MUZ1 1XIGA 3DU0A 5MKGB 3M6DA 5EMLA 1UWIA 1JPMA 3L2MA 5AFDA 3VGHA 2XHYA 2EBNA 1O5KA 4L64A 3NURA 4AU0A 3QZ6A 1AQFA 1IHIA 4N0RA 3MS8A 1KW1A 5BWFA 5I3IA 1MW3A 3QVQA 3UETA 1W5NA 2G96A 1HKJA 4RXGA 3N19B 4WSJA 2V3EA 1VFMA 4MMWA 3DERA 2YFNA 1G01A 1S38A 2QXWA 4HTYA 4NZ5A 4UTIA 3WJXA 3OYZA 5DFAA 2PDJA 1OF8A 2YCKX 3CQKA 1FVPA 3M6YA 1Q3NA 5JBFA 2R1LA 3DAQA 1EUNA 4CN1A 2OLSA 1N8FA 4PUKA 5FF0A 1YDOA 3LV6A 2DSKA 4ATLA 5FF2A 4IX2A 5U4NA 1KM4A 1Q6OA 2VX4A 3PN8A 3A6OA 3ARSA 4XO6A 5MF5A 4M3PA 2EXOA 2WZHA 1XLCA 3LLFA 1BLIA 5FJUA 3KW3A 2ALRA 4P5UA 1GKQA 6ALDA 1W3IA 1VS1A 4HT3A 2ICSA 1R5YA 4AZBA 1ADSA 3F4VA 3H2NA 1TPH1 5CJNA 1CB7B 1CLVA 4WY0A 3TSMA 3QMRA 3LYEA 1XYZA 3T2QA 2E0PA 1TWDA 1IZCA 4REQB 1RQEA 1JF5A 2V2HA 3EKLA 6A3HA 3WEOA 4LX4A 5I3FA 2E1WA 5M17A 4JEJA 5CJ5A 1MW0A 1SU5A 5D38A 2OGYA 1ZSXA 2C0AA 1J01A 3H26A 1US2A 2AKMA 4IHCA 3MWCA 5M3WA 4QG8A 3POCA 4QLJA 3W28A 1SZEA 5A8PA 1O6IA 4P2VA 1U2YA 3QMSA 4LF2A 3CIVA 4GG9A 2PRHA 4Q3MA 4K2SA 4XG1A 4IMGA 2EPKX 3MZNA 4GX8A 4UR7A 3H2MA 3VNKA 1GVIA 4J3VA 2HVOA 5AHMA 3BAXA 2POZA 4CEUC 3PSVA 3IJQA 1C9WA 3LG3A 2HVNA 1NOFA 3E0VA 3VCCA 1EGVA 2OOFA 1PXGA 1OCNA 4E0CA 3L23A 3WNMA 3WF4A 3IAQA 1ME7A 3LRKA 4NASA 4JEQA 4E2DA 4FO4A 2Q3RA 3W02A 3MKKA 2Z26A 3PZQA 5LYRA 4C5ZA 1KGWA 1XIIA 2XM2A 5CSSA 2VX6A 3BANA 1UWTA 5LGXA 1IF2A 1V3JA 3C2VA 1V0NA 1W2PA 1S2VA 3N15A 1CNVA 4XUGA 1VLIA 2NVCA 1K8YA 2C79A 3I3BA 1CXFA 3IK2A 3GTHA 5LKYA 1W1A1 2V30A 1K70A 1V3KA 3UCDA 3WQ4A 1TIWA 1VRXA 3VUSA 3EWXA 2VEKA 1IGSA 1WDWA 1OK4A 3AJ7A 4NNBA 2W79A 3E2SA 2WMJA 4X22A 3ZT5A 2JGYA 3BXWA 4MPQA 2EO7A 3BAJA 3TNOA 3DX5A 3HGOA 3WLJA 4IMDA 5HOSA 5J5DA 5HMFA 1ZAJA 3W7KA 5E0FA 4V33A 4QTGA 3N3TA 2NQHA 2J74A 1Z3NA 3EX3A 4KCWA 4MZYA 1H51A 1Q7QA 3VD3A 4EKJA 2HV5A 3H4XA 2QDDA 1GPWA 4LS2A 5G2IA 1NEYA 5C9ZA 1KNWA 4EWND 1RK5A 3GDLA 3RPDA 4RPQA 4K1GA 2PDLA 3NL5A 3R94A 4YCPA 2AKZA 2F2HA 4PTDA 4FNTA 3LQGA 3GZAA 3DOPA 2PFHA 1OBAA 1PB0A 3ZYZA 4E4PA 3TTEA 3LTYA 2PDHA 1XYFA 4LCSA 4AZ6A 3LDVA 3WH7A 3OQ8A 3KZSA 2VKZG 5DMLA 5DXXA 2Y24A 4UWMA 2HBVA 1EX1A 3BAIA 1WPCA 3EEZA 1ICQA 2WM1A 2NZLA 4QAIA 4Y9MA 1EJRC 3C0JA 2XVGA 3QN3A 2P5NA 4Q8QA 3P62A 1WUEA 3DFTA 2GUUA 4FI4A 3NDOA 5A6AA 4QNWA 3OVRA 3B0XA 2J66A 1FH9A 5C70A 1AUSL 3H4GA 3I4EA 2X40A 3Q45A 3AYTA 1GVEA 1GKPA 4D6GA 2YCIX 2D24A 3TYCA 4DZ5A 2D2GA 3BG9A 1R2RA 4Z1AA 4QISA 3WX7A 4HN4A 4CN6A 3MB9A 4CCDA 2BASA 4Y7EA 7XIMA 1LQ0A 4N9BA 1Q6GA 2DSZA 2ACSA 1SO4A 1EQCA 1D7FA 1B4KA 3U2OA 1T8XA 3SR7A 2VRKA 2ZX7A 3E0FA 5D33A 1VP5A 4DJFC 2E9MA 1H0GA 3ISIX 4B5UA 3DHFA 3K4WA 1FY6A 1XYLA 3WLHA 3FS2A 1DE6A 1E4LA 1RJRA 1AZ2A 2W92A 1E6RA 1D8CA 3MUXA 5FIPA 1A4MA 3E96A 4D2JA 2DSWA 3FSUA 3IGXA 4R9OA 1ZB5A 1DJNA 4H6EA 1MYRA 3PJTA 4FR1A 4IPLA 2O55A 1X96A 5KZ6A 1M65A 2QJGA 4CD6A 3KWXA 3ZJ6A 2V38A 5A69A 1UMYA 5M03A 3H7UA 3T1GA 4I8DA 2WK2A 3WBXA 4GVHA 4GQRA 3BW2A 4NZ1A 4LRTA 2QVHA 4L4MA 3RXZA 2BY3A 3WKZA 1P0BA 5HWJA 1XYCA 2ZZ6A 4XIMA 3EWBX 4GX9A 3MSGA 3BG5A 4H9XA 1TPDA 2OR2A 4HK5A 2YW3A 3VDAA 3L7RA 2DZTA 5CPNA 4NNCA 3NDYA 4O57A 1LJYA 4DM2A 4JFTA 1TPC1 2V5BA 1X8CA 5H1WA 1A5AA 3R8HA 3VMNA 1QDSA 1KXQA 4IWWA 5I00A 1OIMA 3AOFA 1J12A 4DRSA 3EA2A 4I9TA 1QFEA 3NO1A 1R3QA 4BA0A 4DJDD 1TRIA 3V35A 4JX6A 2Y8UA 4DNMA 1NQ6A 3F4CA 1YDVA 1US0A 4O1AA 1GJUA 5C9UA 2VZSA 4QGCA 4U3CA 4QJ3B 1NVMA 5JVLA 4R85A 2D2HA 5DMNA 3P8JA 3FNDA 4AC1X 1XG4A 1LOQA 3BMVA 3REQB 1JZ7A 1PEZA 1SGJA 4RW5A 4S38A 3TC6A 4W7UA 2H9AA 3BK0A 4C6OA 3WBEA 3OLIA 1HL9A 4JXCA 4PBFA 4RV3A 5CLTA 1W31A 3ZJ8A 4UTJA 3GW3A 4AHOA 5E9AA 4DWSC 2CBVA 1KXHA 2CESA 5A94A 1SSGA 3R25A 4NXKA 2P8BA 2GVYA 1Q2RA 1Z8AA 1X6UA 3B8DA 1XP3A 2YGYA 4MTVA 3NPVA 4R53A 4KIEA 2FPTA 5JXQA 4D71A 2VGBA 3DFOA 3GAYA 2KZHA 3TK7A 1X7FA 3K2GA 2XFFA 1JUBA 5E09A 3VD5A 3MO4A 3LI1A 4MY9A 3B3DA 1K7XA 1V93A 2QZRA 4L80A 1FQ0A 5C5YA 3T0BA 2A3AA 1S1PA 4B9YA 4PTXA 5HJXA 1XX1A 4OV4A 3GM8A 1LOSA 5EL1A 1W5MA 2BXVA 3HG5A 4LUTB 1J0HA 4FEZA 1GHSA 4PGLA 1J2BA 3AYSA 4H9TA 4AD3A 4FXSA 4D8LA 1TJ2A 2ZUUA 1F4HA 3ECQA 3AZTA 3A4JA 4AZHA 3UY7A 3LM7A 1X1ZA 3BURA 3B06A 1ZL1A 2D2OA 4HJFA 1XDMA 3B9OA 3PNZA 3GB6A 3H2OA 3NL3A 1AH3A 3ATZA 4IP7A 1GTHA 4Q6JA 3AQUA 3ITXA 2JALA 1M7JA 5FF4A 3UR2A 3I6EA 1E40A 2AOSA 2BG5A 2DT1A 4Q22A 4J1OA 3GKFA 1XIMA 3HG2A 5AYYA 5A8MA 5KINA 5HK4A 1I2RA 5E6YA 1OX6A 3V1HA 1H5YA 5AC6A 1RAKA 4JZ5A 4O8RA 3QQ0A 3WN6A 2E5DA 4DM1A 4A3RA 3FLUA 2DUZA 3NYZA 4UR8A 3TYAA 2XGBA 1ZUAX 3F4NA 1OFBA 1IT0A 3KOYA 2GK1B 5DLCA 1NELA 1QW7A 1J0YA 2XVPA 4U10A 2J7DA 3W70A 5BOOA 2DVXA 3TE9A 4TO8A 1JCNA 1XGDA 1XLLA 2WMGA 4E4FA 1UIPA 4F2TA 5CZJA 4C5YA 3GG8A 2YCLA 3AROA 4ZOCA 1OC7A 2GGEA 4R27A 4JTFA 3SCPA 3WLIA 3PG9A 1RA5A 2NW0A 5FJJA 3CZGA 1K7FA 2Y61A 1XC4A 3STEA 1V8EA 1V7YA 3KBSA 4FIQA 3PBMA 1S5WA 1K8ZA 3CXOA 2H9AB 3N2CA 4KCUA 2PRMA 1FH7A 3LCFA 1TIMA 3CC1A 5FA5A 4C1KA 5T9BG 4PBEA 3LXAA 2R1PA 2V5DA 1R0MA 1IEIA 2VC9A 3P5YA 4HMCA 3CTTA 4C6JA 4PMQA 2TODA 3S4TA 1RVGA 3MBFA 3POHA 1YADA 5A6TC 3WQOA 3DH7A 1TSIA 1M53A 5D2WA 3U9IA 4S3CA 2YB4A 3C86A 2G3MA 3A64A 4LVBA 3W88A 2BODX 2QW5A 4JNZA 2VQTA 1ITXA 1E4IA 1F6PA 3Q65A 3EA3A 2W62A 3T81A 1F6YA 2BV9A 5HANA 3WQDA 1M41A 4M6VA 4ZODA 5JBDA 2CITA 1SJBA 2IPWA 4S39A 1HIZA 3MA8A 1NTHA 3GH7A 3NWRA 3W2KA 5KTLA 3BW4A 2WMIB 1XJBA 2GJRA 2ZZ3A 3WK2A 2NUWA 1YEYA 1SFJA 2UZ9A 4BEUA 1J8VA 4KPLA 1E6NA 3WLOA 3F5KA 1RXOB 3V75A 3BCDA 4TUFA 2X0YA 4UFHA 5C2CA 3SFWA 2ZOXA 1MZHA 1VCGA 2OKTA 2V63A 3W7NA 1GKRA 3QOKA 1X39A 1ZHAA 4GO9A 2ZE3A 4HA0A 1JZ4A 1GZJA 4ZB0A 3MJYA 1CGYA 2Y5JA 1SM9A 3IUIA 1QTWA 4UTKA 3LXCA 3STCA 4W5ZA 4F0KA 1MUWA 4JFWA 4M1BA 3ZVHB 3QV7A 6XIAA 3CH0A 1XH0A 1BXBA 3BO9A 1K3UA 3EMQA 3HPSA 1J10A 5K7JA 4G8TA 2H8ZA 4BK9A 1Z42A 1S5VA 4V28A 4D6HA 3HGJA 1FCBA 1G7UA 2ZVIA 3MI6A 3AI0A 4CD5A 3QW4B 1MO0A 3IJ7A 3K1DA 3QR1A 3GNPA 3S9IA 5AYZA 4DLMA 4KEZA 2PDNA 2RFGA 4RV8A 4HZ7A 3L4XA 3QFWA 4DAIA 3IV3A 4MWAB 1XRTA 2KAUC 1BEUA 3IJLA 4ECLA 2BOGX 1FWIC 2XGIA 3URQA 4P7OA 3T07A 2QCDB 3O6YX 5HR6A 1HP5A 2ZBTA 2VI0A 4ML4A 3KVKA 5BRBA 3FEMA 2ABBA 1TV3A 3S6DA 1WXYA 3OJGA 4GUJA 4LB3A 3L0GA 1W1B1 4F2BA 3TN5A 3M0YA 4KRZA 2F38A 4AF0B 3A9BA 4FSAA 2WVTA 4TVCA 4GC3A 2FPYA 3E02A 3M9YA 2Y0FA 1SJAA 2ZRXA 3OG2A 3RRXA 3C0SA 3QV8A 1HKKA 1D2KA 3ABOA 3C6CA 4I8YA 2DJLA 4XAYA 4TU1A 3WQEA 3HN3A 1R3WA 1AH4A 2XG9A 3M16A 3KRSA 1SUXA 2F8QA 3DFHA 1CLXA 3HM7A 2CWXA 3QGKC 4KFPA 3QXBA 2A21A 4F66A 2J9XA 5LXEA 3PBGA 5FAJA 4D6IA 3V7PA 1ECQA 2PGRA 5LIXX 3GR4A 1F3EA 4NL1A 1UP0A 3FA5A 1SYTA 1WV2A 3WF1A 3NZQA 4GMEA 4D6EA 5HBFA 1B54A 2PDFA 1LDCA 2HJPA 5EPDA 2GUYA 5FJTA 2DSUA 4LALA 1PZ1A 3ALGA 2WB5A 4HMEA 2O7QA 3O2LA 1XLAA 4GABA 2ZUMA 2OLAA 3S1GA 4KWVA 4DO5A 2NWSA 2NV1A 1UC4A 3PWIA 1BG9A 1O66A 2ZX8A 4Z2IA 3N2BA 3JW7A 1YX1A 1XS2A 3VUPA 1EPVA 1R2TA 2IQDA 1PL9A 2GFTA 1G9HA 2RDXA 1OVDA 1H61A 1TV5A 3WK3A 3FYYA 2HISA 3MCOA 3O63A 4H83A 1O1HA 4GZIA 4B2DD 4WQ6A 2D2JA 4BY3A 2PGFA 3NDZA 1UH3A 1ZBWA 1CXEA 4F40A 1K9TA 1S39A 3U8GA 1ZTVA 2PCEA 4DQWA 3VOJA 1NF0A 3GNXA 3VNJA 1R3VA 1Q2SA 3UY8A 4IFKA 3NZPA 1W3TA 5CBIA 2CBJA 1WKYA 3KTXA 3PTQA 4JX4A 3GKAA 1EDTA 4GKLA 4DIAA 4MLJA 2F9RA 4K8HA 1P1XA 1JQVA 3C8FA 3ZS4A 4AMCA 1J6PA 4Z2GA 3RLUA 4MB5A 4OOUA 5DCBA 2FVKA 1XSKA 2QUTA 3W73A 3S6OA 4LEFA 5I3KA 3P6LA 3AXXA 4S3GA 1T99A 2GK1A 4MZ8A 3IK4A 3GQYA 4N7QA 4MVAA 1AJ2A 2ISVA 3T44A 2P0IA 3AYRA 2FGBA 7CGTA 2DW7A 3WNKA 3IJIA 4ZL1A 3UT0A 3SCOA 4KBXA 1JCTA 3DZ1A 4HD5A 1LUCA 3T0CA 3S8HA 3WO8A 1H7XA 2QPXA 3VM7A 2FZ8A 1KFLA 1W5OA 4Q4MA 1RCQA 2VDGA 2VCAA 3DUGA 3ZIZA 1LP6A 3LK6A 4OWGA 4R7WA 4ZE5A 3L4YA 4GH3A 1L0PA 3EA1A 2I5IA 4QITA 3B0UX 1HL8A 1YRRA 3BZJA 1EXPA 4IFKB 2D0GA 3TCSA 2HK0A 2WWCA 1EDGA 5LIKX 5B7ZA 1KXTA 2EJAA 3VGDA 1EBGA 4KFOA 1JPHA 3SO7A 4CQDA 4DYJA 3KRUA 5IFPA 1L2UA 2FLIA 1CDGA 1V02E 3UPMA 2X05A 3XISA 3ZSSA 1NWRA 1VCFA 1R46A 2NSOA 1UD2A 1ISYA 2PRLA 4JQ2A 3TWAA 1FOBA 2YBTA 1BPLB 4AUBA 3MW7A 2FB2A 4CVWA 4OHQA 3ARVA 3IJ8A 5PTDA 3ZT6A 4ENLA 3B9NA 1RSCA 3O6DA 2VDIA 1ONRA 1UD3A 2DT2A 1UR1A 4I7VA 4G9PA 4F4RA 3LY0A 1YBQB 3P82A 3E2QA 3CZLA 1JPDX 1MW2A 4DJFD 2VX7A 3UJRA 1HL2A 1WQ5A 1S5MA 3N2TA 3PTMA 1ZZMA 4NU7A 4XK2A 3H6OA 3BJFA 1QI3A 3P3BA 4J28A 1UROA 1UC5A 1LF1A 4ICMA 1O12A 4O4WA 5DMYA 2QYGA 1DQXA 3FSTA 5KETA 1C9DA 4NUWA 1PIIA 4YHGA 2OWWA 8A3HA 2EPMX 3C2YA 4PMOA 1VAHA 1C93A 1UASA 2CLOA 2ZTJA 1W1IE 4YYCA 2GPTA 1GONA 1KFKA 2QQ6A 1FWTA 2ZADA 1C90A 4DWSB 3O8AA 1MUCA 1A5OC 1CGXA 3GE7A 2A4AA 3ELFA 4AY1A 4TV6A 3BGGA 2Z2AA 3AIUA 3VD9A 1U1HA 1VFTA 4RCXA 3WL1A 4S23A 1GVRA 4RDWA 1UWQA 1X38A 5CC6A 4O1CA 2XFYA 1GVSA 4O50A 1EO5A 3HGSA 1ZBVA 3ZJKA 4S3DA 3PM6A 5AKQA 3GR7A 3EPOA 4HQVA 4ZOAA 1OX5A 5BOFA 1B31A 4PRRA 5LNSA 1IIGA 5IM51 4A8IA 2VMFA 2C1HA 1BKHA 3UERA 1H7WA 3G1SA 1PTGA 4MWAA 1DKWA 1XXXA 3DHUA 5C55A 1TPVA 4KEVA 5AECA 2Y7FA 2GVLA 3UZ5A 2PWGA 5DEZA 5LNVA 5F4XA 3IIZA 4O18A 1TJRA 1TRDA 2VZOA 2Y85A 3LS9A 3MU7A 5E70A 3WZ0E 3BLDA 4PUWA 1FXQA 2ZDSA 2W91A 3BLPX 1SJCA 3B8TA 3NXFA 1E1FA 4GJIA 4MFDA 3TMQA 4PMZA 5CZSA 2ACRA 4CKQA 1I2NA 2A79A 4IGSA 3GHRA 1TJ0A 3AJXA 3IUHA 4M1RA 3GLCA 4U5IA 3CUXA 3KBNA 1MZRA 5HJYA 1J11A 2OGJA 3AHZA 2F2KA 3K46A 3G8RA 4CD7A 2HS6A 1F4AA 2NSXA 4XISA 1MQPA 4AEOA 3ITYA 3QV6A 2OKOA 2PU0A 3AMDA 1Y7VA 3K4DA 4MDOA 3BLFA 3N13A 1H1NA 3RN6A 2HS8A 4M5PA 3SRHA 4XD5A 1QK0A 4Z1BA 2VUNA 1AJ0A 3W7IA 2DH2A 2VR4A 3RAOA 1E5NA 1W3KA 3W25A 3TJLA 2FHBA 4XAPA 2PF8A 1DWIM 3AZSA 3N2OA 1SFTA 3B9AA 2ANUA 5CG7A 5TIMA 1GVFA 3QPEA 2OFJA 4M24A 1CGTA 2PLJA 1TVPA 1HKMA 2FZ9A 4J35A 3SRKA 1DEDA 3B8UA 2YCEA 2WCAA 4HPGA 4KWWA 1H1ZA 2WNWA 4W7VA 3S2MA 3TONA 3KRBA 3MY9A 4O28A 3WBWA 3SADA 2OWXA 5AY7A 3T0DA 2CEQA 3DC8A 3NQDA 3WQCA 1ZFJA 3BSMA 4UQBA 3RGTA 4B2DA 4IXXA 3NZRA 4CN4A 2WNNA 5D04C 3MMTA 4P7QA 3W7EA 2WZIA 4J2PA 4EF8A 3NR0A 1YNYA 4PUDA 3UVIA 1ZCCA 3R0KA 2Y8KA 4FXRA 2IXVA 3BGAA 4JPGA 1TV8A 4HBKA 4WKAA 5AVHA 3TROA 1W8GA 4W87A 1PZ0A 4WXYA 2A7RA 3WCZA 4B5NA 1RK6A 4GUIA 3SN1A 3A3HA 2POTA 3DECA 2RDTA 4A22A 3DN5A 3VKDA 3L12A 3CPUA 5HNNA 3MPGA 4V15A 1EGZA 3C8NA 2J4GA 4PTMA 5BCAA 4XAZA 5D09A 2OEKA 1EJUC 5C6MA 2JF7A 1ENUA 4AEEA 3CT7A 4QLLA 2ONEA 2RUSA 4ZENA 2C15A 2QCNA 4KETA 2DV0A 3W7LA 2DH3A 2VGGA 3CGTA 4BI7A 3P0XA 4LRSA 1JJKA 1GPFA 3LCIA 3LCHA 1B5TA 4XWUA 3KLKA 1BHGA 3MANA 4AWSA 2V82A 1DHKA 3NQMA 3B4UA 3NGFA 2D3LA 6CGTA 4Q8MA 2FJKA 4ES4A 3PUGA 1KFJA 1LWIA 2J24A 3W37A 3E74A 4FF7A 3YPIA 1Q6EA 1LROA 4WDTA 3P74A 2JQXA 2B4GA 4HKPA 1SW3A 3E0WA 4URIA 5FF7A 4L61A 4BWLC 1EC8A 3PSWA 3O15A 1QW9A 1XLJA 3PNUA 4KEUA 2E9BA 3ZSTA 1BFNA 4RK8A 3WD2A 1VYPX 4GKTA 5JH1A 4PL2A 4NF7A 3CHCA 3TX9A 3QHOA 3O6CA 3OA3A 2XSBA 1XRSA 1F07A 3CV1A 3QRHA 1WO2A 4G56A 2QUMA 1R3YA 3B03A 5BXRA 4GC4A 2NQZA 3GHUA 2W5FA 4YJ5A 4BR1A 2ALDA 2YLLA 4X9YA 2GQ9A 3GFXA 4PCPA 3H7RA 1IEVA 2I5GA 1REQA 1OFDA 1A4LA 1YBQA 4FLOA 5CPQA 2QNEA 3WLMA 4E3TA 2PPGA 2GQ3A 2WO5A 4MNKA 3CPGA 3S5ZA 3C52A 2VUYA 3GXPA 1C3FA 5H2ZA 5I23A 4RXFA 1JIBA 4AD5A 1PCWA 2XH4A 3JRKA 3VCNA 1MUMA 3ONCA 2GLKA 3E12A 1P7TB 1CGVA 2XH7A 3MC5A 3D0CA 1KRMA 4EAYA 4REQA 5IHSA 2QUNA 1Q5MA 3AMLA 1JRBA 2WWDA 4JDBA 4L1WA 2Z1SA 5E93A 4OIFA 5H8MA 3LUTA 1FKXA 1GZ1A 1DTNA 3MVTA 4LUTA 3FX4A 2E5BA 3HGRA 1NU5A 2EQDA 4HCLA 1EP1A 3RYSA 5I07A 1HX0A 5M2FX 1RQBA 3NYDA 1SPQA 4IIGA 1XW8A 2QCEA 1VFLA 4QSHA 2BX7A 4JIHA 3P60A 2FVLA 2XTKA 3KCLA 3H2AA 3KP1A 1R87A 4K7VA 2TAAA 5CC5A 2YL6A 4Z1YA 4ZQOA 7ENLA 1OGSA 3L9CA 3B9DA 5FL0A 3GBDA 4FAMA 2X1SA 4DO6A 3CYJA 2P53A 1M03A 1GEHA 5BOEA 5E0CA 3FAXA 3QSRA 4EX4A 1HJWA 2GYIA 4LS1A 2CZ5A 1M7PA 1C29A 2ZZ2A 2J7HA 1VENA 2ZDRA 3BSHA 1J0ZA 2C91A 1QPKA 2XVNA 4M6PA 2WVUA 4K6AA 3GC4A 1MEWA 3M41A 3ZOAA 1O4UA 5C7HA 2CETA 4HNVA 1OB0A 1G7VA 4O11A 3O7UA 1UB3A 2PE4A 1OT2A 2GJXB 2OG9A 3PBVA 4ZMGA 1VPQA 4F8XA 4RDYA 1R7OA 2JKPA 1K8CA 1XI3A 3HB9A 4QE5A 1VIWA 3LXBA 3RLVA 2D0HA 4JKMA 3GVGA 3F5LA 4GYKA 3T4CA 1G4EA 4PBGA 1WYIA 4MM1A 4IG2B 1WE5A 4N42A 3N14A 2J8GA 3SGZA 4GXMA 1PX3A 1NDZA 4PMJA 2PWVA 1JFHA 4Q4PA 2E7FA 1JCYA 2QGYA 1GQNA 4HNNA 4A6GA 4ZGYA 1V6WA 5BYWA 3GXFA 3WQPA 1RA0A 3VIKA 1V08A 5I3GA 1TPB1 3EAUA 1MQQA 1ECEA 2CLLA 2ISFA 2FYMA 3L2LA 3COTA 3OLGA 4OGZA 2EPLX 1W17A 1N8IA 3CASA 4GINA 5T26A 3UGRA 4GYJA 3C2FA 2BVTA 3GYCA 1UQYA 3T05A 1SW0A 4LW7A 1NY1A 2XINA 2E6FA 4MB3A 2YSWA 2QLYA 5EFDA 1JZ3A 3QY7A 2QPSA 3MKVA 1QBAA 1JF6A 1GW9A 1VBRA 3WFZA 2NX3A 2ZRUA 2CIPA 5A6BA 4E38A 4WF7A 1AJZA 1Y0EA 1G94A 2BOFX 1QOPA 1K9DA 3VMOA 1XICA 1ZJHA 1VPXA 2JEPA 1SMAA 4YS1A 4IFOA 2ESCA 3CLMA 3KBJA 5CLWA 1E0XA 2DW6A 3W3OA 2ABAA 2BLEA 4RZ4A 5REQA 5BRPA 2BFGA 1LRTA 1VFSA 3P7YA 1RH9A 2J6XA 1BWVA 5IDZA 1A3XA 1AQHA 3GDTA 4PTVA 1I4NA 3CHFA 3EMCA 3R2GA 3EWWA 3WENA 2VZUA 3LTPA 2F6UA 1WNOA 1WAUA 2WVSA 2KX9A 4GY7A 3L4UA 1FWFC 5DO8A 1VFOA 4FMVA 1V7AA 4PUUA 3W82A 3DFSA 4LY4A 2RJHA 1P0KA 3STFA 2G0WA 4AIBA 3RX3A 4UTTC 5HNTA 2UY3A 2BBFA 2Y62A 2YJQA 4LVAA 2WKLA 3GTXA 3B97A 3HF3A 1OFPA 4JAWA 1IWPA 2YB1A 3WH9A 3WD4A 3EYPA 2OYKA 1FKWA 1XBZA 1LG2A 3K5XA 5EMMA 5F1UA 4DF0A 4ZO6A 4H6RA 3TLLA 2O9TA 1B3VA 2XM1A 1E0TA 3GVVA 1UPMB 1AFSA 5A6BD 4GY0A 3XIMA 3L4VA 1MEIA 4MB1A 1YTKA 3SB0A 1G5AA 3VI2A 4FX7A 2J7CA 4YN5A 5EB8A 3QBUA 3VZYA 3CLWA 4MJ4A 4C6IA 1Y5WA 3RLHA 2P76A 1LT8A 3WQ8A 4Z08A 5EU9A 4INFA 2B7OA 3TN4A 3N6JA 2OB3A 1ME8A 4X60A 3TSBA 1MI3A 4C6PA 2AGKA 2DVUA 3H22A 3OP2A 2DZSA 1LL7A 5A8QA 4H3DA 3S1WA 1FWSA 4AW7A 3VX0A 2BGNE 4HTBA 1PUDA 3T40A 4CGTA 4HHLA 1TQJA 1WZAA 3VIHA 4NJIA 3A22A 4L5ZA 3GH4A 2BTMA 3GO2A 3BV4A 5L6UA 1U33A 4DJFA 3WG6A 3P2VA 2NLIA 2E1DA 2R9RA 2XFWA 4JQAA 1TCMA 2J7FA 4QXIA 3VGEA 1NF7A 1IGWA 1UYQA 3W07A 5GJMA 3I3DA 3NVTA 4LXFA 1ISXA 4RW3A 4C6QA 3WNLA 3GHTA 1YPXA 3EPMA 3ITVA 3EOOA 4O52A 2I9EA 1W37A 4HYWA 3H8AA 3M0IA 2PCQA 4D6JA 3ARWA 1JULA 3DI1A 4RR4A 1E55A 3H53A 4AY8A 3N1AA 4E8DA 3RPMA 5A6MA 1WXJA 4JR5A 5CPSA 5CGQA 3VO0A 1FHLA 1PS9A 2OOGA 4H9MA 4YVPA 1US3A 4PUMA 3ARQA 1VGAA 3ERPA 4KWOA 4HZMA 4RDVA 5I3HA 3NQGA 1XFCA 3DKJA 3VU2A 1M9HA 3WDQA 4W89A 4D1JA 3R8GA 4F0HA 3BPWA 3BOXA 4ADTA 4BKNA 3LD5A 3W1MA 1B3ZA 2JIWA 4WUIA 3PY2A 4UZSA 4HHPA 1WA3A 1KWKA 4JICA 1TUXA 1QHOA 3W74A 3VGBA 2A2IA 4KMQA 3FVDA 4F48A 4DUVA 5AC5A 4MKNA 5FD0A 4LYRA 3QYQA 2NUYA 4O10A 4ACZB 2B31A 2PDCA 2QAPA 4OBTA 4IIDA 1Q6QA 4FR6A 4QCEA 2VRQA 3NM3A 1RCOB 3URAA 3AICA 2RH9A 3KVLA 1I9CB 1UWUA 1FHVA 2PDIA 3QOMA 4TOQA 3AMCA 4YL2A 1O94A 1QVBA 3LBMA 4LAOA 1UMLA 3W1QA 5LHEA 4ZQRA 4PRTA 3A13A 1T7LA 1LUCB 4UTWC 1REQB 1K6WA 2OT1A 2ON3A 2JKEA 3OBKA 4MOZA 1HG3A 5CC3A 3RFAA 3MP5A 4D6CA 4H8HA 1GTEA 4RKAA 4XIAA 3GH5A 3BV7A 2J47A 3OEXA 3S0CA 1GG1A 4B16A 2LLEA 4QLKA 1GEQA 5K9CA 4K8GA 2BY2A 1MWOA 4YWIA 3CHDA 1H62A 4K38A 4UTLA 5H6HA 1PZ3A 2E67A 2OSWA 2WSQA 3OQEA 1HJVA 1ZJAA 2ZC8A 1WCGA 1TYGA 3VZXA 1I0DA 2QS8A 1LORA 1P6BA 4MJMA 4DWDA 3EZ4A 3CPRA 3WUEA 1W1TA 4NNAA 4OZOA 3SGUA 3LZ3A 4UMBA 4TX6A 1L6YA 3NVDA 4YHEA 4GJJA 4Z0JA 3FIGA 3W24A 3PZNA 3VX1A 1H50A 2C3ZA 3NIYA 4HP5A 1UHVA 2E28A 1JUKA 5DRIA 3H12A 4G7EA 4I5UA 4BI6A 3DCPA 1KFCA 1JXJA 1JZ8A 1OEPA 1XSJA 2A5HA 3DHDA 4TQTA 4GYPA 1IR2A 1W9VA 4MF4A 1EP2A 1YIXA 4DBUA 1PKNA 1VF8A 3VOCA 2HPIA 1KCKA 2ZUSA 4DEFA 4B4FA 3NSNA 4HU3A 3IARA 4H7CA 1OX4A 1A49A 1GCYA 4CVUA 1XWYA 2YXXA 2G41A 4HU4A 1PWMA 1VIZA 4UUIA 2I56A 3LCLA 4K7YA 1ISZA 1O5QA 2VD8A 3VIOA 5LIYX 4ROQA 5AZ0A 5JU6A 2DZPA 2WZTA 4K8EA 1H0IA 1LBFA 3WJYA 5JH2A 1YXDA 4IIFA 2GGJA 4U28A 1E4NA 3LB0A 1PDZA 2RKXA 4ZFCA 5ABFB 1L6SA 2Q09A 4Z17A 2ZKMX 2WPBA 3ENLA 3RUBL 2Z6JA 2IXUA 4NXSA 5M1TA 2XVKA 5FOOA 4O17A 3TSDA 4YVVA 3CMFA 3LBOA 3SN4A 3OHMB 3UEQA 2YFOA 2ZFAA 3AFBA 3HBLA 3WLTA 3PK7A 3C0QA 2X42A 5DCDA 1TTPA 5HR7A 1HJUA 3IWPA 3EPNA 4BF5A 3VNYA 3PPFA 2VZTA 3PZVA 4M6QA 1TJ1A 4FHAA 2ZX6A 2H3DA 3VC6A 3RO8A 4E4UA 4XTDA 2YXOA 1JCJA 2HTMA 1SJDA 3BLOA 1QNRA 2HEJA 1Y65A 3KL5A 2OWCA 3RCMA 4PMDA 1S2TA 5KEZA 1FRBA 3DG3A 4QDPA 2NV9A 2R82A 4V27A 1C8YA 1E3XA 2JE8A 3VYLA 2HROA 2XPKA 1POKA 3VCRA 1A50A 2TSYA 3OVGA 3TC3A 4MHBA 1R38A 3KOZA 2ADAA 5FAGA 1UD5A 1S1RA 2A1YA 1TB3A 4PFMA 3N9RA 3CO4A 3ARXA 1I75A 2CBIA 3TLQA 1PKMA 5D9MA 1P6CA 3W85A 2G3NA 1XR2A 3IGHX 1AW2A 2XVLA 3VFCA 3TR9A 3PBWA 1A3HA 3P0WA 4ZTYA 1UKSA 3WSUA 3DXIA 2J9YA 3TUUA 4E2BA 4Q8UA 1FWEC 4QAWA 4W93A 3W0KA 3KBMA 3UFYA 4U33A 1K1DA 3VIIA 3SBFA 4F9JA 1XIHA 3FXGA 4QNEA 3VNLA 1Q6CA 5BMXA 4AWTA 1DBTA 1E15A 2YDRA 1CEOA 4JIIX 1ZY9A 5SWUA 4KERA 3MUIA 3D6NA 2HBXA 3GNOA 4U3AA 4L65A 2UBPC 4G6CA 1EZ2A 3UNTA 3A5FA 4QFUA 4CQBA 4AZ7A 3DENA 1IR1A 3H70A 3P61A 1DWAM 3EBVA 5G1MA 3CV2A 1OABA 1L6GA 1W9BM 6XIMA 5I09A 3PJUA 2RAGA 3FCPA 4P8WA 2Q8XA 5ECVA 2NXHA 2CYGA 1BXNA 1F61A 4MLRA 3KTCA 3S46A 1J9YA 3F2BA 5D03A 2Z28A 4IXHA 2PMQA 4NZFA 3QFEA 2QAFA 3GIQA 4O8AA 4JCLA 1TTJA 3WEMA 1UKTA 3DESA 6REQB 1TA3A 4B3LA 2INEA 4AXKA 4Q4KA 2QEZA 1ML1A 2X1UA 4IOTA 2GL5A 2C16A 1JDFA 1U1UA 4PCSA 2GVJA 3UWWA 3GUGA 3NPUA 2XIOA 5BZAA 1JFXA 1QHPA 4S3KA 3PAOA 4TVDA 4Q4RA 1CXLA 2EKGA 3SUVA 2OZTA 1UCWA 1V3IA 1DWFM 1TR1A 3BVJA 4F0RA 1N2VA 3BUVA 2NVDA 3K30A 4KFNA 2FDSA 2V2DA 1PE1A 4MGGA 1NDWA 5RUBA 3UJSA 3TWBA 3W23A 4M8UA 2IS7A 4I6KA 4IF2A 1UUQA 1XLEA 4POCA 4CD8A 5F1VA 3V5FA 3UZYA 4DYEA 3MHUA 5GNXA 3RX4A 2C6QA 1AQMA 3R13A 3LOTA 3STGA 2O56A 1TTIA 3HQ1A 5DELA 3DYPA 3N73A 1OG0A 2HWGA 3W00A 1NOUA 1L6WA 4GE8A 4XZLX 5DX7A 4XTIA 3C0LA 2NUXA 1WBHA 1CGWA 1VC4A 3OZMA 2P50A 1M5WA 2WC4A 3IVSA 3AYVA 1K77A 4B3ZA 1XIDA 4O16A 4NAFB 5BMWA 3CJPA 1AMKA 4S1FA 4XKYA 1HO4A 5KZMA 2QJNA 2PP1A 1F7BA 4DZIA 4ZBCA 1ZJBA 1YDYA 3KWSA 2WJEA 2YZRA 3S1XA 3R89A 3STPA 4RNJA 2O4QA 3BLIA 3W2NA 4HMDA 2WLZA 4JQ1A 3QR3A 2Z1BA 3W6LA 2Z1KA 4WDXA 4GCAA 1X7IA 3VKKA 3SN0A 1AL8A 1JD7A 1XLGA 1UKQA 3H23A 4AEFA 1GOWA 1RBAA 3BARA 4DJDA 1GJPA 1W3HA 3LQLA 4L9YA 2R1KA 4B5TA 1Q7ZA 3FW6A 1RUSA 3UNDA 4JIRA 3T78A 1OCQA 4W88A 1Q45A 5A8OA 2WBGA 1XM3A 2WMFA 3ATYA 1DJYA 2DZWA 3N29A 3NM1A 2VX5A 4A3UA 1LM1A 2VJXA 2X8RA 4GISA 5G1YA 2PDBA 3TNBA 1NFPA 2C1IA 3KOXA 1JRCA 1R30A 3G6MA 3FJ4A 1UP3A 4FNPA 4ERAA 1E6QM 3KL0A 4JKKA 4KQNA 3MHGA 1W6TA 4J3UA 4XAGA 1C8XA 1EC7A 3QLLA 3G6LA 4WKHA 4ADUA 4C1LA 2Z2BA 3CAQA 3CUHA 4GFSA 4UOJA 5A5WA 3VXGA 2YOCA 1YXYA 5I0DA 3UJFA 2BDQA 5C9XA 3UP8A 3R58A 4QS5A 4XZNX 2WAGA 1NH6A 2W4XA 4KRTA 3REQA 2QCGA 5B7YA 4YYFA 3LSBA 3ITOA 3SUWA 1JNEA 4C6CA 1XDJA 3S5OA 2HRWA 4HA4A 3MSDA 5K3VA 5A2AA 2ZC1A 1TTQA 4LPCA 4S3AA 3S6TA 1QU4A 2AQWA 3EWYA 3TOPA 3WLQA 5MHBA 1MMFA 1OCJA 3BG3A 4ZTXA 5MKGA 3UPWA 4DX3A 3WLPA 3M07A 2OPJA 1V79A 3RHGA 4NZJA 3O3RA 2IQTA 1LTDA 3MCNA 4LQ1A 3IVUA 4GI4A 3L66A 8CGTA 2UY5A 3N6QA 1EJTC 3LN3A 3FHAA 3UA4A 1D8WA 3V1PA 7PTDA 1ICSA 1ZENA 5A2CA 3BDKA 3GU9A 1VHCA 4RE3A 3S1VA 3BTNA 3R8RA 4UTHA 3E49A 2VURA 4E8CA 1BVWA 3U4FA 3KS6A 4QR6A 1G1YA 4YTTA 2VWSA 3I4KA 3R1ZA 1FDYA 1K4HA 2OTDA 4KESA 3BLKA 4ALDA 2BB0A 4XSLA 3BL3A 3MUAA 4XBSA 3K8KA 4I9JA 3OHIA 3GBEA 4LTSA 4HA3A 4BF7A 3UW6A 1R86A 1U5HA 4ZA0A 2CLIA 1EDQA 2XIJA 1W1ZA 4GZJA 3UG3A 2GGIA 1RJQA 3LU2A 3WDHA 5AOUA 1PVNA 1ITCA 1A5MC 1V0LA 1XINA 1BTCA 2XN0A 1F8MA 4KIRA 2XIIA 3AXKA 4A21A 1GOKA 1EWDA 5CPOA 1CI1A 1GOOA 3PUOA 3I7QA 4PUJA 1W3NA 2F61A 3ANUA 4IMEA 1WXZA 3UCQA 2VENA 3I7RA 4IQJA 4Z42C 1E6PA 3NQFA 3B4YA 1RLCL 3KHJA 2PD5A 3B8WA 4P61A 3AUJA 3GNRA 3W2LA 2YA2A 3MT1A 4IISA 2VR5A 4Q8WA 1YTDA 3D46A 3WDRA 4UOZA 3W6YA 4QP0A 3TW7A 5BNKA 4D8ZA 5EMYA 5DBTA 5A8NA 1WDSA 3B8IA 4H7ZA 3HPFA 2ZRWA 4XX6A 2WKGA 5HPOA 1LRNA 4TX8A 1ITUA 2QDHA 1OHLA 4UCFA 1FWBC 1XQKA 3AIEA 4H00A 1EHAA 3E5PA 2QV5A 4IT1A 4RE0A 3MUY1 3TN3A 2D1ZA 1GVYA 3UYCA 4J5NA 3ZR4A 2EG6A 3SI9A 5EA9A 3D3AA 4X0VA 3TFCA 1U1JA 1OINA 4Y8FA 1HKVA 3SQMA 1SMDA 1O1ZA 4CD4A 1XSIA 1UZDA 4FF5A 1TQXA 2HSAA 2FTWA 4ZXLA 4PL1A 4GI9A 2PLMA 4R34A 2XYLA 3GXDA 3A21A 3MVIA 2QJJA 4U2ZA 5HMDA 4JD4A 4O14A 1YLVA 3XINA 1XLFA 1RHCA 4GQGA 1E1EA 3TTQA 1EC9A 2PGEA 1FWHC 2OU4A 2PDGA 4HK7A 5FJOA 5HA7A 3TFXA 3VKJA 1ADDA 5XIAA 1IEQA 5LA1A 1TKKA 3ZO9A 3G0XA 2FJUB 2CWNA 2HNHA 1W9PA 4E3VA 1EJ7L 4H9YA 4AF0A 1T6MA 1BKSA 3MTWA 4US5D 4X61A 2WYSA 5AN7A 2NWRA 3E1F1 3Q2DA 3RMJA 4AIUA 1HGYA 2GOKA 3LEPA 3F5JA 2BMBA 3LHWA 3OBEA 2FMNA 3NQ6A 3CAVA 1XLKA 1H7PA 5BU6A 4AWEA 4ZXOA 4H8NA 3ANYA 3FJLA 1UR4A 4RPPA 5CSYA 4DUXA 4LT9A 2E8YA 3OIHA 6PTDA 2CLHA 1EYWA 4AWUA 2YX0A 3RX2A 1BVZA 3B8VA 3W2MA 3APGA 4R33A 4EVZA 1JG9A 4HNUA 1P1MA 2FHCA 2PWDA 4RZBA 3GTNA 3BOLA 5I6SA 1ODZA 3UXAA 1BRLA 1UBSA 1EPXA 4Y9PA 2ZZ1A 4MFEA 1G4TA 5D32A 2D23A 1NFGA 4W7WA 4O0KA 2YBUA 3HMCA 2VHLA 4WGHA 4IPIA 3QGVA 1S2AA 3GTFA 4PMYA 4QROA 2EG7A 2C13A 4W8LA 1R8LA 2O9RA 3GY1A 3FYPA 4LBSA 5KZEA 1BQCA 3WH5A 1E0VA 3GVWA 1HJXA 2YCLB 5HNRA 4M19A 1HJQA 5CAHA 3MO7A 1LRQA 2ACUA 4K68A 1UZ4A 2Y7GA 3LLDA 4GIEA 5C8BB 3WNPA 2RGMA 4CU6A 1E43A 4I5RA 3EDJA 3AWNA 3T08A 1UA7A 5CH9A 4WDWA 1NDVA 3G5EA 3CK5A 2D20A 5EY5A 1TG7A 1JQXA 4FX8A 4HCDA 3MMWA 1TMHA 1R6WA 4DN1A 1XLHA 4BI5A 2VM8A 3HZ3A 3SRFA 3WF2A 2J79A 2PWHA 4PMRA 4UFLA 3S1UA 1L2QA 4RNHA 4UBPC 2VTFA 4AD0A 3EGJA 1TELA 1N55A 1IYXA 5LNRA 3HJZA 3URBA 3KOFA 3N9SA 1SVDA 3U4AA 3AXHA 1FCUA 2ACQA 3VIPA 3GNDA 2GJNA 4UQEA 1WDQA 1ZLPA 3VNMA 4WJ8A 3V4BA 4ZQCA 3UWVA 3SCTA 4ATDA 4D1IA 3SW6A 4B92A 4DLFA 4CU8A 4B90A 3WBAA 1BAGA 1LT7A 7A3HA 3PS7A 3W1LA 2GSHA 1P0NA 2E25A 4HB7A 3LHVA 4QRNA 4GQQA 1ODUA 5CAKA 1IXQA 1CTNA 1ELSA 3BQ6A 1J0KA 4KCTA 5EFFA 1I2OA 3U2CA 4MY1A 3OOQA 2CFFA 4N9CA 5GPRA 3TU9A 3UZZA 3ORWA 2DY3A 4LB4A 1XDLA 3BSGA 2NXGA 1UD4A 4WGXA 2NXIA 2D69A 2OEMA 3IPWA 4AZCB 3ES7A 5FACA 3W72A 3EOUA 3UESA 8RUCA 4BWLA 1MXDA 4FOJA 1QOQA 3N11A 4GIAA 4WEVX 5CZTA 3W6MA 1LWJA 3GR8A 2C19A 1LLZA 3PBUA 1EXBA 3HQOA 5G2HA 4HYVA 1BWLA 1PCKA 1AQ0A 4UCGA 3G1FA 3H2EA 4JTUA 1H11A 3SUSA 3VIFA 4WDUA 3V5OA 2Y8VA 3SURA 1B90A 3PFRA 3KAOA 2IQ0A 1W3LA 3QM3A 1UIOA 4ICNA 1GW1A 3S3GA 2G4JA 2FH8A 5AB3A 1XLBA 4MDPA 4BQ2A 2PDKA 2XISA 1FWAC 3ALFA 2EPNA 5DY2A 4PE8A 4PN2A 3W1AA 4PUNA 1D3HA 4QEEA 4DO7A 4IICA 2I17A 4DJED 3BAKA 4NZ3A 1YNQA 4U4MA 4QBXA 5C54A 1UR0A 1QR7A 4X2PA 1V3LA 1FDJA 3UD6A 2OO6A 4U2YA 2R24A 3PWAA 4JL1A 4HOWA 1GYNA 3R0DA 5I02A 1OY0A 4QQUA 2MANA 1GOXA 1L9WA 3A12A 1FWGC 2F6KA 1ZP3A 1BYBA 2WZEA 4G2DA 2VVNA 3O1NA 4S2CA 3QR0A 1ADOA 2BZNA 2DSVA 4JN6A 4U5KA 3VDGA 4MKVA 3NQBA 1PKYA 3OZOA 4GD0A 4S3BA 4OV9A 4BCEA 3GU2A 1UR3M 3MBDA 3AHVA 1CW2A 3SUUA 1E1CB 1KCZA 2J75A 3DFNA 4AVOA 2BGQA 5ABEA 4Q4SA 4RDZA 1Z89A 1W5PA 4C6KA 2ATMA 3N17A 3ES8A 5EKYA 3VVGA 3W1PA 2FH6A 1RPKA 4OU1A 1TPWA 4UQDA 3THDA 5J5RA 1OX4B 3SCNA 1XGZA 1NJJA 1IWBA 1QI2A 3CEPA 3W9ZA 3MKCA 4QCFA 2G37A 4AHPA 3O9NA 1YKWA 3N4FA 2FTYA 2ODOA 2DQWA 2IPGA 4D6DA 3QKZA 3ABXA 3RJXA 2Z29A 3E2VA 2B7PA 2ZXBA 1KFWA 1X8FA 3WQ5A 1AK5A 4LYKA 2A7PA 2CHNA 1OT1A 4UFKA 3CWNA 3GNNA 3RNDA 3AMKA 4GO8A 4PSRA 4GYPC 1XLIA 4DJEA 4Q8NA 2CHRA 2WC7A 1GQIA 1IE7C 2QVNA 2Q8ZA 2Z27A 5HUPA 1BYAA 3T7VA 4KKXA 1K6AA 5C9RA 4LY8A 4H9UA 4XAFA 3ANVA 1V0KA 3AXMA 2BVDA 3OGRA 2V5JA 4MYXA 4MSSA 5FEXA 1E56A 4LEQA 3DI0A 3C4UA 3RJYA 4WRHA 1WDRA 2DQXA 3TJXA 1LQAA 2PTWA 4XD3A 4HSOA 1VJZA 2BHUA 1IXNA 1FP8A 5K9XA 3S2NA 5BXSA 2B7QA 4YWSA 1GWJA 1KLZA 4JX5A 3CAWA 4C6MA 4H9ZA 4D6FA 1GOIA 3LRMA 3NJ3A 5I2UA 1XRVA 1WUFA 1HKWA 6TAAA 2H3BA 4US5A 4ZFMA 1EH9A 2HE8A 2XSXA 3ARTA 4C91A 4QE1A 2PC4A 4HU8A 1A3WA 2A3EA 1HF6A 1HGWA 1C7SA 1GJWA 1X6LA 3EOSA 2DUAA 4OBSA 4GYFA 2QCCA 3AWOA 4GY1A 1UP2A 4JOMA 1CXHA 1YHTA 1VEMA 2PLKA 4Q8PA 1NWUA 3AXIA 4GFIA 1UZHA 1ONXA 3EB2A 2I57A 5EBUA 3FYOA 1DIEA 1P7TA 4ZQPA 1FCVA 4RL3A 4IIEA 4WK9A 1EQPA 5EBAA 1GYMA 5FI8A 4EPDC 4JTJA 1Q4NX 2XH0A 4D8AA 1VBHA 2CLKA 3A24A 4GXPA 2BHZA 1UBPC 3TQ0A 4KT2A 2I9UA 5GNZA 4LAKA 1PYMA 4NJHA 4P8VA 2QJIA 2PEVA 3LMZA 2W9MA 3DGBA 4O1DA 4UTTA 3ZT7A 4GK8A 3LERA 4N4QA 2O4MA 5F2GA 4WZHA 4A29A 4QJ5B 1K9FA 2EEXA 4PCTA 4LUYA 2DUXA 3FAWA 3CHEA 2PDUA 3P8IA 3UZWA 2WPGA 2FPVA 1QATA 3M0ZA 3I7SA 3MI3A 4NYYA 1KBBA 3ZJ7A 2ZXQA 4DJEC 3EEGA 3NQ8A 3AU2A 3QMTA 3T2OA 3H2CA 2XN1A 2Z0IA 2XIQA 5CPTA 4RE2A 4XO7A 1QT1A 4FZIA 2VRJA 3NEVA 4US6A 3N9KA 1Y5VA 3VK5A 1AVAA 3MHFA 4JTDA 2REQB 5HMEA 2WNZA 3AISA 1RD6A 1AODA 3W71A 1QO5A 2Y4SA 3W7PA 1HKIA 1YDNA 1UH2A 5FL1A 4NZCA 1QPRA 4UFMA 3LMYA 3SY8A 3C61A 1XHGA 2VR2A 3QHMA 3UVAA 2C7FA 3AIWA 5BWAA 4PMXA 1A5LC 5HWMA 3KLLA 3N18A 3GTIA 4H7VA 4LAMA 2GWGA 2FIQA 1UWSA 3CTLA 1QW8A 1GOQA 3NQAA 2FKPA 4WCJA 4AISA 1DJZA 3S9YA 2UY4A 1NSJA 1DIDA 4J7RA 1KRCC 3CQHA 3SGGA 3W1RA 3AAMA 1PDYA 1EJXC 3N12A 2PP3A 3HTWA 4E5TA 1NP2A 2J7GA 3VE9A 4S3JA 3OVQA 3PJXA 3D5HA 4R3UA 3KRZA 4A3YA 3TQVA 3K8LA 3PANA 5F2MA 1YXCA 1QHZA 5DF0A 3KM8A 3P81A 2V3DA 3HIJA 1TZ7A 4GZEA 2E3ZA 4FOKA 3H21A 3WLLA 2WHMA 5I3JA 2J78A 4K3ZA 3LLXA 5I03A 4NI3A 2PDWA 2YDSA 3GDKA 2Q01A 1S46A 2IMRA 4I6VA 3HO8A 3G0UA 4MWAC 3SUTA 4A05A 2G50A 4PCFA 3G0SA 2ZUNA 5CSRA 1NARA 1XIEA 3WUFA 2WCSA 2VFIA 3G1AA 3CH9A 2NT1A 4UMCA 2E6AA 4L1GA 3RCYA 1I1XA 4DUOA 2GJPA 4L4OA 4AZGA 3T55A 4NYUA 1W1VA 5JIWA 5DBUA 2BXYA 1XYAA 1FH8A 3SCWA 5CGMA 3NO5A 4EXBA 2VDHA 5IRPA 1ZJIA 3DC0A 1EJSC 3OZPA 4AYGA 5CBJA 3HQPA 3LCXA 3NQEA 3O16A 1Q7MA 4FK9A 1Q6DA 3CT2A 5DRCA 3A23A 2GSJA 2I14A 2VEMA 3KEHA 3MMDA 2P1FA 4EANA 3AC0A 3VZZA 2Y5EA 1Z69A 3AZRA 1AW5A 4UFJA 4J3ZA 4ZB2A 4GCXA 3PJWA 3V5CA 1KM3A 4O13A 3G1HA 1SZRA 2VELA 4NZ4A 1QCWA 1H7OA 1TWIA 3EXSA 1W3JA 3W83A 4XV0A 5IBXC 5FESA 2NX9A 3ZWTA 3R6IA 1XPYA 2Z1XA 3U0HA 4ZO9A 2WSYA 2QKFA 1Q8JA 3WLRA 3USZA 3TKFA 1P0EA 2GGHA 1XG3A 1PSCA 3F4WA 3HV9A 4H6QA 4AAJA 3BGJA 1TWSA 3M5YA 3TJ4A 3EWDA 4DZAA 3PZGA 5HNUA 1AD1A 4MJZA 3PZUA 1UUMA 2V2CA 4D9PA 4WY0F 3OODA 5AHLA 4HSHA 1VQTA 3QTPA 4WOQA 2FZBA 4EXAA 4K1WA 1V6VA 3TC7A 4Q33A 4ZE4A 3IJDA 1JEZA 4B91A 1XCXA 1YPIA 2MUCA 1EA0A 3IJ9A 3CWHA 3L0NA 1TWZA 4M7TA 3DFQA 4J4KA 2FZNA 3G1VA 5DXYA 2RJGA 4RLIA 4LBUA 1H1YA 4NJKA 2C1GA 3FJNA 4J27A 3W7MA 4YTUA 2YZ5A 1DIOA 4GNJA 4IIHA 1GHRA 2AL1A 5TNVA 4MPKA 2F6XA 3VILA 3A3WA 4FLRA 2V81A 3IV8A 3ZVIA 5I77A 1OD8A 3U6WA 4A8RA 2WSRA 5HINA 3F2CA 4PB5A 2XIMA 5FEWA 5FSDC 1B3XA 4W4QA 3G22A 3IEBA 4O54A 2J13A 1IZKA 4M81A 2OZ8A 1OJXA 2VFDA 3PZMA 4Z2KA 1TZ9A 2Y70A 4L56A 1E9IA 2WMHA 4C6BA 2D3NA 4CNPA 4NY2A 3T6CA 4FX6M 3BH4A 2PDPA 4ZZ9A 1J5TA 3M5XA 4F79A 4XZIA 1CYGA 4V1XA 4GJ1A 4F2UA 4N2YA 1E51A 3W1NA 3HFTA 1MRQA 5D9PA 2QCLA 4EXQA 2GOUA 3IIXA 2R1MA 3EKGA 4AZIA 3OLDA 2ISSA 1E72M 2INZA 4I7WA 4XBKA 1TX2A 2BP1A 3AIRA 1QWGA 1GQLA 1CCWB 3TN6A 1GUVA 1TMQA 3R11A 1SZNA 3MV11 1G69A 4I9AA 4S3FA 1UR9A 4UNLA 1QI4A 4JFUA 5AHNA 3O06A 4FLSA 4H1ZA 4FA3A 4C6LA 4DWSA 1T40A 3T09A 4AVNA 5D8ZA 3U5YA 3WL0A 3APTA 2EAWA 3SRDA 2R91A 3T8LA 5HQEA 1RY0A 2QR6A 1PHQA 4AMAA 3W7GA 1TR9A 1RVKA 2GDQA 3W1UA 2ZA2A 5D37A 5CGTA 3NUKA 3M1ZA 3LENA 2IPJA 3QH2A 2X7WA 3K1GA 3V16A 3VDHA 1WZKA 2VCBA 5LIUX 3LGEA 4C90A 4GI8A 2VVSA 3S9ZA 4GQ0A 1O68A 4LAUA 3LPFA 1XL9A 2PU1A 3M7SA 2XJ7A 3SQLA 3DYMA 1TPFA 3ARUA 2R94A 3ZMRA 5A6KA 1V02A 4L6HA 2HXTA 4IJBA 3RM4A 5K2ZA 4W8BA 3CQIA 2VO5A 1G4SA 3IIVA 4YXGA 1GK8A 8TIMA 2SFPA 4LUSB 4GUHA 3NQ7A 4PA8A 3TEVA 2VOTA 1T41A 4JTLA 1LL6A 2NX1A 2Y7EA 2ZQ0A 1H4PA 1MFUA 2VCCA 5T9CE 2HMCA 4LSBA 4ZO8A 2Z4GA 1W5QA 3ZZ1A 4GVGA 2YL5A 4IUGA 4LV9A 1FCQA 4AHQA 1DYSA 4FB7A 1UOKA 3VNDA 5I7GA 1V51A 3ZLFA 4EPKA 4GXWA 2Y6ZA 4XZWA 4JHMA 1V3MA 2XN2A 1XH2A 5REQB 2VFGA 1S3TC 3PB2A 4NILA 4HHMA 1K03A 3MDWA 1PIFA 3WQWA 3WQFA 1DJIA 3CL8A 1OFOA 4IGHA 5CPLA 3CZKA 1EX5A 3R43A 3L0KA 3WMBA 3VAVA 1M68A 2ZE0A 2XSAA 4IL2A 1R3TA 3TYEA 4BZYA 4WLCA 1EEXA 3KDNA 3GG7A 1RBOB 4M51A 1YYAA 1XPGA 3TQKA 3SCUA 3ITGA 3GXMA 3IIPA 1HXJA 1TX0A 1Q6LA 3II1A 1VCVA 5AC7A 1CXIA 3MZ2A 4J3WA 1KCXA 3P67A 1MDRA 3FXYA 3UWQA 1C8QA 2X7VA 4H41A 1ISWA 1QI5A 4BFAA 1E6ZA 3UZJA 3DFPA 2RGLA 3LSCA 9XIMA 3GWQA 1O5XA 5CXPA 3LPOA 3W29A 3N4EA 1OYCA 3O6AA 4HSNA 4KGLA 3GG1A 3CB3A 2L5HA 5AC4A 2ZX9A 3LGGA 4LGXA 1I45A 3ARYA 2ZRVA 2OYMA 4G7EB 1ZPTA 2HCVA 4KRUA 2QT3A 1EFZA 1Q6RA 7REQA 3P14A 2PC8A 3O05A 3U2EA 4HIBA 3VINA 5EGRA 1TREA 4LWWA 1QJWA 3KZPA 1S2UA 2P10A 1HVQA 1YW1A 1UD6A 3GC2A 1W9UA 4JIEA 4ORMA 3THQA 4LBRA 4FOUA 4JNYA 4MKSA 4P7RA 3L5AA 4LNYA 1JZ5A 3E38A 1DPMA 1EGMA 3EX2A 4K39A 1AZ1A 2YA0A 5I78A 5DY3A 3SQSA 3QYSA 4B5VA 5IXEA 2DT0A 2DU2A 4O1EA 4ZQNA 1NP0A 4MJ2A 3GU1A 2YDAA 2Z7GA 1F3XA 4JBRA 3UXIA 3WJZA 4I3GA 3EDKA 4L4PA 1G0CA 2ZIDA 1ZBCA 2Z24A 3DKLA 4PR4A 1JVNA 4DI9A 4PULA 1UG6A 1I2QA 3QEZA 1MQRA 4GLEA 1ALDA 3FK4A 4JCMA 3DBNA 4F9DA 3UR8A 2CW6A 3KTSA 1YMYA 3ZLGA 4IMFA 3TH6A 1VR6A 3NAVA 3SY5A 2ZUVA 4MYAA 1G67A 4LJ3A 1OFRA 1JYXA 3VD7A 3ZWSA 3WF3A 1M3UA 4RX0A 2J27A 4E6MA 2E6DA 3OB8A 3BLLA 3LNPA 2X30A 3M7WA 3W01A 4UXDA 4ZCWA 2PI6A 1Z7AA 2OQLA 4F0SA 2ZZ4A 1K7EA 2HZGA 4J3XA 5LA2A 1GORA 3HURA 3IAPA 1GNXA 4IX0A 1WOAA 4NVTA 3ARRA 3NNTA 1HJSA 4TVUA 1NIUA 4CLMA 3ONBA 3HV8A 4QX4A 2QMKA 2XFRA 3K8MA 4IPNB 3TZNA 4KCVA 3ITCA 5FEPA 3QV9A 3GSMA 2ZWYA 4QJ1A 3AO0A 4K36A 5AHEA 1JCMP 3N2XA 2X1RA 4AYSA 1TVNA 4AZCA 1THFD 2HE5A 4EPBC 3OZYA 1QNOA 1QBBA 1BF2A 4LCQA 2J7EA 3GUWA 1BGGA 4WR3A 3IGUA 4UC5A 1XIBA 4HZ6A 5TQLA 2OZ0A 3DG6A 1V6TA 3NA8A 4Q8TA 4UNKA 1L6FA 4FALA 4Y90A 1SO5A 3VTRA 3DIPA 4X0NA 4P7LA 4YLWA 5D8WA 5HULA 2OELA 1KGXA 2VGIA 3GFZA 1POJA 2ZCGA 4W86A 3QLDA 5FSEC 2QV4A 5CEWA 5EMKA 3E0IA 7TIMA 3ZXWA 1DOSA 3W27A 2W63A 4CNNA 1JPIA 3GYEA 3MMUA 1JGIA 3UWZA 1JI1A 2VXNA 3TMLA 1HZYA 1F8IA 1ZAHA 3C2RA 4GA8A 4RZ6A 1W56A 2VNCA 5EMJA 2QUVA 4IMCA 2TRSA 3IS4A 3NQ2A 1XKJA 1H49A 4KH2A 2FDMA 3THCA 4F0LA 2CZDA 2W6RA 4Q6XA 1O60A 2VFHA 3GS6A 3MYPA 1TV4A 1DJXA 1PV8A 1P0DA 4GUGA 2C0HA 2O0TA 1NM9A 3FN9A 2XH2A 2Z1VA 2Q8LA 4AIEA 4ASTA 2GDUA 4L9XA 1UUOA 3LV5A 1H2JA 1ZGDA 1EB3A 1BQGA 3OGVA 3S5SA 2V8ZA 3ICJA 4FNQA 2RDWA 4IPPA 2CC0A 3GAKA 1BYCA 2BOEX 5H8UA 3NOYA 1EEPA 2YW4A 2OYLA 4N9DA 1UKPA 3O07A 2WQDA 3FV9A 2FMOA 4PC8A 4ZVJA 3TJIA 3P5ZA 5L9FA 4AD2A 4G1KA 3CEUA 1M7OA 4ROPA 4DPQA 1HN1A 2PTXA 3UR7A 3B0PA 1Q13A 3N3MA 3G1XA 2C18A 4DWSD 3VDCA 2J62A 4OTKA 4DBWA 1XISA 1IT8A 2NQ5A 4M7SA 4EPEC 2HXUA 3NTYA 1EJWC 3LX9A 2X16A 5JMUA 3RILA 1TVLA 5BU9A 3CIWA 1P6WA 4H8UA 1C8VA 1MEHA 2QF8A 3QPZA 1A5BA 3PVFA 2GUBA 3TA6A 5D9NA 1A0CA 1EKOA 3S2JA 4DZHA 4M80A 1Q4WA 2OVLA 2E68A 3BLEA 2X2YA 1F74A 3OYXA 5J04A 1XKYA 4IQDA 1PHWA 4XKYB 3AIQA 3W84A 3EWCA 4GQBA 4GI6A 3WFLA 3G1RA 1B4EA 3F1QA 1H41A 5HJLA 2BNJA 3CM4A 2JGQA 2V3FA 4HGXA 3SIMA 1UR8A 2JK2A 6ENLA 2VEFA 4M6UA 2YXGA 3QY8A 4LYQA 4LUJA 1G6CA 3G2GA 2QIIA 2X09A 3GW0A 3PF3A 2WXDM 1AL7A 4GGHA 4MAVA 2YBVA 3SEPA 2GVGA 4QG9A 1JYWA 4OOZA 3VIJA 1VBUA 2PWUA 4N9EA 3B9EA 1KRAC 5CJMA 3LZ5A 3QGAC 1TA3B 1UR2A 4M82A 1SR0A 1EZWA 1PX4A 1IQ8A 2J9ZA 3O0FA 2TMDA 3GDRA 1W1YA 2EKCA 3PG8A 1H60A 1MNSA 3CYVA 1N7KA 4E8GA 1TFVA 3BMWA 5LA0A 2ASHA 3TV8A 3M0JA 1XC6A 2OJPA 3CMJA 5AYBA 4WIWA 3IRSA 3IACA 1R9XA 1DXFA 3WLSA 3WYZA 2VL4A 3NOEA 3RCNA 1BXCA 5JIPA 4NI8A 1KLYA 1E6XM 4MADA 5D9OA 1MDLA 3BOFA 3L4TA 4JTAA 2X0SA 1D9EA 1KBJA 3SECA 2CCRA 1IWAA 4IUOA 4PCNA 3VDBA 2OT0A 1JL8A 1CECA 2BGSA 3FKRA 3BCJA 1YTEA 2PF0A 3S47A 3WUGA 1E9LA 2WKJA 2BY0A 2A7NA 2IKJA 5CBBA 4LOCA 1GQKA 4Q32A 4JYEA 1R47A 3CBWA 7ODCA 1V5XA 2BY1A 2ZICA 3BC9A 4OUIA 1VD6A 3OBAA 3FEQA 1DWGM 4HNTA 4M56A 1DE5A 4NAFA 1DVJA 5A2BA 1V6YA 1Z6KA 3FA4A 1E9ZB 3PHAA 3KFTA 1LG1A 4IG2A 5HQLA 4A4AA 3URNA 2H8XA 1ITQA 4IP5A 1TV2A 3LCGA 4X63A 5M5DA 1JUEA 3BW3A 4LCRA 5ENLA 5D2VA 3SCVA 4MAZA 3T8QA 1GYLA 3THAA 4GUFA 1IZJA 3PP7A 2YL8A 1T0OA 1KFBA 4O0ZA 3RF9A 4YMZA 3FFSA 3FY1A 1QWKA 1PYFA 3EDFA 4XD4A 4BHYA 2AGTA 2WJZA 1VRDA 2H90A 3CQ0A 1S5TA 4ONVA 3UZXA 4AX7A 1JDAA 1PO9A 1W9XA 3Q67A 1KKRA 1EJVC 3WQ6A 1VLWA 1R3SA 4WD0A 5A3HA 2BS9A 1U22A 1XLMA 3OG3A 2XZ7A 1GZGA 2A6LA 3RLGA 2Y89A 1I8JA 1KQZA 4A2SA 1QUMA 4NRSA 2Z1WA 5DN1A 1S3HA 3F03K 3QSTA 2PAJA 3B04A 1GG0A 1JCLA 4OECA 3SSJA 1UZ1A 3JS3A 3QHNA 4NQ1A 2E09A 4HN8A 4CQCA 1VBJA 3KCOA 4UTFA 2DIJA 3CMGA 3I6TA 1UPPA 5E5CA 1OZMA 5EMUA 3M46A 3CUGA 1XBXA 3SCQA 2CZVA 3AHYA 3AALA 4ZB5A 3W1TA 1XLDA 1TE6A 3WD1A 1ZS2A 2MNRA 4KWUA 4U31A 2B7NA 4BJHA 3CQJA 3NZ1A 3W7QA 1W32A 4AB4A 1O5RA 2O92A 3PPCA 3HPZA 4A35A 2Q6ZA 1DL3A 5K9DA 2QCDA 1SO6A 2W66A 4F0MA 4LNCA 2Y88A 1SW7A 3V0UA 4R88A 3EOEA 2QULA 4P8XA 3QW3A 3CV7A 3CZ8A 4XBJA 4JY8A 1GGOA 1X98A 3M5ZA 1TJPA 1B30A 4TIMA 3T42A 3MQTA 3PTDA 4MNLA 3H55A 2CKSA 3M0KA 3WNNA 4UZUA 1TWWA 1FWJC 2DZAA 3DFYA 2JF6A 4JTQA 2VFEA 4LS0A 3M47A 1XF0A 3GXNA 5JUVA 3W2UA 3TIMA 1HQTA 1R85A 4UQAA 5FEZA 2PGWA 8XIMA 4B5WA 3JU2A 3A4XA 2PZ0A 4RZ5A 2WMIA 2DPEA 2WNQA 4P7NA 5D30A 2DZUA 4A8LA 1UOZA 4E2OA 2OQYA 3MP3A 4LAZA 3WLKX 2A6NA 1P4CA 4L4LA 1O95A 2INFA 1E0UA 3GC5A 3RO6A 4X9SA 4HCHA 3FHQA 1RP8A 1X1OA 1D3CA 4K37A 1IXPA 2F7FA 4B4HA 4AG0A 3RMEA 1MXGA 3T0AA 2AQOA 3CUIA 3EDEA 1SQ7A 2PDXA 1ONEA 4H2CA 3HJEA 1KCLA 1TV7A 3SDOA 1EWEA 1OFEA 3EDDA 3ZR5A 4Q7BA 2XWDA 4WJXA 4JN7A 4DF1A 2VFFA 3V36A 2G3FA 4NP7A 4JTEA 1S2WA 4DF2A 3U48A 2A0NA 3LGDA 4HPHA 1LLWA 4GVIA 3EX1A 3M0VA 2WM0A 1T96A 4LFYA 3VMPA 1TUFA 3C56A 5G4WA 4NIRA 2VYOA 3ABQA 1L8NA 1FWWA 4R9XA 1JCXA 7REQB 2J7BA 4EF9A 3MI2A 1BF6A 4JTGA 4LYPA 2DFAA 1BYDA 2EHHA 1DP0A 4KGJA 5E6ZA 1XIJA 3HMJG 1QNPA 2EG8A 1VH7A 5AYIA 1RP9A 3IUDA 3HFYA 3GRIA 3SZ8A 1ZAIA 1AW1A 3ARZA 4ZSTA 2UWFA 3OLEA 3F4DA 3LCWA 2V0TA 3P80A 5G5IA 5AHFA 1H5VA 3UWYA 1UJQA 4PRWA 3G24A 1VB9A 2WVVA 1W9DM 3AU6A 4HA1A 1CGUA 1D3GA 4UQCA 3WFAA 3WMCA 5BXTA 3W7CA 3INPA 2WCGA 4XZ9A 4ERIA 4IP4A 3JR2A 5C71A 1X6NA 3FGCA 3PZ9A 4Y96A 1EL3A 2Z7KA 4G7FA 4JHZA 1KWGA 2HPMA 1DHPA 3WF0A 4TMCA 4PTWA 1TZZA 3NCOA 5IFTA 1RR2A 4C1NA 3GXTA 1KQYA 1KM0A 4I90A 2NQLA 1E71M 1LCOA 4XKMA 4AX6A 4IMAA 2CLMA 3I10A 2FVMA 4KS0A 1Q85A 4PEEA 2GVEA 3SSZA 1DORA 2A3HA 1OG6A 3OPSA 3NXLA 2YYTA 4MUZA 4DXXA 2EGZA 2GJLA 4CU7A 3CUZA 4ORIA 5BRQA 3W4RA 1CX9A 1KV5A 5IDIA 4JIPA 2QDEA 3S2LA 3H7VA 5D2YA 5F4WA 1NDYA 3W38A 3W22A 1K9EA 3JVAA 1EBHA 1UQZA 2WJDA 3H54A 3BCFA 3EOLA 4MWAE 4CQAA 1OADA 1M7XA 1HTIA 1KO0A 5I06A 2HNEA 1M1BA 4PYSA 1JR1A 1ISVA 4S3EA 4XQ6A 4C7GA 1FWNA 4UNIA 3BE7A 1J93A 4TR9A 1EOMA 2TYSA 1HP4A 2A3BA 2J6VA 4AZ5A 3LRLA 2FB3A 5D05A 2DORA 3UCCA 4AIOA 1EIBA 4AVFA 1CWYA 4LU0A 2Q02A 4IZGA 4GIYA 4JHOA 1B1YA 2CERA 4GHRA 2WOQA 5ECUA 5DT5A 4ERGA 4AH7A 1LOLA 5LIWX 3T0TA 3TP4A 2EF9A 4DXVA 4XB3A 2IKIA 3UG4A 3THUA 1V77A 3B0VC 1DJGA 4RE4A 3BQ5A 1VEPA 3TYUA 2DT3A 5DMMA 3SY1A 4Q8VA 1Q66A 1SR9A 3WUBA 1RJPA 5HWNA 1P48A 1LBLA 2YKKA 4FNUA 3SFKA 8XIAA 3KVJA 2DZBA 4Z1DA 3KOWA 1UKOA 3MV01 1WAWA 3GX9A 1CBGA 1UD8A 2AAAA 3Q37A 4TXEA 2QDGA 2W61A 3V0SA 3VOHA 1LBMA 4DBSA 1K4GA 3I3EA 5AYXA 3UJEA 1PIGA 3NL6A 4OJYA 1JXKA 2UY2A 2VP8A 3OIXA 4H04A 4H19A 3KHDA 2QUUA 5AVNA 1WKFA 2Z25A 3K4AA 4DBEA 3UGVA 1H7RA 4Z0SA 1J96A 3TAOA 4EE9A 3G8EA 1VEOA 2V6AA 3VKCA 5CC7A 2ZRYA 1OQFA 4EIVA 3UA3A 4X2RA 1GVQA 3UWEA 4XZBA 2O9OA 3GVQA 1PKLA 1WZMA 3IIOA 3GDBA 3OW1A 1CENA 4JGDA 3G18A 4UIOA 1U5VA 1EA9C 3MCMA 3L5LA 1FUYA 3L2IA 4HNLA 1WB0A 3WQVA 3FGCB 2AL2A 3DGRA 2CHOA 2BHYA 1VFUA 2D0FA 1XD1A 2W67A 2Y5SA 4ZOBA 3TDFA 4J40A 1C91A 5HXMA 3TR2A 3HPXA 2G4FA 3GFYA 2PTYA 3WD0A 3CAKA 1ICPA 4JTKA 2G3JA 3R7MA 3L68A 2G3IA 5KSWA 1AD4A 2NV2A 4GRSA 3ZVHA 3FVMA 4NX0A 2FGLA 2ZX5A 1DWJM 1RPXA 3KDOA 4OE7A 1VFHA 3G1YA 5LNWA 2F84A 1LQ2A 3QY6A 3VA8A 1DWHM 4Z2LA 4GVFA 2PWEA 5B80A 4EOUA 4HMNA 4DY1A 1K8XA 3RDKA 5DCEA 1Z32X 1A80A 3PZIA 1XV8A 2E77A 4BQ5A 3M5VA 3ZQ9A 3VKAA 4CNOA 3VC5A 2R8WA 3E6EA 5CG0A 2VGFA 4GACA 1DQUA 2A85A 4LVFA 2YPIA 4XVDA 1WKEA 4ZEPA 2B0MA 1JAEA 4RUBA 3TTOA 4JTIA 1RALA 4Y8EA 4LH8A 3TW6A 2OLHA 1YNPA 1EF3A 3CUFA 1ZQ5A 4IGNA 3RG6A 4HHHA 2EPOA 1AA1B 4QS6A 3C3NA 3CZJA 2ISDA 1QNQA 1FDZA 2CXEA 3AS2A 1RZMA 4IJRA 3OVPA 3TVAA 5JQ9A 2PZNA 3G77A 3D47A 1R9ZA 4PB4A 3UYIA 3UQNA 3T2PA 2EPHA 2R14A 3AIVA 2Q3OA 4PMUA 3F7JA 3VPLA 3LBCA 4ILSA 3BAWA 1KFEA 3ABZA 3NSMA 1MFVA 3OO2A 4Y6GA 1KBIA 3BJSA 2WJFA 2WC3A 1GQJA 1SFLA 1OC5A 1OC6A 1B2YA 3IGSA 2UV8G 1DV7A 1M6JA 1OFAA 3W81A 2OSYA 2R1NA 4AD4A 2W3ZA 1IIHA 1D7KA 4R7JA 1B57A 4OBRA 1F76A 4CQ8A 1SO3A 1J79A 4WOZA 3QC0A 1FBAA 4A2RA 2DGAA 2GZXA 1KA9F 3UR5A 2YL9A 1CIUA 3DYOA 2FTPA 1PPIA 1A5UA 2QJHA 3WNOA 6REQA 2C8NA 2Z6IA 3CO8A 3TYBA 4IM4A 4HJWA 1F6KA 2QIWA 3LNMA 4CCEA 1P43A 3BWWA 3TOYA 1W1PA 2ZA3A 1W91A 4OUEA 5CCZA 2XIBA 2VEPA 1KR1A 3L4ZA 1A0EA 1V3HA 2P0OA 1WKDA 4Q4OA 5HDRA 3T4WA 2AMXA 1XQLA 2OX1A 4AC7C 1B9ZA 4GBDA 2V67A 4LUSA 1YQ2A 5ABTA 3A47A 1AH0A 2ZRZA 2B81A 2ZA1A 4Q4QA 4UTUA 4HNCA 1U5JA 3L67A 2PWFA 3OTRA 4NAEB 2V69A 2ZZ7A 1KR0A 1Q6FA 1Y5XA 2NQ9A 1MNZA 1DQWA 1KM6A 4L6DA 5LXXA 4J3TA 4WXZA 1JYNA 1A53A 5FCZA 2GDVA 3R10A 4NSBA 1TPUA 3UF9A 1ZRQA 2GSEA 3GDMA 3M0XA 4ZR8A 1KKOA 4JTCA 1KM1A 3MSRA 3ZLHA 3CL7A 1RY8A 2BVWA 3RU8