1I6NA

1.8 a crystal structure of ioli protein with a binding zinc atom
Total Genus 111
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
111
sequence length
278
structure length
278
Chain Sequence
b'MKLCFNEATTLENSNLKLDLELCEKHGYDYIEIRTMDKLPEYLKDHSLDDLAEYFQTHHIKPLALNALVFFNNRDEKGHNEIITEFKGMMETCKTLGVKYVVAVPLVTEQKIVKEEIKKSSVDVLTELSDIAEPYGVKIALEFVGHPQCTVNTFEQAYEIVNTVNRDNVGLVLDSFHFHAMGSNIESLKQADGKKIFIYHIDDTEDFPIGFLTDEDRVWPGQGAIDLDAHLSALKEIGFSDVVSVELFRPEYYKLTAEEAIQTAKKTTVDVVSKYFSM'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords IOLI PROTEIN
molecule tags Structural genomics, unknown function
source organism Bacillus subtilis
publication title Crystal structure of Bacillus subtilis ioli shows endonuclase IV fold with altered Zn binding.
pubmed doi rcsb
total genus 111
structure length 278
sequence length 278
ec nomenclature ec 5.3.99.11: 2-keto-myo-inositol isomerase.
pdb deposition date 2001-03-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01261 AP_endonuc_2 Xylose isomerase-like TIM barrel
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.150 Alpha Beta Alpha-Beta Barrel TIM Barrel Divalent-metal-dependent TIM barrel enzymes 1i6nA00
1DIEA 1XYAA 2G4JA 3KCLA 1DE6A 4X61A 3BZGA 3UA4A 2G0WA 8XIAA 1MNZA 4A8NA 1XLAA 2NQHA 9XIAA 1XLKA 1XYBA 3XINA 1XLFA 5AVNA 3M0MA 3TVAA 4E3VA 1D8WA 1XLLA 4YTQA 3KBJA 3GNXA 4A8IA 3KBNA 3ITTA 8XIMA 3KTCA 1I60A 3C0SA 4HHMA 3M0LA 1XLJA 3UXIA 3VNLA 4ZB0A 1XICA 4GQBA 3CQKA 1XLBA 2ZVRA 5EMMA 4XSMA 4OVXA 5XIMA 1XIBA 4PGLA 5AVHA 4X60A 5XINA 4HNOA 3VYLA 2Q02A 3VNMA 1CLKA 3UU0A 7XIMA 4W4QA 1OADA 3CWHA 2GVEA 4XIMA 4PFHA 3CQJA 4XSLA 3TC3A 1XLCA 4QEHA 1K77A 5FA5A 4EAYA 3WQOA 3L23A 1S5NA 5H1WA 3QC0A 4QEEA 1A0DA 5H6HA 3NGFA 2NQ9A 1QT1A 2HK1A 3AALA 3IUIA 2XISA 3ITYA 4YTUA 5EMKA 4QE5A 1TZ9A 4QDPA 3CQHA 4HHLA 3KBMA 2I57A 4A8RA 3P14A 1XLIA 4GJJA 4Q7IA 4QDWA 4ZB5A 3LMZA 2QW5A 1XIHA 1DXIA 4HGXA 5EMLA 3KBVA 3BANA 4YTRA 3XISA 1XIDA 1QUMA 1XINA 3JU2A 3C0QA 4X63A 4GJIA 3VNKA 4G56A 4J4KA 2HK0A 1DE5A 4EACA 1YX1A 5B7ZA 1S5MA 2X7VA 2NQJA 1XIMA 1XLMA 1XIJA 3KBSA 1XISA 4KW2A 4ZB2A 5B80A 3KCJA 1DIDA 3BWWA 3ITOA 2GLKA 4A8LA 3ITVA 2GYIA 1XLGA 5EMJA 3CQIA 3P6LA 4DVOA 6XIMA 5C9ZA 3FVMA 3KCOA 3IUHA 3OBEA 4YTTA 3U0HA 3QXBA 2ZDSA 1QTWA 4XIAA 3AAMA 3ITXA 1XIFA 4DUOA 3QZAA 1XYMA 4QE1A 3VNJA 4XISA 4LNCA 4QE4A 3CNYA 1XIIA 1O1HA 2I56A 1BXCA 1XLEA 3BDKA 3AYTA 3XIMA 3DBNA 4K1GA 3UA3A 2XINA 5J8LA 3C0LA 3M0HA 5I7GA 2X7WA 2OU4A 4XKMA 5TNVA 2J6VA 3U3HA 1GW9A 1A0EA 3VNIA 1MUWA 3M0VA 4ZBCA 1XP3A 5B7YA 5XIAA 9XIMA 4GLEA 1XYLA 2HCVA 3N4AA 4K3ZA 2QULA 3UVAA 3KBWA 4US6A 3ITLA 3M0XA 1XLDA 2GUBA 1I6NA 2QUMA 2QUNA 1XIEA 4YTSA 6XIAA 3IUDA 1XYCA 1BXBA 3M0YA 2XIMA 3BZJA 3AYVA 1XLHA 1XIGA 1A0CA 3KWSA 3DX5A 3QYSA
chains in the Genus database with same CATH superfamily
4DZIA 1ONWA 1SJDA 2JEQA 3TQVA 3NOEA 1NARA 1R3VA 4N9DA 4ZTXA 3AU6A 3S5NA 1UP2A 2V30A 3RMEA 4RV8A 1UB3A 4ORMA 2XUCA 5I3GA 1B3ZA 1F05A 3FV9A 2PDFA 4O28A 4XD6A 4PUDA 1K03A 3WD1A 5C9XA 4NRSA 1K77A 5A8NA 3NL5A 4P7QA 4LEFA 2E09A 5A6LA 1QNOA 3SURA 1YPIA 3QKEA 3W87A 3NSNA 1T5AA 3L4TA 4NZ3A 3KVLA 3DESA 3THUA 1TKKA 3MHGA 3TNBA 4GXWA 2A85A 2ZDRA 3UF9A 3LHUA 3Q65A 4HT3A 3SUSA 1F73A 4FLOA 1IZJA 3WZ0E 4WF7A 1JUEA 2IPGA 2V3FA 4TX8A 1OT2A 2CCRA 4GZIA 1PV8A 2O55A 3FIGA 4IFKA 2XYLA 2OT1A 4UR8A 3B4UA 1PL9A 2HE8A 3WQVA 3HURA 1D3GA 3AMCA 3TYEA 4J2PA 1QOQA 3O9NA 5LHFA 2Y6ZA 1F6YA 2XN0A 1TUXA 3O0KA 1ICPA 5IBXA 3LHTA 1HN1A 3GFXA 6REQB 3WQCA 3BGJA 2XGZA 3RJYA 3P2VA 1ZP4A 2ZXQA 3VUPA 3BV4A 1W56A 1RPKA 2H8ZA 2GVEA 2Z1SA 4YIWA 3I7SA 1XL9A 2OEKA 4GYPA 3NO3A 4UC5A 3UNTA 1TWZA 3UXLA 4XWUA 2YCEA 1S1RA 2R82A 1WOBA 4NSBA 1EOMA 3PANA 2J7FA 1XINA 2D3NA 4JQ2A 1M7JA 2ZADA 4HOZA 4J3ZA 1QOXA 3FEMA 3MHUA 3WNNA 2WCGA 2JBMA 4US5D 2NQJA 1XIJA 4ZB2A 4XZBA 2BXZA 1XF0A 2ZRYA 3GM8A 3UG3A 1J01A 1J12A 5AB3A 4DO6A 2PTYA 3W76A 4E2OA 1K7FA 3B0VC 1AD1A 4XZLX 3EDJA 4ILSA 3LPPA 4I7UA 3W1QA 2OU4A 3HFYA 1LRQA 5CJMA 2A5HA 2OGJA 2Z7GA 4PMDA 3AS1A 3MKVA 1FVPA 1UWAA 5D2TA 3VOCA 3WBXA 3TN5A 1NF7A 2DZTA 4HNCA 4Z1BA 3T4WA 5C2CA 4C7GA 5BXPA 2FHCA 3S47A 1QJWA 3S2LA 2FH8A 5CKSA 3S1XA 3W28A 4TVCA 3G2GA 5C2XA 1R47A 3EX4A 1GKPA 5CCZA 4U2ZA 3IV3A 1BG9A 1VLIA 3JR2A 4AX6A 1NU5A 1Y5WA 4KWVA 5KZDA 1OJXA 4UQCA 3CQJA 4A35A 4L65A 3WEOA 5A6JA 1TMLA 3GU1A 3E5BA 2Z2BA 3LY0A 3WJWA 1WX0A 1LBLA 2ZVIA 4HHLA 4QDWA 4A2SA 4D8LA 2D24A 1PWLA 3A64A 1XXXA 3L7RA 1WDWA 1DQUA 3WL0A 3RPMA 1MRAA 4TUFA 3EDFA 4H6RA 5I77A 1HNYA 5B80A 3S2NA 1RBOB 4IM4A 2I7GA 1W1ZA 3GVVA 3UJSA 1PX8A 1VEOA 1PSCA 3R10A 5ABHA 4GIEA 4MLRA 1ME8A 3H55A 1J5SA 1E0XA 3HG5A 3KVKA 4FOJA 4WRHA 1LRTA 4RUBA 2VCAA 4IP4A 3G3DA 3M0HA 1SW0A 3VNIA 1KFBA 2HISA 1S2AA 4MJ2A 4WSKA 2CKRA 1KLYA 4AU0A 4C1NA 2B81A 4JN8A 1BXBA 3W27A 2CWNA 1PDZA 2B7QA 1XYAA 3KCLA 4X61A 1WNOA 2Y88A 3JS3A 3AUJA 2Z25A 1DJHA 3WLPA 4EKJA 3MKKA 3BO9A 5HDRA 2JE8A 1CWYA 1RBLA 4MVAA 5CPSA 5GPRA 2E8ZA 1IIHA 3CTTA 2X05A 1B1YA 1FHVA 1JUKA 3OGVA 4O11A 3VIGA 3PG8A 2CYGA 3EB4A 2W3ZA 3TV8A 1OZQA 4QROA 5GNZA 1TMQA 3H2MA 1CX9A 4FOKA 6ALDA 1QO5A 3JZUA 2ISDA 2CLHA 2NXHA 3EWDA 4S39A 3OLGA 4OGZA 4EXBA 2Y61A 3KRZA 3T1GA 4DXVA 1XPYA 3VE9A 3LMZA 3BSMA 1DXIA 2P0OA 5FF3A 4IPLA 4PB3A 4YJ5A 4YLWA 3AJXA 3FAWA 4RW5A 3BVJA 5LYRA 5A8GA 1PX4A 1XWYA 1HKVA 1YPXA 5HNNA 2VT0A 5I3KA 4LRSA 4TTUA 4N6FA 5F2MA 4XTIA 4KFPA 3DH7A 2XSBA 4AYGA 1B3VA 1B9ZA 2VXNA 4YPJA 4XD5A 5GJNA 4M6QA 3D3FA 3WX7A 2W4XA 2UY5A 3XIMA 3RIKA 1VAHA 1CXEA 1FTXA 1IXQA 3CZ8A 1TTJA 4JTJA 3VI2A 1FOBA 3BAJA 3NQGA 3PZGA 2EBNA 3NDYA 3AMGA 4DM1A 4O18A 1JRCA 5IDIA 1HL2A 1I2RA 1PKNA 3DHPA 5D2VA 3CV7A 4H8UA 1CNVA 2XFWA 2XVLA 1D8WA 4AIBA 3FOKA 4EPEC 2E1DA 2VR2A 3OW1A 3RCMA 3MMWA 1DVJA 3IJQA 1X96A 4KMQA 4RXGA 2J74A 4PTXA 1L2UA 2CBUA 4D9PA 3BARA 1TJPA 4F0SA 2RDWA 3U2OA 1UIPA 2VVSA 5LA1A 4HU8A 3IVSA 2REQB 3B4YA 3HJEA 3HU7A 3GVQA 3AHXA 4R85A 1AQ0A 1PCKA 5FL0A 4U4MA 3CS2A 5KEZA 3EWXA 2H6RA 3EMCA 2YL9A 2GGEA 1O6IA 3APTA 5DRCA 1PIFA 3WMSA 4IF2A 1Y65A 2D2OA 1FP8A 4F0KA 4M1RA 2G37A 5HA7A 2I1OA 2CLOA 1FFRA 5CPOA 4WJXA 3V18A 3A3WA 2C18A 2ZQ0A 1LDCA 4LT9A 4XD4A 3TLLA 3W7PA 1TTIA 3NQVA 2QIIA 1W9VA 3EPMA 1WKEA 1UUOA 1UKSA 3EX1A 1NDYA 1ZPTA 2WHJA 1ICSA 1FRBA 4QLJA 4GC3A 3CT2A 1TA3A 1SSDA 5CZSA 1R87A 2G0WA 3BJTA 1QNPA 4C6FA 4YCOA 3S2JA 4B4FA 5EGRA 1IEIA 3G22A 3U5UA 2VEMA 4L4MA 3LCWA 1XLJA 1MO0A 3UCCA 1I2PA 1HL9A 1P1XA 2WJEA 3S9YA 1H7RA 3ELFA 3F2BA 3BGAA 5G2WA 1SQ7A 5DMYA 2CHOA 2V2HA 1SZRA 1YIXA 2J8FA 3LENA 3PBWA 2YYUA 3FHAA 1KR0A 3A23A 3I7RA 2OZ8A 2Z29A 3KVJA 4NU7A 3REQB 4AWEA 2PWEA 3KOYA 2DSUA 1W3NA 4M6PA 1QUMA 3N19B 1PZ0A 3WYZA 2ZRVA 5AY7A 3TDFA 2DFAA 4DF1A 2GSJA 3M0KA 4MG4A 1ZCOA 3PAOA 4KF1A 4JX6A 1VBRA 4LVFA 1M68A 4KWSA 5FJRA 2ZZ3A 4AYSA 4LC6A 3IIZA 3E02A 5A1AA 1MZHA 1XQKA 1KCXA 2PRMA 5F2IA 4PTMA 3F4CA 3T42A 4V1YA 1BQGA 1CGUA 4GABA 4V15A 3DC0A 1A3HA 4GLEA 4KFOA 5TF0A 1M7OA 3GDKA 4NF7A 4IQDA 1ENUA 2OYMA 1V3IA 4QXIA 4K1WA 4K39A 4YTSA 3QV7A 4NI8A 1P7TB 1PZ2A 2HMCA 3CQ0A 3T55A 3GG8A 1O94A 1ADOA 3PB0A 3V4BA 1WUEA 1X1NA 2WPBA 4IMAA 3C8FA 2KAUC 3TJ4A 1LLOA 3E2SA 4GMEA 3PNZA 4LYQA 1EUNA 1JRBA 3P81A 1BYBA 4NZ4A 4CLMA 1HXJA 1YNYA 2F38A 1WPCA 1EL3A 4L7ZA 3HMCA 4E2DA 4BQ5A 1VJZA 4LSBA 2X40A 5C55A 2XM1A 1OF6A 4W7WA 5DMMA 1XH1A 1KBKA 1XX1A 4FX7A 4P61A 3VGGA 3CAKA 3OBKA 2CLKA 4Z2IA 1X97A 3GTIA 4H2HA 4FALA 2EAWA 2EPHA 1SJAA 3TFCA 2KZHA 4MUZA 2V8ZA 3PC0A 5D9MA 4DJFD 1W9UA 4S3GA 4CU7A 4LNYA 4PCNA 2Y7GA 4DVOA 1OFOA 4NUWA 2OSWA 3SQSA 4IXHA 4DI9A 3L5MA 4FXSA 4IT1A 3K46A 1EHNA 2ON3A 1WBJA 4D1IA 4XBSA 4Q8QA 1W1B1 2GZXA 1H41A 1J96A 3FW6A 5BOOA 4TVDA 4LS2A 1NWRA 1NWTA 3NNTA 2YSWA 1GCYA 1J8VA 1PHWA 3SEPA 2B7NA 1MXDA 3KE0A 4UNIA 1KM6A 1C8VA 1E5JA 4CNOA 3NO5A 4QCEA 3UZ5A 3A4WA 1HJVA 4TO8A 2WC7A 1UA3A 1A5AA 1U1JA 2QJIA 3UPMA 1KBLA 3GHRA 1C7TA 1R3SA 1L2QA 4O57A 4O17A 1A5NC 2V9DA 5IRPA 3PTDA 3QZ6A 4NL1A 3UP8A 2Q6ZA 2E68A 4IP7A 2YLAA 3L0KA 4CD7A 4MJZA 4PB4A 4CQDA 4AEOA 4QG9A 4X0VA 3UPWA 4J2MA 1L6SA 3SFWA 3WLRA 4Z2JA 3W7LA 3H7RA 1O5RA 3PY2A 1UC5A 1OC6A 3W1RA 2Z6JA 5I09A 1WXYA 2AAAA 4JTDA 3LGEA 4JFTA 5LA0A 3FJLA 3S5YA 4POCA 2CLFA 3EGJA 3D3AA 3TW9A 3VMOA 3PN8A 3OLIA 4HMDA 3NDZA 2DPEA 4ZQCA 4P7NA 1PB0A 3REQA 3CV1A 1TV4A 4PZVA 4EOUA 4HA3A 4UR9A 3WJZA 1E6SM 2GOKA 5C9ZA 3FVMA 5E5CA 1FXPA 4HCLA 4XTDA 2G5WA 3VFCA 4M5PA 3GDTA 2PCQA 5FF2A 3YPIA 2VUYA 4MZYA 4FPSA 4L4PA 2OQLA 3W7RA 5CSYA 4AWTA 3CHEA 1UD6A 1YHTA 2Y85A 4P5UA 2X1UA 1PZ1A 4ADTA 3PZ9A 3TYUA 3QR0A 4GVFA 3DYPA 4B2DD 4QIUA 1TV2A 2WVVB 3H7VA 2WMIA 5E0CA 5SWUA 2VRQA 1V79A 1BSIA 1GW1A 4PCTA 4DJED 3POHA 5CPMA 5IHRA 4R7JA 2DGAA 3OZOA 3PZIA 3TC3A 1MXSA 1KM3A 1XSIA 4NT0A 2DZWA 1ECQA 2Q09A 1YTEA 3ITYA 2X1IA 2QLYA 2ZYFA 2C14A 1K9EA 2WYSA 5BW6A 2A3HA 4PH6A 3VOIA 1Q8JA 3LHZA 3NVTA 1LYXA 1JDAA 3BLKA 3DBPA 4G6CA 3UT0A 4AIUA 3KBSA 4DBSA 2BX7A 5DX7A 2GSHA 1NIUA 1MEIA 1NP2A 1YXDA 4QSFA 5FSEC 4DUOA 3QZAA 1N7KA 1REQB 2WKGA 3DG3A 3B0YA 1HFBA 2VEKA 4WSJA 3DC8A 2J27A 2PGWA 1OFAA 4AX7A 4FR6A 4HYWA 1V02E 2BOFX 2VURA 4DZ5A 3UVAA 4Z42C 2C1IA 2PGFA 2BDQA 4H6KA 1W3KA 2WZTA 3PBVA 2QCDA 2QGHA 4O1CA 3AQUA 4IIEA 4X3ZA 1HT6A 1VR6A 2NX1A 3E3HA 4QTGA 2QIWA 3ONCA 1GKRA 5D04C 3HPFA 4I90A 3VINA 5CJNA 4I9JA 1I1XA 2RGLA 1BSLA 1FCUA 1U5HA 5CG0A 1KC7A 1JCNA 4F9JA 4DHGA 3GFZA 3WLQA 3G1VA 4Z2GA 4U3AA 2DT3A 1VD6A 2C8NA 3DYOA 5C7VA 3NAVA 4J3XA 1E6RA 1YDOA 3EA1A 3M5XA 2BWGA 2QF7A 4QLLA 4UQAA 3NL3A 1OBAA 2X30A 5AYZA 3KX6A 1WO2A 4IGHA 3UZZA 3WD2A 4ZTYA 4B3KA 2HV5A 7TAAA 1H7PA 4NG3A 1UA7A 2YFOA 4GNKB 1WAWA 3DHDA 3EX3A 4IMCA 2PBGA 3V5OA 2J25A 4X9YA 1XYMA 3V0UA 2FKPA 4JIQA 3MMUA 5GNYA 3W7HA 2FZ9A 4PUMA 2H3BA 5LIKX 1RD6A 1WDQA 1FUYA 2XHYA 4FXJA 4A3QA 3RUBL 5ABTA 1H7XA 1RK6A 2QDEA 3G0SA 1TJ0A 4AF0A 4AC1X 3G24A 3LLFA 1TPC1 3MVIA 1UZ4A 1UH3A 1UWSA 3A22A 1F4HA 1KKRA 2WZMA 1VYPX 2YBUA 3M0MA 1W1IE 5C54A 3LDVA 1I60A 3AIBA 4WLCA 4LC8A 5FJUA 7ODCA 4L9ZA 3CQKA 2BGQA 4JPGA 1XYFA 2XH2A 2ATSA 2PE4A 3QR1A 2V5KA 3T0BA 3RX2A 4IPNB 3FXYA 4Q8VA 4PBEA 2OSYA 3ZOAA 3VCNA 4C6IA 2X16A 1JUBA 3T78A 2YPIA 2QDHA 2C3ZA 3NZPA 1TVNA 2O9OA 4F40A 4R7WA 1FDJA 3AIEA 3I3DA 2E8YA 3ZR6A 2VUNA 2W0UA 2NLYA 1SZNA 1UWIA 3TYZA 1X6NA 3HB9A 3U7BA 3CXOA 2F6UA 4GFSA 3W1PA 1RZMA 4JS3A 1O5QA 4XAFA 3OIHA 4IMDA 3T07A 4PYSA 3W84A 1PBGA 5D30A 4XKYA 1OHLA 3EKZA 5A94A 1XLEA 1BAGA 2PDNA 5J8LA 1U5VA 4N9CA 1VYSX 1KM5A 4L6DA 1F9CA 4Z17A 3TU9A 3AIQA 1B4KA 2NVDA 4BEQA 4MKSA 4DYEA 1OC7A 3GSMA 1XCXA 3WF0A 1THFD 4O1DA 1P6WA 3NQDA 2VENA 1GPWA 3AI0A 3EOOA 4REQB 2C16A 1VBGA 3RM9A 4MDPA 1A5CA 3QHMA 3W6MA 3BICA 3URBA 1Q7MA 3H7UA 1Z41A 4O1AA 2H8XA 4JKLA 4FP1A 1OGGA 2WV8A 3CQHA 1MW0A 1NELA 2PRHA 1JZ3A 1QU4A 2MANA 2C15A 4BWLC 1EC7A 1O68A 1C91A 5I6SA 1EBHA 1JI1A 4IL2A 1T7LA 1C8XA 3IAPA 3W86A 5IFPA 3CEUA 2DSKA 2JIWA 4OECA 3W7GA 1V0NA 2GLKA 3TIMA 1DJGA 3O1NA 3OBEA 3EDDA 2E5DA 1U30A 3AZSA 1AQFA 2QPXA 4TX6A 4Y9OA 3ZQ9A 3NQCA 1ZJIA 4L4OA 4DELA 2R1NA 1FKWA 3EZ4A 2PDKA 3R1ZA 4U5KA 3T2OA 3SI9A 3E2RA 2YBTA 3KBWA 4KRUA 2FPTA 4WY0A 2JKEA 1LRNA 3IUDA 1JI2A 1XGDA 2VX7A 1EA9C 4MNLA 2Z2UA 3ZS4A 4OOUA 4R34A 3WMLA 3T44A 4EANA 3TZNA 3TQ0A 4B5WA 3W2MA 4KCVA 1HVXA 4LB3A 4W7UA 4NZFA 2VFIA 4XUGA 3VZXA 5FEPA 3UGRA 1AW1A 7A3HA 3G1FA 3H2NA 1UPMB 3OO2A 2ZXAA 2VC9A 2WSPA 1X98A 1VHNA 3HV8A 1PWMA 3LA4A 1VHCA 2CIPA 4JQ3A 1UOKA 2QYGA 4IMGA 4JX4A 1UPPA 3M16A 3L23A 5HR7A 2ACUA 4QE5A 1LUCA 1MQQA 3F5KA 2GUUA 3MCOA 2X2YA 5K9DA 3VD4A 1FQ0A 4MMWA 4UTUA 2OWXA 3GE7A 3LERA 3SCWA 5IHSA 1S5MA 3B3DA 4YCPA 2ZXBA 1F3EA 4I7WA 2G3NA 4FF7A 1GG0A 2GJLA 1D2KA 1A53A 1K02A 3LM3A 4PTNA 3RYSA 4L80A 3P8IA 3LHWA 3TSMA 2ACQA 2QCHA 1Z44A 1UMLA 4IJCA 2YXXA 3CPUA 4J5NA 2VKZG 2OOGA 1UJPA 1JL8A 4H00A 3HN3A 3PTKA 1IV8A 5T9CE 3P80A 2IW0A 3DFOA 2NUYA 4ADUA 5D32A 3FXGA 2E6FA 2D23A 5GQBA 2VC7A 2CXEA 5I3DA 1I45A 1H1YA 3HM7A 2VC5A 2Y70A 2NSXA 4S3EA 3QPYA 4CNSA 3O8AA 9RUBA 1RHCA 3IANA 2ALRA 3ZVIA 2E40A 4PUWA 4A3RA 1H5YA 3POCA 4A3YA 1BWVA 4HNNA 1CENA 3Q4DA 4J3WA 4W5UA 2BTMA 3F2DA 3UY8A 2DVUA 3AS3A 2D69A 3GC2A 4D8AA 2Q3RA 2VDGA 1E4LA 2PUZA 2BFGA 1TWWA 2Y5SA 2Y4SA 3B04A 4DBEA 1TIWA 1W32A 2YFNA 4YTUA 1VGAA 3VMNA 3NQBA 2HVOA 2OVLA 2Z26A 3H54A 3FA4A 4FNSA 4RE2A 3KBVA 3V0SA 1EBGA 1DXFA 1OFQA 3QEZA 3LX9A 5DMLA 1S46A 1G7VA 1M5WA 4HHPA 2R1MA 2ZC8A 4M3PA 3QM3A 3OBAA 1AW2A 4C90A 1HZYA 3UYIA 1UCWA 1OG0A 1K4GA 4BQ2A 4Q4PA 3GKAA 4I9TA 4HYVA 3AXXA 1W17A 5HWNA 3LGGA 2R1LA 5I3FA 2C71A 4GIAA 3TR9A 3A3XA 4O1EA 2DZAA 5A8OA 1TPEA 3M0ZA 4LCRA 4DWSC 3ANYA 1JCTA 3TA9A 1YQ2A 5REQB 2WVSA 4DUWA 4MB1A 1QRQA 3NFUA 1QI4A 1XYBA 3L0NA 1OFEA 4ZSUA 1CW2A 5J04A 4DN1A 4ACZB 4GI8A 3BG3A 2CETA 4TQTA 3PK7A 2F6XA 1Q4WA 3TC6A 4AEFA 3TYBA 2Q02A 1KBBA 4F0RA 4E2VA 1DIKA 3LRLA 4ZQNA 1OFPA 4QAWA 1V8EA 3GZ3A 4PCPA 5DXYA 3AS2A 1VPXA 3OVRA 2ZUNA 1J6OA 5ECVA 1FHUA 3VNKA 2OELA 3T7VA 4ATWA 1SO5A 4JR5A 4C91A 3GC4A 3VFLA 5I5RA 1S5WA 2XVNA 1DJIA 1POKA 3C0JA 4Z0SA 1UH2A 4Q8WA 1DIDA 4V2XA 3LQGA 5CZKA 4ZQPA 1DJQA 1RH9A 3TE9A 3QFWA 4UTKA 1P1MA 4NVTA 1YXCA 2VGFA 1VYRA 1JVNA 3SUUA 1Q65A 1TV3A 1ONXA 4ICCX 2NW0A 2OGYA 2LLEA 6TAAA 1YKWA 4PEKA 3W38A 8A3HA 4AAJA 3C3UA 2ZX5A 5KETA 3V36A 3FYYA 1OX6A 1LCOA 1Z9AA 4BR1A 3TWAA 2NVAA 2WMKA 2PI6A 4DI8A 1AJZA 1FWBC 2PDWA 3PTQA 1XLLA 4WJ8A 3MDUA 2VYOA 3T2PA 3K2GA 1RALA 3BE7A 4GQBA 2BSLA 3WUBA 3QR3A 4GBUA 5I24A 2ZIDA 4GZJA 4UCGA 4N9BA 1OX4A 1SZEA 2E6AA 4JTHA 1Q63A 4L1XA 4JTGA 3CPRA 4ZXLA 3N6QA 4IGNA 4LAUA 4PSRA 1VCFA 3A3HA 4O0ZA 4K8EA 1M53A 3WQGA 4OWGA 3U6WA 1CBGA 1Q6EA 3B9DA 3RHGA 3PBYA 3C2OA 4RLIA 3EWBX 1T0OA 5FJPA 1ONRA 2X09A 1W9PA 1OCQA 4MZ8A 4QJ4B 1ZNNA 3ERPA 4DAIA 3RX4A 3IGHX 1I1WA 5CBIA 2V2DA 4TMCA 1SFSA 1UP0A 3SUVA 5HMSA 3DG6A 3DI1A 3SRDA 5KITA 4WD0A 2GJRA 1NEYA 2IXVA 4MY1A 2I5IA 1D3HA 3LPOA 4OUEA 3QY7A 3GNNA 5CLTA 1TX0A 4QJ5B 3VDGA 3GXIA 3V3WA 1LG2A 1UP3A 1KRMA 1VFUA 2P8BA 5HJLA 3M7SA 3B8TA 4O19A 2AGTA 5FL1A 4H8NA 5T91A 2WSQA 2WMIB 5FD0A 3BXWA 3VKBA 3MC5A 4QCFA 4RNIA 2CKSA 3EAUA 3NWRA 4AWUA 3BV7A 3H2EA 4Q8TA 2PZNA 1BXNA 4NILA 5CAHA 3AXKA 1CPUA 1ME7A 4OTKA 3QMSA 4RDYA 4LF1A 3GG0A 1PIIA 3MCMA 3JUGA 3QV8A 4UTWC 3JZEA 4P7RA 4Q7NA 3TFXA 4V28A 5EMLA 3LMYA 3LTSA 1M41A 3CM4A 4H41A 4J1OA 3VOGA 3COTA 3PSVA 2FPVA 3P5YA 3LV5A 3JRKA 2WBGA 1SZGA 2DT1A 2PDHA 3MYOA 2YLLA 2OZ0A 3Q37A 4BI5A 3IARA 6XIMA 3NQ6A 2H9AB 4PCSA 4Y90A 5BOEA 2DV0A 3SJ3A 1RVGA 3TH6A 3GXFA 2HNHA 4XISA 3R89A 1O1ZA 2XN2A 2J7BA 4QM1A 2XVKA 4ZL1A 4DYJA 2J8GA 3D47A 3M0VA 2JGYA 3MJMA 4L9XA 1QMLA 1EF3A 2HNEA 2ACSA 2G96A 5I03A 1FY6A 1YTKA 2PDIA 3CHDA 3NZGA 3L5AA 2D22A 4M29A 1ZBCA 4Y96A 1DWAM 3I4EA 1O12A 5D8ZA 3KP0A 4F66A 3GAKA 3DFYA 4FOUA 3WK2A 1V3MA 3OP2A 1PTGA 4XSMA 1V93A 3NUKA 2YKKA 3NZRA 4ZCWA 2A3BA 2OCZA 2CXGA 4H6EA 1LQAA 3PR2A 3RCNA 4LRTA 1EKOA 2DORA 3AZRA 3ZT7A 3HPAA 5FA5A 4FIQA 3GDMA 3WUGA 4ZMGA 3SCTA 3F5LA 4JBRA 4Q3MA 3RU8X 3VKDA 4JFUA 1ISZA 2QW5A 5C9UA 4GOAA 3NSXA 2HK0A 3I7QA 4KCWA 1M01A 1ZJAA 4ZE4A 3W7CA 1V6YA 1O5KA 1U1HA 2DVXA 2P1FA 1ZCCA 3QH2A 2P3EA 3HQ1A 5JUVA 3HA1A 4GX9A 5DN1A 4HCDA 2CEQA 3B0PA 5FEXA 2FZNA 3VC5A 1O1HA 4DO4A 4UFJA 5C5YA 4XKMA 3I3EA 4KFNA 4JFSA 4UFIA 1EB3A 4AHPA 1PJ9A 2HXTA 3LUTA 4AZ6A 2Y63A 4A05A 3L4YA 2QS8A 3ARXA 4NNAA 5D9NA 4AXNA 1VIZA 5PTDA 3GVRA 2WW5A 1XLHA 2QJGA 4DLFA 1SJBA 1H7NA 3PG9A 4RR4A 5LXEA 3OHIA 1B31A 2DT0A 1TFVA 1V6VA 1HTIA 2CLMA 1CXHA 1KTBA 1GJPA 3H23A 4QQUA 3RFAA 1EA0A 4AFYA 5FIPA 3M44A 4XG1A 1RAKA 3VIJA 3INPA 3IJ8A 5I0DA 1PPIA 5J5RA 2ISSA 1EYWA 4M51A 4BHYA 3HGJA 2GQ8A 3QC3A 4MWAD 2DZSA 3TONA 2OWCA 1XBYA 4EAYA 1LP6A 3N29A 4JFVA 3OYZA 1JF6A 3MYPA 4G1NA 3QGKC 4Y8EA 2DH3A 1JD7A 2PRLA 2JGQA 4GGBA 5JIPA 1J0KA 4JTEA 4LVAA 4JKMA 4X0NA 1TE1A 1G94A 2DZVA 3W1MA 2B31A 3HFTA 4V33A 1TV5A 3PPHA 4BF7A 1XLGA 1UOZA 4GX8A 1TWIA 4LVBA 5FJIA 1ZS2A 4O15A 1YEYA 1FCBA 2OYKA 1L9WA 2I5QA 4ROPA 1GZJA 2AMGA 4UQEA 1UC4A 1I2NA 1U5JA 2G3MA 4V27A 2UY3A 1YYAA 5HXMA 4D71A 1KTNA 4ACYA 1X6UA 3L21A 2Z7KA 3H70A 2G8ZA 3CHFA 3SY5A 5I23A 2G97A 3PTMA 4L1GA 3QHNA 2L5HA 1OINA 1F8IA 4FF5A 4H7ZA 1I6NA 1XGZA 5KINA 3PSWA 3MCNA 4CD4A 2BMBA 1GVIA 3C2VA 2Z6IA 4IMFA 8RUCA 3T9PA 2BXVA 3AHYA 4CD6A 1DORA 1G4EA 1PYFA 4MF4A 3KXQA 3T09A 4XZ9A 3VZZA 3RLGA 2XG9A 2ZUSA 3HO8A 4QDMA 1OCBA 2EEXA 1BD0A 3SR7A 1E4NA 1CI1A 5LSMA 1QW8A 4HN4A 3GW3A 3VIPA 3CUXA 3DZ1A 1M1BA 3FLUA 1U2YA 3CL6A 2PEVA 3F5JA 4NJHA 4K2SA 2PP3A 1QK2A 1L0PA 1P0BA 3NVDA 3TX9A 2R8WA 3WLHA 3NXFA 3TKFA 3S83A 1IEWA 1K4HA 1UD4A 3NOYA 1I2QA 1R3QA 1UH4A 1SZFA 5DO8A 1EPXA 1XG4A 4AZ5A 3ANUA 1SMAA 2VGGA 4RE4A 4E8GA 3BG5A 4AY7A 3RM4A 4IPIA 3S8HA 3E0IA 4NAFB 3BPWA 1E43A 5LXXA 1V3JA 1R46A 2G4JA 4ORIA 2ZZ1A 3HZ3A 3RPTA 1R9XA 4MYXA 5BU9A 1H5VA 2ZZ6A 2CLEA 3TCSA 1ITQA 4C6DA 3BLLA 4PUNA 1PKYA 2FGLA 1KV8A 2FTPA 3RG6A 3CWOX 3WQFA 1XFBA 1HP4A 4AMAA 3WEZA 5C2GA 4LYRA 4ZFMA 1MI3A 3ISIX 4LCSA 3K5XA 1US2A 3WLSA 4BI6A 2GPTA 2E77A 1GTEA 5LIYX 4NRRA 2WMHA 1ODZA 3CJPA 2UZ9A 5FAJA 4DJDC 4LAMA 2BOGX 3W1AA 2UY4A 1QT1A 2CBIA 1UJQA 5FACA 1J18A 1TUFA 2I14A 1XIHA 1F07A 2PDLA 1Q6QA 2DJXA 2MUCA 3E2QA 4FNTA 4DWSD 1SYTA 1BTMA 4AIEA 1VZWA 3IIOA 4YWIA 3MP5A 2NWRA 4FX6M 2WJZA 2XWDA 5F2GA 3EKGA 5I78A 3O6YX 3FHQA 3KCOA 2HQAA 3CO8A 2CBJA 1G01A 3LI0A 2FHFA 2YB1A 4QE1A 1DWIM 1V3LA 4FXFA 3CZLA 5T9BG 3M0JA 1N55A 2QJMA 4ZOCA 3ARPA 3P0WA 3LZ5A 4Q4OA 2PWVA 4JIEA 3PPCA 2NWSA 4F3HA 1U33A 2OLSA 3N2XA 1BYCA 4QX4A 3WK0A 3WH9A 5I79A 1FWSA 1XDJA 4J7RA 2V68A 1KFCA 1YADA 3OQEA 1Q13A 5HMDA 2ZKMX 3BCJA 4ZOBA 4N02A 2ZRZA 1FWAC 4Z2LA 4S3AA 2W61A 3HPSA 3WD3A 5HQMA 5DXXA 1MFVA 3LCIA 1FWCC 3ZMRA 4UTLA 1KM2A 3NZ1A 2FVKA 3PBUA 1J93A 2V5DA 1GVRA 1EO5A 3A47A 2GJPA 3E49A 2OQHA 1FWNA 2PU0A 3NL2A 4LXFA 4PUUA 1AA1B 1WDPA 5H1WA 2EPOA 1REQA 2OTDA 1N2VA 1RY8A 4US5A 3II1A 1GVFA 1TX2A 4D6EA 2INFA 3JU2A 4C6LA 1XBZA 3IACA 2G3IA 5B7ZA 1W0MA 4BF5A 3NL6A 4MB4A 1CCWB 3W01A 4S3FA 3T40A 4Z1DA 3N2CA 1KWGA 1Q6GA 3W2NA 3TC7A 1QDSA 1AJ2A 1PKMA 4GE8A 4K1GA 4CQ9A 4TR9A 3O06A 3ZIZA 4OBRA 1HKIA 4I9AA 4C1LA 3MDWA 1IEVA 2O92A 3SRHA 3I6RA 2AOSA 1TJRA 3CYJA 1TO3A 1RQHA 5CLWA 2J7GA 2NQHA 3CBWA 3ABXA 4MTVA 4Q4MA 3V0TA 4O0KA 2FZBA 4I5RA 3KTCA 2QCDB 3WSUA 3V5FA 3CPGA 5XIMA 1BHGA 3TN4A 4GC4A 1VBUA 4AD2A 3R6IA 2BVYA 2XH0A 2PSNA 4MADA 2E6YA 1XLCA 1VF8A 1WCGA 3G8EA 1W5OA 4U5IA 4JCLA 1VC4A 1MEWA 1K70A 1DHPA 2OX1A 2GK1A 3ANVA 3ZR5A 3KOWA 3W7JA 4NJJA 2QT3A 5DQPA 2XM2A 3QSTA 4W85A 1P4CA 4O10A 4IQLA 3GXPA 3STCA 1EP1A 2OO6A 5E0KA 4KEVA 3W2UA 1ALDA 3L12A 4MNJA 3IJ7A 5HQLA 1C92A 3EWWA 1TREA 2X7WA 3VA8A 1L8PA 1XJBA 3DEQA 3UESA 1W3HA 5FESA 4ZVJA 2WHKA 4IHCA 1KQZA 2QUMA 3APYA 3KOFA 2F2KA 4Y9PA 2TYSA 1V6XA 3DX5A 4Q8MA 3G6MA 3DFTA 1ZQ5A 3LTYA 4KWWA 1X8CA 1TRIA 3LPFA 2IQDA 2EF9A 5AVNA 3GBEA 4P8VA 3LCLA 1V6WA 3CMFA 2BBFA 4A8IA 1W8GA 3H2FA 4YHGA 2BVTA 1HJWA 1JYNA 4D6HA 1R9ZA 4YU1A 2OO0A 2V2CA 3BMVA 5A2AA 4AZBA 1DXEA 6TIMA 4GY0A 1W1PA 1BLIA 2JALA 2ACRA 1GOOA 1OYAA 3U48A 1S39A 1I8JA 3ZJKA 3ATYA 3DAQA 3E1F1 5TBOA 2XFFA 4JQ4A 4IG2A 4CVWA 4UFLA 4D2JA 4X2RA 3GUWA 4A2RA 4N6EA 1WV2A 7REQA 5LIXX 2FJKA 4AZHA 1LL6A 3K30A 1NAL1 1VJIA 1ZAIA 3M6DA 4DAFA 1XI3A 3IRDA 1R2TA 1AL8A 3CV2A 3CNYA 1H60A 4ML4A 3EPNA 4ADSA 1UD8A 3EYPA 2CPUA 1ZBVA 3T6CA 1JPDX 4GUFA 1KM1A 1LWIA 3TMLA 3I3BA 4JDYA 1FWGC 2I9UA 1W31A 4IQJA 3A24A 1VBJA 2CHRA 1XYCA 2GUYA 1P0KA 3OZPA 4MM1A 1EGVA 3WBYA 2OZTA 3A5VA 2DT2A 1PO9A 2A0NA 3IJIA 3DOPA 1S1PA 3CIVA 4YTQA 3WEMA 4OUIA 3KAOA 4RCXA 5I2UA 1P7TA 5A69A 4XZIA 3SN0A 4QNEA 4M7SA 1UBPC 2J24A 1EJWC 1UR8A 1TJ1A 4GQGA 3NJ3A 1J4EA 4GQQA 4GNJA 2AQOA 4ACZA 3KLKA 3OYXA 3BG9A 1WUFA 3VOHA 3DHFA 3R13A 3ARWA 4Y6GA 3W1UA 2Q71A 3FYOA 2WVVA 3R8RA 4WKHA 2P76A 1HO4A 3S6TA 5I02A 4ZA0A 4PUKA 1TRDA 4FAMA 4JTUA 3TXVA 2GVJA 2Z2AA 2W5FA 4JYDA 3UR7A 2DP3A 4HNVA 3CAQA 4LFYA 2IS7A 3I4KA 2GWGA 5AC7A 3WLIA 3NTYA 4GYPC 2DW6A 4LVDA 3UWQA 1GQJA 3CMGA 3KL5A 1WDSA 3W1XA 3KW3A 2ZXDA 3G6LA 3GXMA 3LCXA 2PWHA 1AQHA 2WNNA 3M0XA 1NQ6A 3AICA 1O4UA 6XIAA 4R9XA 2ABBA 2Y7EA 2OKOA 3M4HA 4J3UA 2VEGA 1WXZA 3PWGA 5DT7A 3WLMA 1YNQA 2ZX6A 2WNWA 2G95A 3MZ2A 3M43A 4B2DA 3UNDA 4NAEB 2R14A 1XLBA 1IWAA 4FZIA 1E70M 1BFNA 4LH8A 5XINA 3W2JA 4LB4A 2QQ6A 1ISXA 3FDKA 2C1GA 1RP8A 2E67A 4DBUA 3GS6A 2PWGA 1J0HA 3L68A 3QOKA 3KS6A 5FCZA 3ALGA 3SCSA 4LV9A 3QFEA 3FJ4A 1E55A 1OQFA 4YVXA 1JGIA 2HBXA 4M24A 5BCAA 3WKZA 2QJJA 5TIMA 3P5ZA 4FSAA 5E9AA 3C3NA 3T4CA 2WAGA 3QY8A 4G56A 3WF3A 1JCYA 1JG9A 2TAAA 2VWSA 4DO7A 2PDQA 3F4WA 3P0XA 3CHVA 4MOZA 3SB0A 1LQ0A 5D2WA 1RLCL 3MB9A 1IYXA 2BHZA 3CUIA 1W54A 1X6LA 1LOLA 5TNVA 1ZFJA 4M19A 4L5ZA 2VR4A 2Y7DA 4HCHA 4PCFA 3ZLFA 3N4AA 4CQAA 2A3LA 2PWUA 2ZRXA 2BASA 4MWAA 1QW7A 4RX0A 3BC9A 2ZZ7A 3W7DA 1S2CA 3ABRA 4JTAA 1P0NA 3U9IA 5CC7A 3RPDA 3WF2A 1A3WA 1RR2A 4UQ9A 5FF4A 2A79A 1UW9A 2OQYA 2PD9A 5BU6A 1R85A 4WOZA 1CGWA 1EWEA 1AK5A 4RE0A 4O4VA 5FSDC 5BXSA 2F6KA 2VCBA 2A7NA 3MBFA 3B0XA 3TMQA 2W66A 3A4XA 2BVDA 1UWRA 3URAA 4ZSTA 4B5VA 4HNTA 5EB8A 3CYVA 4OFCA 2HPMA 2WC4A 3O15A 3L9CA 4E4PA 1JYWA 1KD0A 1V3HA 2FQIA 4MAZA 5LKYA 1VRXA 1QNQA 2BG5A 2VQTA 4AEEA 1CXLA 2HE5A 3FYPA 2GYIA 4B5SA 3UEQA 3EXSA 2JK2A 2YDQA 3QY6A 4AUBA 2J7CA 1Y5XA 4AXKA 1GOMA 1KRBC 4D1JA 1SJCA 3S6DA 1H63A 2POTA 1G0CA 3U3HA 3ZM8A 4LF2A 2XH4A 1ZJBA 1Z7AA 3SIMA 3VIIA 1CXFA 4RNFA 5IFTA 4DNHA 4F4RA 3QMTA 4BWLA 1XIEA 1JZ5A 1VFFA 1FCQA 3ARTA 3RO6A 3S46A 3PFRA 1RY0A 2J66A 3FSTA 4JGDA 3TVAA 1QR7A 1JFHA 3KBNA 1OM0A 5I06A 3ARRA 2BVWA 3OG3A 4ZGYA 3UXIA 2EG6A 1QBBA 1DJZA 2D3LA 5A8PA 4B90A 4P8UA 3UETA 4KEZA 2JF6A 3TA6A 1E9LA 3W7QA 1JCXA 4LY8A 4W86A 2XGBA 1LBFA 2D1ZA 4GKLA 3QC0A 1A0DA 3G5EA 3WQ6A 2XISA 2ZUMA 4CD5A 5A6TC 5G4HC 4NASA 3HPXA 1KM4A 1DQWA 2PLMA 1CXKA 3AC0A 1G7UA 2QJHA 1RK5A 1E73M 1P5BA 1DE5A 1GORA 2Z1WA 4BJHA 4D6GA 4GCAA 5HMEA 1K1DA 3ZWSA 3NEHA 4HU4A 3S2MA 1KNWA 3AU2A 5CAKA 4C6CA 3ITVA 4KERA 1R7OA 4KIEA 3NGJA 5AYBA 4DY1A 3L67A 3EBVA 4M6VA 1Y8BA 1EXPA 2J62A 4FXRA 3NQ7A 1ZTVA 4KCUA 2HS6A 2CNCA 3VABA 3G0UA 3N11A 2EKCA 3RRAA 2AL2B 1TPH1 4LANA 3VGFA 1LROA 3AZTA 1KB3A 1CXIA 4O54A 5AC4A 3TAKA 3WLJA 3SCRA 1AVAA 1TQJA 1H0GA 1Q6DA 3EPOA 7ENLA 2FZMA 1QAPA 1Q6OA 1EDTA 3FA3A 2CLIA 3FVDA 2RDTA 2O9RA 4NQ1A 1K6AA 1CDGA 1KRCC 4MNMA 5AKQA 1R3RA 3UXDA 1YXYA 2ZZ4A 3G18A 2VMFA 3KL0A 4XD3A 3HJZA 1OX5A 7PTDA 2UWFA 1T6MA 3VM5A 4RPPA 4C5ZA 2OX4A 8TIMA 3SAZA 1T99A 1BRLA 3H21A 4NJGA 1OT1A 2QVHA 2PDJA 4LAKA 5HJXA 2ZA3A 1Q3NA 2ZX7A 2VX6A 4YTRA 2YCKX 1DWJM 4X63A 1QI3A 3USZA 1R6WA 3U2CA 4IUGA 5LIUX 2YCLB 3LV6A 4AHQA 1OD8A 4EAMA 1LWJA 3PZQA 4Z1YA 2GFTA 4AD3A 4MWAE 3B8WA 5KZ6A 4C6KA 3RILA 3VVGA 4LVGA 3LGDA 1UKPA 1H50A 4A6GA 5HPOA 2VELA 1C8QA 3CEPA 4PTVA 1QNVA 3E6EA 4K6AA 1R3TA 3R5EA 5HANA 3ZWTA 4RZBA 3VIMA 1PYMA 3VDHA 1R2RA 3ABOA 4RJEA 4I6VA 5AHIA 4D8ZA 1TPVA 3CLMA 1J0YA 3IVTA 2XN1A 3F7JA 4J35A 1LT7A 1UKOA 4O52A 4QQ3A 1T8XA 1JCMP 3VU2A 3N34A 4J9JA 2PLCA 2P53A 2Y1HA 1X7FA 2Y8UA 3WMCA 3UWVA 2VZUA 4S3BA 3BLEA 4CQCA 3DKJA 3QMRA 2UV8G 5A6KA 2DZXA 3WDRA 1OADA 4REQA 1K8XA 4M80A 3ZVHA 1BVZA 3H2OA 2D0FA 4PTDA 3R94A 1SUXA 5CSUA 1UKTA 5BYWA 4UQDA 1G4SA 4GVIA 3SQMA 1EFZA 4QG8A 5HULA 2IKIA 2R94A 3EA3A 4GY1A 2BHUA 1WKFA 3F4VA 4W88A 5T26A 2FPYA 1Y7VA 2YXGA 2CZEA 1XV8A 3LK6A 2FMNA 4C60A 1PE1A 3TQKA 4Z1CA 2YX0A 1M03A 3MO4A 4PMZA 5EMYA 1IWPA 1VCVA 4G8TA 4CGTA 2OWWA 5T8GA 2HZGA 1NH6A 1SPQA 3QYQA 1B3XA 5G2IA 4UNKA 5KMYA 2HCVA 3GYEA 4L6HA 2FTYA 2HROA 4HZ6A 3PZTA 3H6OA 1I75A 3LPGA 4RDZA 3T2QA 2NQ5A 1W9BM 2O7QA 1A80A 4HK6A 3P62A 1UQZA 1LOQA 4AD0A 1BVWA 2E25A 4W8LA 1KWKA 1F4AA 3G3MA 5DCEA 4W9TA 1G1YA 4ZO8A 3W2LA 5F4SA 3TSBA 4DUVA 5EBAA 2OJPA 3DECA 2RAGA 4PBGA 5MHBA 1X7IA 1TG7A 2NT0A 4LQ1A 1GEQA 4H9VA 4MKNA 3SCUA 1IT0A 1JDEA 3IK2A 3V75A 3BANA 5C70A 3SIZA 3EOLA 2Z24A 3FK4A 3SY8A 3IWPA 2IKHA 4UFKA 2PLJA 3RJXA 3UCDA 3TJLA 3LN3A 4KW2A 3EDKA 4HZMA 4E38A 4HA0A 4MY8A 5DT5A 4L56A 2PMQA 3SSZA 3UJEA 2Q01A 2Y2WA 4B9ZA 1HO1A 2VJXA 3LBCA 1NY1A 2JQXA 3EMQA 4KPLA 3N1AA 4O16A 3PJXA 1IHIA 1KGUA 3O6CA 1ZBWA 3H4GA 4FR1A 4AB4A 3AIVA 3FAXA 3NSMA 3F03K 2QF8A 3GDLA 5ABGA 1PZ3A 3NPXA 4XVDA 4MHBA 3SM0A 3GAYA 5DLCA 5ECUA 5MF5A 1LJYA 4XVEA 1WAUA 3OODA 4QRNA 4AWSA 1NWSA 1XW8A 3GY1A 1EGMA 3WNKA 3CHCA 1KW1A 2V81A 3AXMA 3SUTA 3WD4A 4W84A 4IISA 2VD9A 3GIPA 2E5BA 4RV3A 2J77A 4H01A 2ASHA 3VNYA 3HMJG 4E4FA 4IQEA 3VE7A 3VTRA 1HW6A 4LU0A 1PHQA 1OIMA 2IPJA 4OHQA 5JXQA 5BOFA 1V4YA 2BZNA 3ARQA 4PEEA 1IXOA 5GJMA 3FSUA 1JAEA 1RJPA 1B3OA 4S2CA 1KCZA 2W9MA 3A9BA 2O4QA 3AYRA 3VGDA 2IXUA 1MZRA 1XIMA 1I9CB 4YVPA 1NOUA 1TZ7A 4A22A 3UVIA 4LUYA 3WQDA 3CU2A 4PBFA 4O4WA 4WXZA 5EU9A 2ALDA 4HJWA 4YTTA 3C6CA 1XD0A 3LHVA 1M7PA 3GTNA 1QHOA 1FDZA 2CITA 4JN6A 1ZALA 2J6VA 3DGRA 2BS9A 3W2KA 2EG8A 3WJYA 3QQ0A 2OB3A 4GH3A 3VPLA 1ME9A 2X1RA 2YDSA 4DLMA 3KFTA 2ZICA 3TZFA 3GXDA 3GTHA 4Y7EA 3UGVA 3EWYA 2BLEA 4Q8UA 4CN6A 2JFEX 3LI1A 1MXGA 4U28A 3WBWA 1PXGA 1QNSA 3K13A 4I5UA 3W29A 5CGTA 5A6BD 3W73A 3BOLA 1Q45A 2HRWA 5HQEA 3E0WA 4C5YA 1F3XA 3CWHA 3BLPX 1B3YA 1OK6A 5HWMA 1SGJA 3B9AA 3KEHA 1A3XA 4HQVA 4HOXA 1E9ZB 4ATDA 4IXXA 2FDMA 3GX9A 3VOFA 4AW7A 3P67A 4L4LA 1K6WA 1OWQA 1XRFA 4HP5A 4R53A 2CZFA 4ALDA 4MPKA 3ATZA 3T8QA 3CC1A 1WE5A 3EOEA 3TOPA 4HSOA 2OKTA 1BYAA 5LNVA 2BHYA 4J27A 4XQ6A 3W53A 2P0IA 3UQNA 2WNZA 1KXQA 1ESWA 2QUUA 5K9CA 2EO7A 2NX9A 3L66A 3AYTA 3R2GA 1HUVA 4HPNA 4DNMA 1EDQA 1LQ2A 4KGLA 3TAOA 3CMJA 5BZAA 1QPNA 1OYCA 3IK4A 2CFFA 3AIUA 2JIEA 3BJSA 2EJAA 2R6OA 1SMDA 3UA4A 4WQ6A 1S38A 1R3WA 4ICNA 2Q8XA 4GH1A 1V7YA 1GYMA 2WHLA 3QGAC 3UWYA 1XDLA 5FF7A 1XICA 4FNPA 2UY2A 3B0UX 3MVTA 1F2JA 2G50A 1X39A 4IJRA 2GSEA 4KRZA 4UTHA 3W26A 1E1EA 1E6ZA 2CWXA 1KFKA 4XUYA 3BAXA 3LYEA 1KFLA 1G67A 5KTLA 3AFBA 1JQVA 4H83A 1A5SA 3C52A 1V51A 3CB8A 1S5TA 4OE7A 3P93A 3VX0A 2C19A 4A3HA 3GD6A 1S2UA 4QLKA 1IGWA 1O7AA 2X1TA 5CC3A 1MRQA 4HZ7A 1R0MA 2PDMA 5JH1A 4C6NA 5HNRA 1OCNA 2DQXA 2E1WA 4RZ5A 1H1ZA 1XBXA 3K4AA 3QJAA 2WSYA 3DXIA 4PMJA 2P8CA 3W02A 2NV9A 1LLZA 1VFHA 5GNXA 3AMLA 2CZDA 1HGWA 4O13A 2VL4A 3ZZ1A 3LLXA 3APGA 3FN9A 4JNMA 2BNJA 4GUIA 3W1NA 1OIFA 2FB2A 4WUIA 4DXKA 1EYEA 3PBMA 1DYSA 4JY8A 4MAVA 2XIBA 2V3EA 4BZYA 2GQ3A 2VDHA 3WQ5A 1EQPA 3MUZ1 3EWZA 3GHUA 4Q4RA 3N2TA 2X42A 4HA4A 2WJFA 3E0VA 3A5FA 3O6AA 3BMWA 3W3OA 1W3JA 1KFWA 2XPKA 1K9DA 2GGGA 1N8IA 2O9TA 1NJJA 3BGGA 3S5ZA 2WK2A 3UG4A 1XSKA 4HGXA 4E4UA 4JQAA 4ZFCA 4HSNA 1GVEA 1IQ8A 3TN6A 3OVGA 4TV5A 1K8ZA 5DELA 2DJLA 1GWJA 3UWUA 1E1FA 3RITA 2BGNE 1LUCB 5EFFA 3O2LA 3TW7A 1G5AA 1VFOA 4ML9A 2V63A 1KKOA 4DQWA 1XIIA 2C0AA 1EC8A 3BDKA 3D6NA 1QFEA 1ISVA 1WZAA 4IG2B 2RJGA 5AYXA 1U83A 4GQ0A 3OA5A 1E3XA 1UD2A 1N82A 2ZUTA 2VM8A 1BG4A 4KEUA 3G1XA 1YDVA 5IDZA 4S3CA 3VKCA 3F1QA 4A29A 4HJFA 3DFQA 1RQEA 5AHLA 3QPZA 3HV9A 4NYYA 3DCPA 3FJ6A 3AJ7A 3M5VA 4LX4A 3PZNA 4JD4A 3KHDA 4DRSA 2CESA 1E71M 2XZ9A 3CAWA 1XIBA 2ZA1A 4JIPA 1IXNA 4XAZA 3H4WA 3HIJA 1P0EA 4DF0A 3TLQA 3DN5A 3UXKA 3MUIA 5A95A 4OV9A 3CUFA 3UR5A 3L4WA 4IX0A 4HTYA 2R91A 2G3FA 3GC5A 3N3TA 1VS1A 1HKKA 1TZZA 2NSOA 1EP2A 1BTCA 4CD8A 3PZVA 2Y8KA 4DPQA 3EOUA 2Y8VA 3CZEA 2XU2A 1OFDA 2HBVA 1WZMA 3QXBA 3TTEA 5G1TA 2QV5A 3IJDA 4RW3A 4C6QA 2YZRA 3QW4B 1J10A 4HSHA 1QVBA 1MQRA 5D8WA 1JF5A 2V5BA 3VGHA 1WA3A 4E3VA 3VIKA 3H12A 3E9AA 5GVJA 1PTDA 2NXIA 4H2CA 1LF1A 4KIRA 1JULA 4J28A 4KKXA 4CQBA 4QBXA 1XG3A 2IQ0A 3W71A 1M65A 4WVXA 3GLCA 2ZZ5A 4F2UA 5E6YA 2X2GA 5JBDA 2WC3A 3RDKA 2A7RA 3RN6A 9XIAA 1HJUA 4UFMA 3PS7A 2W63A 4IPJA 2XIQA 3N9KA 3V35A 2QGYA 1MW3A 3N6JA 4IGMA 2PF8A 4OVXA 4PGLA 4B3LA 4O50A 3U2ZA 3VYLA 2C1HA 5GJPA 3HGRA 2ZOXA 3B97A 2DZUA 3CGTA 3M9YA 1SR0A 2BY1A 5DF0A 4AY8A 2ZWYA 3SBFA 2JF7A 1V0MA 3BSGA 5CC6A 2VDIA 2DY3A 2Z4GA 4IH3A 4YYFA 5AYIA 1QI0A 4UTTA 3AXHA 4ZO9A 2PPGA 3GH4A 3R11A 4PODA 1XFCA 5M1TA 1JXKA 1XISA 4OIFA 2EPLX 3MWCA 3DU0A 2YW4A 4DUXA 4LALA 2HVNA 4E8CA 4H7CA 4QE4A 2YIHA 1PIGA 3GNOA 1ZGDA 2D2GA 4M6UA 4E3TA 4JIRA 1VLWA 5LNWA 2VGIA 3NQAA 3ZR4A 3WFAA 3SUWA 1XKJA 1G9HA 4I5XA 3P82A 3MJYA 1YE6A 4LBSA 4F0MA 4HVXA 4GVGA 5CPLA 3LRMA 2VGBA 3VDCA 3KWSA 5I00A 1ZHAA 2O56A 3LSCA 2QPUA 3VAVA 4MB3A 1S2VA 5RUBA 4IJBA 4WGXA 1XS2A 3O07A 3BCDA 1V03A 4GO9A 2P50A 2WKJA 5EMMA 1H3GA 2C7FA 1IIGA 2X0YA 4K68A 2VP8A 4O1FA 3ZJ6A 4XSLA 4C1KA 2PTZA 1C7SA 1UR3M 4UOJA 3TTQA 4GYJA 1ZZMA 1SO4A 2AL2A 2YA0A 1WQ5A 2D2HA 5DCBA 4AZIA 3KUMA 3WDHA 4HK7A 3MW7A 4ZB5A 1W1TA 3A4JA 2BY0A 4H4IA 4GO8A 4MJ4A 1R3YA 4FEZA 1XIDA 3WLKX 4LYKA 4QS5A 5CBBA 2DIEA 5BROA 1XR2A 4NKCA 5AN7A 1Z89A 1UR1A 5A5WA 4G7FA 3MUXA 3PULA 2YR1A 1M6JA 3BWWA 5IBXC 3WH7A 4WZHA 1CT5A 3VXGA 3HBLA 3O3RA 1UR0A 5D37A 2ZDSA 1XM3A 3UJRA 3QV9A 4C6OA 2POZA 3FS2A 2V67A 1XD1A 1UZHA 1L6GA 4HPXA 1ZP3A 4NNBA 4QHRA 4ASTA 5B7YA 2XH7A 1H61A 2P3ZA 3FKRA 4IGSA 4JTKA 4US6A 3ITLA 4MUPA 2ESCA 4NX0A 2GJXB 2DW7A 4L6OA 3IIXA 3GO2A 4XK2A 1A0CA 3QVQA 4PRWA 3AS0A 1MQPA 1Q6LA 1TWDA 3FNDA 4IZGA 3MSRA 1S5VA 2Q3OA 4PUJA 3IAQA 3K4DA 4AC7C 1AUSL 1TWSA 1XUZA 1TMHA 3EEGA 3KBJA 5G5IA 2GWNA 4H1ZA 3FKKA 4JICA 3CLWA 3TROA 1ADDA 1GT8A 4XB3A 4CUCA 5C8BB 1WBHA 1E6NA 3BSHA 4GGHA 4XZNX 1J0ZA 3SRKA 4E8DA 3VNMA 2ZX9A 4FI4A 5BRQA 2VC6A 3TCEA 3WBAA 3BH4A 3CAVA 2DZPA 4DX3A 1B5TA 2FFCA 1VIWA 2FMOA 1YRRA 2X0HA 4JTQA 3MO7A 5AHMA 4Q7IA 3B8DA 3EXRA 1UD3A 3W70A 4XAPA 5I07A 4Q6JA 2GQ9A 1SW7A 3BQ6A 3DI0A 1L6FA 4QS6A 4AMCA 5EY5A 4WKAA 5BXRA 1R86A 4N7QA 3WDJA 4JZ5A 3EEZA 4I8YA 2QCCA 3UWZA 1DBTA 1FP9A 3RLVA 3H53A 3CV6A 3GFYA 5BMXA 1FA2A 1XP3A 1BGGA 3SGUA 3VCCA 3MY9A 1AODA 1E6XM 3OGSA 3WQEA 3I65A 1RJRA 4R7OA 3NPVA 2X1SA 3RM8A 1IT7A 3BAKA 1KRAC 1DEDA 1KBIA 3LEPA 1IEXA 4TV6A 3I6TA 2NXGA 1RPXA 2PGEA 4FLQA 4J3TA 1W1A1 3MP4A 3SZ8A 3AOFA 3TYAA 8XIMA 1SW3A 2HJPA 3LTPA 3RNDA 3MI3A 3VNLA 5HK4A 4G5DA 3FFSA 1B30A 4UTIA 4WDXA 5M5DA 4XO7A 2AKZA 3EX2A 4LOCA 1HF6A 4BKNA 3NEVA 4WOQA 2AGKA 3NPWA 2NQ9A 3THCA 3L2IA 3CUGA 2WO5A 3WK1A 1DQXA 1HJSA 3HQNA 4FNRA 3IEBA 5CC5A 4UMBA 4H8VA 2B4GA 3GR7A 1AMYA 1G4TA 3WBEA 4MWAC 5K4ZA 2ICSA 4GPNA 4OOZA 1EEXA 1OX4B 1W5PA 4WXYA 5TAOA 2PDUA 2IKGA 3AHZA 3WFZA 5JBFA 1LORA 1FH7A 3Q58A 1HGYA 3G1SA 3MQTA 2WZIA 3M64A 3AAMA 4H9YA 3W82A 3NIYA 4LNCA 2XJ7A 3BW3A 4BS0A 5D33A 2EG7A 1RCOB 1YNPA 1LT8A 4LYPA 1GW9A 4GISA 3IJLA 5C9RA 3MI2A 4CVUA 1AH4A 4DPPA 4LUJA 1JJKA 4Y9MA 3ZT6A 4JNYA 3OLEA 1XIGA 1WKDA 4IFOA 5D9OA 3IPWA 2ZBTA 2GQAA 5DY2A 3SGGA 5EA9A 1TQXA 5F4WA 1NFBA 1XH2A 1V0KA 3TJIA 4X9SA 5E9XA 3MU7A 4ONVA 4Q32A 2QEZA 3WF4A 2EPMX 1ZAJA 2NLIA 5A6AA 2UBPC 3C61A 1EJUC 1CZ1A 4K38A 3Q94A 2J9ZA 2I16A 1EOKA 2NV2A 1HVQA 3ARSA 4D6JA 3PZOA 4QEHA 5K7JA 1GVQA 1UWUA 4UZSA 1OCJA 4PMUA 3N2OA 4H19A 3GB6A 2AAMA 3AIRA 3HG4A 4F79A 1CIUA 2D0GA 3MT1A 1FWDC 4I9MA 4ROQA 1EIBA 4LAOA 4K37A 2J79A 3AO0A 1AW5A 3D0CA 1MDLA 5HWJA 4GUGA 1MWOA 4TU1A 3CQIA 4KEMA 1TA3B 3P6LA 3MI6A 1VFLA 1WB0A 1RLDA 2QJNA 5ENLA 4YN5A 4DWSA 1UUMA 2NQLA 4HYRA 2D73A 4JTIA 4JNZA 3UD6A 2WMFA 2PP0A 3UA3A 2YCLA 3PB2A 3QLDA 4G7EA 4HD5A 2Y7FA 6REQA 4JYFA 1DJWA 2Y62A 1OABA 3QN3A 2J47A 4UUIA 3THQA 3WENA 1JYVA 3AUOA 3TP4A 1X8FA 4PMNA 3QPEA 1CLXA 2DQWA 1EX1A 3E74A 2XVGA 4HNLA 2XZ7A 5HPCA 3NQEA 4O8RA 1SO3A 1FWTA 2E0PA 3BAWA 3LOTA 1T8QA 3CH9A 4F8XA 1PAMA 3HF3A 2PTWA 4LY4A 4E6MA 4BEUA 3LB0A 5A2CA 1E0TA 3RF9A 3SW6A 4F2BA 3KDNA 2YL5A 5C0QA 4PN2A 1W2PA 1TZ9A 4HTBA 1H4PA 4K8HA 3BURA 3GH5A 5HNUA 1KR1A 3UYCA 3G1DA 2AQWA 3C0QA 2WWCA 2TRSA 1E6QM 1UASA 3MUY1 2WMJA 3TN3A 1AG1O 1NTHA 1VENA 3KL3A 4M7TA 4IL0A 2OT0A 1MYRA 4ZO6A 1TELA 2B7PA 4AD5A 2QXWA 4CN4A 1E4IA 1UBSA 4OJYA 3IUHA 3PJWA 2FZDA 4UTWA 4ZOEA 5CJ5A 2GJXA 4RDWA 3DKLA 2OLAA 3KS5A 3WDIA 1E1CB 2XSAA 4ENLA 3W4RA 1WYIA 1B2YA 1DHKA 3VZYA 3H8AA 3DFPA 1R5YA 3QSRA 3TOYA 4QAIA 3W74A 1DTNA 3UBPC 2FB3A 2QUNA 5A8MA 1GJUA 5HATA 2I9EA 4CCDA 1GZ1A 3QYSA 1Q8AA 2WSRA 1S2WA 1ODUA 2FLIA 1XPGA 3GU2A 4PE8A 5BWAA 3URNA 3OU8A 2PDXA 1VJSA 3NZQA 1GOKA 1A47A 3M0LA 4FMVA 1BYDA 4JQ1A 1J0JA 1GKQA 5FJOA 5A6MA 1H62A 2NQZA 2ZUWA 1A5MC 2I5GA 4HNOA 4JYEA 4D6FA 2IKJA 4Q4SA 3A9IA 4C6BA 3KZPA 4HIBA 1VFTA 1FWIC 2F8QA 1Q2RA 3IGUA 3GWQA 3WD0A 3L2LA 3BJFA 2WNQA 3VDAA 2NV1A 4KQNA 4DB7A 4FNQA 3M0IA 1C9DA 1GQKA 1F76A 1UUQA 1WP6A 2WVUA 3B9NA 4Q4KA 2BP1A 4A3UA 4X22A 1QWGA 5E0FA 1KXTA 5AYYA 5DBUA 2JEPA 3M07A 3GQYA 2DSVA 1E40A 5LA2A 1E6PA 3M1ZA 3QOMA 4H6QA 1QPQA 5HOSA 1NF0A 3WCZA 9XIMA 4RK8A 2GGHA 5A6SA 5MKGA 1A5KC 1RVKA 4KT2A 4PA8A 3OVQA 4RE3A 5CZ0A 1KLZA 4Y8FA 3LD5A 4HHHA 4YS1A 3GIQA 3DHUA 4GVHA 1BEUA 2HTMA 4G7EB 3W7OA 1KXHA 4GI9A 2RHGA 2V38A 1J2WA 3DERA 1RA5A 1RD5A 2VNCA 3LU2A 4P8XA 3WH5A 1BF2A 2YL8A 3EX6A 4QISA 3WIJA 1C90A 1CEOA 3QBUA 4MLJA 4EXAA 1DWFM 1SFLA 4CEUC 3SCVA 1FXQA 1D7KA 4CN1A 3EB3A 3W1LA 2V5JA 3W00A 2IQTA 2YDAA 1NDWA 1S3HA 2OZ3A 9CGTA 3MWAA 4KWUA 4Z2KA 3OLDA 4NAEA 3T0CA 1T41A 3VDBA 3DDMA 2W62A 3FY1A 3KM8A 4DEFA 4OV4A 3Q45A 2VFHA 3AXIA 4I3GA 2E6DA 2H9AA 2HPIA 4B3ZA 5FF0A 3WF1A 2Z27A 4W5ZA 4LAZA 2J75A 3BQ5A 1XUUA 1LG1A 1UR4A 3MV01 4F0HA 5E6ZA 3PUGA 3NURA 4MGGA 3DUGA 2E4TA 5L9FA 1OZMA 3L4VA 3S2CA 1EDGA 2WCSA 3IVUA 4AQLA 5AHNA 4N2YA 3WLLA 1GYNA 4Q22A 4PMXA 1GVSA 1IF2A 2E7FA 5I7GA 3JW7A 1AL7A 2OOFA 3KLLA 3NQFA 3IJ6A 1KFJA 4HPHA 4ZQMA 4K3ZA 4IICA 1BGAA 1B9BA 3P61A 4A21A 2PCEA 1MDRA 3EB2A 1UD5A 5D2YA 4H7VA 2AQVA 3G1AA 3QV6A 2OXNA 1UWTA 4D6CA 4PB5A 2QUVA 4JEJA 2AMXA 1K3UA 3N25A 1JNDA 1XLFA 4UTFA 1OB0A 4BFAA 5CGMA 2C0HA 3U57A 4HHMA 2PF0A 1SVDA 4CQ8A 2J7EA 5AECA 1T40A 2BXYA 2QNEA 5REQA 1JR1A 4XAYA 3W0KA 4UBPC 1M9HA 3OZMA 4QNWA 1AQMA 2TMDA 5BMWA 4GXPA 3N73A 3W88A 3P7YA 3UPBA 5EMKA 2ZRWA 1OEPA 2GDQA 4H9ZA 1GPFA 4MKVA 4M82A 5AC6A 5LNUA 2HWGA 1TV8A 1G6CA 4LBRA 4P8WA 2VX5A 1H1NA 2ODOA 1FBAA 5HBFA 1EJ7L 4YL2A 1HKMA 1S2TA 1QO2A 5F2LA 3IGSA 4N4PA 3S0CA 2W92A 4GXMA 3VMPA 5CPTA 1IE7C 1JFXA 3OVPA 2A2IA 2PWDA 1EO7A 2WKLA 4FNUA 2F9RA 2IPWA 4FHAA 2O7SA 3A4AA 4IFKB 4RNJA 4JHOA 1HL8A 3VNZA 1W3IA 3VD3A 3N9SA 3ENLA 5H8PA 1W2VA 3QQ1A 2A4AA 1BKHA 1NFGA 3RAOA 2VFFA 2V5CA 4O8AA 4A4AA 5C7HA 3N17A 4ICMA 4KESA 4UCFA 1LL4A 5DFAA 3OA3A 2WZHA 3MMTA 3B8SA 3R12A 2AL1A 4C1NB 4OBSA 1YW1A 1H11A 3VD9A 1UG6A 3GNXA 3PUOA 4Y9NA 1SU5A 1W91A 2GDUA 1V0LA 3G1RA 1ELSA 3STGA 4GKTA 3CH0A 4GUJA 5G1MA 1ZRQA 1V6UA 2OG9A 3PZMA 3O63A 1TVLA 4HA1A 2PWFA 2OMAA 2YB4A 3UCQA 3W7NA 3ES7A 4YWSA 2AKMA 4S2BA 2ANUA 3I6EA 1KTCA 2ISVA 4WY0F 4TOQA 4UFHA 4JCMA 4M0XA 2VFEA 1C29A 1TTQA 1C8YA 1Z69A 2BY2A 2WHMA 4MYAA 4GUHA 2QMJA 3OZYA 3L0GA 3VM7A 1FDYA 4KGJA 1PX3A 2ZX8A 1E15A 4QP0A 1BVNP 1QW9A 4W87A 2E9MA 3H2CA 1QOPA 2YYTA 4D6IA 1A49A 4PFMA 3MMDA 3GH7A 3M5ZA 4EX4A 4M56A 1NVMA 2YCJA 4R9OA 3EA2A 4BQ3A 1XSJA 4LCQA 4ZQRA 3U7VA 3UG8A 1MVYA 4C6PA 1V08A 4RDVA 3AYVA 1R8LA 2PC8A 1GQIA 4JTTA 4AZ7A 4GI4A 5AFDA 1KGXA 4WSHA 1OK4A 1MEHA 1CB7B 3LS9A 3H2AA 3M5YA 2PTXA 1W5NA 5DRIA 4MB5A 3OGRA 2PDBA 1GZGA 3ARZA 4DJDA 1BWLA 2A7PA 4S1FA 2REQA 1PVNA 5F7UA 2J7DA 1VP5A 1TPUA 4WIWA 3VILA 3BLFA 4GHRA 1F3WA 1CGVA 3ICJA 4UIOA 1VRDA 2Y89A 2QAPA 3VGEA 1LOSA 5CGQA 3UZJA 2HK1A 2V3GA 4J40A 1D7FA 1XC6A 2CHNA 2FZ8A 2I57A 1O66A 4GJJA 2QZRA 1GVOA 4L61A 3PHAA 4GNVA 2QCGA 3L65A 4DWSB 1ECEA 3WH6A 3DIPA 3R43A 4IP5A 4P7LA 5D38A 4J3SA 4AH7A 2P88A 1OFBA 1V6TA 3WNOA 2Z1VA 3CIXA 4AZGA 4I8DA 3GG7A 3CO4A 1HP5A 2YOCA 3BAIA 3P8JA 4C65A 1L6YA 3WQ8A 4EPBC 2R1KA 2VQUA 5KZMA 4B92A 4NI3A 1JXJA 4GD0A 2WB5A 3J7HA 3R8HA 3NQ2A 1A0EA 1EIXA 1IZCA 2PA6A 3NM1A 3B9OA 4AHOA 3ZYZA 3O16A 1EGZA 2HXUA 3GDBA 5E1QA 1RSCA 3TQPA 5TQLA 3ZO9A 3IS4A 1ISYA 1U1UA 1Z42A 2XIMA 3VNDA 3GK0A 1RXOB 1SFJA 1FWRA 2B0MA 3ES8A 3RLHA 1LWHA 4PMRA 4V1XA 3XINA 1EH9A 2OPJA 3DG7A 1EPVA 1JZ6A 1YLVA 3TTOA 1YE4A 3MUCA 3B8VA 1E5NA 3LNMA 1DIOA 4UTTC 2V82A 3E38A 5HR6A 3LCGA 3CWNA 3ZXWA 4HBKA 2VFGA 3TEVA 1VKFA 1J11A 4LV4A 1GEHA 2SFPA 1ZUAX 4QSHA 2KX9A 4K7YA 3SSJA 1V5XA 2YA1A 4MIMA 3SDOA 3ZSSA 1YX1A 4W93A 3MSDA 3CUZA 4WJEA 2VEIA 1JDFA 1AH0A 3WNMA 3HG2A 2A6LA 3C2YA 4ZODA 3BL3A 2D2JA 3N4EA 4NY2A 2CLLA 1XIFA 2BGSA 2EPKX 4PC8A 1FX6A 3MV11 3GW0A 3DBNA 3DFSA 3N2MA 3ARUA 4P7OA 1NQKA 5ABFA 3M47A 4NX5A 1ZAHA 1DWGM 3W81A 5DMNA 3S1WA 4OU1A 3UERA 2WCAA 4QITA 1GHRA 3RO8A 3W6YA 3ZLHA 3T0DA 5J5DA 2PDPA 4HN8A 4NYUA 2HS8A 4MSSA 4B16A 4Q8NA 3B05A 2YXOA 1TVPA 5D03A 1MNZA 1DKWA 1ZU8A 1GHSA 4O0QA 1KV5A 3TXZA 2TPSA 2YL6A 2WANA 4ZR8A 1XKYA 2INZA 1UWQA 4I6KA 2ZZ2A 3W83A 4GIYA 5AZ0A 1CGXA 5DANA 4M81A 2FGBA 4PFHA 3LQLA 3ITGA 3OHMB 4DJEA 3LRKA 2PFHA 1JCJA 2BB0A 2CLPA 3STFA 3HTWA 3U4FA 1FWWA 1US3A 2CW6A 5U7SA 4S3DA 2QCLA 3BW4A 4IWWA 3MP3A 3KOXA 4QJ3B 2V69A 1FCVA 3WY1A 1JZ8A 2GJNA 3WK3A 1VH7A 5JMUA 4C7FA 4CNTA 5DBTA 5EMJA 1Q6FA 2QAFA 3T8LA 2CBVA 3ITXA 1Q6RA 3B8IA 1R30A 4U31A 4Z0JA 4IOTA 2QMKA 1UQYA 3KOZA 1F6PA 4HMEA 1A5LC 3QHOA 5IM51 5XIAA 4DWDA 2ADAA 4GQRA 3S42A 3URQA 2C91A 2PC4A 4UTJA 3O6DA 2NVCA 3W23A 1V77A 3VX1A 3GNRA 3GVGA 3T05A 3GTXA 3BTNA 2OSXA 2QHAA 4FO4A 1K7XA 1LM1A 2Y5JA 4KCTA 1D8CA 1P6BA 5LNSA 1W1YA 2JKAA 5I3HA 2J8TA 1AH3A 2YDRA 1XYZA 3MSYA 1ITXA 2P10A 4PTWA 3WJSA 3WQOA 1NDVA 3K8MA 4JX5A 1NSJA 1OVDA 1UR9A 4QGCA 4Z08A 4DZHA 4BQ4A 4AIOA 1QI5A 1HQTA 3HQOA 4EE9A 1M3UA 4C6MA 4CNUA 1R2SA 1H49A 1TJ2A 1UIOA 4FLRA 3V1HA 1SSGA 1AFSA 1NWUA 3RX3A 2FJUB 3GG1A 3SJNA 1VQTA 3BAYA 3CIWA 1EZ2A 1GQNA 2GOUA 3KDOA 3E0FA 4GINA 1QPOA 2OFJA 3WG6A 4PRRA 4E5TA 1CTNA 4U3CA 4HMNA 4AVFA 1E9YB 4ZE5A 1D3CA 3CL8A 3MBDA 2C6QA 3DYMA 4H9TA 4N0RA 1P6CA 1A5OC 2YZ5A 1GONA 4DJFA 2W6RA 4AVOA 4KRTA 1JEZA 1KCKA 1F8MA 1WZLA 1ADSA 3GUGA 4GA8A 3A21A 4A8NA 1H7OA 3N12A 4JTRA 3NQ8A 1FH9A 1SR9A 5EKYA 1Z3NA 5M3WA 2Z1BA 5M17A 3CZKA 4OT7A 5AC5A 5EYWA 3TSDA 4HOWA 4N4QA 1XCFA 3KZSA 3S6OA 3C56A 3TTYA 1JIBA 3N9RA 2TODA 4B5XA 1X38A 3O05A 2CU0A 2FTWA 4B5UA 2FH6A 3NGFA 5C6MA 2XTKA 4ES4A 1R9YA 3S3GA 1F3TA 4JDBA 3AMDA 2ZC1A 1QBAA 5D05A 3R0KA 1O5XA 4S38A 4EF8A 5K9XA 4D6DA 2X41A 3GIYA 4OKDA 3UJ2A 2BV9A 4F2TA 3TWBA 5G4EA 4WCJA 5FI8A 5H2ZA 8CGTA 1OF8A 3FA5A 3PZUA 3M41A 3PPGA 1TPFA 3C0LA 1TPDA 3O7UA 4LS1A 4GI6A 4IIGA 2EJ1A 3S5SA 4PRTA 1MSSA 3K4WA 2VO5A 4NXSA 3V5CA 1PCWA 3VD5A 4G1KA 4CNNA 1KBJA 3K8LA 1Y0EA 5K3VA 2O4MA 3AWOA 5CEWA 3SCPA 2A6NA 4CKQA 5BXTA 2HDJA 3H22A 3QTPA 4URIA 2EQDA 1SFTA 3DFHA 1F7BA 1V02A 2X8RA 4GG9A 3LSBA 6ENLA 3UWWA 2PTDA 4M1BA 1XC4A 1GOXA 2XFRA 4OZOA 4LUIA 1MUCA 4S23A 5JH2A 4GZEA 1JD9A 5CSRA 4QDPA 5AC8A 3PPFA 4INFA 5EFDA 4N9EA 3SRFA 4MFDA 3A6OA 4ECLA 4K7VA 3XISA 1CB2A 4FLSA 4HZ8A 4R33A 2J9YA 4J4KA 4AF0B 1E1CA 4GIRA 3LXCA 3GXNA 4IIDA 4H9XA 2O9PA 4TXEA 4ERGA 4DIAA 3UY7A 2B7OA 1HKJA 4I7VA 3WDPP 4BI7A 1GK8A 3VCRA 3FGCA 3BUVA 4ZOAA 2FYMA 1HX0A 3U0HA 4AD1A 4EIVA 3G1HA 4RNHA 2J7HA 5CQ1A 1RBAA 1OY0A 2J4GA 4QR6A 1HIZA 1GOWA 1F74A 3GNPA 1KGWA 1XH0A 1Z6KA 3GVWA 1W9DM 1AJ0A 2ZTJA 5FEZA 4DJEC 1I0BA 2PODA 4B15A 3BMXA 3CUJA 4FIRA 1AD4A 3GZAA 3NM3A 4OBTA 3FGCB 1E0WA 5L6UA 4HPJA 5A6BA 2CERA 1XLAA 3BW2A 3PFMA 3W1TA 3GHSA 3PWIA 3ITTA 2E5CA 4JFWA 4ZB0A 3ABSA 3R4IA 1EJTC 3R25A 1X1OA 2RFGA 7XIMA 3C8NA 5BRBA 3FCPA 2PURA 3CK5A 1FWJC 2QDGA 4TIMA 2YW3A 1K8YA 3KBMA 4JKKA 1HJQA 4S3JA 2RGMA 1JPIA 3CZGA 1FWEC 4R27A 1OG6A 1U22A 5CSSA 5FEWA 1QXLA 2IMRA 1XLMA 1IZKA 4YXGA 5AOUA 3KTXA 3U2EA 2INEA 3MHFA 3OG2A 3UZXA 4PL2A 4JTLA 3WUEA 4F9DA 4DJDD 3U8GA 3E2VA 1E51A 3PF3A 5LIWX 5F4XA 2NX3A 4MPQA 3C2EA 5D02A 2OR2A 3P84A 4LUSA 5E93A 2QCMA 4PMVA 1KCLA 4WK9A 3W7MA 3PAJA 2DDXA 3Q2DA 1J79A 1DIEA 4GY7A 5IOBA 1DE6A 4JXCA 3WH8A 1QK0A 2A3CA 4GWEA 4DJFC 1PS9A 1ML1A 1ZJHA 3ONBA 2XIIA 2NT1A 2BY3A 1UZDA 2WLZA 2A3AA 2PLKA 2ZVRA 3V16A 5D2XA 1H7WA 5AVHA 3A13A 3RMJA 4X2PA 1TE6A 4LW7A 3QKZA 3W24A 3AISA 4IIFA 2G3JA 2ZA2A 2IUZA 3LCHA 4GYKA 4YMZA 1UHVA 3VD7A 1TYGA 2BOEX 1ICQA 2VEPA 1P48A 1W6TA 5FKYA 4JTCA 5H91A 4UOQA 5HNTA 3BCFA 4O12A 3AHTA 3D5HA 3HG3A 6PTDA 2GVYA 4WHBA 4Z1AA 2E9LA 1GVYA 4A8LA 1MUMA 4UMAA 3ZVHB 4HU3A 3PUDA 4DXXA 1W37A 1M7XA 1C93A 5FJTA 2GL5A 4EPKA 3LZ3A 1B54A 3IIVA 3BK0A 2QUTA 3G77A 1ITUA 3GR8A 4N42A 3QGVA 4UWMA 2VWTA 1O60A 3F4NA 4JY9A 3VKJA 3NYDA 3BZJA 3CB3A 4DM2A 4FA3A 4XX6A 4AZCA 3PM6A 1QATA 3ABZA 3N04A 5CBJA 1IEQA 2WSKA 1VEPA 3S5OA 1K7EA 3N15A 3F4DA 1EF2A 4F0LA 1UZ1A 5EPDA 3RGTA 1XRVA 1JQXA 1W1VA 3A12A 2QV4A 4H04A 2RDXA 1WXJA 4HPGA 3QW3A 1CLKA 3JVAA 3R7MA 2GGJA 3N4FA 2DIKA 1EJSC 4YYCA 3IRSA 1A4MA 1R7AA 1LBMA 2GGIA 1OD0A 4ZO7A 3W37A 1JPHA 7CGTA 1JZ4A 4R3UA 3BOFA 3CTLA 3NXLA 1JDDA 5H8MA 3D46A 2FFIA 3G8RA 3L4ZA 4ERIA 1I2OA 3MUAA 4NIRA 2YBVA 3NYZA 3WLOA 5ABFB 4XZWA 2QPSA 1NP0A 1B4EA 1J2BA 3HOJA 4W7VA 2VOTA 1EEPA 1E4MM 1PEZA 4YHEA 1DJXA 4JTSA 4UNLA 2QDDA 2PAJA 2VVNA 3BLIA 5IXEA 3KRUA 2QVNA 4W8BA 3ALFA 5D9PA 4CU8A 2QKFA 3C2FA 4K8GA 4NZCA 3L2MA 1Q7QA 1XDMA 2F7FA 3NDOA 1QHZA 1VEMA 4LGXA 2XWEA 1W8SA 4LBUA 1IGSA 1EQCA 2XSXA 2V0TA 2WLYA 1YMYA 3WUFA 2ZFAA 1K9TA 4IUOA 7TIMA 4UXDA 4JHMA 3W6LA 6A3HA 3W22A 2Z1KA 4IFRA 4JIIX 4NNCA 2QCEA 3VIHA 5JBEA 2V6AA 4NZJA 3E0LA 3PBGA 3S9ZA 4UOZA 1IR2A 1ZBKA 4L64A 4TVUA 2CC0A 1RCQA 1YBQB 4BF9A 1XGEA 3IV8A 1SM9A 4XV0A 1F6KA 2VZTA 3NO1A 3ZJ7A 2J9XA 2PB1A 2FHBA 2VRKA 1TCMA 3NR0A 1XCWA 2Z1XA 3S1GA 1POJA 1IXPA 6CGTA 5KSWA 3VKAA 4UQBA 1ZLPA 2H3DA 4HU0A 4NZ5A 1G4PA 1KA9F 1EJRC 3S4TA 1Q6CA 4FK9A 3UZWA 2C13A 3QRHA 1VB9A 3M6YA 3QQWA 3EKLA 1JZ7A 3STPA 3QF0A 3W85A 3S1VA 5KZEA 1EXBA 3S1UA 2WPGA 1GTHA 3MKCA 4RKAA 3PNUA 3OB8A 4XO6A 1I0DA 3NCOA 3N2BA 7REQB 4U10A 3KWXA 4Y9AA 3ARVA 1CGTA 4GCXA 3N14A 3N3MA 2ABAA 4R88A 3VGBA 4CU6A 3K1GA 1PTAA 1I4NA 4BY3A 2Y24A 1FWHC 2VEFA 1T96A 4NXKA 3T81A 1JAKA 3SY1A 5BRPA 1AZ1A 3V1PA 3W25A 4LS0A 2MNRA 5CZTA 4DO5A 4F48A 2A3EA 1JPKA 4G9PA 3U5YA 2XVPA 5M2FX 2DEPA 4GJIA 3EWUA 2OODA 2X7VA 1OFRA 1Q5MA 5CZJA 3KRSA 5CH9A 1VBHA 3AIWA 3L4UA 2FVMA 3OQ8A 5ABEA 3MA8A 4Q7BA 2EXOA 4FS9A 1YDYA 1BKSA 1VPQA 1J0IA 4C6JA 1LZOA 1SO6A 3U4AA 5JIWA 1R38A 3WQPA 3CL7A 4ZBCA 3R0DA 5F1VA 4KETA 2DSZA 2EHHA 1Z48A 1NDZA 1QNRA 4FX8A 5AZ1A 2O0TA 1NFPA 1WOAA 1EP3A 1OC5A 3MSGA 1Q4NX 3QTGA 2E3ZA 1CYGA 3BLOA 3LCFA 3GRIA 4WGHA 5M03A 2WOQA 4ZQOA 4RXFA 4IPPA 2GK1B 3WLNA 5K4XA 1RQBA 1B57A 1J5TA 3WLTA 3AHVA 2J13A 3VK5A 4Q8OA 3ECQA 3I68A 3P60A 1VFMA 3AALA 1EJXC 2HEJA 3GXTA 3LLDA 1E0UA 2XDFA 4XZHA 4WX2A 1LLWA 3SADA 1BF6A 2VX4A 3ZFHA 2A21A 3O0FA 4PMOA 4E0CA 4EACA 4PULA 1TSIA 2PU1A 3R8GA 2H90A 5HJYA 1FH8A 1O95A 5CXPA 3KHJA 1C3FA 3C86A 1K8CA 3UW6A 1VCGA 2F2HA 4UZUA 4L1WA 4WR3A 4AVNA 4YNGA 4WDWA 4NAFA 3HPZA 4GJ1A 3DFNA 3KRBA 3W72A 3LM7A 1KQYA 1KO0A 1TPB1 2XGIA