1I6NA

1.8 a crystal structure of ioli protein with a binding zinc atom
Total Genus 111
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
111
sequence length
278
structure length
278
Chain Sequence
MKLCFNEATTLENSNLKLDLELCEKHGYDYIEIRTMDKLPEYLKDHSLDDLAEYFQTHHIKPLALNALVFFNNRDEKGHNEIITEFKGMMETCKTLGVKYVVAVPLVTEQKIVKEEIKKSSVDVLTELSDIAEPYGVKIALEFVGHPQCTVNTFEQAYEIVNTVNRDNVGLVLDSFHFHAMGSNIESLKQADGKKIFIYHIDDTEDFPIGFLTDEDRVWPGQGAIDLDAHLSALKEIGFSDVVSVELFRPEYYKLTAEEAIQTAKKTTVDVVSKYFSM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of Bacillus subtilis ioli shows endonuclase IV fold with altered Zn binding.
pubmed doi rcsb
source organism Bacillus subtilis
molecule tags Structural genomics, unknown function
molecule keywords IOLI PROTEIN
total genus 111
structure length 278
sequence length 278
ec nomenclature ec 5.3.99.11: 2-keto-myo-inositol isomerase.
pdb deposition date 2001-03-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01261 AP_endonuc_2 Xylose isomerase-like TIM barrel
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.150 Alpha Beta Alpha-Beta Barrel TIM Barrel Divalent-metal-dependent TIM barrel enzymes 1i6nA00
3KBJA 3GNXA 4XKMA 2ZDSA 3DX5A 2X7VA 3KCJA 1K77A 3M0HA 3QZAA 3XISA 1XLCA 4XISA 5J8LA 2QW5A 3KBMA 4A8NA 1XLIA 1QT1A 1XYBA 1XIEA 1XYLA 3P6LA 1QUMA 3AYTA 4A8IA 1XLFA 2QUMA 3QC0A 1I60A 4LNCA 4K3ZA 3VNJA 3N4AA 3CQIA 3VNLA 1XIFA 5AVHA 3NGFA 8XIMA 1CLKA 3UA3A 2XIMA 2G0WA 3DBNA 3CQJA 3P14A 4J4KA 1TZ9A 1BXCA 1XYAA 2HK1A 3KCLA 4QE1A 1XISA 1XLBA 2I57A 3C0LA 3KBWA 2I56A 5EMJA 3UU0A 4A8LA 6XIAA 4K1GA 1XIMA 4GQBA 2GLKA 4X60A 4XIMA 1XP3A 3U0HA 5EMLA 4ZB5A 2HCVA 3VYLA 1DXIA 5XIAA 2HK0A 1XLLA 1XIBA 1DIDA 2GUBA 2ZVRA 3FVMA 4PGLA 4X63A 4QDWA 3AALA 4EACA 1XIGA 1QTWA 2J6VA 7XIMA 4EAYA 3TC3A 3UXIA 4Q7IA 1XLKA 4ZB0A 5H6HA 2G4JA 6XIMA 3XIMA 5C9ZA 3ITOA 5H1WA 3ITTA 3KBSA 1XIJA 1XIHA 3IUIA 3M0LA 2X7WA 3AYVA 3C0SA 9XIMA 1XINA 4US6A 5TNVA 2NQHA 5EMMA 4ZBCA 4DUOA 2GVEA 4YTRA 1YX1A 5FA5A 1I6NA 1OADA 2XISA 4X61A 4ZB2A 3VNMA 3XINA 1XLHA 3AAMA 3M0MA 3QYSA 3VNIA 3UA4A 3KTCA 3M0VA 4GJIA 1A0EA 3BZJA 3CQHA 5AVNA 1XLAA 3CQKA 5I7GA 3BWWA 2OU4A 1MUWA 4QE5A 3L23A 4XSLA 1DE6A 3QXBA 1D8WA 4YTTA 4GLEA 8XIAA 1DIEA 4A8RA 1XIDA 1S5MA 4QE4A 3UVAA 1GW9A 4YTSA 1XLGA 4YTUA 3M0YA 3U3HA 1XLMA 5XINA 4HGXA 3KWSA 4XIAA 1DE5A 1XLJA 4E3VA 3VNKA 5B80A 4G56A 2GYIA 4OVXA 3BDKA 9XIAA 2NQJA 4W4QA 1O1HA 3ITYA 1XYCA 2NQ9A 3ITLA 4HNOA 4QEEA 2Q02A 3M0XA 5XIMA 1XYMA 4QEHA 4KW2A 3KCOA 2QULA 3JU2A 5B7YA 1S5NA 1MNZA 3LMZA 3C0QA 3CNYA 3BZGA 1A0DA 4PFHA 3TVAA 3WQOA 1XLDA 1BXBA 2XINA 3IUDA 4XSMA 4GJJA 3BANA 4QDPA 3CWHA 4YTQA 1A0CA 3KBNA 4HHMA 5EMKA 2QUNA 4DVOA 1XICA 5B7ZA 1XIIA 3ITVA 4HHLA 3KBVA 3ITXA 3IUHA 3OBEA 1XLEA
chains in the Genus database with same CATH superfamily
1VENA 1ME9A 3Q37A 3UWUA 4DUVA 1IXOA 4D6GA 1QT1A 2POZA 1U33A 2VI0A 4EPBC 3PAJA 2XSBA 4HA4A 1S2CA 1XIFA 5LGZA 1PE1A 1XRVA 3UA3A 1H61A 3DI1A 3AYRA 4PULA 5EY5A 4GYKA 2A79A 1F07A 2AAAA 4K38A 3QTPA 2HQAA 1UP2A 4HNVA 5AYIA 2O7QA 3W2LA 4BF5A 4XVDA 1PTDA 2DZVA 5CZ0A 3HZ3A 3RX2A 3VKBA 5C9ZA 5I0DA 1O95A 3FJ6A 4LYPA 4Z2HA 3GDBA 4YCPA 1AMYA 3UWZA 4GZEA 4YTRA 2C0AA 1UR8A 1YXDA 1O66A 3TQ0A 1X6LA 3LHUA 4JHZA 3NQFA 2VL4A 1KRBC 4US5D 4H19A 4X0NA 4ATWA 1X8CA 3PSVA 1ISWA 1AJ0A 2YA1A 2E9LA 4O18A 4X0VA 3SGGA 2X2YA 1EJXC 1SPQA 3TVAA 3R94A 3AJXA 1W1A1 4U10A 1YW1A 2A3EA 2PEVA 1XH0A 3DAQA 1B3ZA 4CNSA 3EDFA 2Z6IA 5DMLA 1H60A 2DSKA 2MANA 4HZ8A 3SBFA 3W4RA 1PO9A 1OFOA 4RK8A 4IG2B 2DZTA 2ZA2A 5EFFA 3ECQA 3E2QA 4Z0SA 1VFSA 3VIJA 2Z4GA 2J27A 4BQ2A 3BLEA 1ZCOA 1TV2A 1AL7A 4WSHA 1SZEA 2NX3A 3U6WA 2X1UA 3NXFA 4B9YA 3NSXA 1KCLA 5FJIA 2C91A 1W3LA 2Y7FA 3NTYA 2A7PA 2GSEA 4PBEA 1TMQA 3CH9A 4AVFA 4U2YA 2VZSA 3WH8A 3T0TA 3QF0A 3AMLA 3ZWSA 1DBTA 4LOCA 2V2DA 2DH3A 2FYMA 3GDLA 2GVYA 3N9RA 5HOSA 4UR7A 4C5ZA 3LBOA 1N8WA 2Y89A 4QG9A 4HNCA 1X39A 3VABA 3CMJA 2X0HA 3RRAA 3M4HA 5HQLA 4YCOA 3R6IA 2R24A 4J2MA 2PBGA 3UJEA 1Q7MA 4XBKA 5F4WA 3B0YA 2Z0IA 4BI7A 1PYMA 1R2RA 3MB9A 2PDUA 2WB5A 2UY5A 3T9PA 3V18A 2P3EA 4L4MA 1R3RA 2VQTA 3ABXA 4AW7A 1B3XA 5J8LA 4HYRA 4UQAA 3KAOA 4LW7A 4DN1A 1GQKA 4C6PA 4IUOA 1TMLA 1F8MA 4KRUA 4K3ZA 1GVSA 2GK1B 1UOZA 4WVXA 1D3HA 4WKAA 4NNAA 2QCHA 3QMSA 4Q8TA 3SIMA 1U30A 3OJGA 4OOZA 1CGWA 3H7RA 3R5EA 1R0MA 3QV9A 3GNRA 3T0AA 3BAIA 3UWWA 3S83A 3GW3A 4Y90A 1XLLA 1G7VA 3TTSA 3AWOA 3AJ7A 4FNRA 4AY8A 4UTKA 2WHKA 3GG0A 2X2GA 3QHOA 3W70A 5D03A 3SFWA 3UZ5A 4IT1A 3EEGA 3QJAA 3LB0A 3PUEA 3PY2A 1J93A 4PUEA 1RSCA 1J10A 5IXEA 1RHCA 1OADA 2I5GA 3TR2A 1UJPA 1ONXA 1UWSA 5AVNA 1GQLA 3PC0A 4CQDA 5C9XA 2HBVA 3RLHA 3ARXA 3T2OA 1ZJBA 1LDCA 4WQ6A 1VZWA 4JFUA 2WZMA 1H7NA 1EUNA 4YS1A 3ITLA 3PANA 4AVOA 1XX1A 3W6YA 2R1NA 2O55A 2QCDB 4FXSA 3VOHA 2J7GA 3IEBA 3NL5A 3DFYA 1SW0A 3LYEA 3H70A 3C4UA 5K3VA 5FJJA 4FOUA 2J7EA 1YE4A 2XU2A 1IIGA 3CHCA 1TV8A 2VDIA 3BJSA 3MBFA 5AKQA 2QUMA 3WL1A 3O07A 3TC7A 5CPMA 4ZXOA 1KC7A 2PE4A 3QZ6A 3TDFA 3C0LA 3TQKA 5DBTA 3L4VA 4LEFA 1EEXA 2NUWA 3APYA 1N55A 3REQA 1UWAA 2WZEA 2EPMX 1DJZA 4K7VA 4MG4A 3UP8A 2AMGA 4AF0B 4XD5A 2HDJA 4JNZA 4C6FA 3RM8A 2A4AA 2DDXA 1A5LC 1EF3A 2PRLA 2VEPA 1OM0A 4M82A 1M9HA 4DJEA 3H2EA 1VPYA 3IJIA 3SW6A 5BXRA 4CNOA 3V5OA 1DWJM 3GHRA 2XH2A 3PWIA 2VFFA 3QQ0A 3BAJA 4LY8A 2V5BA 1UW9A 1E4MM 4P8WA 2HPMA 3ZLFA 3VOFA 2BY1A 5C0QA 3AZSA 3BTNA 4C7FA 4UTTA 2RDWA 4QQ3A 3UWQA 3UR5A 1C92A 3CB8A 3DG6A 4YNGA 3RUBL 1ZB5A 3QPEA 2D2JA 4GABA 2WLZA 3W1MA 3NQEA 4JTLA 4AC1X 4NZ3A 2Q3RA 2JIWA 2RDXA 2X40A 3K5XA 3L2MA 1DJGA 3IAPA 3S5ZA 3CJPA 3V75A 5DRCA 1J0IA 1AODA 2H90A 1XBYA 4FF5A 2DU2A 4R27A 5CAHA 4LWWA 3W27A 4DELA 3AXIA 1MUMA 4UBPC 1GVIA 4PL1A 3FNDA 1XQKA 4IQEA 1EP3A 1Y7VA 3EOUA 3DHDA 1C90A 1UA3A 1P6WA 3C56A 2BY2A 4A35A 1JD9A 2ON3A 3QY6A 1J11A 5C6MA 3SCVA 6TAAA 2ANUA 4BJHA 3BLLA 2VZOA 2WPBA 2ACQA 3TMQA 5D9NA 1TUXA 1EUAA 5M03A 1UD2A 1ZJHA 3FJ4A 2QMJA 1AD1A 5CPLA 3N04A 2Y85A 1VF8A 4ZQCA 2F2KA 4IMFA 1ME8A 4K8GA 3M0XA 1CXKA 3KTSA 3MMWA 2PB1A 4PFHA 5E6YA 3LXAA 2A7NA 3WLKX 2NXGA 2NXHA 4L61A 3N2CA 3ENLA 1X6UA 2VM8A 5AZ0A 2ZWYA 3PZTA 1E71M 4MF4A 3OA3A 2VX6A 4MOZA 3PJWA 5JVLA 4M0XA 1PJ9A 4MY8A 1J2BA 4QJ5B 5E1QA 1TPFA 1Q66A 4H8UA 3F4DA 4MUZA 3UXAA 1QW7A 4BS0A 5AVHA 2CCRA 5DFAA 3THCA 4F79A 1RALA 4XTDA 5IM51 1IZCA 4O12A 1XLBA 3FW6A 1X96A 3OO2A 2G96A 3GIPA 2QR6A 4K8EA 3RXZA 4C7DA 3PBYA 1JYXA 1BRLA 2H8ZA 1VBRA 3VC5A 2FTYA 4PA8A 5H1WA 3E2VA 4WZHA 5G2HA 3EPNA 3MDWA 2ZBTA 4G7EB 3CIVA 3O6YX 1VLWA 1VQTA 2VQUA 1NDYA 5A8NA 1S2WA 3BZJA 2J9ZA 1BKSA 3TAKA 1V3KA 1XDJA 4HVXA 4XD6A 4Z2LA 3UZWA 3AUJA 4L56A 3MMDA 7CGTA 1KLZA 1ZZMA 4TXEA 4RV8A 2RHGA 2BHUA 2DQWA 4Q8WA 1WDRA 3ZJ8A 3URNA 3H2CA 3VDCA 3WBXA 1JIBA 3CHFA 4GVFA 1AG1O 2G97A 2CLPA 4H7VA 3CLMA 2Y8UA 3CUHA 3KBVA 1MXGA 4F0MA 5DCBA 5HK4A 4Q8QA 2QDGA 2ZUTA 4V27A 3MUY1 1RJPA 3NA8A 2VC6A 4P5UA 3QRHA 4FA3A 1V03A 5I77A 1EHAA 1TB3A 3CQJA 4U33A 1JRBA 5FJUA 3SB0A 1UD6A 4X2PA 1WDDA 3WLQA 3DHFA 1RBLA 3GZ3A 1AW2A 4A29A 2VCAA 1Q13A 3FVMA 5BRPA 1OC6A 2QF7A 4AHPA 3KVKA 3UESA 5E0KA 4PCPA 1RY0A 2JKEA 4TVUA 2PDLA 1FDJA 5C2XA 4RE4A 4BEQA 3N11A 4I7WA 1NH6A 2OLAA 1GQJA 4DUOA 3TYAA 3LPGA 4JTEA 1XLHA 1EEPA 1O4UA 2CWNA 4K7YA 3VI2A 4ASTA 3AXKA 2P0OA 1DJQA 1BYCA 3GY1A 4H7CA 2W3ZA 5CC3A 3VCCA 7ODCA 3WUGA 3QFWA 2CBVA 2F6KA 1KBKA 4S3AA 3EWXA 1BGAA 2R14A 1KM0A 1ZBVA 3ARWA 2OZTA 2PRHA 3IPWA 2CLMA 3AXXA 3TP4A 3RPMA 5DLCA 3W1NA 1V79A 5HANA 4CLMA 2NV2A 2PDYA 3E96A 2UV8G 1LRQA 1HVQA 3IJ9A 4N7QA 1J79A 4HCHA 2P8CA 5BXTA 4EWND 2PAJA 4UTLA 2XVNA 1M6JA 1XG4A 2Y0FA 1TZ9A 2NZLA 3PJUA 4ACYA 3L4TA 1TA3B 2PDBA 1IT0A 3EXTA 1HVXA 1BYBA 2WMIA 3GYEA 2JE8A 4OU1A 4I6VA 2X09A 1QI0A 4BI6A 3WBWA 3WQPA 3HIJA 4AWEA 4D8LA 3R1ZA 5C70A 2VDHA 4DIAA 3G22A 3TAOA 1H50A 4F2UA 4TVDA 3AI0A 2PZNA 1JCJA 3O63A 3NJ3A 2ISWA 4UTJA 4ZOBA 4NI8A 4AD0A 1CXFA 2YKKA 1V93A 3K4AA 1WDPA 1I45A 1GHSA 1D8WA 2BX7A 3DBPA 5AN7A 4YLWA 5DANA 5DXYA 1MWOA 4YTUA 4BHYA 3A9BA 2RDTA 2HNHA 2WNWA 3GUWA 3ES8A 1GT8A 4FXFA 2NQ9A 5KETA 4WIWA 4I9TA 3U57A 3K8MA 4PMOA 1SFLA 1F4HA 4H2HA 3A23A 3UD6A 1LBLA 4K6AA 2GQ8A 1R2TA 4V28A 2DORA 1U5JA 3S6DA 3G77A 1N82A 2BB0A 7TIMA 1V3LA 2GOUA 4F0SA 1NOWA 3CL8A 4IGNA 4G1NA 4DJDD 4MPKA 2YPIA 3RF9A 1NWRA 4WJXA 4L9ZA 3TR9A 3L9CA 2WPGA 3LHVA 4UUIA 1NWSA 1TRIA 2HXTA 1EJUC 4E5TA 2HPIA 3WQ8A 3OHMB 1OC5A 1FOBA 2OLHA 5XIAA 4JDYA 4C1NA 1BTCA 1EXPA 3M0JA 4UFJA 2G3MA 3T78A 1GK8A 3ZM8A 2FVMA 3KBSA 2ZFAA 4HHHA 4LVGA 3P5YA 1TTQA 2YDRA 1J6PA 1H7XA 1LG1A 1ONWA 3BOFA 4RCXA 3WFAA 2OX1A 4JX4A 1VB9A 4O1CA 4DY1A 4S3CA 2XGZA 1CNVA 3A5FA 3M5VA 4JN8A 3LGEA 2WKLA 4PYSA 1UMLA 2DVTA 3S2NA 4V1XA 1XLMA 4UIOA 2C79A 4E3VA 3WH9A 3FXGA 3KP0A 3WELA 3COTA 3PFMA 1A5KC 2AL1A 3WJXA 2VGIA 3GIQA 1QHZA 1KFJA 3S1XA 4OWGA 3I7RA 2NT0A 2E1WA 4NJHA 3DH7A 4AAJA 3TW6A 2FHBA 6ALDA 3VIPA 5LHEA 2X0SA 3RCNA 1EH9A 4P8XA 5DBUA 3T0CA 3EPOA 2YBTA 1BVZA 2PU0A 2RDUA 3FFSA 1KM1A 4O52A 2GGJA 1S39A 3VD3A 3KLKA 1CECA 3PSWA 3NQ2A 3AU2A 1V3HA 4TV6A 3GXNA 3BLOA 3H2NA 3V4BA 3I6EA 3WKZA 3UW6A 1KFEA 3EEZA 5HAOA 4P7OA 1O5RA 1RXOB 4IIFA 1PBGA 2DW7A 1QI2A 3NQBA 1VYRA 1DL3A 3EWDA 1N8IA 1XKJA 3TYBA 3W85A 2FLIA 1NOUA 1H7OA 4L7ZA 5JIPA 2VJXA 3SY8A 3UJ2A 3CAQA 2TSYA 3G1DA 3KP1A 3L67A 2VFIA 2BVDA 3IUIA 2ZX6A 3SURA 4QLJA 4DNMA 4AZCB 4M1RA 3S2LA 2W5FA 3CC1A 3S4TA 1NFPA 3F2BA 2I5QA 1XJBA 4L9XA 1MW3A 3A4XA 4H6KA 4FIRA 4RPPA 2QCLA 4DBEA 3OP2A 1RPKA 1LT7A 4I8YA 1U22A 4NZFA 4DZ5A 2DZBA 4NJJA 1T8XA 4CD6A 2WWDA 1E6RA 4OT7A 4I9AA 4F0HA 2J78A 5A2AA 4E2DA 1JCMP 2ZA3A 3PWAA 4HNOA 4JNYA 3TKFA 4L6DA 1VFUA 1B9BA 4N6EA 3UZYA 4JKMA 1F4AA 5RUBA 5HATA 3WLOA 1QHPA 2NSOA 5CSYA 1OX4B 1W8GA 3AIRA 1K02A 3LCXA 1B4KA 4JTRA 4PEEA 1XLIA 4LALA 1DP0A 1U83A 2DW6A 4A2SA 2WKJA 3CMGA 5CG7A 2OEJA 3ITGA 3UG5A 4UTUA 1GEHA 1ZLPA 3TUUA 3CQIA 1KBBA 1E9ZB 1O12A 3LI0A 1FBAA 2Y70A 4M24A 1XYAA 1C93A 1D8CA 5BOOA 3M7WA 3TOPA 2PD5A 3VE7A 4GE8A 5C9RA 3R79A 3LCLA 4N9BA 3WD3A 3VA8A 9CGTA 4MVAA 2CBIA 2FB3A 2PWHA 4EACA 1CX9A 4WXZA 1IT8A 4GKTA 1CGUA 2Y5JA 3PG8A 3TCSA 1KTNA 5M5DA 1EL3A 3B8WA 5FOOA 2C16A 5I09A 3LV5A 4X61A 1HL8A 3B03A 3AAMA 2QPSA 4YVVA 1TPWA 1W54A 1LM1A 4AIEA 3HF3A 1A5MC 4QDMA 4AD1A 4MKSA 4Z1BA 4FOKA 3SM0A 4GQGA 3KWSA 4NSBA 4XIAA 3PPHA 2QAFA 3H26A 2X1SA 2VX7A 1US3A 2AAMA 2NQ5A 1IV8A 2PWGA 3FY1A 4DYKA 2I9UA 1O60A 4GZJA 3HV8A 5DN1A 2VFGA 2J7FA 1Q4WA 3VDBA 1VRDA 5CSSA 4NKCA 4NT0A 1H1NA 4HMNA 3CU2A 2FFCA 2FH8A 4CVUA 1XW8A 4MB3A 4QIUA 4Q32A 1SVDA 2XVPA 3JRKA 2FZBA 3V5FA 4HMDA 3NQDA 5CBIA 3OGRA 2HS8A 3WNMA 1E9YB 4XQ6A 1UROA 1WBHA 2QDDA 3O7UA 3GZAA 2C6QA 2E9MA 3UT0A 5C2CA 3R2GA 1A3WA 4CN6A 2CEQA 3SRHA 3N6JA 1G5AA 3LSBA 2EHHA 1OSEA 1DHPA 1XDLA 1NY1A 2INEA 2NUYA 4BF9A 1TWZA 4K1WA 4HA3A 1J4EA 1A5BA 2PDWA 2ALDA 3N9SA 2NWSA 4NAFB 3IIZA 5FD0A 3RJXA 1RPXA 2VEIA 1ZBKA 4NJGA 1ODUA 1UPPA 5BWAA 5H91A 3P84A 3UYIA 3QYSA 4KIEA 5FEPA 3C86A 2P1FA 5I7GA 1T0OA 2YFNA 4X2RA 3POHA 4Y9OA 1SFTA 5G4WA 4NQ1A 2B7OA 3W7QA 1KXQA 1MQRA 3A4WA 1I0BA 3WH7A 4L64A 3W1QA 1ZBWA 2Y5SA 3H54A 3DC0A 1PIIA 1Q6GA 1DWGM 3DGBA 4JQ4A 2TPSA 4QS5A 2VZTA 3WF2A 2ACUA 4HSHA 4DBUA 1ITCA 3Q4DA 3JVAA 4HZMA 4NILA 2V8ZA 1KWGA 4M81A 4ZQMA 1N8FA 4B5XA 2PDGA 3P6LA 3V16A 4A8IA 3G1VA 5T8GA 1N2VA 2OYMA 5GJMA 1EFZA 1RD6A 1JRCA 3AICA 3ZLHA 3L5MA 1TPH1 3F4NA 2NV9A 2OOFA 2Q8XA 1TREA 3OG3A 4LUSB 2ZUNA 1IXNA 1HO1A 1BAGA 1FHLA 1C91A 3VX1A 5A1AA 1JCXA 5F2MA 1CYGA 4D72A 4C90A 1PCKA 4B2DA 2CLIA 3SCRA 4IMDA 4OJYA 3FN9A 3KS5A 3OVRA 1BVNP 3ZT5A 1K8ZA 1W9BM 1QFEA 4XV0A 4D6JA 3M6YA 1RLDA 1VBUA 1PEZA 2BY3A 1EOMA 2PC4A 1OFBA 1RA5A 4Y9NA 4LS0A 3T2PA 1W2PA 2GDUA 3M0LA 5AYZA 2WJZA 2FZ8A 7REQA 3LGDA 1MEWA 2V3DA 3AS0A 4YVPA 1TYGA 4KWUA 1O5KA 4EE9A 1A0EA 1KWKA 1VPQA 1V08A 3TFXA 2G8ZA 3HFTA 3H7VA 3BOXA 1E9IA 1IWAA 3F5LA 4KFPA 2A5HA 3GW0A 1JAKA 1Z41A 3MY9A 2X8RA 3T7VA 1S5NA 2YL8A 2QDHA 3N2OA 4HOWA 1W3HA 2NWRA 2V30A 4KPLA 1UD4A 4UTWC 3NO1A 2FH6A 4U4MA 1NTHA 1Y5XA 4ZO9A 4A3RA 5FF7A 3SO7A 3WD2A 4EPEC 3SUTA 4IJBA 1R46A 3G8RA 3DIPA 3GFYA 1A5NC 1HJWA 3OVPA 1GOOA 3RX4A 1IHIA 5CSUA 1AQHA 4EANA 5FEZA 1D2KA 1E5JA 1FWCC 3EKZA 3PZUA 4MHBA 5I3JA 1OX4A 3LPFA 3LPPA 2C1GA 5D4YA 2WMJA 1JZ2A 1JDFA 3U2OA 4K37A 4PTWA 3W7IA 3RIKA 1GJPA 1DJHA 1EGZA 1WKFA 2VC7A 3N18A 4FNTA 3TWAA 4LXFA 4S2CA 3SCQA 2OOGA 4H4IA 4GUFA 4EXQA 1J0YA 1KM6A 2ISFA 3LOTA 2G3IA 2XVKA 4GLEA 1VFTA 1ZGDA 2WBKA 1WV2A 4TX9A 2CPUA 2Z6JA 2C19A 2GQ3A 1KBIA 5D38A 1GJUA 4EF8A 1W9PA 4MJ4A 4F40A 1G01A 3VKDA 2OEKA 4QG8A 2PP3A 1QBBA 4W8BA 1YNQA 5HQEA 3HM7A 3B8SA 3B8TA 5G1YA 2CZFA 3BANA 3GC5A 4HHMA 5KTLA 2D24A 1DYSA 4PB5A 1BQGA 2ISDA 3GU9A 2J8GA 5FF0A 3DENA 1M68A 3C2VA 1AUSL 4RNHA 3W83A 3O16A 2OLSA 2Z24A 3DFSA 2GSHA 3W01A 2IMRA 4G6CA 3HBLA 4Q7NA 3UPBA 3CGTA 2DVXA 1QOPA 5D02A 5EMJA 2QGHA 2BLEA 1KV5A 3VM5A 2UBPC 3MCMA 4IPLA 1MW1A 1VGAA 5JXQA 1ENUA 3VDGA 5LA2A 2ZVIA 4PC8A 3MO7A 1HX0A 4AB4A 1B9ZA 4AVNA 1Q3NA 1PYFA 1L2QA 1MXSA 3IIOA 2ZX8A 3TJXA 1G4EA 2ZE0A 1KQYA 2HWGA 2YCJA 3H8AA 5H2ZA 4KCWA 1PHQA 2QJHA 2ICSA 3AMGA 2WZIA 4PUWA 2F9RA 3SUUA 3S2MA 3TROA 4HU3A 4FAMA 1PUDA 4MNMA 4ATDA 4L9YA 3NEVA 4NJIA 2QXWA 4QE5A 2A3CA 1BWLA 2CKRA 4H8HA 5K4XA 4Q3MA 2QIWA 3BMWA 3ZVIA 4IL0A 5GQBA 1CGXA 4J3UA 1XH1A 2OQHA 1QPQA 2AGKA 2WCSA 3KRBA 1IXQA 4LEQA 3LRMA 4QP0A 5M3WA 1O94A 2FQIA 4P8UA 3GTIA 3FHQA 1ZS2A 2WAGA 1P0EA 4CD5A 2WCAA 3W07A 1WE5A 4HNNA 4GJJA 1FVPA 2GGIA 4DBDA 3ARZA 1TV3A 2B4GA 3QSTA 4NXSA 3RM4A 1HGWA 1JCNA 3HTWA 3OB8A 2ZICA 1Q8JA 2YCLB 3FK4A 2YZ5A 4HT3A 3S46A 3NSNA 1J5TA 4FSAA 3CHDA 5DY2A 1V6YA 2WMIB 1QMLA 3WEMA 1X97A 2GGEA 2GDVA 4ZZ9A 4WDUA 3WNNA 4UXDA 3SJ3A 2B7NA 1AFSA 1Q7ZA 3O6CA 1EP2A 4KWSA 4U31A 3N4FA 4AZGA 1OG6A 3VGEA 3WLPA 2QJJA 3BSHA 3KM8A 3P7YA 2NW0A 3WK0A 1IQ8A 4JHMA 2BVYA 3MUZ1 4CCDA 4LUSA 4HSOA 4S38A 1S2AA 3GHUA 2G5WA 1UC5A 1E1CA 3W7PA 3MJMA 4PODA 3LCHA 4AFYA 1SM9A 4GZIA 2E1DA 3NZGA 4JTTA 4LV4A 2ZZ5A 1M04A 1JUEA 1XUUA 3AIWA 4L65A 4Q7BA 4LAOA 3EZ4A 2HZGA 3N25A 4GOAA 2NV1A 1PHWA 1M53A 1TFVA 3T8QA 3DYOA 2OELA 1DOSA 2X1IA 3EX2A 4Y9AA 1S2VA 3ZSTA 3NZRA 3W1PA 4LRTA 3WENA 2Y63A 4KEZA 4H04A 4IXXA 3PVFA 4C1LA 4DXXA 4ADUA 2X1TA 4IXHA 2OMAA 5EGRA 1W9VA 2VVSA 4K36A 2XIIA 1VEMA 3GB6A 1B31A 1KW1A 3SN0A 3W26A 1GCYA 2DIKA 5AHFA 4GH3A 3OYXA 4PMYA 3WY1A 5MF5A 3H53A 2YYUA 2VP8A 4BA0A 4YIWA 1EGMA 4X3ZA 3TNBA 4NIRA 2J7DA 3VMPA 5FI8A 4PMNA 4WOQA 3F4VA 4YTTA 3C6CA 4KFOA 3Q2DA 1SJCA 3P74A 4NG3A 3UR8A 1XGEA 3MV11 3DDMA 4JFTA 2CIPA 3O1NA 1O1HA 3M44A 3BURA 3R13A 4QEHA 4KW2A 2YBUA 1W32A 3S5NA 2YFOA 4O0ZA 4AWSA 3OBAA 3GG8A 1I1WA 4DF0A 4UNIA 1G1YA 1A4LA 3KOZA 4QFUA 1FUYA 4AD5A 3ATZA 1FXPA 2EGZA 3SCWA 2OB3A 2BG5A 1EGVA 5CJ5A 1R6WA 4FXRA 1SW7A 4KQNA 2OXNA 1THFD 1TV4A 2GOKA 5BRQA 5IFTA 2NX1A 1OEPA 3HQ1A 3V7PA 4CVWA 1FP9A 5HQMA 3U4AA 1LRNA 4O53A 2AQWA 3ES7A 4HZ7A 2VT0A 3T4CA 4LVFA 4Q8NA 3EDKA 4A3YA 3FSUA 5IHSA 2DZPA 3HPFA 5LZLA 1PZ0A 5FF3A 2W66A 3DFQA 1OT1A 3PBMA 5G5IA 5A6LA 1AQ0A 1OX5A 3B40A 4GKLA 4NU7A 2VO5A 1T96A 1OJXA 3PTDA 3QHNA 4G7FA 3CTLA 2Z1XA 3SCNA 3CUIA 2J9XA 1JDAA 8XIAA 3VOGA 2A3BA 4DUXA 4MJ2A 4QTGA 3U3HA 3W87A 1UZHA 4HSNA 4DYEA 1NELA 5XIMA 2HNEA 4ZENA 2YL9A 2DP3A 1DIOA 2ZZ3A 3O06A 1GYNA 3OBKA 4R33A 5K9CA 2UZ9A 3HJEA 2IKHA 2A2IA 3A6OA 4BQ5A 3RLUA 2CFFA 3PULA 4CD8A 3EDEA 1VAHA 1T5AA 3ZZ1A 2XWEA 3IANA 1UH4A 2XGIA 3W1AA 2WC3A 4B91A 4M6UA 3MJYA 3JS3A 1P1MA 7A3HA 3DKJA 2ZIDA 1GW1A 3ZO9A 2WMKA 4JQ2A 3KTXA 4C6MA 4R7OA 1QW8A 1RBAA 2JF7A 4XIMA 1E6NA 5EMLA 3QEZA 1UMYA 4GGHA 3RNDA 2ACRA 3EWBX 4W89A 1R30A 1EJ7L 3W02A 2R91A 1ODZA 2QQ6A 4PN2A 1KGWA 2UY3A 2F84A 2D0HA 4OHQA 4TVCA 4DO7A 3GR8A 1UBPC 3KVJA 3R12A 4GMEA 1HIZA 1GNXA 4U5KA 1LLOA 2ODOA 3NEHA 1I6NA 2YDAA 4LBRA 2VGFA 3UY7A 2TAAA 1UWRA 4IIEA 3TLQA 8CGTA 5MKGB 3NQ8A 3M0KA 4HJFA 1MUWA 2EPKX 3SN1A 2PU1A 4S3KA 4GUIA 1XC6A 2Z2UA 1QO5A 1Q7QA 1FP8A 4FP1A 4CN4A 4POCA 3WQ6A 2GSJA 1XUZA 5DMNA 3CL7A 5CBBA 3KOYA 2QUTA 5HJYA 3LNPA 1T8QA 3VOIA 4JEJA 2V3GA 1SMDA 2EPHA 2ZUVA 3WNLA 1XYLA 3WBAA 4XAGA 3JZUA 1VBJA 1H63A 3FA4A 3UPMA 4QE1A 5FESA 2V67A 2ISVA 5F4XA 3ARRA 4IP4A 5A6AA 4Z1DA 4O10A 1W5MA 1C8XA 4Q22A 2WSKA 3KL0A 2J8TA 1H51A 3RLGA 1OYCA 1B3OA 7XIMA 1O5XA 3MCNA 3L4YA 2IPFA 1DJIA 1LORA 2Z1BA 4C6KA 2I14A 3OZOA 1F3XA 5FF4A 3H4XA 1ITQA 4LCSA 3ZIZA 5CBJA 1F7BA 3SJNA 1EB3A 4Y6GA 1TJRA 3MWAA 1RCXB 3F2CA 4GJIA 1MRQA 3LHYA 3P3BA 4WK9A 4C6IA 1BTMA 1KQZA 2Z1VA 3P67A 1F3TA 2J7CA 2ALRA 2XH4A 3FYPA 4JBRA 3TYDA 3KHJA 5DX7A 1D7FA 1R9ZA 3AU6A 1H5VA 4ZO6A 3A47A 3MSGA 2GJXB 2F6XA 1LLZA 4UWMA 4OECA 3FXYA 3P5ZA 3BK0A 4MM1A 1TVNA 5BZAA 4KRZA 3NR0A 2PDNA 2EPLX 3SGZA 4JYEA 3KBMA 4FIQA 3NZ1A 1HP5A 2GQ9A 1VR6A 4I3GA 3OLDA 4IX0A 1FH9A 4J40A 3VM7A 4BQ3A 2GPTA 3N6HA 5EFDA 3O2LA 2XTKA 4RZ6A 4Q33A 5GJPA 1WB0A 2P0IA 7ENLA 1SMAA 5AHIA 5A95A 4DXVA 1GOMA 5A94A 4AC7C 4OV9A 4ICMA 3ABOA 2YL6A 1ZAIA 4WDXA 3RCMA 4DM2A 3P60A 5JQ9A 2WK2A 1SSGA 2XFRA 2JBMA 4RNIA 3OW1A 3VKKA 3S9ZA 4RR4A 3E49A 5HUOA 1TTJA 2PF0A 1UC4A 4AD3A 3W7DA 3W2MA 3SDOA 3CQKA 4ZQOA 4JFWA 1QPNA 2FDMA 4D6IA 2EPNA 3SY5A 2EO7A 4EOUA 3IVSA 5AFDA 2JF6A 3L0NA 4Z2JA 3VD4A 1NIUA 3IARA 4MUPA 2ZZ4A 4XAYA 4C6JA 1WKEA 1Y0EA 3LLDA 4AEFA 3KL5A 3LTPA 3KRZA 1AA1B 1AMKA 4NYYA 3KBNA 4ERIA 1FXQA 4IJRA 1FCQA 4RZ4A 3M6DA 5K4ZA 2Y7DA 2PDCA 1VFLA 1OWQA 3MI2A 1E4LA 3THAA 2CBUA 2P10A 2B7PA 3W7CA 1U5VA 2DVUA 5G4EA 4HP5A 1Q6RA 4E8GA 1Z89A 1PB0A 5ABTA 3QH2A 4XZHA 2ZTJA 1TO3A 2FMNA 3VD5A 1WZLA 4S23A 1KR1A 3OIXA 2CERA 5LIWX 1QK2A 3HMCA 2J25A 4O4WA 3FSTA 4Q8VA 1NDVA 3BMXA 1SFJA 1FHVA 1IR2A 3TH6A 1MSSA 2W92A 4S1FA 1UR3M 3S6OA 3EBVA 3STEA 3WN6A 5I3HA 2OVLA 2XH7A 3SY1A 9XIMA 2BXYA 1GG0A 3F1QA 6REQA 3B8UA 3LMYA 1YPIA 2BGQA 3R0KA 5FSDC 4U2ZA 2GDQA 2YCEA 4KT2A 4W7WA 3E3HA 4BZYA 2QLYA 3MA8A 3GG7A 3WFZA 1ME7A 2ZRUA 2CLHA 1IIHA 1BSLA 2IQ0A 3C2EA 4IGSA 4W9TA 1XIDA 4QE4A 1HP4A 3EGJA 1EO5A 1FWFC 4WD0A 3TCEA 1TZ7A 4W4QA 3A4AA 1L6SA 3CV1A 1J12A 1I2OA 2XJ7A 5FEWA 2HV5A 4LBSA 3S8HA 1E0XA 2XINA 4UQ9A 3RGTA 3SADA 1DWHM 1UZ1A 1PIGA 1AZ1A 2WO5A 4G1KA 2PDQA 3CYVA 4NP7A 2XGBA 4CQBA 3UY8A 1JUKA 1N7KA 3IIPA 4QS6A 1WZMA 1J0KA 1RV8A 1W91A 1GVRA 3BLKA 1JL8A 5IFPA 2BNJA 4WY0B 4Y9PA 2GJNA 4G7EA 4CUCA 4GXWA 1PVNA 4HU0A 3E0VA 3PWGA 3F5KA 1F76A 2G50A 2VRJA 2XIBA 1BPLB 3F03K 4HPJA 2A7RA 3GYCA 1OFRA 3MYPA 2DT1A 3O6AA 2XUCA 1MEIA 4O17A 1PL9A 3ALFA 3GNNA 1RJQA 2PGWA 3NL3A 4ZBCA 5HPCA 2PP1A 4KBXA 2BGNE 4L1XA 4AZ5A 1G67A 4ZXLA 4US5A 5HWNA 1F8IA 4AUBA 5CPQA 3W9ZA 3W22A 3UR7A 3UCQA 1CXHA 3UNTA 1A47A 2QKFA 3CAVA 3GE7A 3AIUA 4D8ZA 1Q63A 3I68A 4AEOA 5EBUA 2YW4A 3EX1A 3R7MA 2PTDA 2NQZA 3B05A 3NOEA 5JU6A 3RILA 3B0XA 5D32A 3WFLA 1FDYA 1KLYA 3WLLA 1KBJA 3R25A 3CS2A 3GU2A 2NVDA 1A0DA 3EA2A 1CWYA 2PI6A 2ZXQA 3LQGA 5F4SA 1EJTC 3KX6A 3GTXA 3RYSA 1EOKA 1RA0A 3PM6A 3BJFA 4PBGA 4HTYA 4H9VA 2OWCA 2YXOA 4GYFA 2PDMA 3B97A 3WLRA 3H22A 2X42A 4FR6A 2WW5A 1ML1A 3UJRA 1PPIA 4R34A 1F6KA 3W7NA 3C61A 4HHPA 3WQCA 1J9YA 1ZP4A 3NQMA 4NYUA 3TFCA 3LDVA 3W3OA 3EB2A 5HINA 3DHUA 3NSMA 1HNYA 1B57A 4S3GA 2QIIA 2HXUA 2Z1WA 5H6HA 1KCZA 3BAYA 1OCNA 4F9DA 1H62A 2NT1A 3BJTA 4GINA 4S3FA 2I17A 5TNVA 1IEQA 3I3BA 3VIIA 4V1YA 3EOEA 3NG3A 3CWNA 4H00A 1OFDA 3BCFA 5LHFA 3L4WA 4HPGA 2HJPA 1BF2A 1GZJA 3ONCA 2FB2A 3PB2A 4GBUA 4GY0A 3RRXA 5BW6A 3W7RA 4JY8A 3WMBA 1UQYA 1S5MA 4JYDA 2WV8A 3VX0A 4FI4A 4PUNA 4E8CA 1PX4A 1ADOA 1ONEA 2E40A 2DQXA 1G4SA 3QN3A 4UMAA 4I5UA 5TF0A 2ZC1A 4W7UA 1V7AA 3B9NA 4O19A 4ZMGA 3SIZA 3MI3A 1IEVA 3CM4A 1VFOA 5J5DA 3LBCA 5BU9A 3T44A 1TZZA 4O14A 3G6LA 3EWYA 4GK8A 4MADA 1R5YA 2VD8A 4DX3A 1QUMA 5CAKA 4A22A 3V3WA 3VUPA 4UB9A 1HL2A 4DEFA 3KE0A 4JN6A 2XIMA 3MKCA 2VRKA 2AGTA 3NL6A 4OE7A 1WCGA 3KBWA 3P61A 1TX0A 2AKMA 4XZWA 1UB3A 1KKOA 3LD5A 3U0HA 2HCVA 3KLLA 1JPMA 1QTWA 2R9RA 3U7VA 3T0BA 4WKFA 2ZXBA 4PSRA 1Z69A 3L21A 4FLOA 4QRNA 1TR9A 3VIHA 4AEEA 4UTIA 1E1FA 3EWUA 3N29A 2E67A 1SSDA 2VGBA 3W1LA 3GUGA 1NEYA 1AW5A 5C7HA 4DZHA 1YIXA 2W6RA 4HBKA 3WCZA 5FAJA 1ESWA 2XM1A 3CWOX 5F1UA 1MDLA 4PB3A 5I06A 1DQWA 1JI2A 5K9DA 2WNZA 2QNEA 4GI6A 4GYJA 2W67A 2YCLA 5EA9A 4E2VA 3IJLA 4LCQA 4JCMA 4OKDA 4XD4A 1S2UA 2EJ1A 2QCDA 3MT1A 4A3QA 1HL9A 1K77A 3SCPA 1EC8A 3RLVA 1FWNA 3ARPA 3E6EA 2BP1A 2FHCA 3PHAA 3W7LA 1S5WA 4WEVX 1HKKA 4YWIA 2VWSA 2Q09A 5D30A 3BO9A 1SJAA 1LOLA 4RZ5A 4LUTA 1TUFA 4DZIA 3N19B 3MP3A 5GVJA 1YKWA 1G69A 1KRMA 3TU9A 2UWFA 3VXGA 4HNLA 3GS6A 1X98A 4QNWA 3MSRA 1NSJA 4M56A 4WUIA 1ZL1A 3BLFA 4UFLA 1IEWA 5C8BB 1G4PA 1CI1A 5AHNA 1UUMA 2B0MA 1Q6CA 4AXKA 2ZZ1A 3NGJA 5F1VA 3K46A 3KTCA 1QI4A 1QO2A 4AZIA 3LZ5A 4DWSB 2BFGA 2O56A 5ABFA 4UFMA 4J3ZA 3GVQA 3S1WA 1E0TA 3C3UA 3G3MA 4YN5A 4DWDA 2DT3A 2G3NA 2PGRA 3WLHA 4GIRA 1MDRA 3CHEA 4JICA 1MVYA 5CZKA 4AWUA 4NZCA 4Z2IA 4LVAA 3PS7A 5B7ZA 1OABA 1NAL1 2PA6A 1GVEA 3IK4A 2YGYA 4AIBA 4B15A 1DWAM 2PWFA 1H1ZA 1NWUA 3DX5A 2EPOA 3QZAA 4ZTYA 5HMSA 1K8CA 3KL3A 4QHRA 3G24A 4RJEA 5BOEA 3CLWA 1W1YA 2F2HA 5C54A 1ICSA 1LLWA 3ZXWA 3FV9A 1QBAA 2XFYA 3LI1A 1Q6EA 3WDJA 3V0TA 2EG7A 2TODA 4GQBA 1SYTA 5CG0A 1W6TA 3L4ZA 3C0JA 1WBJA 4Y7EA 4XZNX 1FCUA 2SFPA 4IP7A 3TSBA 1HN1A 1XIGA 3LCWA 5CZSA 1OC7A 4F0RA 1RBOB 2TYSA 5JUVA 1FFRA 1UQZA 1V4YA 3QV7A 4NASA 3WK1A 2INFA 3O05A 4ML9A 1QR7A 3LM7A 1KXHA 1LQAA 4AIUA 2Z29A 4RV3A 4FO4A 4GO8A 2OZ0A 4N4QA 1XLAA 2V9DA 3QZEA 3ATYA 1J96A 3ZOAA 3TJIA 4IJCA 5D8ZA 5IBXA 2CW6A 4A05A 4AF0A 5I3IA 1P7TB 4LY4A 3I6RA 3A4JA 3CASA 4YVXA 4IPJA 2V3EA 3SUWA 3TXVA 2O9PA 3ZYZA 5KZDA 2BXZA 3NUKA 4CQAA 1LZOA 4MYXA 3W2KA 1MNSA 4M7TA 3E9AA 1O68A 4D1IA 1XHGA 3LLFA 3AZTA 4WLCA 3LQLA 3CL6A 3LX9A 4UMBA 4HJWA 4HPXA 4NZ1A 4UCGA 1L6WA 5FEXA 4IPIA 3V0UA 2PSNA 3ZJKA 3OYZA 4XG1A 1R3YA 3R0DA 4H83A 4MB4A 3BQ6A 3Q45A 2I57A 1FCVA 1W9XA 2P8BA 3UBPC 1W3JA 1GZGA 4DZAA 2ADAA 1G9HA 3OZPA 2PZ0A 3UWYA 4C7GA 4GIYA 4AYGA 4LPCA 1JFXA 3CZEA 3DXIA 4WRHA 4B2DD 4MLJA 1DQXA 1L9WA 2NLYA 1JXKA 1WAUA 4IZGA 3H4GA 1P4CA 2CLKA 3M9YA 3XINA 2O7SA 1Y5WA 3DG3A 1UA7A 5JIWA 1QNOA 4HK5A 2YR1A 2OZ8A 1QRQA 2WJFA 3ZJ7A 1RVKA 3HV9A 4BF7A 1S3TC 1PX8A 1SFSA 2EEXA 4JIRA 7TAAA 4GYPC 4I9MA 4H01A 1QNVA 4TMCA 4RW5A 4YU1A 1WXJA 1EJWC 4KRTA 2V3FA 4O11A 1Z3NA 5CGMA 4PCTA 1TPEA 1EPVA 2PRMA 3M0HA 1TKKA 3PTMA 1K7XA 3VZYA 4MWAA 3AYTA 1R7AA 4NAFA 4RDWA 2E09A 2QCEA 3S42A 3Q94A 2JFEX 1IWBA 4RL3A 5E09A 3LTSA 5CC5A 3LNMA 1KGUA 2F6UA 3IAQA 1UKPA 3UU0A 4C6OA 3NWRA 3HG2A 1JNDA 7PTDA 4EVZA 2YOCA 2OWXA 3THDA 1UR9A 2H6RA 2ZDRA 2Q8LA 3ISIX 2J6VA 3RFAA 4IFOA 3STFA 3EMZA 4KGJA 5FL1A 1H09A 4NJKA 1F05A 3TOYA 3QR3A 3MANA 2OTDA 1BWVA 2Y8KA 2XZ7A 1IGSA 3BW2A 4RW3A 5G2IA 4GO9A 2PDJA 3ICJA 3QBUA 1ZY9A 1S46A 1SO6A 1NJJA 3VDAA 4AYSA 1UCWA 2QV5A 5K7JA 1EA0A 2PDFA 1NDWA 2GWGA 1TE6A 4JZ5A 4MZ1A 1XC4A 5IOBA 4DJFD 1U2YA 1AW1A 1GQNA 3W7EA 5E9AA 3R8GA 1OK4A 2V2CA 4LYKA 1CPUA 3LXCA 1PIFA 3H24A 1W1TA 4NZ4A 1UG6A 3ZJ6A 3QW3A 4WSJA 1E40A 1A0CA 3CXOA 1W3IA 3T0DA 3ABZA 1SUXA 2CZ5A 3UWVA 1M03A 4H9XA 2D1ZA 5HMEA 2ZX7A 3ZR4A 3UCCA 1QNSA 1O1ZA 4XO6A 1PDZA 1ZFJA 2BY0A 4MAZA 4B3ZA 3AFBA 3RK8A 3TYCA 1NM9A 2E25A 1TMHA 3NGFA 1LUCB 3T8LA 3TA6A 1XISA 4E0CA 3E5BA 3EYPA 3WIJA 2NX9A 1RQHA 4MNJA 4GACA 2DIEA 4LUYA 3WEOA 5K2ZA 3W53A 1TVPA 1PCWA 3I3EA 4HYVA 3ARVA 2PP0A 4FZIA 4LH8A 1CIUA 2O4MA 3HURA 1IYXA 1MO0A 5EBAA 3WDHA 1KV8A 3ONBA 4IMAA 4KEMA 4L1GA 1NWTA 3PP7A 3GG1A 3UA4A 3FIGA 3GQYA 2C14A 2Y8VA 4HA0A 1EYWA 1XCWA 1WQ5A 3URAA 4A3UA 3CEUA 3M0YA 4RKAA 4Q4PA 1UD8A 2PDHA 2EF9A 3C8NA 2FZNA 2QF8A 3U8GA 3GKFA 2OO6A 5A8OA 1GVOA 5A2BA 1JGMA 4UQEA 1LP6A 4FK9A 4CNNA 3PZMA 5HMDA 2G37A 2Z2AA 5KZ6A 1ALDA 1PAMA 5CGQA 4JQ1A 5G4HC 1UWIA 1P0DA 2QCMA 3HN3A 3EA3A 3HMJG 2ZX9A 3UERA 3S47A 4RXGA 1BWKA 2ZX5A 2H9AA 2IKGA 5D9PA 4MFEA 3CAKA 1GOXA 2DEPA 4C1NB 5A6TC 3S1UA 3USZA 3H2FA 4ZQPA 1YTEA 1UKQA 3K1GA 4G9PA 2PC8A 4B4FA 1F3EA 4F2BA 4A8LA 2INZA 3H12A 1ZPTA 2POTA 4JD4A 2VZVA 4MPQA 3VKCA 4WKHA 2HBXA 4CNUA 1REQB 4MTVA 1HUVA 1G7UA 1FWEC 3B8IA 1YE6A 3N2MA 1LROA 3N1AA 3LV6A 3HB9A 1K03A 3MKKA 4QISA 3LHWA 1XIHA 4MJMA 3WMSA 3UQNA 4O28A 4B5WA 1D7KA 2DSVA 1JVNA 4OOUA 2BZNA 2QZRA 1CT5A 1KXTA 2R82A 3HOJA 4GQRA 3M0VA 2XSXA 5CPNA 1XBVA 3OODA 4JCLA 3Q58A 4MGGA 5AHLA 4Z2GA 3KDOA 1ICPA 2QHAA 1BKHA 4ICCX 4UOQA 3I6TA 2J24A 5T26A 2E5DA 2G3FA 3VUSA 2A3HA 3GD6A 4ZCWA 3QV8A 1F5ZA 5D2VA 1YYAA 5G1TA 1AH0A 2PTZA 4JPGA 1GVYA 6A3HA 3Q65A 4L6HA 2DFAA 1WNOA 2PGFA 4CD7A 1VD6A 5G1MA 1R86A 3TZFA 4D6DA 4Z17A 3RJYA 3FA3A 2NUXA 5BRBA 5AYBA 4PUKA 5I2UA 1PDYA 1HXJA 4HTBA 3TMLA 4D6HA 2OCZA 2Z28A 1QI3A 1H7WA 3EXSA 4X60A 1OX6A 3GTNA 3VGHA 4Y96A 1KO0A 1E6QM 4HPHA 1S5TA 4H9UA 1LOQA 5DQPA 1Z32X 3EX3A 4FNQA 3TYZA 2B81A 2OSXA 3E2RA 1YDYA 1XQLA 1I2PA 2O0TA 1WDWA 2HVNA 1SJBA 1KFBA 1FH7A 1Y8BA 4GIEA 1OZQA 4KIRA 4LCRA 3I4EA 2PDKA 4S3JA 3NURA 1MXDA 3AS3A 1OF8A 3PZGA 1YPFA 4ATLA 3VNKA 3A12A 4KFNA 5FCZA 2IW0A 3W24A 1E6SM 2BWGA 5LIYX 2G3JA 2A6LA 4ACZB 5DEZA 3CZGA 2CYGA 1CEOA 4B5TA 4HMCA 1SO3A 2IPGA 4DO6A 2BOGX 2AOSA 1FWWA 4QCEA 1DWIM 3WNKA 4XZLX 1OFPA 2Y7GA 3KWXA 3B0VC 3VNYA 3DHPA 1CGTA 1PZ1A 2XVLA 2AKZA 2QYGA 5BWFA 1SU5A 4HNUA 1H3GA 5D09A 2OODA 1U1JA 4HMEA 1DXEA 1US0A 2EKGA 1BYDA 4LUJA 3F4CA 1LBMA 1RR2A 1VRXA 4TTGA 4DAFA 1FH8A 2V81A 2DV0A 2Q3OA 2HK0A 3WDIA 4LVDA 5LSMA 1OG0A 2BBFA 1W1ZA 5LIKX 3ARSA 3D47A 4BEUA 2WVVB 1GQIA 4M29A 3T42A 2X7WA 1J0ZA 2WNQA 2WWCA 3QR0A 4MWAD 2C7FA 5JBDA 2D20A 3PZOA 5E5CA 3EOSA 2P76A 3SZ8A 4MZYA 4QR6A 4WDTA 3AMKA 4JTGA 4GWEA 2QT3A 3RN6A 3UXKA 1JZ8A 2XPKA 2DSZA 5LNRA 3OQEA 1J8VA 5CC7A 1XLGA 4MDPA 3WO8A 3TONA 4FR1A 2OEMA 3B9AA 4IFKA 1V6VA 1VEOA 4B5NA 2DSWA 3FDKA 1EO7A 2D2HA 2O4QA 4ERAA 4KETA 2GUUA 5DT5A 2W27A 4E4FA 3GVRA 2Z1SA 3OLIA 1QOXA 1E70M 2VXNA 3C2FA 3N13A 3QVQA 4DUWA 2YB4A 2W79A 2VC5A 5BYWA 5CJMA 3GDRA 2XWDA 3K13A 1MW0A 4UR8A 5CLWA 2WNNA 2Q6ZA 1E73M 3NDZA 3WZ0E 2ZOXA 4WXYA 3B0PA 2CXEA 4CEXC 2G0WA 2IUZA 4C1KA 3O0KA 4D6EA 2VVNA 3VCRA 3BE7A 3FEQA 2CNCA 1EC7A 1CGVA 5ABHA 4C60A 1R8LA 4E38A 2E4TA 1OY0A 3QFEA 2OQLA 1KCXA 4Q7IA 3WF0A 5E0FA 4LB4A 3PK7A 4DJFC 4F0LA 1V0NA 2PDIA 3LY0A 3V0SA 3W7MA 1JZ4A 1DORA 3VMNA 1XGZA 1OT2A 2WZTA 1JZ7A 1HJVA 3WEZA 4HQVA 1A49A 3UETA 5FL0A 1JYNA 4N9EA 4AMCA 4QGCA 4I90A 2XH0A 4KEUA 4XB3A 3W2NA 3AQUA 1ONRA 1VYPX 1MFVA 5EYWA 3AXHA 4GH1A 4MB1A 3MHUA 1GOQA 1LWIA 3BLIA 3APGA 3ZT6A 1GONA 4XAFA 1WZKA 4PCFA 2VUNA 1WXYA 3L7RA 1AL8A 4O1AA 2HS6A 4DVOA 2IQDA 4HHLA 4ZOCA 2X30A 5LNUA 3PNZA 4Y2WA 2YB1A 4CQ8A 4DJDA 1FWTA 4ONVA 4IF2A 2FTWA 2E6DA 3WQDA 4FS9A 4IH3A 4ZQNA 1NQKA 2KX9A 4WDWA 4NY2A 4JTCA 3DYMA 1NARA 4NX0A 1E6PA 4H9MA 2GGGA 4RZBA 4NAEA 4UC5A 1OCQA 1EQCA 1B1YA 2V5CA 1BQCA 3ZSSA 3HG4A 1P43A 3AALA 2V5DA 1WA3A 2YLLA 1XLKA 1GVFA 3BARA 3OVQA 1AQFA 4OFCA 4AHQA 3M41A 4LYRA 1GYLA 3R8HA 4FB7A 1U5HA 1CBGA 1YX1A 3H2AA 3R89A 1V51A 1JYVA 3AHYA 4DYJA 3FHAA 1NU5A 1HKMA 2OGYA 3D5HA 2D0FA 3TQPA 1X6NA 4R53A 3W2UA 4ZGYA 5CGTA 2B7QA 4WX2A 4QG6A 1POJA 2EJAA 4JTQA 4Z08A 2BDQA 4PTVA 1Q45A 3B4YA 3S0CA 1XD0A 2E9BA 3WQOA 1LF1A 1W37A 2RGMA 1DVJA 2YDSA 2VFHA 2YCIX 1JPHA 1XGDA 2TRSA 4LQ1A 3TJ4A 4XWUA 3ABSA 2NSXA 2DZUA 2CKSA 5EKYA 4NHVA 1VH7A 3FS2A 3LHZA 3SAZA 5HR7A 1OZMA 3ZVHA 4HNTA 2CHRA 4MIMA 3BGJA 3PZ9A 4EX4A 2FPYA 1G6CA 2ASHA 3WF1A 4LANA 1TV7A 3GR7A 2V6AA 2CETA 6XIAA 2J6XA 3REQB 4AD4A 1GZ1A 2R1LA 2E5BA 2GLKA 4H9ZA 1FWAC 4XZBA 4PMZA 4N2YA 3S2JA 2C8NA 1WUEA 1V8EA 4WGXA 3DESA 4Y9MA 3DFPA 2ZZ6A 2WC7A 3G1HA 2ONEA 1KKRA 5GJNA 1VCFA 2Z25A 3M07A 4M19A 4N6FA 1B3VA 5LYRA 3I7SA 4DI9A 8RUCA 4O0KA 1K1DA 2OKTA 3W1XA 4PFMA 5HWJA 3MKVA 2EBNA 2FMOA 1K7FA 4AD2A 3OA5A 1A3HA 1L8NA 1DE5A 9XIAA 1EX1A 2NVCA 1VYSX 4R3UA 3W81A 1UBSA 2WHJA 1SW3A 5DY3A 4WR3A 5C2GA 1XPYA 1EF2A 4CU8A 1JZ6A 2J75A 1H7RA 3AIVA 3WJSA 4R7WA 1BSIA 3IWPA 2PDPA 4W7VA 2XIJA 4QSFA 2QV4A 3KS6A 4BWLA 3P82A 4F9JA 3WNPA 1E51A 2UY2A 4UMCA 4GBDA 1TIWA 1W56A 2Y6ZA 5D2WA 3S5SA 3W74A 3HPZA 1RH9A 2V0TA 1D3CA 4GVGA 3VCNA 4DJED 3WJYA 1JCTA 2HK1A 4KF1A 3DUGA 1ZNNA 4MZ8A 1KRCC 1CGYA 3PR2A 2EKCA 1HTIA 4PUMA 5I3DA 3NZPA 1L6GA 4P7QA 4JXCA 4PUDA 1UUOA 1DIDA 3BG9A 1MUCA 3W88A 1XFCA 5FIPA 3RDKA 1J0JA 5ABGA 2OJPA 3E12A 4KEVA 2OYLA 4EP8C 4Q8UA 2VCBA 3E0IA 4CKQA 1O6IA 3G6MA 4PE8A 3TYUA 4AY7A 5A6KA 6CGTA 3VAVA 3WH5A 5FAGA 4UOZA 3CQHA 2FJUB 1FY6A 2G41A 2PWDA 1LRTA 4LS2A 3POCA 3KHDA 1ZAHA 3HG5A 5CZTA 4A4AA 4QJ1A 4WJEA 2E0PA 4AISA 4ZA0A 3R8RA 3U5YA 4OTKA 5AECA 4GJ1A 3H21A 1MFUA 4E4UA 3A64A 2QCFA 2Y24A 3CWHA 2RKXA 1YDOA 3WBEA 3KBJA 4QLKA 3XISA 4JTUA 2VGGA 3CPUA 1F9CA 4UQBA 3MZNA 2D3LA 4TO8A 1QWKA 4ENLA 3SUSA 2E28A 8XIMA 1E15A 3QM3A 3RO8A 5EU9A 3VU2A 3WLTA 1KM2A 5BXSA 4CN1A 1AJ2A 1B90A 3IVTA 1JZ5A 4LF1A 4DF1A 4Q4KA 5BMXA 4TIMA 5DT7A 4BQ4A 3AIEA 2FGLA 5FJPA 4EPDC 3ORWA 4GC3A 4ZO8A 1TV5A 1EBGA 1JQVA 3GC4A 3XIMA 5U4NA 4H9TA 3VDHA 2RH9A 3W28A 5EMMA 4AZCA 5ABEA 4TX6A 3KW3A 4YXGA 3CV6A 3FJLA 2BOFX 2WVUA 1IZKA 2DUZA 2YSWA 1TIMA 1Y65A 4W8AA 3EWWA 4F48A 3H55A 3FKRA 2C0HA 1SZRA 3WSUA 1OD8A 3NO5A 5LNWA 3U2ZA 5TIMA 4GD0A 3GH5A 3P93A 4A3HA 3WMLA 4DBWA 3CZKA 4PR4A 1B30A 1P0BA 3WD1A 4RLIA 1DWFM 2A6NA 4XAPA 3AZRA 4UTTC 4DLMA 1FWHC 1HJXA 1P0NA 2BVWA 3JZEA 1XSJA 4WF7A 4XD3A 3UG4A 5CPTA 2CLOA 4JAWA 3QC0A 4YWSA 1W0MA 1V3MA 2W62A 3DN5A 4A8NA 4L80A 1IEIA 3B8DA 3N6QA 4GQQA 3K1DA 4QM1A 4F66A 1FWBC 4PUJA 1W3TA 3JUGA 2OR2A 3DBNA 3MU7A 3VPLA 1FCBA 1KM4A 4K1GA 3PZQA 3GDMA 1EIBA 1M1BA 3P0XA 4IP5A 3O9NA 4Z2KA 4P8VA 1XH2A 1L6YA 2E6AA 1Q8AA 2I9EA 1CDGA 3UR2A 4EAYA 3EX4A 1DPMA 3HJZA 3CTTA 4W88A 1M7XA 1TPC1 3WX7A 2CLEA 5HWMA 1JDDA 4M5PA 1M7OA 4FLSA 5SWUA 2J62A 4L4PA 3L5LA 1LG2A 3W38A 3WUFA 2PLCA 4C6EA 4UTWA 3O3RA 3WJWA 1E56A 3LS9A 3LG3A 3CT2A 2GWNA 3KXQA 1C3FA 3B8VA 4RXFA 3M16A 4YPJA 4BK9A 5XINA 4IFRA 1W3KA 4WGHA 4Q6XA 5M1TA 1VS1A 3P81A 3MS8A 3QPZA 3SSZA 1OFEA 2VFDA 3CV7A 3G3DA 1SR9A 3PPGA 3C0QA 1XBZA 4C65A 1WKYA 2XN0A 3OLEA 3BICA 3BW3A 5FF2A 5AC8A 4BWLC 1ECQA 3I10A 4OGZA 4N0RA 1VFHA 3BSMA 1A5UA 2HVOA 3VE9A 4JTFA 3QHMA 3BV4A 1Z7AA 2PODA 1WOBA 2H8XA 2FIQA 3HG3A 3N4AA 4XKYB 1KD0A 1XWYA 2EG8A 1Z9AA 1OGGA 4I6KA 4RUBA 1X7FA 3SCUA 1GORA 2QCGA 1WX0A 4F4RA 3EB3A 1C7TA 4I9JA 3R4IA 3F2DA 3VZZA 1H49A 4GNJA 1XFBA 3PTQA 1YADA 4JX6A 2FFIA 2ZVRA 3IIVA 3G1FA 1LUCA 4XUGA 4UNLA 3T1GA 3GNPA 3CV2A 3GHTA 4Q8MA 1GWJA 1XIJA 4L1WA 4LNYA 1ZCCA 1JCLA 5FA5A 4O13A 2XISA 3K8KA 4ZFCA 5LNVA 2W9MA 3CPRA 1HG3A 1QXLA 1VBHA 4OQVA 3QQ1A 2VFEA 2QAPA 3QOKA 2WXDM 1JJKA 3STPA 3B06A 3B04A 2O9RA 5B80A 1B54A 5HNUA 1KFKA 2ZUWA 1QAPA 4DRSA 4FHAA 3AROA 4R9OA 3MO4A 1OIFA 4GC4A 1UR1A 1V5XA 1Q6DA 2DUAA 4J28A 4NZJA 1ELSA 4RX0A 3IS4A 2PF8A 1R85A 4I7VA 1KTCA 4QNEA 3E0WA 5DO8A 1BFNA 1QW9A 4K39A 3NQ7A 1F2JA 2YXXA 4GCAA 1BF6A 3OTRA 3M0IA 5CKSA 1X38A 4GNKB 1PV8A 3B3DA 1F3WA 1ISXA 2R6OA 4GQ0A 1U1UA 2HISA 1ZUAX 2DT0A 4H2CA 1T7LA 2E6YA 3FYOA 4KERA 5D2TA 2VHLA 4M80A 4ZOAA 4KS0A 3P2VA 3NQVA 5F2LA 3UGVA 3WG6A 3GNOA 3TX9A 4IX2A 3S1VA 6ENLA 5MKGA 4LGXA 3DFHA 5I79A 3ELFA 4ZL1A 3M47A 1MRAA 3C52A 4US6A 1OB0A 1CLVA 2VRQA 3W1TA 4DWSC 4EAMA 4IQJA 3QKZA 2WQPA 3UCDA 1VPXA 3GVGA 3G1RA 3PPCA 4UQCA 4ES4A 1C8QA 3USBA 2WCGA 2YX0A 5HNRA 3BCJA 4K8HA 5CLTA 1V0KA 1JI1A 1H0IA 1A5OC 1X8FA 1VJSA 4J1OA 4OZOA 5A6BD 2CWXA 1W5PA 1HJUA 4J3VA 1QI5A 1KGXA 4L4LA 2WJDA 3ARYA 3BZGA 1JD7A 4J3XA 3CPGA 3W25A 1LT8A 4DJDC 4JTHA 4YYCA 1WPCA 4PB4A 4R5EA 3V5CA 5CC6A 4DWSA 3VIMA 3TJLA 1TA3A 1S2TA 3WMCA 3K4DA 1Q85A 2VCCA 3UJFA 1EJVC 1YPXA 1W1VA 3KCLA 4GPNA 3ZS4A 1XG3A 3I4KA 2FZDA 4JTAA 2WJEA 2XM2A 4X9YA 2PPGA 4ADTA 3W2JA 4AZHA 4Z0JA 1PKLA 4ZB5A 4WCJA 3ARUA 3EWCA 3LCGA 2V5KA 1TVLA 2JK2A 5C7VA 2D0GA 3S1GA 4LX4A 1W5QA 3ZWTA 1UKTA 4ZSUA 2E3ZA 2QCNA 1KCKA 3IVUA 5DELA 3W23A 1QJWA 1KTBA 1QPRA 4FOJA 1FA2A 5FJRA 4JHOA 1UPMB 3R10A 5TBOA 1Q65A 1UP0A 4PL2A 4UOJA 1V02E 1GW9A 4QXIA 3RAOA 3PFRA 2NQJA 1QASA 3BG5A 3CUZA 1DJXA 2PWUA 3QY7A 2NXIA 1GYMA 4TOQA 4MNLA 3NVTA 2X1RA 3D46A 3LBMA 4J9JA 3L2IA 4Q4OA 4REQB 3NCOA 3OZYA 4RDYA 3E2SA 2CLLA 2W63A 3GXIA 5BMWA 3VNDA 4B3KA 2VURA 4DJEC 2FPTA 1Q2RA 4ZE5A 3QTGA 1E5NA 1P0KA 3EWZA 1HKIA 1PKNA 1K9TA 4NF7A 1OF6A 1XDMA 5A6MA 1ISZA 3RITA 1W31A 2J47A 4JL2A 5I07A 3GWQA 3CQ0A 1NF7A 4JIHA 2W91A 3CB3A 5I02A 3TE9A 4LS1A 3ZT7A 3UJSA 1REQA 2JGYA 4CQ9A 4V33A 3EDJA 1VCGA 1WKDA 6XIMA 2V5JA 1VJIA 1XF0A 3UG8A 2PWEA 3N14A 4GI9A 1AQMA 5D2XA 4O50A 3C2YA 5AC4A 2V68A 3MBDA 3VNMA 4AZ6A 3MUXA 2Y4SA 4LUIA 3A3WA 2VR5A 1FWRA 3TSDA 4JIEA 3OU8A 4RE3A 1RP8A 2FHFA 5DXXA 1E55A 4ML4A 2IS7A 3UVAA 4PTMA 4RNFA 2PURA 3CH0A 4JFVA 5BXPA 4PEKA 8TIMA 2Q02A 3UG3A 3WQVA 2QULA 4OBRA 5AHMA 1XSIA 1O5QA 3L68A 1QPKA 3DEQA 2FVLA 4XAZA 1NOFA 4J2PA 1JZ3A 1AK5A 1JNEA 1WDQA 1HF6A 5TAOA 2QCCA 5CXPA 2DZWA 1UH2A 3P8IA 1XCFA 4C6BA 4U3AA 4ZODA 2BXVA 5G2WA 3SI9A 3P62A 2J66A 1S38A 3OPSA 2YZRA 4ZFMA 3LCFA 2OPJA 4AZ7A 3W1UA 1B2YA 3EXRA 1LL6A 3D3FA 3G5EA 3LUTA 1PZ2A 1GVQA 1SQ7A 1JULA 3OIHA 1EZ2A 2JALA 3SQLA 2BVTA 5MHBA 2IPJA 4ZB0A 1BLIA 1TQJA 3QC3A 1RAKA 4LB3A 5BOFA 1YDVA 1XINA 3HPSA 5CPOA 3LZ3A 4QJ3B 2VUYA 5JBFA 4DB7A 3W73A 5I6SA 3CYJA 1TPDA 1YDNA 3AXMA 5I00A 3TW9A 3AOFA 3GXFA 1R9YA 3GH7A 3ZQ9A 1E72M 3KRSA 4G8TA 4OBTA 3PN8A 1SO5A 3URBA 3KFTA 1LWHA 3DFOA 3GTFA 4NXKA 2J79A 3HQNA 5A6SA 1VEPA 3L0KA 2RGLA 4LSBA 4JFSA 3GBEA 1FRBA 1MNZA 5LIXX 4LAZA 1LQ0A 3IGXA 1QOQA 4C6NA 1ZP3A 4WY0A 2WM0A 1RD5A 3ITVA 4JR5A 3PNUA 1T41A 3GNXA 3TNOA 3PG9A 2CZVA 2X0YA 2IXUA 3O6DA 1PX3A 2F61A 3IV8A 3F4WA 4MSSA 3UXDA 3MMUA 1EXBA 3E74A 3BG3A 1NF0A 3GSMA 3BLDA 1LOSA 4XK2A 1POKA 3A21A 3IJDA 5LA0A 5HJLA 3TN5A 1K9DA 3W7GA 4DLFA 4B3LA 4INFA 5KINA 3CAWA 3ANVA 1RCQA 4F8XA 1RK6A 1JAEA 4I5XA 5H8UA 4F0KA 4U3CA 1TELA 4MLRA 2REQA 3RG6A 3N3TA 4IQLA 1BHGA 1W9DM 1WOAA 5DRIA 1OYAA 1K4HA 3Q67A 4HCLA 4M51A 2F38A 5AYYA 1UR0A 1D9EA 2DSUA 4LAMA 4PMVA 3QXBA 4NL1A 4S39A 3L4UA 2ABAA 3VO0A 4IOTA 3CBWA 2DUXA 2AMXA 1SO4A 4DO4A 4BR1A 3QR1A 1CTNA 1F6PA 3DZ1A 4LFYA 1DXFA 3OZMA 3K2GA 5F2IA 2ABBA 4O15A 3H2MA 1DJWA 2BS9A 2ZRVA 3S5YA 5HMFA 3VMOA 2BHYA 1KFWA 3FKKA 3QSRA 2C1HA 3PBWA 4IG2A 1NVMA 4R9XA 4RNJA 2WVTA 3D6NA 3W37A 2VOMA 1L8PA 2VKZG 3TN3A 3W7JA 1GJWA 1GUVA 4NZ5A 1VFFA 1A50A 1XIMA 4AXNA 1MI3A 4ZEPA 2VR2A 5FACA 3E38A 4ACZA 4QDWA 1VIZA 2PS2A 3T05A 2H3BA 3BAKA 1OCJA 4OUEA 5BU6A 2E8YA 4Q8OA 1TX2A 4DF2A 4GISA 4D8AA 4CCCA 2FZMA 5KZMA 4XTIA 3GH4A 4LC6A 4PMUA 2ZRZA 4O1DA 1AH3A 4XSLA 2QMKA 4A8RA 5I3GA 3MCOA 5AZ1A 1CCWB 1XCXA 4RDZA 1XRTA 1EYEA 3N2BA 1ZBCA 5ECUA 3R58A 3KEHA 1V6TA 5A8GA 1HGYA 2XHYA 4GUGA 3VVGA 3NM3A 3G0UA 4KH2A 4UZSA 3PBGA 4CU6A 2PTYA 1E0WA 2GQAA 2CLFA 1XM3A 2C15A 1SZGA 3FGCB 2QW5A 4YL2A 1XIEA 3NIYA 3T08A 2AQVA 3QMTA 3IRSA 1VFMA 2DZSA 2BTMA 1JCYA 1JYWA 1TWWA 1DTUA 1HKVA 1YNPA 3OOQA 5IHRA 4H1ZA 3SFKA 3WUBA 1YLVA 3AIBA 4AIOA 4CD4A 4Q4SA 1V02A 1SR0A 2VEKA 2WYSA 4TMBA 1ZQ5A 3D0CA 3T81A 4AHOA 3C2OA 4RPQA 4P7RA 2VELA 3MSYA 4QBXA 1BYAA 2DIJA 3UZXA 1FWDC 3IIXA 3LN3A 3W82A 2RUSA 1IE7C 3LGGA 1MZRA 4LYQA 2YJQA 5A8QA 1DV7A 3LRKA 5D33A 3H4WA 3TN6A 2WC4A 4QAIA 3AUOA 4AMAA 3EA1A 3ME3A 2L5HA 3IGUA 3N15A 1PKMA 1TJPA 1FWGC 4HGXA 1AD4A 1Q5MA 2GYIA 4S3DA 1TPUA 3N2TA 3S6TA 1ISVA 4I8DA 4Y8EA 3WQ5A 1UKOA 4O4VA 1TR1A 5A5WA 1WXZA 3F7JA 2I16A 4N9DA 3S9IA 3W29A 4E2OA 3CUFA 4MY1A 1OBAA 3QGAC 4IIHA 4P61A 2QVHA 1BXNA 4O1EA 4ERGA 3ITCA 2XG9A 4FALA 1I60A 1Q2SA 2OQYA 2X41A 4DNHA 3GU1A 1QVBA 3WK2A 4DPQA 1CLKA 2J77A 4HZ6A 1UWTA 2E68A 1Y5VA 1D3GA 4D2JA 4GYPA 3NPVA 4DXKA 1ZU8A 1KA9F 4EXAA 4GFIA 2IXVA 5PTDA 1UH3A 4GY1A 3EKGA 3CUXA 4DO5A 3E5PA 1L0PA 5AOUA 1YRRA 3TW7A 2BOEX 3V36A 3EPMA 3VILA 1L6FA 1UR2A 3R0UA 4JL1A 4HOXA 4ICNA 5A3HA 2JQXA 3WDPP 4O16A 3BAWA 1FKXA 4CQCA 4ZB2A 4IGHA 1B5TA 3M0MA 3NFUA 2BMBA 5U7SA 2WKGA 2PLMA 5I5RA 4JNMA 2W0UA 3AHTA 2XZ9A 1EBHA 3MV01 4KMQA 3EB4A 5FKYA 4PRRA 4V15A 4IWWA 1H7PA 4H6RA 1PTAA 5HXMA 4EIVA 4HU8A 3GXMA 3QGKC 3LMZA 3R43A 4KKXA 4AWTA 3THQA 2OX4A 3EX6A 3E0LA 5HNNA 4GVHA 3S3GA 2PBOA 1I0DA 1CZ1A 5FJOA 2Z7KA 1MW2A 2D3NA 4MKNA 1VC4A 4F2TA 4AG0A 2C3ZA 3OEXA 2ZWZA 2IPWA 2JEPA 4W84A 1NQ6A 3W7KA 3TTYA 5HNTA 3LXBA 4HU4A 3FAWA 3VNLA 2XIOA 1TPB1 2ZC8A 3G0XA 4IHCA 3QGVA 5IDIA 1HT6A 1E4NA 3LEPA 4O57A 1XS2A 3BH4A 4JN7A 2Z00A 3E02A 4WSKA 4Z1CA 2KAUC 3CK5A 3SUVA 3TTEA 2VWTA 4TTUA 3OVGA 1XIBA 2GJLA 1H41A 3EKLA 2I5IA 2GJPA 4HCDA 4IPPA 4BFAA 4D6CA 1R87A 3KOFA 3MSDA 3GR4A 1C8VA 2C1IA 4KCTA 4MB5A 1FWJC 3WQGA 3ZFHA 2MNRA 4L5ZA 3AWNA 4OUIA 4CCEA 2R1MA 3SQMA 5E9XA 2OO0A 4Q8PA 5GNZA 3KOWA 3QLLA 3EMQA 3GC2A 5A2CA 4O0QA 1W2VA 2BSLA 3U2EA 4PMDA 1CB7B 5D8WA 4M6QA 1J5SA 1V3JA 3GTHA 1G0CA 5B7YA 2ZUSA 2VZUA 1JPKA 4Q4QA 3K30A 3GDTA 3M7SA 3N73A 4GA8A 4V2XA 5KSWA 4Z1YA 1IEXA 3P8JA 1ZJAA 3TXZA 5DF0A 4EF9A 3HO8A 3TTOA 1NP2A 2BHZA 4S3EA 4UTFA 2I1OA 1BD0A 5JMUA 3W1RA 2V38A 4CNTA 4PTDA 3PZNA 2XIQA 3TWBA 1ISYA 4AX6A 2EXOA 3GXDA 3K4WA 4JY9A 5ENLA 2P3ZA 4O8RA 3A13A 1BVWA 4S3BA 2OYKA 2WSYA 4E6MA 1PWMA 1E1CB 1JDCA 2GVEA 2FKPA 3AIQA 4W87A 5I78A 4K2SA 2WLYA 3H7UA 1W3NA 2ZRYA 1G4TA 3UFYA 1JDEA 3ID7A 3T2QA 5CCZA 4B5VA 4DAIA 3NAVA 1K8YA 2J88A 2P88A 3W6MA 4MDOA 4NUWA 2EG6A 3MW7A 3UF9A 2VEGA 1M01A 5KMYA 4JX5A 1P6BA 2C13A 4YTQA 1XIIA 2WMHA 1DIKA 1GOIA 2VTFA 4R7JA 4UNKA 4ZR8A 3O8AA 3TC6A 3W76A 3VK5A 5T9BG 4LBUA 2J13A 3SEPA 4CGTA 5CPSA 1WP6A 1OFAA 2LLEA 5TD4A 1ITXA 2QJGA 3C5QA 1H11A 4H3DA 5CEWA 2QJMA 3FAXA 2CBJA 1RUSA 3MUAA 4A6GA 1HO4A 4IM4A 2J7BA 4BY3A 2J74A 2VDGA 1A80A 3DC8A 5JH1A 2O92A 3JR2A 2ESCA 2WBGA 4PMQA 4FX7A 3CO8A 4L4OA 1QPOA 2R8WA 4ILSA 3TTQA 1XRSA 3TEVA 1EPXA 3O15A 1EX5A 1Z8AA 2GVJA 3G1SA 3FVDA 3FYYA 3NO3A 3VNIA 1DQUA 2AQOA 3WLNA 2GGHA 4UFHA 2PUZA 3S2CA 1TTIA 3LA4A 2YXGA 3FGCA 5T9CE 2DPEA 3U7BA 4QITA 1QK0A 2HMCA 3LK6A 4MAVA 3B9OA 1I2RA 1RCOB 3WDRA 1PXGA 3SGUA 1XYCA 3GNDA 2Y62A 1RZMA 2OFJA 5DCDA 2QGYA 2Y88A 4HN8A 2QVNA 1UKSA 1TWIA 4FX6M 4XSMA 3DI0A 7REQB 3WF3A 1Q6FA 4IFKB 1JEZA 4JS3A 3M43A 1UOKA 1JF6A 1L2UA 2H3DA 2CU0A 2QJNA 3KRUA 1PS9A 4OV4A 4C5YA 1P1XA 2FGBA 4ORMA 2GJRA 3OHIA 1ZJIA 4I5RA 3T07A 2NLIA 3ARQA 1VIWA 4C6CA 4QQUA 2YA2A 2RJHA 1A53A 2OSYA 1UJQA 4PUUA 4XO7A 2YDQA 1OVDA 3PTKA 2DGAA 5AY7A 2WZHA 1RQBA 4IGMA 3M1ZA 5HBFA 3W71A 2WANA 2ACSA 2RAGA 4MWAB 3WF4A 4KCVA 2DZAA 3C3NA 4IUGA 4M1BA 4AH7A 2NQHA 1XYFA 2ZTKA 5KITA 4IIBA 3UVIA 1IZJA 4B4HA 3N3MA 2V2HA 1UHVA 4NNBA 5AC5A 2Z1KA 1KR0A 4HOZA 3SRFA 4UR9A 5J04A 4HYWA 1OHLA 1FHUA 1DKWA 1R47A 1ITUA 2FPVA 1JXJA 1EDGA 3VD9A 3BDKA 1K9FA 3DU0A 3DFNA 1GOWA 3HGSA 4LF2A 4YHGA 3YPIA 3BV7A 3VIFA 2VENA 4LRSA 3BSGA 4FNPA 2VX5A 3UGRA 1X7IA 2H9AB 2ZADA 1QNRA 3I3DA 2PFHA 2ZCGA 4JIPA 3SCOA 5A8MA 1C29A 4JOMA 2ZDSA 5D04C 4ZSTA 3W7OA 3ZR6A 4XISA 1Q6OA 1FQ0A 1IT7A 4J5NA 3PBVA 1VLIA 2CXGA 4Q4MA 3ZR5A 1TTPA 5ABFB 1W9UA 3LM3A 1UWUA 3TSMA 1XD1A 3BPWA 3AMCA 3L66A 2CITA 2TMDA 3IRDA 1UIOA 3U9IA 2HSAA 2D69A 1K3UA 3EOLA 4GX9A 2MUCA 2YW3A 1ZAJA 5L6UA 4ECLA 3MDUA 5TQLA 2ZA1A 1EWEA 4FPSA 3L65A 2CC0A 3C0SA 3AYVA 4H8NA 2WVSA 4S2BA 1B4EA 5HA7A 1GHRA 3WH6A 2Q71A 1JR1A 1MEHA 3DECA 1NFBA 5L9FA 1I8JA 1LCOA 1LL4A 2AL2A 4ROQA 1BRLB 1OIMA 1EDTA 1M41A 1CXIA 4H6EA 1C8YA 1TSIA 2GFTA 1J18A 1J2WA 3N2XA 5CH9A 4R88A 1LTDA 4NI3A 1A5AA 3B4UA 3BOLA 2Z27A 2X16A 1KB3A 5AC6A 3NL2A 4EXBA 3DGRA 3GAKA 1ZHAA 4MWAC 1WDSA 2QUNA 4TV5A 1KM3A 4DI8A 1E9LA 3QMRA 3NQGA 3AISA 3R11A 1V6XA 3PZVA 1R3WA 5M2FX 3AS1A 4DWSD 2HVMA 2REQB 3VC6A 1AZ2A 3VKAA 1K9EA 5EPDA 1QU4A 4O8AA 1IF2A 1BGGA 4W93A 3PUDA 1PKYA 3THUA 1GPFA 2F8QA 2OT0A 2IKJA 3UZJA 1RVGA 1GKRA 4QJ4B 2ATMA 1RY8A 1S3HA 1YXCA 1I75A 3LU2A 3TC3A 4IMCA 3FLUA 3MYOA 3SQSA 4GVIA 4Q6JA 3M0ZA 3VZXA 5LIUX 3NPWA 6REQB 3BAXA 1TJ0A 4FLRA 2YIHA 4RE0A 1TWSA 1X1NA 3VKJA 3RU6A 1MQPA 3VFCA 1XSKA 3VIKA 4EK7A 3JW7A 4PZVA 3LHTA 4ORIA 1AH4A 2JEQA 3SCTA 3NYDA 1AJZA 2ATSA 2VOTA 1M3UA 3WJZA 1XR2A 4UFIA 2PGEA 2X05A 4E2BA 4J7RA 1JQXA 3LRLA 1OINA 1EA9C 3DERA 3MHGA 3RHGA 3WYZA 1EDQA 2CZDA 2W61A 1HJSA 4PH6A 4CU7A 1B3WA 1P5BA 1JPIA 3CNYA 1MQQA 1WAWA 3NZQA 1KBLA 1CXLA 1VKFA 5EMKA 1QWGA 5EMYA 5T91A 1B0IA 4N4PA 3BW4A 3IUHA 1XLEA 2G4FA 3MVIA 4JTSA 1C7SA 3KCJA 1UD3A 2PCQA 2V5LA 1WO2A 3NVDA 1ZRQA 1XLFA 1OCBA 4KWOA 1F73A 5JH2A 3VIGA 3G1YA 2QPUA 1RK5A 3LERA 2R1KA 3NOYA 4C6LA 4R85A 4JQ3A 3WLMA 3NYZA 3OGSA 3PJXA 2E5CA 2VEMA 4D9PA 3HQOA 5GPRA 3EAUA 1M65A 1PWLA 3WQ4A 4H7ZA 1VCVA 5REQB 2PTXA 2E7FA 3EMCA 3LENA 3PAOA 2WSRA 2XSAA 4JIQA 5LGXA 1QCWA 1VHCA 3AC0A 1QHOA 3V35A 3TQVA 4CEUC 2PLKA 3OLGA 2Y5EA 1DIEA 1TG7A 1RQEA 4H8VA 1GPWA 1JFHA 4M3PA 5I23A 2IQTA 1QNPA 3AMDA 3GO2A 3KUMA 5HULA 3E0FA 3BGAA 3M5ZA 4XZIA 5HJXA 2XN1A 3IACA 5IBXC 1CENA 1I1XA 5CSRA 2IKIA 5EB8A 3W0KA 1S1PA 2A21A 1ZALA 3N17A 2ZUUA 6TIMA 1WZAA 3H2OA 3QQWA 5I3KA 2R1PA 3GXPA 4IMGA 3GBDA 4ZTXA 4FNUA 5HR6A 2P5NA 3G1AA 1V0MA 4FF7A 2QUUA 4XVEA 4W86A 3N12A 4X22A 4CNPA 3BQ5A 1VJZA 3V1PA 1EWDA 3VGFA 3MC5A 2GUYA 4QX4A 3F5JA 3MUIA 1TCMA 1SZFA 4RDVA 3QPYA 1W1PA 2PMQA 3D3AA 2GZXA 2ZZ7A 1CLXA 3TYEA 4C91A 2J8FA 4D1JA 3C8FA 1P7TA 1DTNA 4FEZA 5DMYA 1JPDX 3IGHX 4REQA 5D9OA 3A3XA 1R9XA 4W85A 4URIA 1Q6QA 4AQLA 1ZENA 4HA1A 1T6MA 3WQEA 2R94A 4LC8A 1MZHA 1GKPA 2Y61A 3CUJA 4GCXA 1GGOA 1TJ1A 3G1XA 1DE6A 1DJYA 2HEJA 4LTSA 5LXEA 3VTRA 3T55A 1ZTVA 1OQFA 1JGIA 3TLLA 5CZJA 2CHNA 4DQWA 3I7QA 1Z48A 2WQDA 1TE1A 4GIAA 3QLDA 1Z44A 4D71A 3GM8A 1MMFA 3NXLA 3E1F1 4J35A 2JKAA 2OZ3A 1FX6A 3OBEA 1XXXA 4F3HA 3T4WA 4B5SA 2DJXA 2ZRWA 3VINA 4KWWA 4XZMX 3W72A 3KZSA 4B9ZA 3TA9A 9RUBA 3O0FA 4MWAE 2DJLA 3VOCA 3ZLGA 5BROA 2YA0A 3HGOA 1OK6A 1R3SA 2YL5A 1FFQA 3GRIA 2Q8ZA 5LNSA 3ARTA 4JTIA 2NVAA 3MPGA 3VGGA 3AHZA 2OWWA 4C6DA 4QLLA 3ABRA 3VYLA 1K7EA 3BVJA 2GUBA 4GXMA 1EJSC 1UP3A 3W84A 3UXIA 4EKJA 1RLCL 1T99A 3L4XA 3UWEA 3ITOA 1W8SA 1EZWA 1ADDA 3U5UA 4NAEB 3M64A 1LJYA 3T40A 3ANUA 3BGGA 2A0NA 1RJRA 5JBEA 1KXVA 2GL5A 1H1YA 4XUYA 3IJQA 1PTGA 3GVWA 2WMGA 5AHEA 2C71A 3NM1A 4XBJA 2GVGA 4YHEA 2E6FA 2DY3A 3W00A 2GVLA 2J7HA 2Z2BA 4GY7A 4YTSA 1J6OA 4HK6A 1BEUA 2QEZA 3KDNA 3APTA 4B92A 3HU7A 1TWDA 1IGWA 3G0SA 3VOJA 3SN4A 1S1RA 4RE2A 5E70A 1UR4A 4A2RA 5C9UA 3VGBA 4FX8A 3N34A 3N9KA 3VNZA 1W5NA 3OGVA 4B16A 4MY9A 3A5VA 2XVGA 1YNYA 2YCKX 1I2NA 1EKOA 1JUBA 4P2VA 1U1HA 4EWJA 1E0UA 3DOPA 1R3TA 4M6PA 3WDQA 3SSJA 4LNCA 3NDYA 2XDFA 1IWPA 1YTDA 3RM9A 3W75A 5D37A 1YQ2A 4YJ5A 2NQLA 3WLIA 4GG9A 1UD5A 2OG9A 3LSCA 5HDRA 1A3XA 3CIXA 2PCEA 2XYLA 3GFXA 3MHFA 3RO6A 3NQCA 3DKLA 3CZLA 3MMTA 1K70A 4UFKA 2D73A 1ICQA 3II1A 1A5CA 1A5SA 1CXEA 3M46A 4HPN