1I70A

Crystal structure of rnase sa y86f mutant
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
96
structure length
96
Chain Sequence
DVSGTVCLSALPPEATDTLNLIASDGPFPYSQDGVVFQNRESVLPTQSYGYYHEYTVITPGARTRGTRRIITGEATQEDYYTGDHFATFSLIDQTC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Tyrosine hydrogen bonds make a large contribution to protein stability.
pubmed doi rcsb
source organism Streptomyces aureofaciens
molecule tags Hydrolase
molecule keywords GUANYL-SPECIFIC RIBONUCLEASE SA
total genus 24
structure length 96
sequence length 96
chains with identical sequence B
ec nomenclature ec 3.1.27.3: Ribonuclease T(1).
pdb deposition date 2001-03-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00545 Ribonuclease ribonuclease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.30 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Microbial ribonucleases 1i70A00
1RTUA 2RNTA 1B2MA 3D5GA 3URPA 1FYSA 1UCLA 2KF6A 8RNTA 1BNFA 1RCKA 1BNEA 1I0VA 1I3FA 4J5KA 1FW7A 1FUTA 1HYFA 2KF4A 2RBIA 1RGLA 1IYYA 1FZUA 1I3IA 1YGWA 3SYUA 1BAOA 1GMQA 1BRHA 3HOHA 1AQZA 1BANA 1BVIA 1GMPA 2BIRA 1ZGXA 1JBSA 1BRKA 3A5EA 1BRNL 1GOVA 1BNRA 1B2ZA 1RMSA 3KCHA 1UCJA 2AADA 1BSCA 1JBRA 1BRGA 4GSPA 5HOHA 1BRJA 2F56A 1I2FA 1HZ1A 4J5GA 2ZA4A 1FUSA 1UCIA 1B27A 1BNIA 5BIRA 1RN4A 4RNTA 1DETA 1LOWA 1BRSA 3BIRA 1I2EA 1LNIA 3BU4A 3AGNA 1RNBA 3WHOA 1RLSA 1B20A 1TRPA 2SARA 1LRAA 4HAAA 1JBTA 3D5IA 1B21A 1X1YA 1X1WA 1PYLA 1UCKA 1BIRA 7RNTA 3DGYA 6RNTA 1RCLA 1A2PA 1RSNA 2F5MA 3DH2A 1TRQA 2KAAA 1Q9EA 1BRIA 1R4YA 1C54A 4BIRA 1B2UA 1B2XA 1RN1A 2KF3A 1GOYA 1BNGA 1T2HA 1T2IA 3AGOA 1RGFA 3D4AA 1BNJA 6GSPA 1RHLA 1RGCA 3AHWA 1LOYA 9RNTA 1TTOA 1X1UA 1BSEA 1RGGA 1GOUA 1I0XA 3Q3FA 1AY7A 1GSPA 2C4BA 1I8VA 1DE3A 1MGWA 1BSAA 1CH0A 1G02A 1RGAA 1I70A 1GMRA 5RNTA 1RGHA 2HOHA 1BUJA 1YVSA 1RGEA 2BU4A 2AAEA 1SARA 1X1XA 7GSPA 1B2SA 1RDSA 3WR2A 1LOVA 1RGKA 2F4YA 2KF5A 1BSDA 1RNTA 1PY3A 3RNTA 2GSPA 1BU4A 4HOHA 3AHSA 1BSBA 1I2GA 2F5WA 4BU4A 1BOXA 1BGSA 5BU4A 1MGRA 1B3SA 1YNVX 4GHOA 3GSPA 5GSPA 1BNSA
chains in the Genus database with same CATH superfamily
4JRFA 2IUJA 1O7HB 4XBTA 1RKYA 1EG9B 3CC23 8RNTA 2STDA 1BUQA 1Q42A 5G2GA 1RCKA 3MYTA 1NDOB 3NUVA 4FMCA 2OQEA 1I0VA 1FUTA 4R1KA 3JUQA 2OQEC 3BNEA 1GY6A 3B7CA 2YFLB 1IYYA 4GL6A 4N6LA 4EBGA 1I3IA 4FCMA 3MSOA 1VQ43 3JUOA 2BT3A 2Y73A 2JQ5A 4KFDA 5IF6A 3IPTA 3UB1A 1GMPA 4N6NB 3S27A 4CJNA 1OHOA 1LOXA 1W6CA 4CDLA 2L1SA 5CK6A 3LH4A 3GZYB 4QWTA 1M1XB 2Y74A 1N9EA 2W9QA 1B2ZA 4ZM8A 1RMSA 1UDII 4FCZA 1UCJA 2AADA 1W5ZA 1YHQ3 2C10A 1UI8A 3IJEB 1BRJA 3CNXA 1I2FA 1RN7A 4J5GA 1EA2A 1FUSA 1UCIA 1O7MB 1JZOA 2LQVA 1BNIA 3NM7A 3LTBA 2QEX3 5CLKA 5BIRA 1LOWA 1RRHA 3BIRA 1OGZA 1I2EA 2RCDA 1LNIA 1Q824 1W2ZA 3V92A 3WHOA 3DGOA 3KKGA 1RJOA 2H0GA 2K0MA 2CG1A 3EN8A 1MWRA 2XGLA 3AMOA 3D5IA 1Y4KA 4N6V0 1QAKA 1OHSA 2A15A 1V58A 2UX0A 1BIRA 4HKVB 1JB5A 4I5QA 3B4PA 2XSOB 3F7XA 1RCLA 1YJW3 1GY5A 2WO0A 1A2PA 2F5MA 3QK9A 4O8SA 1TRQA 3Q2PA 3NV0B 3FG1A 3ZG0A 5BVBA 1FUWA 2H0HA 3LTAA 2BMOB 4BIRA 3CMA3 1NNVA 2KF3A 2B1XB 2IYJA 1TJDA 1VQQA 4RBNA 1W02A 1UW1A 4LZIA 4OVMA 4X2HA 2V1LA 4HM3B 3X3XA 2IA7A 4J8TA 3G4S3 5JPUA 3X3ZA 4ORLA 2D1WA 1TTOA 3L0RA 4TX4A 1RGGA 1N5PA 9RNTA 1GOUA 1I0XA 2H0IA 1VQ93 1A90A 1WQLB 4H3UA 2OWPA 5KP3A 2P0XA 3LXUX 3CC73 1I8VA 1I70A 1Q40A 2RFRA 3QRDA 2K3DA 1BUJA 1CEWI 1YVSA 3F7SA 5AI1A 2XH9A 4K1VA 4NHFA 1SARA 1TU5A 1D6YA 1E3RA 1Q864 1QJGA 1UUVB 7GSPA 1RDSA 2K54A 1LOVA 2KF5A 4BTXA 2OOVC 2C11A 2M7OA 4XM4A 1BSBA 1OPYA 4LMIA 1BOXA 2CFWA 3NBRA 1BGSA 4Q53A 2XF3A 4FMAA 4PEJA 1B3SA 4GHOA 1DMMA 3KZTA 3PS8A 4R80A 3EX9A 1GYBA 1RTUA 1M9GA 1GD3A 3D5GA 3OXAA 4N6TA 5CXOA 1STFI 1UGIA 1S5AA 4KVHA 2RSXA 1UCLA 2YX9A 5JPPA 2WGQA 4HVNA 4MMZB 3FF2A 3PYJA 1JNQA 3F8HA 1KWIA 4J5KA 1K8A4 3MHEA 4N6MA 3NX0A 3NM2A 1RGLA 3NV0A 3V99A 1ZX2A 1FZUA 4MEIA 3I0YA 3JVCA 3I553 2CFDA 2PNCA 3ZG5A 1AQZA 1US1A 1IVUA 4FR9A 3DUKA 3OW22 1NB3I 2W9PA 3A5EA 2XGNA 2F86B 4LGQA 1BRNL 2XR8B 1NJI4 3OWUA 1GOVA 3JUNA 3J7Yd 5D82A 3HZPA 1OHPA 1W2B2 3KCHA 1ULIB 3D9RA 3E99A 1BSCA 4O2HA 1AV4A 1BRGA 3M8CA 1OH0A 2WOHA 2ZA4A 1IV9A 4BL2A 1DMQA 4L8PA 4WWUC 3LZAA 1K734 1Q40B 3DGLA 1OACA 1AR0A 1W4NA 5CF1A 3FSDA 4HZBB 1QVF2 5AYRB 1JV2B 2P38A 1D6ZA 3AGNA 3BU4A 4XBYA 1RNBA 4HM1B 2BMRB 3FGYA 1B20A 1IVVA 1TRPA 1ISKA 3PXMA 1V74A 1VQL3 5M18A 3GWRA 1AVLA 3BLZA 4X2OA 4HAAA 1KC84 1IVXA 1X1YA 1X1WA 3G0KA 1W6YA 4HBRA 1PYLA 4EXRA 5AEUB 2XFSA 5I97A 3PGBA 3A76A 4HM0B 4N6OB 2XSHB 4KFFA 3DGYA 6RNTA 3CXC2 1HKXA 3SLUA 3V98A 3N8BA 3DH2A 1IK3A 4ILFA 3UNLA 1O7GB 1OGXA 3EQQB 1T5YA 4WFOA 4EV5A 3VSYA 1B2XA 1RN1A 2MF7A 3GZXB 3O8YA 1CYVA 5D83A 2W04A 2CH9A 2W6JH 4LEHA 1GOYA 3EBYA 3N9HA 4CCVA 1T2HA 2E2UA 1E3VA 2HMJB 2HMKB 2ML6A 2Z76A 1BNJA 2CX0A 3D4AA 1RHLA 2O9UX 3DGNA 3H3HA 1TFKA 2P09A 4HM6B 1BSEA 2QA43 1K28A 1U5OA 2D42A 3K63A 1KD14 1C7HA 1CQSA 5DRVA 3G713 1KQS2 4MMXB 1YJ93 1FA3A 1CH0A 2YFIB 3UL6A 3CC43 3WOFB 1VZZA 2F98A 3EB8A 2HOHA 3K5TA 5G1LA 3T0UA 3X3YA 1VQM3 2WGOA 3Q1CA 1W00A 1VQP3 2AAEA 3CD63 3F9SA 1TFOA 1Q7Y4 3UL5A 3VGNA 4AEQA 1B2SA 2HMMB 5IENA 2F4YA 1FGMA 3BNDA 1RNTA 3WA2X 2JDIH 3FG3A 3SX1A 3RNTA 2GSPA 1BU4A 3BNBA 4HOHA 3AHSA 1I2GA 3CCS3 2F5WA 5DREA 2BMQB 1QAFA 3HX8A 4BU4A 1EQKA 2R4IA 2UUGC 3CCM3 4R4KA 4O3VA 1AVKA 1YNVX 2CC3A 1ZS7A 4HYZA 1O7WB 3GSPA 3RGAA 2FNQA 3FG4A 1GD4A 1BNSA 2IMJA 4FMDA 3PCSA 5GSPA 1T3BA 2RNTA 4HM7B 5IG4A 1VQ73 1B2MA 4OK0A 1STDA 1SPUA 5FGOA 5IG3A 1FYSA 5IEPA 3HIIA 1QVG2 3T8NA 2KF6A 3FLJA 2W0QA 1BNFA 4O02B 2P05A 1D6UA 5G1KA 1VQO3 1DMNA 1FW7A 1HYFA 2CK3H 2KF4A 1MNLA 1YGWA 3SYUA 1UGHI 3JUMA 3BNCA 3LOYA 8CHOA 1PU4A 3KFQC 4OUQA 3LTDA 1VQ53 1J2BA 1YJN3 2WOFA 1LQMB 3KSPA 4MJDA 4BTWA 1NU3A 1BVIA 2BIRA 1ZGXA 1IU7A 1LXEA 2F99A 3CCE3 1JN5B 2W56B 2GEXA 2HMNB 1BNRA 2GU1A 3MWZA 3CME3 3WMDA 4R9LA 3OWYA 7STDA 1JBRA 2ZHXB 1ASKA 1VQN3 4GSPA 1NWWA 3DXOA 3F40A 3DGMA 4WYKA 3G6E3 4EC6A 4K90B 6STDA 1JRQA 5IEOA 3NQYA 1PFPA 3CCQ3 1NB5I 1IQ8A 4KT3B 4HM8B 1DETA 3D79A 1MWSA 1ULJB 4WHAA 1Q814 5IG0A 3HI7A 1IT8A 2KXGA 3EJVA 4K61A 1K9M4 2CG0A 3G16A 4N6UA 1N8QA 2SARA 4EYCA 3GAXA 3RDEA 1B21A 2ZDJA 1YIT3 3G8ZA 2R41A 3NBJA 2OTJ3 1UCKA 1YI23 2RGQA 4HM5B 3MG3A 1K41A 5EQLA 5BXQA 1KSIA 2CKFB 2E2TA 3WOEB 1N5HA 2XEPA 1RSNA 5A0OB 1L5GB 2CFKA 1Q9EA 1BRIA 3EHCA 3S5CA 1C54A 3KIIA 1B2UA 1W7CA 3LMLA 1IDPA 2W03A 1IVWA 1WTHA 1ROAA 1TUHA 3S67A 3ALAA 3EF8A 2OOVA 5AIFA 3EC9A 1OCVA 1T2IA 1GS3A 1RGFA 2QGUA 3AGOA 1LQGC 1IQYA 4RNYA 5AYSC 3AHWA 4L7KA 1X1UA 3ECFA 1IQXA 3SXXA 1OF5A 2BHMA 4FMBA 3CCV3 3Q3FA 2BO9B 2CW9A 3ER7A 1M1K4 1AY7A 1WMOA 1GSPA 2C4BA 3CCL3 2OTL3 4HM2B 1U8CB 2I9WA 5AEWB 1BSAA 4RZMA 1G02A 3U1WA 4H61A 1DVCA 1RGHA 4XB5A 1RGEA 1O7PB 1WMNA 2W2CA 1JKGB 2B24B 1Z1SA 2BNGA 1X1XA 3LYGA 5LC6A 3WDGB 1W01A 3K7CA 4N3VA 3WR2A 1RGKA 3NQZA 1DYUA 1VQ63 3B8LA 1JJ22 4XDWA 3CPOA 5M1AA 2HMLB 3F14A 2GXFA 4IIAA 3GZBA 3OX9A 5KP1A 3WODG 1NO3A 4KZ1A 3CPW2 2LYXA 2YFJB 5BU4A 2CWVA 3SEDA 3SVAA 4I4KA 4NPBA 3CCU3 1SIHA 1UI7A 2CFGA 3MG2A 1TIJA 2FGTA 1DVDA 1ROVA 4CPKA 1GY7A 3FKAA 2GBXB 2XRXB 2HMOB 3URPA 4G1MB 3GZRA 4IPBA 1LNHA 5IW9A 5IERA 3STDA 1BNEA 3NXJA 3NBBA 1I3FA 3K0ZA 1OUNA 3LT9A 2Z6BA 2RBIA 5STDA 4HZ9B 4LSOA 3FH1A 3CCJ3 4BL3A 1RRLA 4IT7A 1BAOA 4BTYA 1GMQA 1BRHA 2FXTA 3H51A 4FCJA 1FGQA 5AIGA 3HOHA 1JN5A 2W56A 1BANA 5AIHA 3I563 3PCRA 1MWTA 1MWUA 1QMAA 1JBSA 5HGRA 3LTCA 1BRKA 1EKMA 3OWSA 2KCDA 3EBTA 4WYKB 4L8OA 2J8XB 3N54B 3DY5A 3OV4A 4NREA 2PZVA 5M19A 1N9JA 5HOHA 2F56A 1HZ1A 3CU3A 1G96A 3X42A 3KE7A 2ML5A 2CWUA 3ROBA 2XFTA 1B27A 1JB4A 4WP5A 1RN4A 4RNTA 1JZDA 2SBLA 1BRSA 1JKGA 1HU9A 1QALA 2O3OA 4EV2A 1A67A 1UUGB 1SQWA 1RLSA 1G0TA 4GB5A 3BB9A 1EUIC 1LRAA 1JBTA 4AKZA 2CWTA 3IMAB 4J9AA 4KFEA 4DKIA 1UUWB 3VF1A 3DMCA 3ZFZA 7RNTA 5AIIA 1Q7HA 2IUKA 2Z77A 3F8XA 2INXA 1JB2A 3DZLA 4LYLB 1S723 4XBXA 3JUPA 3SOAA 1SJWA 2L4VA 5D81A 1F8NA 3MG1A 2CHCA 2KAAA 1SIIA 3SOYA 1LVNA 1WNHA 1R4CA 3X40A 1R4YA 1IV7A 3B4OA 1EEJA 1FGRA 1CYUA 3CNMA 3GRDA 3X41A 1V57A 4HJLB 2Q07A 2ZL8A 1ZO2A 3EE1A 4STDA 3TDGA 1OF5B 4R9KA 1BNGA 1A2VA 2CIUA 5ELUA 5EEOA 2MC8A 1YIJ3 1VQ83 5JBSA 5KP4A 6GSPA 1RGCA 2Z7AA 5EVHA 1LOYA 4RNZA 3Q90A 1YVBI 3S28A 1N8R4 4JF8A 4XDVA 3PZWA 5LC7A 3DM8A 3FZWA 3KN4A 2CFLA 4HM4B 3FF0A 3NHXA 3KSED 1DE3A 1FGOA 1MGWA 1RGAA 2GEYA 1GMRA 2IY2A 5RNTA 1E97A 4MMYB 2UGIA 4U13A 2GU3A 2KRTA 2BU4A 5TGNA 3UJMA 2QIYA 4K1UA 1MOLA 3HK4A 5ELJA 3S29A 3T8UA 3WA3A 1TP6A 3LT8A 1M904 1BSDA 2CX1A 1A2KA 3K9MC 3FCSB 1PY3A 3AMOB 5FW5A 3D3LA 4AKYA 3RGRA 5IG5A 1VQK3 3MPHA 3MKIA 2OCTA 1O7NB 5CF2A 1IT7A 2GBWB 3CCR3 1W6GA 1WMPA 3HIGA 3EN1B 2E2VA 3U97A 1MGRA 1YGEA 2P0MA 1FGTA 4EW5A
chains in the Genus database with same CATH topology
1RTUA 2RNTA 1B2MA 3D5GA 3URPA 1FYSA 1UCLA 2KF6A 8RNTA 1BNFA 1RCKA 1BNEA 1I0VA 1I3FA 4J5KA 1FW7A 1FUTA 1HYFA 2KF4A 2RBIA 1RGLA 1IYYA 1FZUA 1I3IA 1YGWA 3SYUA 1BAOA 1GMQA 1BRHA 3HOHA 1AQZA 1BANA 1BVIA 1GMPA 2BIRA 1ZGXA 1JBSA 1BRKA 3A5EA 1BRNL 1GOVA 1BNRA 1B2ZA 1RMSA 3KCHA 1UCJA 2AADA 1BSCA 1JBRA 1BRGA 4GSPA 5HOHA 1BRJA 2F56A 1I2FA 1HZ1A 4J5GA 2ZA4A 1FUSA 1UCIA 1B27A 1BNIA 5BIRA 1RN4A 4RNTA 1DETA 1LOWA 1BRSA 3BIRA 1I2EA 1LNIA 3BU4A 3AGNA 1RNBA 3WHOA 1RLSA 1B20A 1TRPA 2SARA 1LRAA 4HAAA 1JBTA 3D5IA 1B21A 1X1YA 1X1WA 1PYLA 1UCKA 1BIRA 7RNTA 3DGYA 6RNTA 1RCLA 1A2PA 1RSNA 2F5MA 3DH2A 1TRQA 2KAAA 1Q9EA 1BRIA 1R4YA 1C54A 4BIRA 1B2UA 1B2XA 1RN1A 2KF3A 1GOYA 1BNGA 1T2HA 1T2IA 3AGOA 1RGFA 3D4AA 1BNJA 6GSPA 1RHLA 1RGCA 3AHWA 1LOYA 9RNTA 1TTOA 1X1UA 1BSEA 1RGGA 1GOUA 1I0XA 3Q3FA 1AY7A 1GSPA 2C4BA 1I8VA 1DE3A 1MGWA 1BSAA 1CH0A 1G02A 1RGAA 1I70A 1GMRA 5RNTA 1RGHA 2HOHA 1BUJA 1YVSA 1RGEA 2BU4A 2AAEA 1SARA 1X1XA 7GSPA 1B2SA 1RDSA 3WR2A 1LOVA 1RGKA 2F4YA 2KF5A 1BSDA 1RNTA 1PY3A 3RNTA 2GSPA 1BU4A 4HOHA 3AHSA 1BSBA 1I2GA 2F5WA 4BU4A 1BOXA 1BGSA 5BU4A 1MGRA 1B3SA 1YNVX 4GHOA 3GSPA 5GSPA 1BNSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1RTU A;  2RNT A;  1B2M A;  3D5G A;  3URP A;  1FYS A;  1UCL A;  2KF6 A;  8RNT A;  1BNF A;  1RCK A;  1BNE A;  1I0V A;  1I3F A;  4J5K A;  1FW7 A;  1FUT A;  1HYF A;  2KF4 A;  2RBI A;  1RGL A;  1IYY A;  1FZU A;  1I3I A;  1YGW A;  3SYU A;  1BAO A;  1GMQ A;  1BRH A;  3HOH A;  1AQZ A;  1BAN A;  1BVI A;  1GMP A;  2BIR A;  1ZGX A;  1JBS A;  1BRK A;  3A5E A;  1BRN L;  1GOV A;  1BNR A;  1B2Z A;  1RMS A;  3KCH A;  1UCJ A;  2AAD A;  1BSC A;  1JBR A;  1BRG A;  4GSP A;  5HOH A;  1BRJ A;  2F56 A;  1I2F A;  1HZ1 A;  4J5G A;  2ZA4 A;  1FUS A;  1UCI A;  1B27 A;  1BNI A;  5BIR A;  1RN4 A;  4RNT A;  1DET A;  1LOW A;  1BRS A;  3BIR A;  1I2E A;  1LNI A;  3BU4 A;  3AGN A;  1RNB A;  3WHO A;  1RLS A;  1B20 A;  1TRP A;  2SAR A;  1LRA A;  4HAA A;  1JBT A;  3D5I A;  1B21 A;  1X1Y A;  1X1W A;  1PYL A;  1UCK A;  1BIR A;  7RNT A;  3DGY A;  6RNT A;  1RCL A;  1A2P A;  1RSN A;  2F5M A;  3DH2 A;  1TRQ A;  2KAA A;  1Q9E A;  1BRI A;  1R4Y A;  1C54 A;  4BIR A;  1B2U A;  1B2X A;  1RN1 A;  2KF3 A;  1GOY A;  1BNG A;  1T2H A;  1T2I A;  3AGO A;  1RGF A;  3D4A A;  1BNJ A;  6GSP A;  1RHL A;  1RGC A;  3AHW A;  1LOY A;  9RNT A;  1TTO A;  1X1U A;  1BSE A;  1RGG A;  1GOU A;  1I0X A;  3Q3F A;  1AY7 A;  1GSP A;  2C4B A;  1I8V A;  1DE3 A;  1MGW A;  1BSA A;  1CH0 A;  1G02 A;  1RGA A;  1I70 A;  1GMR A;  5RNT A;  1RGH A;  2HOH A;  1BUJ A;  1YVS A;  1RGE A;  2BU4 A;  2AAE A;  1SAR A;  1X1X A;  7GSP A;  1B2S A;  1RDS A;  3WR2 A;  1LOV A;  1RGK A;  2F4Y A;  2KF5 A;  1BSD A;  1RNT A;  1PY3 A;  3RNT A;  2GSP A;  1BU4 A;  4HOH A;  3AHS A;  1BSB A;  1I2G A;  2F5W A;  4BU4 A;  1BOX A;  1BGS A;  5BU4 A;  1MGR A;  1B3S A;  1YNV X;  4GHO A;  3GSP A;  5GSP A;  1BNS A; 
#chains in the Genus database with same CATH topology
 4JRF A;  2IUJ A;  1O7H B;  4XBT A;  1RKY A;  1EG9 B;  3CC2 3;  8RNT A;  2STD A;  1BUQ A;  1Q42 A;  5G2G A;  1RCK A;  3MYT A;  1NDO B;  3NUV A;  4FMC A;  2OQE A;  1I0V A;  1FUT A;  4R1K A;  3JUQ A;  2OQE C;  3BNE A;  1GY6 A;  3B7C A;  2YFL B;  1IYY A;  4GL6 A;  4N6L A;  4EBG A;  1I3I A;  4FCM A;  3MSO A;  1VQ4 3;  3JUO A;  2BT3 A;  2Y73 A;  2JQ5 A;  4KFD A;  5IF6 A;  3IPT A;  3UB1 A;  1GMP A;  4N6N B;  3S27 A;  4CJN A;  1OHO A;  1LOX A;  1W6C A;  4CDL A;  2L1S A;  5CK6 A;  3LH4 A;  3GZY B;  4QWT A;  1M1X B;  2Y74 A;  1N9E A;  2W9Q A;  1B2Z A;  4ZM8 A;  1RMS A;  1UDI I;  4FCZ A;  1UCJ A;  2AAD A;  1W5Z A;  1YHQ 3;  2C10 A;  1UI8 A;  3IJE B;  1BRJ A;  3CNX A;  1I2F A;  1RN7 A;  4J5G A;  1EA2 A;  1FUS A;  1UCI A;  1O7M B;  1JZO A;  2LQV A;  1BNI A;  3NM7 A;  3LTB A;  2QEX 3;  5CLK A;  5BIR A;  1LOW A;  1RRH A;  3BIR A;  1OGZ A;  1I2E A;  2RCD A;  1LNI A;  1Q82 4;  1W2Z A;  3V92 A;  3WHO A;  3DGO A;  3KKG A;  1RJO A;  2H0G A;  2K0M A;  2CG1 A;  3EN8 A;  1MWR A;  2XGL A;  3AMO A;  3D5I A;  1Y4K A;  4N6V 0;  1QAK A;  1OHS A;  2A15 A;  1V58 A;  2UX0 A;  1BIR A;  4HKV B;  1JB5 A;  4I5Q A;  3B4P A;  2XSO B;  3F7X A;  1RCL A;  1YJW 3;  1GY5 A;  2WO0 A;  1A2P A;  2F5M A;  3QK9 A;  4O8S A;  1TRQ A;  3Q2P A;  3NV0 B;  3FG1 A;  3ZG0 A;  5BVB A;  1FUW A;  2H0H A;  3LTA A;  2BMO B;  4BIR A;  3CMA 3;  1NNV A;  2KF3 A;  2B1X B;  2IYJ A;  1TJD A;  1VQQ A;  4RBN A;  1W02 A;  1UW1 A;  4LZI A;  4OVM A;  4X2H A;  2V1L A;  4HM3 B;  3X3X A;  2IA7 A;  4J8T A;  3G4S 3;  5JPU A;  3X3Z A;  4ORL A;  2D1W A;  1TTO A;  3L0R A;  4TX4 A;  1RGG A;  1N5P A;  9RNT A;  1GOU A;  1I0X A;  2H0I A;  1VQ9 3;  1A90 A;  1WQL B;  4H3U A;  2OWP A;  5KP3 A;  2P0X A;  3LXU X;  3CC7 3;  1I8V A;  1I70 A;  1Q40 A;  2RFR A;  3QRD A;  2K3D A;  1BUJ A;  1CEW I;  1YVS A;  3F7S A;  5AI1 A;  2XH9 A;  4K1V A;  4NHF A;  1SAR A;  1TU5 A;  1D6Y A;  1E3R A;  1Q86 4;  1QJG A;  1UUV B;  7GSP A;  1RDS A;  2K54 A;  1LOV A;  2KF5 A;  4BTX A;  2OOV C;  2C11 A;  2M7O A;  4XM4 A;  1BSB A;  1OPY A;  4LMI A;  1BOX A;  2CFW A;  3NBR A;  1BGS A;  4Q53 A;  2XF3 A;  4FMA A;  4PEJ A;  1B3S A;  4GHO A;  1DMM A;  3KZT A;  3PS8 A;  4R80 A;  3EX9 A;  1GYB A;  1RTU A;  1M9G A;  1GD3 A;  3D5G A;  3OXA A;  4N6T A;  5CXO A;  1STF I;  1UGI A;  1S5A A;  4KVH A;  2RSX A;  1UCL A;  2YX9 A;  5JPP A;  2WGQ A;  4HVN A;  4MMZ B;  3FF2 A;  3PYJ A;  1JNQ A;  3F8H A;  1KWI A;  4J5K A;  1K8A 4;  3MHE A;  4N6M A;  3NX0 A;  3NM2 A;  1RGL A;  3NV0 A;  3V99 A;  1ZX2 A;  1FZU A;  4MEI A;  3I0Y A;  3JVC A;  3I55 3;  2CFD A;  2PNC A;  3ZG5 A;  1AQZ A;  1US1 A;  1IVU A;  4FR9 A;  3DUK A;  3OW2 2;  1NB3 I;  2W9P A;  3A5E A;  2XGN A;  2F86 B;  4LGQ A;  1BRN L;  2XR8 B;  1NJI 4;  3OWU A;  1GOV A;  3JUN A;  3J7Y d;  5D82 A;  3HZP A;  1OHP A;  1W2B 2;  3KCH A;  1ULI B;  3D9R A;  3E99 A;  1BSC A;  4O2H A;  1AV4 A;  1BRG A;  3M8C A;  1OH0 A;  2WOH A;  2ZA4 A;  1IV9 A;  4BL2 A;  1DMQ A;  4L8P A;  4WWU C;  3LZA A;  1K73 4;  1Q40 B;  3DGL A;  1OAC A;  1AR0 A;  1W4N A;  5CF1 A;  3FSD A;  4HZB B;  1QVF 2;  5AYR B;  1JV2 B;  2P38 A;  1D6Z A;  3AGN A;  3BU4 A;  4XBY A;  1RNB A;  4HM1 B;  2BMR B;  3FGY A;  1B20 A;  1IVV A;  1TRP A;  1ISK A;  3PXM A;  1V74 A;  1VQL 3;  5M18 A;  3GWR A;  1AVL A;  3BLZ A;  4X2O A;  4HAA A;  1KC8 4;  1IVX A;  1X1Y A;  1X1W A;  3G0K A;  1W6Y A;  4HBR A;  1PYL A;  4EXR A;  5AEU B;  2XFS A;  5I97 A;  3PGB A;  3A76 A;  4HM0 B;  4N6O B;  2XSH B;  4KFF A;  3DGY A;  6RNT A;  3CXC 2;  1HKX A;  3SLU A;  3V98 A;  3N8B A;  3DH2 A;  1IK3 A;  4ILF A;  3UNL A;  1O7G B;  1OGX A;  3EQQ B;  1T5Y A;  4WFO A;  4EV5 A;  3VSY A;  1B2X A;  1RN1 A;  2MF7 A;  3GZX B;  3O8Y A;  1CYV A;  5D83 A;  2W04 A;  2CH9 A;  2W6J H;  4LEH A;  1GOY A;  3EBY A;  3N9H A;  4CCV A;  1T2H A;  2E2U A;  1E3V A;  2HMJ B;  2HMK B;  2ML6 A;  2Z76 A;  1BNJ A;  2CX0 A;  3D4A A;  1RHL A;  2O9U X;  3DGN A;  3H3H A;  1TFK A;  2P09 A;  4HM6 B;  1BSE A;  2QA4 3;  1K28 A;  1U5O A;  2D42 A;  3K63 A;  1KD1 4;  1C7H A;  1CQS A;  5DRV A;  3G71 3;  1KQS 2;  4MMX B;  1YJ9 3;  1FA3 A;  1CH0 A;  2YFI B;  3UL6 A;  3CC4 3;  3WOF B;  1VZZ A;  2F98 A;  3EB8 A;  2HOH A;  3K5T A;  5G1L A;  3T0U A;  3X3Y A;  1VQM 3;  2WGO A;  3Q1C A;  1W00 A;  1VQP 3;  2AAE A;  3CD6 3;  3F9S A;  1TFO A;  1Q7Y 4;  3UL5 A;  3VGN A;  4AEQ A;  1B2S A;  2HMM B;  5IEN A;  2F4Y A;  1FGM A;  3BND A;  1RNT A;  3WA2 X;  2JDI H;  3FG3 A;  3SX1 A;  3RNT A;  2GSP A;  1BU4 A;  3BNB A;  4HOH A;  3AHS A;  1I2G A;  3CCS 3;  2F5W A;  5DRE A;  2BMQ B;  1QAF A;  3HX8 A;  4BU4 A;  1EQK A;  2R4I A;  2UUG C;  3CCM 3;  4R4K A;  4O3V A;  1AVK A;  1YNV X;  2CC3 A;  1ZS7 A;  4HYZ A;  1O7W B;  3GSP A;  3RGA A;  2FNQ A;  3FG4 A;  1GD4 A;  1BNS A;  2IMJ A;  4FMD A;  3PCS A;  5GSP A;  1T3B A;  2RNT A;  4HM7 B;  5IG4 A;  1VQ7 3;  1B2M A;  4OK0 A;  1STD A;  1SPU A;  5FGO A;  5IG3 A;  1FYS A;  5IEP A;  3HII A;  1QVG 2;  3T8N A;  2KF6 A;  3FLJ A;  2W0Q A;  1BNF A;  4O02 B;  2P05 A;  1D6U A;  5G1K A;  1VQO 3;  1DMN A;  1FW7 A;  1HYF A;  2CK3 H;  2KF4 A;  1MNL A;  1YGW A;  3SYU A;  1UGH I;  3JUM A;  3BNC A;  3LOY A;  8CHO A;  1PU4 A;  3KFQ C;  4OUQ A;  3LTD A;  1VQ5 3;  1J2B A;  1YJN 3;  2WOF A;  1LQM B;  3KSP A;  4MJD A;  4BTW A;  1NU3 A;  1BVI A;  2BIR A;  1ZGX A;  1IU7 A;  1LXE A;  2F99 A;  3CCE 3;  1JN5 B;  2W56 B;  2GEX A;  2HMN B;  1BNR A;  2GU1 A;  3MWZ A;  3CME 3;  3WMD A;  4R9L A;  3OWY A;  7STD A;  1JBR A;  2ZHX B;  1ASK A;  1VQN 3;  4GSP A;  1NWW A;  3DXO A;  3F40 A;  3DGM A;  4WYK A;  3G6E 3;  4EC6 A;  4K90 B;  6STD A;  1JRQ A;  5IEO A;  3NQY A;  1PFP A;  3CCQ 3;  1NB5 I;  1IQ8 A;  4KT3 B;  4HM8 B;  1DET A;  3D79 A;  1MWS A;  1ULJ B;  4WHA A;  1Q81 4;  5IG0 A;  3HI7 A;  1IT8 A;  2KXG A;  3EJV A;  4K61 A;  1K9M 4;  2CG0 A;  3G16 A;  4N6U A;  1N8Q A;  2SAR A;  4EYC A;  3GAX A;  3RDE A;  1B21 A;  2ZDJ A;  1YIT 3;  3G8Z A;  2R41 A;  3NBJ A;  2OTJ 3;  1UCK A;  1YI2 3;  2RGQ A;  4HM5 B;  3MG3 A;  1K41 A;  5EQL A;  5BXQ A;  1KSI A;  2CKF B;  2E2T A;  3WOE B;  1N5H A;  2XEP A;  1RSN A;  5A0O B;  1L5G B;  2CFK A;  1Q9E A;  1BRI A;  3EHC A;  3S5C A;  1C54 A;  3KII A;  1B2U A;  1W7C A;  3LML A;  1IDP A;  2W03 A;  1IVW A;  1WTH A;  1ROA A;  1TUH A;  3S67 A;  3ALA A;  3EF8 A;  2OOV A;  5AIF A;  3EC9 A;  1OCV A;  1T2I A;  1GS3 A;  1RGF A;  2QGU A;  3AGO A;  1LQG C;  1IQY A;  4RNY A;  5AYS C;  3AHW A;  4L7K A;  1X1U A;  3ECF A;  1IQX A;  3SXX A;  1OF5 A;  2BHM A;  4FMB A;  3CCV 3;  3Q3F A;  2BO9 B;  2CW9 A;  3ER7 A;  1M1K 4;  1AY7 A;  1WMO A;  1GSP A;  2C4B A;  3CCL 3;  2OTL 3;  4HM2 B;  1U8C B;  2I9W A;  5AEW B;  1BSA A;  4RZM A;  1G02 A;  3U1W A;  4H61 A;  1DVC A;  1RGH A;  4XB5 A;  1RGE A;  1O7P B;  1WMN A;  2W2C A;  1JKG B;  2B24 B;  1Z1S A;  2BNG A;  1X1X A;  3LYG A;  5LC6 A;  3WDG B;  1W01 A;  3K7C A;  4N3V A;  3WR2 A;  1RGK A;  3NQZ A;  1DYU A;  1VQ6 3;  3B8L A;  1JJ2 2;  4XDW A;  3CPO A;  5M1A A;  2HML B;  3F14 A;  2GXF A;  4IIA A;  3GZB A;  3OX9 A;  5KP1 A;  3WOD G;  1NO3 A;  4KZ1 A;  3CPW 2;  2LYX A;  2YFJ B;  5BU4 A;  2CWV A;  3SED A;  3SVA A;  4I4K A;  4NPB A;  3CCU 3;  1SIH A;  1UI7 A;  2CFG A;  3MG2 A;  1TIJ A;  2FGT A;  1DVD A;  1ROV A;  4CPK A;  1GY7 A;  3FKA A;  2GBX B;  2XRX B;  2HMO B;  3URP A;  4G1M B;  3GZR A;  4IPB A;  1LNH A;  5IW9 A;  5IER A;  3STD A;  1BNE A;  3NXJ A;  3NBB A;  1I3F A;  3K0Z A;  1OUN A;  3LT9 A;  2Z6B A;  2RBI A;  5STD A;  4HZ9 B;  4LSO A;  3FH1 A;  3CCJ 3;  4BL3 A;  1RRL A;  4IT7 A;  1BAO A;  4BTY A;  1GMQ A;  1BRH A;  2FXT A;  3H51 A;  4FCJ A;  1FGQ A;  5AIG A;  3HOH A;  1JN5 A;  2W56 A;  1BAN A;  5AIH A;  3I56 3;  3PCR A;  1MWT A;  1MWU A;  1QMA A;  1JBS A;  5HGR A;  3LTC A;  1BRK A;  1EKM A;  3OWS A;  2KCD A;  3EBT A;  4WYK B;  4L8O A;  2J8X B;  3N54 B;  3DY5 A;  3OV4 A;  4NRE A;  2PZV A;  5M19 A;  1N9J A;  5HOH A;  2F56 A;  1HZ1 A;  3CU3 A;  1G96 A;  3X42 A;  3KE7 A;  2ML5 A;  2CWU A;  3ROB A;  2XFT A;  1B27 A;  1JB4 A;  4WP5 A;  1RN4 A;  4RNT A;  1JZD A;  2SBL A;  1BRS A;  1JKG A;  1HU9 A;  1QAL A;  2O3O A;  4EV2 A;  1A67 A;  1UUG B;  1SQW A;  1RLS A;  1G0T A;  4GB5 A;  3BB9 A;  1EUI C;  1LRA A;  1JBT A;  4AKZ A;  2CWT A;  3IMA B;  4J9A A;  4KFE A;  4DKI A;  1UUW B;  3VF1 A;  3DMC A;  3ZFZ A;  7RNT A;  5AII A;  1Q7H A;  2IUK A;  2Z77 A;  3F8X A;  2INX A;  1JB2 A;  3DZL A;  4LYL B;  1S72 3;  4XBX A;  3JUP A;  3SOA A;  1SJW A;  2L4V A;  5D81 A;  1F8N A;  3MG1 A;  2CHC A;  2KAA A;  1SII A;  3SOY A;  1LVN A;  1WNH A;  1R4C A;  3X40 A;  1R4Y A;  1IV7 A;  3B4O A;  1EEJ A;  1FGR A;  1CYU A;  3CNM A;  3GRD A;  3X41 A;  1V57 A;  4HJL B;  2Q07 A;  2ZL8 A;  1ZO2 A;  3EE1 A;  4STD A;  3TDG A;  1OF5 B;  4R9K A;  1BNG A;  1A2V A;  2CIU A;  5ELU A;  5EEO A;  2MC8 A;  1YIJ 3;  1VQ8 3;  5JBS A;  5KP4 A;  6GSP A;  1RGC A;  2Z7A A;  5EVH A;  1LOY A;  4RNZ A;  3Q90 A;  1YVB I;  3S28 A;  1N8R 4;  4JF8 A;  4XDV A;  3PZW A;  5LC7 A;  3DM8 A;  3FZW A;  3KN4 A;  2CFL A;  4HM4 B;  3FF0 A;  3NHX A;  3KSE D;  1DE3 A;  1FGO A;  1MGW A;  1RGA A;  2GEY A;  1GMR A;  2IY2 A;  5RNT A;  1E97 A;  4MMY B;  2UGI A;  4U13 A;  2GU3 A;  2KRT A;  2BU4 A;  5TGN A;  3UJM A;  2QIY A;  4K1U A;  1MOL A;  3HK4 A;  5ELJ A;  3S29 A;  3T8U A;  3WA3 A;  1TP6 A;  3LT8 A;  1M90 4;  1BSD A;  2CX1 A;  1A2K A;  3K9M C;  3FCS B;  1PY3 A;  3AMO B;  5FW5 A;  3D3L A;  4AKY A;  3RGR A;  5IG5 A;  1VQK 3;  3MPH A;  3MKI A;  2OCT A;  1O7N B;  5CF2 A;  1IT7 A;  2GBW B;  3CCR 3;  1W6G A;  1WMP A;  3HIG A;  3EN1 B;  2E2V A;  3U97 A;  1MGR A;  1YGE A;  2P0M A;  1FGT A;  4EW5 A; 
#chains in the Genus database with same CATH homology
 1RTU A;  2RNT A;  1B2M A;  3D5G A;  3URP A;  1FYS A;  1UCL A;  2KF6 A;  8RNT A;  1BNF A;  1RCK A;  1BNE A;  1I0V A;  1I3F A;  4J5K A;  1FW7 A;  1FUT A;  1HYF A;  2KF4 A;  2RBI A;  1RGL A;  1IYY A;  1FZU A;  1I3I A;  1YGW A;  3SYU A;  1BAO A;  1GMQ A;  1BRH A;  3HOH A;  1AQZ A;  1BAN A;  1BVI A;  1GMP A;  2BIR A;  1ZGX A;  1JBS A;  1BRK A;  3A5E A;  1BRN L;  1GOV A;  1BNR A;  1B2Z A;  1RMS A;  3KCH A;  1UCJ A;  2AAD A;  1BSC A;  1JBR A;  1BRG A;  4GSP A;  5HOH A;  1BRJ A;  2F56 A;  1I2F A;  1HZ1 A;  4J5G A;  2ZA4 A;  1FUS A;  1UCI A;  1B27 A;  1BNI A;  5BIR A;  1RN4 A;  4RNT A;  1DET A;  1LOW A;  1BRS A;  3BIR A;  1I2E A;  1LNI A;  3BU4 A;  3AGN A;  1RNB A;  3WHO A;  1RLS A;  1B20 A;  1TRP A;  2SAR A;  1LRA A;  4HAA A;  1JBT A;  3D5I A;  1B21 A;  1X1Y A;  1X1W A;  1PYL A;  1UCK A;  1BIR A;  7RNT A;  3DGY A;  6RNT A;  1RCL A;  1A2P A;  1RSN A;  2F5M A;  3DH2 A;  1TRQ A;  2KAA A;  1Q9E A;  1BRI A;  1R4Y A;  1C54 A;  4BIR A;  1B2U A;  1B2X A;  1RN1 A;  2KF3 A;  1GOY A;  1BNG A;  1T2H A;  1T2I A;  3AGO A;  1RGF A;  3D4A A;  1BNJ A;  6GSP A;  1RHL A;  1RGC A;  3AHW A;  1LOY A;  9RNT A;  1TTO A;  1X1U A;  1BSE A;  1RGG A;  1GOU A;  1I0X A;  3Q3F A;  1AY7 A;  1GSP A;  2C4B A;  1I8V A;  1DE3 A;  1MGW A;  1BSA A;  1CH0 A;  1G02 A;  1RGA A;  1I70 A;  1GMR A;  5RNT A;  1RGH A;  2HOH A;  1BUJ A;  1YVS A;  1RGE A;  2BU4 A;  2AAE A;  1SAR A;  1X1X A;  7GSP A;  1B2S A;  1RDS A;  3WR2 A;  1LOV A;  1RGK A;  2F4Y A;  2KF5 A;  1BSD A;  1RNT A;  1PY3 A;  3RNT A;  2GSP A;  1BU4 A;  4HOH A;  3AHS A;  1BSB A;  1I2G A;  2F5W A;  4BU4 A;  1BOX A;  1BGS A;  5BU4 A;  1MGR A;  1B3S A;  1YNV X;  4GHO A;  3GSP A;  5GSP A;  1BNS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...