1I70A

Crystal structure of rnase sa y86f mutant
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
96
structure length
96
Chain Sequence
b'DVSGTVCLSALPPEATDTLNLIASDGPFPYSQDGVVFQNRESVLPTQSYGYYHEYTVITPGARTRGTRRIITGEATQEDYYTGDHFATFSLIDQTC'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GUANYL-SPECIFIC RIBONUCLEASE SA
publication title Tyrosine hydrogen bonds make a large contribution to protein stability.
pubmed doi rcsb
source organism Streptomyces aureofaciens
molecule tags Hydrolase
total genus 24
structure length 96
sequence length 96
chains with identical sequence B
ec nomenclature ec 3.1.27.3: Ribonuclease T(1).
pdb deposition date 2001-03-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00545 Ribonuclease ribonuclease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.30 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Microbial ribonucleases 1i70A00
1B2ZA 1BRKA 1BNIA 1JBSA 2RNTA 1GOVA 1RNBA 1B2UA 1C54A 2BIRA 1BVIA 1FYSA 8RNTA 5HOHA 1BIRA 1BSDA 1RN4A 1RGAA 4BU4A 1FW7A 1B2XA 1SARA 1T2IA 1BRSA 1RGLA 1RGFA 2C4BA 2KF4A 1MGWA 1TRPA 1IYYA 1I3FA 2KF6A 1BOXA 3A5EA 4GSPA 3AHWA 1I2EA 1YNVX 3DH2A 1AQZA 3BIRA 1BNSA 1JBTA 1BSEA 4HAAA 2KF5A 1MGRA 1DETA 2AAEA 1BGSA 1YVSA 1I0XA 2ZA4A 1LOVA 1X1YA 1GOYA 1BAOA 1RMSA 1RSNA 1I8VA 1G02A 1TRQA 3D5GA 1B2MA 2F5MA 1BSCA 3AGOA 3RNTA 1FUSA 1I2GA 1B20A 3AHSA 1RGKA 3D5IA 2RBIA 1BSBA 1CH0A 4BIRA 1R4YA 1RHLA 1HYFA 6GSPA 2GSPA 1TTOA 2KF3A 1HZ1A 2HOHA 5BU4A 1PYLA 1X1UA 9RNTA 1GMPA 1X1XA 1DE3A 5RNTA 3URPA 1RTUA 4J5KA 1JBRA 1RGCA 1AY7A 2F56A 1BANA 3DGYA 1RCLA 1I70A 1BRGA 4GHOA 1B3SA 1RDSA 1LRAA 4HOHA 4RNTA 1GMRA 1B2SA 1BRNL 1GOUA 1I2FA 1YGWA 1FZUA 6RNTA 1B21A 1UCJA 3WHOA 5BIRA 1BU4A 3WR2A 3AGNA 2F4YA 1A2PA 7GSPA 1LOYA 1RLSA 3SYUA 3D4AA 1UCLA 3GSPA 1ZGXA 2KAAA 2F5WA 1BRJA 1FUTA 1BRIA 2SARA 1BNEA 1I0VA 1PY3A 1RGGA 1GMQA 1BNJA 1I3IA 7RNTA 4J5GA 2AADA 1BRHA 1Q9EA 1BNGA 1RNTA 3Q3FA 3KCHA 1X1WA 1RN1A 1BNFA 1GSPA 1UCKA 1BNRA 3HOHA 1LOWA 1BSAA 1UCIA 1B27A 2BU4A 1RGHA 1BUJA 1T2HA 5GSPA 1LNIA 1RGEA 3BU4A 1RCKA
chains in the Genus database with same CATH superfamily
4L8PA 1BRKA 1JBSA 1IU7A 3KE7A 2RNTA 1GOVA 2MC8A 1B2UA 5M19A 2XGLA 3CCQ3 1IQYA 3LMLA 4BL2A 5HOHA 1LQGC 2FXTA 8RNTA 3CCL3 3CMA3 1BSDA 1VZZA 1UI8A 4BU4A 2QIYA 3FLJA 4BTYA 1EEJA 4FMBA 4R1KA 2CWUA 4X2HA 3CCJ3 3BNCA 5AYRB 2W9QA 2RSXA 2LQVA 4K90B 3FKAA 3EN1B 3CNXA 1BRSA 4L8OA 1V74A 1RGFA 3KSPA 2Z76A 4L7KA 5IG4A 3GZYB 1JKGB 4O2HA 3ALAA 3O8YA 3WA3A 3NHXA 2CG1A 1YNVX 1LXEA 1Y4KA 3DH2A 4MJDA 1L5GB 1AQZA 1MWRA 2Z6BA 1DYUA 1MGRA 2BMRB 1AR0A 3CME3 2AAEA 2B1XB 1NDOB 2H0GA 4I5QA 4N6OB 5G2GA 5CF1A 1CEWI 1Q40B 5AIFA 3STDA 3CPW2 1WTHA 1X1YA 1RJOA 3K0ZA 4GB5A 3CCU3 1N8R4 1M1K4 1Q7Y4 1BAOA 1RMSA 2INXA 2P0MA 4CCVA 2QEX3 1W2B2 1I8VA 1TRQA 3D5GA 5JPPA 1Q824 1BSCA 3EQQB 3NQZA 1KC84 1OF5B 1HKXA 1AVKA 5FW5A 1BSBA 4O8SA 2OOVC 1TFKA 3E99A 1ISKA 1OHSA 1STDA 1HYFA 2HMJB 2JQ5A 2W9PA 3AMOB 2QGUA 4HM7B 1SPUA 1OH0A 3ER7A 1X1UA 3WMDA 1JBRA 1RGCA 3PXMA 1A2VA 3OWSA 3VGNA 5D83A 1UI7A 3OWUA 2CFLA 1B3SA 1RDSA 1JN5A 5M1AA 4PEJA 3ECFA 1VQ93 1GMRA 3KSED 4BTWA 4EC6A 3F9SA 1M9GA 1QAKA 1VQ73 2HMLB 1IQ8A 1FZUA 1UUVB 3IMAB 5TGNA 3LTDA 4XB5A 3CPOA 1BU4A 2W56A 4JRFA 5DREA 4QWTA 3WR2A 3CCS3 3UB1A 4BTXA 4WWUC 1G0TA 3SYUA 1ROAA 1AVLA 3LT8A 3J7Yd 1UCLA 3JUMA 1E97A 3DMCA 3WA2X 2KAAA 3X40A 2HMNB 1TUHA 1K734 1UGIA 1EG9B 1O7WB 2SARA 1PY3A 1RRLA 3DZLA 3GAXA 3NXJA 3EF8A 1US1A 1JZDA 2R4IA 1FGMA 1SJWA 2GXFA 1VQO3 2UUGC 3KCHA 2XFSA 4RBNA 4FCZA 3U97A 3HI7A 2GEXA 4N3VA 2A15A 4IPBA 1MWTA 1RGHA 4WYKA 1BUJA 1QALA 1LNIA 3T0UA 3BU4A 1WMOA 3JUNA 3Q3FA 2Z7AA 2CC3A 4EV2A 4MMXB 3KN4A 1TIJA 3OWYA 3CD63 1VQ63 1RNBA 3RDEA 1C54A 2BIRA 1E3VA 2CH9A 3FSDA 1BVIA 1FYSA 1W6GA 1ZX2A 3OV4A 5LC7A 1BIRA 3WOFB 5A0OB 5IW9A 1YIJ3 1TJDA 3K9MC 2W04A 1UUGB 3FF2A 2WOFA 1D6UA 1JJ22 3F40A 1JV2B 4N6UA 1SARA 3NQYA 5AIGA 4AKYA 1ZO2A 5IENA 1JRQA 1W2ZA 2MF7A 3SEDA 1RKYA 1EKMA 3WDGB 2D42A 2KF6A 1LVNA 3LH4A 1PFPA 3M8CA 3NV0A 4LZIA 1IK3A 1K28A 3KFQC 1N5HA 1JN5B 4HM8B 1MWUA 1QAFA 1W4NA 3D9RA 2C10A 2K54A 3DY5A 2ZHXB 3H51A 4KZ1A 3ROBA 1YJ93 1BNSA 1IVXA 4ORLA 1JNQA 2C11A 3Q2PA 4R80A 3JVCA 5CK6A 3S5CA 1STFI 1N9EA 1YVSA 1MWSA 2HMKB 5IG0A 3SLUA 1AV4A 2ZA4A 2W56B 2ZL8A 3LOYA 1GOYA 3EHCA 3EE1A 4KT3B 1R4CA 3S27A 1EQKA 2PZVA 3CC23 1B2MA 4FMDA 3RNTA 1FUSA 1IT7A 5I97A 3AHSA 1RGKA 3SXXA 3T8UA 1R4YA 1RHLA 1N9JA 1TTOA 4LEHA 2V1LA 1V57A 2XSHB 4O02B 3EN8A 7STDA 3B8LA 4GL6A 4J5KA 1GD4A 4G1MB 5KP1A 4LMIA 1CYVA 1AY7A 5EQLA 1A67A 2F56A 4OK0A 1BANA 2D1WA 3DGYA 4WYKB 5JPUA 5KP4A 1VQ53 1I70A 2CWTA 4GHOA 5IERA 2XH9A 1LRAA 5KP3A 4RNTA 4N6NB 3LTBA 5AEUB 2F98A 3K5TA 1YGWA 2IUJA 3CCR3 4LYLB 5M18A 2P0XA 1UW1A 2W2CA 3K7CA 2FNQA 5BIRA 4EW5A 2XSOB 1IVUA 2BHMA 1LOXA 5IEOA 3BNEA 3OX9A 2CFWA 3SOYA 2OTL3 1PU4A 3K63A 2CFGA 3AGNA 1WMPA 4FR9A 4JF8A 1LOYA 1RLSA 7GSPA 2ML6A 3HX8A 4H61A 3WOEB 1KQS2 3TDGA 1LQMB 3NV0B 2CFDA 1GD3A 3GWRA 1JB2A 1W6YA 1JB4A 4HM2B 4XBXA 1WQLB 2GEYA 3Q90A 5STDA 4KVHA 4EV5A 3DUKA 1I3IA 1BNJA 3IPTA 1JZOA 2Z77A 4J5GA 5AEWB 1FGTA 1NB3I 4XM4A 4O3VA 3FZWA 3G16A 4Q53A 2LYXA 1VQP3 1OGXA 2BMOB 1X1WA 3PS8A 4MMYB 1GSPA 1UCKA 3BNDA 1GY6A 2BT3A 2W03A 1WNHA 1Z1SA 3KZTA 3MYTA 4EBGA 2E2TA 3MG2A 1A2KA 3X41A 2W0QA 1B27A 4CDLA 1SIIA 2BU4A 2QA43 3NBBA 5AYSC 1B2ZA 2GBWB 4HZBB 1IVWA 1D6YA 3MSOA 5IEPA 1RGAA 3HK4A 1OUNA 3G0KA 1NJI4 1N8QA 3UJMA 2FGTA 1B2XA 1O7MB 2IA7A 1QJGA 3I0YA 3S29A 2C4BA 1IV7A 2KF4A 3NM7A 1TRPA 2R41A 1I3FA 2GBXB 2BO9B 3F7XA 3WODG 1IYYA 3G6E3 3U1WA 3EB8A 4TX4A 1Q864 2ZDJA 1I2EA 1VQN3 3BIRA 3FG1A 4HBRA 1JBTA 1WMNA 2KF5A 2WOHA 1KD14 1DETA 1HU9A 1FUWA 2W6JH 4WHAA 1OHPA 2H0HA 1J2BA 2O9UX 3CCV3 1I0XA 2OQEA 3HIGA 1O7HB 1LOVA 4LSOA 1JKGA 3NBRA 4AKZA 1VQ43 2OTJ3 1FGQA 4FMAA 2XRXB 1OHOA 5HGRA 3VSYA 5BXQA 1OGZA 1BUQA 3F8XA 2ML5A 2OCTA 3PGBA 2F5MA 3NX0A 4U13A 3AGOA 3FG4A 5EEOA 3KKGA 1YIT3 3CXC2 1DMMA 1I2GA 1B20A 2KCDA 3D5IA 1RN7A 3PYJA 3PCRA 1CH0A 3G713 4BIRA 2F86B 1U5OA 5G1KA 2PNCA 6GSPA 1GY5A 2KF3A 1HZ1A 2HOHA 5CXOA 5CF2A 1UUWB 3I553 1YI23 1W01A 1PYLA 1W02A 1CYUA 1NB5I 9RNTA 1X1XA 1DE3A 1O7PB 5IG3A 1V58A 1RTUA 5AI1A 1MOLA 1ULJB 1W7CA 2CX0A 3MWZA 2L1SA 1NO3A 3FF0A 4HJLB 2GU1A 1RCLA 3A76A 4H3UA 2XGNA 4KFFA 2J8XB 2STDA 3H3HA 1LNHA 5G1LA 4ZM8A 3CCM3 3I563 2O3OA 4OVMA 1B2SA 3KIIA 3EX9A 1GOUA 1I2FA 2YFLB 3DGOA 1NU3A 1Q814 1Q7HA 1N5PA 2P09A 1G96A 3F8HA 3FG3A 1ULIB 5FGOA 1B21A 1NWWA 3DGLA 1FGRA 2L4VA 2RCDA 3QRDA 4X2OA 3SOAA 4FCJA 8CHOA 1A2PA 2H0IA 2CHCA 4HM4B 5LC6A 2P38A 1TFOA 2CKFB 2SBLA 4CJNA 3SVAA 1U8CB 3GSPA 3ZFZA 4R4KA 3JUOA 3OW22 1FUTA 3FH1A 1BRIA 2BMQB 1CQSA 1DMNA 1BNEA 3N9HA 1RGGA 2WGQA 3MPHA 7RNTA 3DGNA 2AADA 2YX9A 3RGRA 3HIIA 3FGYA 3UL5A 1F8NA 1BNGA 2CWVA 1RRHA 4LGQA 1YJN3 3GZRA 3DM8A 3B7CA 1S723 4XBTA 4K1VA 1BNRA 2F99A 2KXGA 3HOHA 1LOWA 1KSIA 1BSAA 4OUQA 1ROVA 3EBYA 4NPBA 1K41A 3BLZA 3DXOA 3LTAA 3NBJA 5IF6A 2XEPA 1MNLA 5GSPA 2CW9A 5DRVA 1RGEA 4MEIA 3MG1A 1RCKA 4FMCA 4GSPA 3CNMA 1QVG2 2IMJA 1K8A4 2CG0A 1BNIA 3NUVA 2CIUA 3MKIA 3N8BA 3IJEB 4HM5B 1VQM3 1K9M4 3CC43 4HM1B 4J9AA 1RN4A 1FW7A 3PZWA 4STDA 2Y74A 3LZAA 4R9KA 3OXAA 3NM2A 3G8ZA 2YFIB 1T2IA 4XBYA 1IV9A 1RGLA 4AEQA 1MGWA 2OOVA 1YHQ3 1QVF2 4HKVB 2B24B 1T5YA 1BOXA 3A5EA 1IDPA 3UL6A 4HVNA 3CU3A 3AHWA 1UGHI 2Q07A 3QK9A 1C7HA 2K0MA 2RGQA 1BSEA 4HAAA 1OACA 4FCMA 1YJW3 1BGSA 1GYBA 3HZPA 1NNVA 1OCVA 4XDWA 4WFOA 3G4S3 4MMZB 4NREA 3LXUX 4BL3A 2CFKA 4K61A 3L0RA 3V98A 3MHEA 4KFEA 1EUIC 1RSNA 2YFJB 2IYJA 1G02A 3LYGA 2HMMB 2XR8B 5AIIA 3T8NA 2UGIA 3DGMA 2M7OA 3BNBA 3F14A 1ASKA 5JBSA 1TP6A 1M904 3X42A 2XFTA 3F7SA 1VQQA 2RBIA 3GZBA 4HZ9B 3X3ZA 2K3DA 2JDIH 2BNGA 2Y73A 1A90A 3JUPA 1E3RA 4CPKA 1M1XB 1IVVA 5IG5A 3ZG0A 4I4KA 2GSPA 1FGOA 1SQWA 3D79A 3FCSB 5BVBA 4N6V0 5BU4A 4HM0B 3GRDA 5D82A 2CK3H 1DMQA 1GMPA 2IY2A 4K1UA 3SX1A 1UDII 5ELUA 3URPA 3V99A 5RNTA 3CC73 4XDVA 1T3BA 3RGAA 3S28A 3X3XA 2OQEC 5EVHA 1KWIA 1Q42A 3EJVA 4EYCA 1TU5A 1BRGA 4R9LA 3JUQA 4RNYA 2UX0A 4HOHA 2HMOB 5ELJA 3X3YA 4IT7A 1BRNL 2CX1A 3CCE3 4NHFA 1IQXA 4RZMA 3S67A 1VQL3 2P05A 6RNTA 1SIHA 1ZS7A 3PCSA 5D81A 4EXRA 1UCJA 1DVCA 3WHOA 1JB5A 2WO0A 5AIHA 1O7GB 1YVBI 3EBTA 1Q40A 3BB9A 2KRTA 1VQK3 2F4YA 1GS3A 3LTCA 1W5ZA 3D4AA 4N6MA 1ZGXA 4HM3B 1O7NB 2F5WA 1DVDA 1BRJA 4WP5A 2RFRA 1GY7A 1OF5A 1YGEA 1IT8A 1I0VA 4IIAA 6STDA 1GMQA 2I9WA 1OPYA 3B4PA 1VQ83 2WGOA 4HM6B 4KFDA 1BRHA 4N6LA 3VF1A 3Q1CA 4HYZA 4DKIA 1Q9EA 1RNTA 3UNLA 2GU3A 1D6ZA 3AMOA 3ZG5A 3N54B 3MG3A 3GZXB 3V92A 1RN1A 1BNFA 1W00A 3LT9A 1QMAA 2OWPA 5CLKA 1UCIA 2XF3A 1W6CA 2E2VA 3EC9A 4RNZA 4N6TA 1FA3A 2IUKA 1S5AA 1EA2A 2E2UA 4J8TA 3B4OA 3D3LA 1T2HA 4ILFA
chains in the Genus database with same CATH topology
1B2ZA 1BRKA 1BNIA 1JBSA 2RNTA 1GOVA 1RNBA 1B2UA 1C54A 2BIRA 1BVIA 1FYSA 8RNTA 5HOHA 1BIRA 1BSDA 1RN4A 1RGAA 4BU4A 1FW7A 1B2XA 1SARA 1T2IA 1BRSA 1RGLA 1RGFA 2C4BA 2KF4A 1MGWA 1TRPA 1IYYA 1I3FA 2KF6A 1BOXA 3A5EA 4GSPA 3AHWA 1I2EA 1YNVX 3DH2A 1AQZA 3BIRA 1BNSA 1JBTA 1BSEA 4HAAA 2KF5A 1MGRA 1DETA 2AAEA 1BGSA 1YVSA 1I0XA 2ZA4A 1LOVA 1X1YA 1GOYA 1BAOA 1RMSA 1RSNA 1I8VA 1G02A 1TRQA 3D5GA 1B2MA 2F5MA 1BSCA 3AGOA 3RNTA 1FUSA 1I2GA 1B20A 3AHSA 1RGKA 3D5IA 2RBIA 1BSBA 1CH0A 4BIRA 1R4YA 1RHLA 1HYFA 6GSPA 2GSPA 1TTOA 2KF3A 1HZ1A 2HOHA 5BU4A 1PYLA 1X1UA 9RNTA 1GMPA 1X1XA 1DE3A 5RNTA 3URPA 1RTUA 4J5KA 1JBRA 1RGCA 1AY7A 2F56A 1BANA 3DGYA 1RCLA 1I70A 1BRGA 4GHOA 1B3SA 1RDSA 1LRAA 4HOHA 4RNTA 1GMRA 1B2SA 1BRNL 1GOUA 1I2FA 1YGWA 1FZUA 6RNTA 1B21A 1UCJA 3WHOA 5BIRA 1BU4A 3WR2A 3AGNA 2F4YA 1A2PA 7GSPA 1LOYA 1RLSA 3SYUA 3D4AA 1UCLA 3GSPA 1ZGXA 2KAAA 2F5WA 1BRJA 1FUTA 1BRIA 2SARA 1BNEA 1I0VA 1PY3A 1RGGA 1GMQA 1BNJA 1I3IA 7RNTA 4J5GA 2AADA 1BRHA 1Q9EA 1BNGA 1RNTA 3Q3FA 3KCHA 1X1WA 1RN1A 1BNFA 1GSPA 1UCKA 1BNRA 3HOHA 1LOWA 1BSAA 1UCIA 1B27A 2BU4A 1RGHA 1BUJA 1T2HA 5GSPA 1LNIA 1RGEA 3BU4A 1RCKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1B2Z A;  1BRK A;  1BNI A;  1JBS A;  2RNT A;  1GOV A;  1RNB A;  1B2U A;  1C54 A;  2BIR A;  1BVI A;  1FYS A;  8RNT A;  5HOH A;  1BIR A;  1BSD A;  1RN4 A;  1RGA A;  4BU4 A;  1FW7 A;  1B2X A;  1SAR A;  1T2I A;  1BRS A;  1RGL A;  1RGF A;  2C4B A;  2KF4 A;  1MGW A;  1TRP A;  1IYY A;  1I3F A;  2KF6 A;  1BOX A;  3A5E A;  4GSP A;  3AHW A;  1I2E A;  1YNV X;  3DH2 A;  1AQZ A;  3BIR A;  1BNS A;  1JBT A;  1BSE A;  4HAA A;  2KF5 A;  1MGR A;  1DET A;  2AAE A;  1BGS A;  1YVS A;  1I0X A;  2ZA4 A;  1LOV A;  1X1Y A;  1GOY A;  1BAO A;  1RMS A;  1RSN A;  1I8V A;  1G02 A;  1TRQ A;  3D5G A;  1B2M A;  2F5M A;  1BSC A;  3AGO A;  3RNT A;  1FUS A;  1I2G A;  1B20 A;  3AHS A;  1RGK A;  3D5I A;  2RBI A;  1BSB A;  1CH0 A;  4BIR A;  1R4Y A;  1RHL A;  1HYF A;  6GSP A;  2GSP A;  1TTO A;  2KF3 A;  1HZ1 A;  2HOH A;  5BU4 A;  1PYL A;  1X1U A;  9RNT A;  1GMP A;  1X1X A;  1DE3 A;  5RNT A;  3URP A;  1RTU A;  4J5K A;  1JBR A;  1RGC A;  1AY7 A;  2F56 A;  1BAN A;  3DGY A;  1RCL A;  1I70 A;  1BRG A;  4GHO A;  1B3S A;  1RDS A;  1LRA A;  4HOH A;  4RNT A;  1GMR A;  1B2S A;  1BRN L;  1GOU A;  1I2F A;  1YGW A;  1FZU A;  6RNT A;  1B21 A;  1UCJ A;  3WHO A;  5BIR A;  1BU4 A;  3WR2 A;  3AGN A;  2F4Y A;  1A2P A;  7GSP A;  1LOY A;  1RLS A;  3SYU A;  3D4A A;  1UCL A;  3GSP A;  1ZGX A;  2KAA A;  2F5W A;  1BRJ A;  1FUT A;  1BRI A;  2SAR A;  1BNE A;  1I0V A;  1PY3 A;  1RGG A;  1GMQ A;  1BNJ A;  1I3I A;  7RNT A;  4J5G A;  2AAD A;  1BRH A;  1Q9E A;  1BNG A;  1RNT A;  3Q3F A;  3KCH A;  1X1W A;  1RN1 A;  1BNF A;  1GSP A;  1UCK A;  1BNR A;  3HOH A;  1LOW A;  1BSA A;  1UCI A;  1B27 A;  2BU4 A;  1RGH A;  1BUJ A;  1T2H A;  5GSP A;  1LNI A;  1RGE A;  3BU4 A;  1RCK A; 
#chains in the Genus database with same CATH topology
 4L8P A;  1BRK A;  1JBS A;  1IU7 A;  3KE7 A;  2RNT A;  1GOV A;  2MC8 A;  1B2U A;  5M19 A;  2XGL A;  3CCQ 3;  1IQY A;  3LML A;  4BL2 A;  5HOH A;  1LQG C;  2FXT A;  8RNT A;  3CCL 3;  3CMA 3;  1BSD A;  1VZZ A;  1UI8 A;  4BU4 A;  2QIY A;  3FLJ A;  4BTY A;  1EEJ A;  4FMB A;  4R1K A;  2CWU A;  4X2H A;  3CCJ 3;  3BNC A;  5AYR B;  2W9Q A;  2RSX A;  2LQV A;  4K90 B;  3FKA A;  3EN1 B;  3CNX A;  1BRS A;  4L8O A;  1V74 A;  1RGF A;  3KSP A;  2Z76 A;  4L7K A;  5IG4 A;  3GZY B;  1JKG B;  4O2H A;  3ALA A;  3O8Y A;  3WA3 A;  3NHX A;  2CG1 A;  1YNV X;  1LXE A;  1Y4K A;  3DH2 A;  4MJD A;  1L5G B;  1AQZ A;  1MWR A;  2Z6B A;  1DYU A;  1MGR A;  2BMR B;  1AR0 A;  3CME 3;  2AAE A;  2B1X B;  1NDO B;  2H0G A;  4I5Q A;  4N6O B;  5G2G A;  5CF1 A;  1CEW I;  1Q40 B;  5AIF A;  3STD A;  3CPW 2;  1WTH A;  1X1Y A;  1RJO A;  3K0Z A;  4GB5 A;  3CCU 3;  1N8R 4;  1M1K 4;  1Q7Y 4;  1BAO A;  1RMS A;  2INX A;  2P0M A;  4CCV A;  2QEX 3;  1W2B 2;  1I8V A;  1TRQ A;  3D5G A;  5JPP A;  1Q82 4;  1BSC A;  3EQQ B;  3NQZ A;  1KC8 4;  1OF5 B;  1HKX A;  1AVK A;  5FW5 A;  1BSB A;  4O8S A;  2OOV C;  1TFK A;  3E99 A;  1ISK A;  1OHS A;  1STD A;  1HYF A;  2HMJ B;  2JQ5 A;  2W9P A;  3AMO B;  2QGU A;  4HM7 B;  1SPU A;  1OH0 A;  3ER7 A;  1X1U A;  3WMD A;  1JBR A;  1RGC A;  3PXM A;  1A2V A;  3OWS A;  3VGN A;  5D83 A;  1UI7 A;  3OWU A;  2CFL A;  1B3S A;  1RDS A;  1JN5 A;  5M1A A;  4PEJ A;  3ECF A;  1VQ9 3;  1GMR A;  3KSE D;  4BTW A;  4EC6 A;  3F9S A;  1M9G A;  1QAK A;  1VQ7 3;  2HML B;  1IQ8 A;  1FZU A;  1UUV B;  3IMA B;  5TGN A;  3LTD A;  4XB5 A;  3CPO A;  1BU4 A;  2W56 A;  4JRF A;  5DRE A;  4QWT A;  3WR2 A;  3CCS 3;  3UB1 A;  4BTX A;  4WWU C;  1G0T A;  3SYU A;  1ROA A;  1AVL A;  3LT8 A;  3J7Y d;  1UCL A;  3JUM A;  1E97 A;  3DMC A;  3WA2 X;  2KAA A;  3X40 A;  2HMN B;  1TUH A;  1K73 4;  1UGI A;  1EG9 B;  1O7W B;  2SAR A;  1PY3 A;  1RRL A;  3DZL A;  3GAX A;  3NXJ A;  3EF8 A;  1US1 A;  1JZD A;  2R4I A;  1FGM A;  1SJW A;  2GXF A;  1VQO 3;  2UUG C;  3KCH A;  2XFS A;  4RBN A;  4FCZ A;  3U97 A;  3HI7 A;  2GEX A;  4N3V A;  2A15 A;  4IPB A;  1MWT A;  1RGH A;  4WYK A;  1BUJ A;  1QAL A;  1LNI A;  3T0U A;  3BU4 A;  1WMO A;  3JUN A;  3Q3F A;  2Z7A A;  2CC3 A;  4EV2 A;  4MMX B;  3KN4 A;  1TIJ A;  3OWY A;  3CD6 3;  1VQ6 3;  1RNB A;  3RDE A;  1C54 A;  2BIR A;  1E3V A;  2CH9 A;  3FSD A;  1BVI A;  1FYS A;  1W6G A;  1ZX2 A;  3OV4 A;  5LC7 A;  1BIR A;  3WOF B;  5A0O B;  5IW9 A;  1YIJ 3;  1TJD A;  3K9M C;  2W04 A;  1UUG B;  3FF2 A;  2WOF A;  1D6U A;  1JJ2 2;  3F40 A;  1JV2 B;  4N6U A;  1SAR A;  3NQY A;  5AIG A;  4AKY A;  1ZO2 A;  5IEN A;  1JRQ A;  1W2Z A;  2MF7 A;  3SED A;  1RKY A;  1EKM A;  3WDG B;  2D42 A;  2KF6 A;  1LVN A;  3LH4 A;  1PFP A;  3M8C A;  3NV0 A;  4LZI A;  1IK3 A;  1K28 A;  3KFQ C;  1N5H A;  1JN5 B;  4HM8 B;  1MWU A;  1QAF A;  1W4N A;  3D9R A;  2C10 A;  2K54 A;  3DY5 A;  2ZHX B;  3H51 A;  4KZ1 A;  3ROB A;  1YJ9 3;  1BNS A;  1IVX A;  4ORL A;  1JNQ A;  2C11 A;  3Q2P A;  4R80 A;  3JVC A;  5CK6 A;  3S5C A;  1STF I;  1N9E A;  1YVS A;  1MWS A;  2HMK B;  5IG0 A;  3SLU A;  1AV4 A;  2ZA4 A;  2W56 B;  2ZL8 A;  3LOY A;  1GOY A;  3EHC A;  3EE1 A;  4KT3 B;  1R4C A;  3S27 A;  1EQK A;  2PZV A;  3CC2 3;  1B2M A;  4FMD A;  3RNT A;  1FUS A;  1IT7 A;  5I97 A;  3AHS A;  1RGK A;  3SXX A;  3T8U A;  1R4Y A;  1RHL A;  1N9J A;  1TTO A;  4LEH A;  2V1L A;  1V57 A;  2XSH B;  4O02 B;  3EN8 A;  7STD A;  3B8L A;  4GL6 A;  4J5K A;  1GD4 A;  4G1M B;  5KP1 A;  4LMI A;  1CYV A;  1AY7 A;  5EQL A;  1A67 A;  2F56 A;  4OK0 A;  1BAN A;  2D1W A;  3DGY A;  4WYK B;  5JPU A;  5KP4 A;  1VQ5 3;  1I70 A;  2CWT A;  4GHO A;  5IER A;  2XH9 A;  1LRA A;  5KP3 A;  4RNT A;  4N6N B;  3LTB A;  5AEU B;  2F98 A;  3K5T A;  1YGW A;  2IUJ A;  3CCR 3;  4LYL B;  5M18 A;  2P0X A;  1UW1 A;  2W2C A;  3K7C A;  2FNQ A;  5BIR A;  4EW5 A;  2XSO B;  1IVU A;  2BHM A;  1LOX A;  5IEO A;  3BNE A;  3OX9 A;  2CFW A;  3SOY A;  2OTL 3;  1PU4 A;  3K63 A;  2CFG A;  3AGN A;  1WMP A;  4FR9 A;  4JF8 A;  1LOY A;  1RLS A;  7GSP A;  2ML6 A;  3HX8 A;  4H61 A;  3WOE B;  1KQS 2;  3TDG A;  1LQM B;  3NV0 B;  2CFD A;  1GD3 A;  3GWR A;  1JB2 A;  1W6Y A;  1JB4 A;  4HM2 B;  4XBX A;  1WQL B;  2GEY A;  3Q90 A;  5STD A;  4KVH A;  4EV5 A;  3DUK A;  1I3I A;  1BNJ A;  3IPT A;  1JZO A;  2Z77 A;  4J5G A;  5AEW B;  1FGT A;  1NB3 I;  4XM4 A;  4O3V A;  3FZW A;  3G16 A;  4Q53 A;  2LYX A;  1VQP 3;  1OGX A;  2BMO B;  1X1W A;  3PS8 A;  4MMY B;  1GSP A;  1UCK A;  3BND A;  1GY6 A;  2BT3 A;  2W03 A;  1WNH A;  1Z1S A;  3KZT A;  3MYT A;  4EBG A;  2E2T A;  3MG2 A;  1A2K A;  3X41 A;  2W0Q A;  1B27 A;  4CDL A;  1SII A;  2BU4 A;  2QA4 3;  3NBB A;  5AYS C;  1B2Z A;  2GBW B;  4HZB B;  1IVW A;  1D6Y A;  3MSO A;  5IEP A;  1RGA A;  3HK4 A;  1OUN A;  3G0K A;  1NJI 4;  1N8Q A;  3UJM A;  2FGT A;  1B2X A;  1O7M B;  2IA7 A;  1QJG A;  3I0Y A;  3S29 A;  2C4B A;  1IV7 A;  2KF4 A;  3NM7 A;  1TRP A;  2R41 A;  1I3F A;  2GBX B;  2BO9 B;  3F7X A;  3WOD G;  1IYY A;  3G6E 3;  3U1W A;  3EB8 A;  4TX4 A;  1Q86 4;  2ZDJ A;  1I2E A;  1VQN 3;  3BIR A;  3FG1 A;  4HBR A;  1JBT A;  1WMN A;  2KF5 A;  2WOH A;  1KD1 4;  1DET A;  1HU9 A;  1FUW A;  2W6J H;  4WHA A;  1OHP A;  2H0H A;  1J2B A;  2O9U X;  3CCV 3;  1I0X A;  2OQE A;  3HIG A;  1O7H B;  1LOV A;  4LSO A;  1JKG A;  3NBR A;  4AKZ A;  1VQ4 3;  2OTJ 3;  1FGQ A;  4FMA A;  2XRX B;  1OHO A;  5HGR A;  3VSY A;  5BXQ A;  1OGZ A;  1BUQ A;  3F8X A;  2ML5 A;  2OCT A;  3PGB A;  2F5M A;  3NX0 A;  4U13 A;  3AGO A;  3FG4 A;  5EEO A;  3KKG A;  1YIT 3;  3CXC 2;  1DMM A;  1I2G A;  1B20 A;  2KCD A;  3D5I A;  1RN7 A;  3PYJ A;  3PCR A;  1CH0 A;  3G71 3;  4BIR A;  2F86 B;  1U5O A;  5G1K A;  2PNC A;  6GSP A;  1GY5 A;  2KF3 A;  1HZ1 A;  2HOH A;  5CXO A;  5CF2 A;  1UUW B;  3I55 3;  1YI2 3;  1W01 A;  1PYL A;  1W02 A;  1CYU A;  1NB5 I;  9RNT A;  1X1X A;  1DE3 A;  1O7P B;  5IG3 A;  1V58 A;  1RTU A;  5AI1 A;  1MOL A;  1ULJ B;  1W7C A;  2CX0 A;  3MWZ A;  2L1S A;  1NO3 A;  3FF0 A;  4HJL B;  2GU1 A;  1RCL A;  3A76 A;  4H3U A;  2XGN A;  4KFF A;  2J8X B;  2STD A;  3H3H A;  1LNH A;  5G1L A;  4ZM8 A;  3CCM 3;  3I56 3;  2O3O A;  4OVM A;  1B2S A;  3KII A;  3EX9 A;  1GOU A;  1I2F A;  2YFL B;  3DGO A;  1NU3 A;  1Q81 4;  1Q7H A;  1N5P A;  2P09 A;  1G96 A;  3F8H A;  3FG3 A;  1ULI B;  5FGO A;  1B21 A;  1NWW A;  3DGL A;  1FGR A;  2L4V A;  2RCD A;  3QRD A;  4X2O A;  3SOA A;  4FCJ A;  8CHO A;  1A2P A;  2H0I A;  2CHC A;  4HM4 B;  5LC6 A;  2P38 A;  1TFO A;  2CKF B;  2SBL A;  4CJN A;  3SVA A;  1U8C B;  3GSP A;  3ZFZ A;  4R4K A;  3JUO A;  3OW2 2;  1FUT A;  3FH1 A;  1BRI A;  2BMQ B;  1CQS A;  1DMN A;  1BNE A;  3N9H A;  1RGG A;  2WGQ A;  3MPH A;  7RNT A;  3DGN A;  2AAD A;  2YX9 A;  3RGR A;  3HII A;  3FGY A;  3UL5 A;  1F8N A;  1BNG A;  2CWV A;  1RRH A;  4LGQ A;  1YJN 3;  3GZR A;  3DM8 A;  3B7C A;  1S72 3;  4XBT A;  4K1V A;  1BNR A;  2F99 A;  2KXG A;  3HOH A;  1LOW A;  1KSI A;  1BSA A;  4OUQ A;  1ROV A;  3EBY A;  4NPB A;  1K41 A;  3BLZ A;  3DXO A;  3LTA A;  3NBJ A;  5IF6 A;  2XEP A;  1MNL A;  5GSP A;  2CW9 A;  5DRV A;  1RGE A;  4MEI A;  3MG1 A;  1RCK A;  4FMC A;  4GSP A;  3CNM A;  1QVG 2;  2IMJ A;  1K8A 4;  2CG0 A;  1BNI A;  3NUV A;  2CIU A;  3MKI A;  3N8B A;  3IJE B;  4HM5 B;  1VQM 3;  1K9M 4;  3CC4 3;  4HM1 B;  4J9A A;  1RN4 A;  1FW7 A;  3PZW A;  4STD A;  2Y74 A;  3LZA A;  4R9K A;  3OXA A;  3NM2 A;  3G8Z A;  2YFI B;  1T2I A;  4XBY A;  1IV9 A;  1RGL A;  4AEQ A;  1MGW A;  2OOV A;  1YHQ 3;  1QVF 2;  4HKV B;  2B24 B;  1T5Y A;  1BOX A;  3A5E A;  1IDP A;  3UL6 A;  4HVN A;  3CU3 A;  3AHW A;  1UGH I;  2Q07 A;  3QK9 A;  1C7H A;  2K0M A;  2RGQ A;  1BSE A;  4HAA A;  1OAC A;  4FCM A;  1YJW 3;  1BGS A;  1GYB A;  3HZP A;  1NNV A;  1OCV A;  4XDW A;  4WFO A;  3G4S 3;  4MMZ B;  4NRE A;  3LXU X;  4BL3 A;  2CFK A;  4K61 A;  3L0R A;  3V98 A;  3MHE A;  4KFE A;  1EUI C;  1RSN A;  2YFJ B;  2IYJ A;  1G02 A;  3LYG A;  2HMM B;  2XR8 B;  5AII A;  3T8N A;  2UGI A;  3DGM A;  2M7O A;  3BNB A;  3F14 A;  1ASK A;  5JBS A;  1TP6 A;  1M90 4;  3X42 A;  2XFT A;  3F7S A;  1VQQ A;  2RBI A;  3GZB A;  4HZ9 B;  3X3Z A;  2K3D A;  2JDI H;  2BNG A;  2Y73 A;  1A90 A;  3JUP A;  1E3R A;  4CPK A;  1M1X B;  1IVV A;  5IG5 A;  3ZG0 A;  4I4K A;  2GSP A;  1FGO A;  1SQW A;  3D79 A;  3FCS B;  5BVB A;  4N6V 0;  5BU4 A;  4HM0 B;  3GRD A;  5D82 A;  2CK3 H;  1DMQ A;  1GMP A;  2IY2 A;  4K1U A;  3SX1 A;  1UDI I;  5ELU A;  3URP A;  3V99 A;  5RNT A;  3CC7 3;  4XDV A;  1T3B A;  3RGA A;  3S28 A;  3X3X A;  2OQE C;  5EVH A;  1KWI A;  1Q42 A;  3EJV A;  4EYC A;  1TU5 A;  1BRG A;  4R9L A;  3JUQ A;  4RNY A;  2UX0 A;  4HOH A;  2HMO B;  5ELJ A;  3X3Y A;  4IT7 A;  1BRN L;  2CX1 A;  3CCE 3;  4NHF A;  1IQX A;  4RZM A;  3S67 A;  1VQL 3;  2P05 A;  6RNT A;  1SIH A;  1ZS7 A;  3PCS A;  5D81 A;  4EXR A;  1UCJ A;  1DVC A;  3WHO A;  1JB5 A;  2WO0 A;  5AIH A;  1O7G B;  1YVB I;  3EBT A;  1Q40 A;  3BB9 A;  2KRT A;  1VQK 3;  2F4Y A;  1GS3 A;  3LTC A;  1W5Z A;  3D4A A;  4N6M A;  1ZGX A;  4HM3 B;  1O7N B;  2F5W A;  1DVD A;  1BRJ A;  4WP5 A;  2RFR A;  1GY7 A;  1OF5 A;  1YGE A;  1IT8 A;  1I0V A;  4IIA A;  6STD A;  1GMQ A;  2I9W A;  1OPY A;  3B4P A;  1VQ8 3;  2WGO A;  4HM6 B;  4KFD A;  1BRH A;  4N6L A;  3VF1 A;  3Q1C A;  4HYZ A;  4DKI A;  1Q9E A;  1RNT A;  3UNL A;  2GU3 A;  1D6Z A;  3AMO A;  3ZG5 A;  3N54 B;  3MG3 A;  3GZX B;  3V92 A;  1RN1 A;  1BNF A;  1W00 A;  3LT9 A;  1QMA A;  2OWP A;  5CLK A;  1UCI A;  2XF3 A;  1W6C A;  2E2V A;  3EC9 A;  4RNZ A;  4N6T A;  1FA3 A;  2IUK A;  1S5A A;  1EA2 A;  2E2U A;  4J8T A;  3B4O A;  3D3L A;  1T2H A;  4ILF A; 
#chains in the Genus database with same CATH homology
 1B2Z A;  1BRK A;  1BNI A;  1JBS A;  2RNT A;  1GOV A;  1RNB A;  1B2U A;  1C54 A;  2BIR A;  1BVI A;  1FYS A;  8RNT A;  5HOH A;  1BIR A;  1BSD A;  1RN4 A;  1RGA A;  4BU4 A;  1FW7 A;  1B2X A;  1SAR A;  1T2I A;  1BRS A;  1RGL A;  1RGF A;  2C4B A;  2KF4 A;  1MGW A;  1TRP A;  1IYY A;  1I3F A;  2KF6 A;  1BOX A;  3A5E A;  4GSP A;  3AHW A;  1I2E A;  1YNV X;  3DH2 A;  1AQZ A;  3BIR A;  1BNS A;  1JBT A;  1BSE A;  4HAA A;  2KF5 A;  1MGR A;  1DET A;  2AAE A;  1BGS A;  1YVS A;  1I0X A;  2ZA4 A;  1LOV A;  1X1Y A;  1GOY A;  1BAO A;  1RMS A;  1RSN A;  1I8V A;  1G02 A;  1TRQ A;  3D5G A;  1B2M A;  2F5M A;  1BSC A;  3AGO A;  3RNT A;  1FUS A;  1I2G A;  1B20 A;  3AHS A;  1RGK A;  3D5I A;  2RBI A;  1BSB A;  1CH0 A;  4BIR A;  1R4Y A;  1RHL A;  1HYF A;  6GSP A;  2GSP A;  1TTO A;  2KF3 A;  1HZ1 A;  2HOH A;  5BU4 A;  1PYL A;  1X1U A;  9RNT A;  1GMP A;  1X1X A;  1DE3 A;  5RNT A;  3URP A;  1RTU A;  4J5K A;  1JBR A;  1RGC A;  1AY7 A;  2F56 A;  1BAN A;  3DGY A;  1RCL A;  1I70 A;  1BRG A;  4GHO A;  1B3S A;  1RDS A;  1LRA A;  4HOH A;  4RNT A;  1GMR A;  1B2S A;  1BRN L;  1GOU A;  1I2F A;  1YGW A;  1FZU A;  6RNT A;  1B21 A;  1UCJ A;  3WHO A;  5BIR A;  1BU4 A;  3WR2 A;  3AGN A;  2F4Y A;  1A2P A;  7GSP A;  1LOY A;  1RLS A;  3SYU A;  3D4A A;  1UCL A;  3GSP A;  1ZGX A;  2KAA A;  2F5W A;  1BRJ A;  1FUT A;  1BRI A;  2SAR A;  1BNE A;  1I0V A;  1PY3 A;  1RGG A;  1GMQ A;  1BNJ A;  1I3I A;  7RNT A;  4J5G A;  2AAD A;  1BRH A;  1Q9E A;  1BNG A;  1RNT A;  3Q3F A;  3KCH A;  1X1W A;  1RN1 A;  1BNF A;  1GSP A;  1UCK A;  1BNR A;  3HOH A;  1LOW A;  1BSA A;  1UCI A;  1B27 A;  2BU4 A;  1RGH A;  1BUJ A;  1T2H A;  5GSP A;  1LNI A;  1RGE A;  3BU4 A;  1RCK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...