1I72B

Human s-adenosylmethionine decarboxylase with covalently bound pyruvoyl group and covalently bound 5'-deoxy-5'-[n-methyl-n-(2-aminooxyethyl) amino]adenosine
Total Genus 6
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
6
sequence length
64
structure length
61
Chain Sequence
AHFFEGTEKLLEVWFSRQQPQGSGDLRTIPRSEWDILLKDVQCSIISVTKTDKQEAYVLSE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The structural basis for substrate specificity and inhibition of human S-adenosylmethionine decarboxylase.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Lyase
molecule keywords S-ADENOSYLMETHIONINE DECARBOXYLASE BETA CHAIN
total genus 6
structure length 61
sequence length 64
ec nomenclature ec 4.1.1.50: Adenosylmethionine decarboxylase.
pdb deposition date 2001-03-07
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.360.50 Alpha Beta 2-Layer Sandwich Dihydrodipicolinate Reductase; domain 2 S-adenosylmethionine decarboxylase 1i72B01
1I7BB 3DZ5B 3DZ6B 1MHMB 1I72B 3EP3B 3EP6B 3EPAB 3DZ3B 1I7MB 1I79B 3DZ7B 5TVOB 1I7CB 1JENB 3H0WB 3DZ2B 3DZ4B 3EP4B 3EP5B 3EP7B 3EP9B 3H0VB 3EPBB 3EP8B
chains in the Genus database with same CATH superfamily
3QVTA 2O48X 1EBUA 2DBVO 3WYBA 3KUXA 2YV3A 3RVDA 4K9DA 4GPD1 3H9EO 1NBOA 4MIYA 4O89A 1EVJA 1J0XO 1H94A 3NT4A 4MINA 4INAA 1FF9A 5A02A 2FPNA 3BIOA 3EP5B 3EP4B 5GZ1A 3E82A 3EP7B 3EPBB 1TB4A 1QKIA 3VAZA 3B1KA 4TVBA 1YL6A 4MKZA 4MIOA 4O63O 3TZ6A 4JN6B 1Q2XA 1GL3A 2GLXA 3MOIA 3WB9A 1I72B 2EP5A 2BHLA 3DBVO 4XB1A 1DC3A 3OA0A 4LRTB 3V5NA 1QMIA 3ZDFA 1HDGO 3HQ4O 3Q2IA 1QMHA 3E5RA 1VM6A 2Q4EA 1NQAO 4EW6A 4MKXA 5M6DA 4R5MA 3I23A 5JYAA 1XYGA 1MHMB 3OQBA 5JYEA 4YDRA 3QV1A 1DRVA 1H93A 3NTOA 4LRSB 1YL7A 3PZRA 2AXQA 4XB2A 3WGZA 3BTVA 1PQPA 5DDIP 3GPDG 2NVWA 3ZJXA 1LA2A 3DAPA 5JYFA 1LC3A 3DR3A 3EC7A 5C7OO 1DC4A 3DZ5B 3IP3A 1CF2O 5BNTA 1P1KA 3HNPA 3F4LA 3HSKA 3B1JA 3DOCA 1NQ5A 3EZYA 1U8FO 3WBBA 5KVQA 4R41A 2VYND 4R54A 1YWGO 3WGYA 3EP8B 4WNIA 1GCUA 1DC5A 3CMCO 1B7GO 1S7CA 3EUWA 2GZ1A 4R3NA 2BH9A 3UUWA 3NTQA 4IQ0A 1I33A 3C8MA 2GZ3A 4LGVA 2QZ9A 4PG7A 1BRMA 1JN0A 1NQOA 2HJSA 1E7YA 4N54A 1PQUA 1U1IA 1YS4A 3DMTA 2B4RO 3E18A 3UW3A 4PG8A 3DB2A 2HKIA 5C7IO 5EINA 4MVJG 4WNCA 3NT2A 5GZ3A 2DPGA 4MVJH 1ZNQO 4XQGA 2Q49A 1TLTA 3QVSA 4R4JA 1VSUA 3Q1LA 2Q22A 2H63A 1RYDA 2GYYA 3Q11A 4MVJI 3V2UA 3JSAA 1ZH8A 2R00C 4MVJP 1PR3A 3DZ6B 3WBFA 3QY9A 3LC1O 3VOSA 4WOJA 3DZ3B 3TV1A 3HJAA 1JENB 1E5LA 2XF8A 3E1KA 4HADA 2DUUA 3WYCA 3RCBA 1H6AA 2R00A 4MVJD 3DTYA 3NTRA 3LC2O 1P9LA 2OZPA 3BTUA 1P1HA 3EPAB 1NWHA 2EJWA 1JKIA 1YL5A 1OZAA 3KV3O 1H9AA 4PG6A 3DZ2B 4H3VA 5CEFA 3BTSA 4MJLA 1C3VA 1OFGA 5AVOA 2EP7A 1F06A 1VC2A 5A05A 1VSVA 2I3GA 2PKQP 3K9QO 3PFWO 1H6BA 3IWBB 2VYNA 1DSSG 3B20A 1I32A 2O4UX 1RM5A 3CINA 3DO5A 3DZ7B 3Q0EA 4DIBA 3TUXA 1RM4A 1MC4A 1Q7GA 3L4SO 1CERA 3WGOA 2NQTA 3IWDB 1RM0A 1GAEO 3EP9B 4DBVO 3GNQA 5A06A 3K73O 4KOAA 3EVNA 3GDOA 2DAPA 5JY6A 3EP6B 2PH5A 2GD1O 1RM3A 1GYQA 1PU2A 3HXLA 4P8RA 1DBVO 3CIFA 3M2TA 3KSDO 5AQ1A 1T4BA 5C7LO 3PYLA 2POQX 4L9RA 1IHYA 3Q2KA 1SZJG 4Z0HO 5A03A 3K2BA 3V1YA 1GD1O 3O9ZA 3INGA 1DRUA 3TW3A 3FHLA 1GYPA 3IWCB 1E5QA 1I79B 4II7A 2I5PO 4IQ8A 3NT5A 1XEAA 2P2SA 4GMFA 1J5PA 2D2IA 3L6OO 2PKRA 5EIOA 1NX6A 1E7MA 1DAPA 3EP3B 5EESA 4HKTA 3E9MA 1IHXA 1I7MB 2VYVA 1A7KA 3PZBA 5TVOB 3WGQA 5JW6A 2CVOA 1EBFA 1DPGA 1H2HA 1H9BA 3DMTC 1ARZA 3RC1A 1NVMB 1RYEA 3MTJA 4ZHSA 4O8JA 3ZCXA 4BOYA 3OA2A 1UYJA 3CEAA 4MVJM 2PKQO 2X5JO 1VKNA 3GFGA 4R3WA 3ABIA 3PYMA 4GMGA 3KGDA 1I7CB 2I3AA 2DC1A 5A04A 3DZ4B 5KVSA 3RC2A 2HO5A 4MVJF 2IXAA 2G82A 5EERA 1I7BB 3MZ0A 4MVJE 3KSZO 4XQEA 3FD8A 4XR4A 1DC6A 3TUTA 4DPMA 3C1AA 1T4DA 3E6AA 4F3YA 1E77A 1P1IA 2B4TO 1NPTO 1DIHA 1LC0A 1MB4A 2VYVD 2X0NA 1TA4A 5J9GA 3IDSA 4PG4A 3RC7A 4MVJA 3QVWA 4NHEA 5GZ6A 3PWSA 3PWKA 3QVXA 4CLQA 3H0VB 1TVEA 1NWCA 1GADO 2GZ2A 3IJPA 2CZCA 4PLPA 1JKFA 4XQCA 3LC7O 3LVFO 3OHSX 3RBVA 2YYYA 3U3XA 4XRGA 1CRWG 4R5HA 4DPLA 4QX6A 4R51A 3PYXA 4XQ9A 1P1FA 4L8VA 1ML3A 4O59O 4ZICA 1OBFO 4GQAA 2X5KO 4YWJA 3QW2A 1VKOA 3H0WB 1P1JA 1H6CA 4FB5A 3STHA 2IXBA 1YDWA 3CPSA 5T73A 4MIEA 3PQVA 2G17A 1K3TA 1PS8A 3L0DA 1H6DA 4AK1A 4LSMA 1GPDG 1GR0A 3RC9A 4RL6A 4PG5A 4DPKA 1QXSA 1DRWA
chains in the Genus database with same CATH topology
3EP8A 3EP3A 3DZ7A 1I79A 1JL0A 1I7BB 3DZ5B 1TMIA 3EP5A 3DZ5A 1I7BA 3DZ6B 1MSVA 1MHMB 3H0WA 1I72B 3EP3B 3DZ6A 3EPBA 3EP6B 1I72A 1MHMA 1I7MA 3EPAB 3DZ3B 3EP7A 1I7MB 1I79B 3DZ7B 3DZ4A 5TVOB 1I7CB 1JENB 1JENA 3H0WB 3DZ2B 1I7CA 3EP9A 3H0VA 3DZ4B 3EP4B 3EP5B 5TVOA 3EP4A 2IIIA 3EP7B 3EP9B 3DZ3A 1TLUA 3DZ2A 3EPAA 3H0VB 1VR7A 3EP6A 3EPBB 3EP8B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1I7B B;  3DZ5 B;  3DZ6 B;  1MHM B;  1I72 B;  3EP3 B;  3EP6 B;  3EPA B;  3DZ3 B;  1I7M B;  1I79 B;  3DZ7 B;  5TVO B;  1I7C B;  1JEN B;  3H0W B;  3DZ2 B;  3DZ4 B;  3EP4 B;  3EP5 B;  3EP7 B;  3EP9 B;  3H0V B;  3EPB B;  3EP8 B; 
#chains in the Genus database with same CATH topology
 3QVT A;  2O48 X;  1EBU A;  2DBV O;  3WYB A;  3KUX A;  2YV3 A;  3RVD A;  4K9D A;  4GPD 1;  3H9E O;  1NBO A;  4MIY A;  4O89 A;  1EVJ A;  1J0X O;  1H94 A;  3NT4 A;  4MIN A;  4INA A;  1FF9 A;  5A02 A;  2FPN A;  3BIO A;  3EP5 B;  3EP4 B;  5GZ1 A;  3E82 A;  3EP7 B;  3EPB B;  1TB4 A;  1QKI A;  3VAZ A;  3B1K A;  4TVB A;  1YL6 A;  4MKZ A;  4MIO A;  4O63 O;  3TZ6 A;  4JN6 B;  1Q2X A;  1GL3 A;  2GLX A;  3MOI A;  3WB9 A;  1I72 B;  2EP5 A;  2BHL A;  3DBV O;  4XB1 A;  1DC3 A;  3OA0 A;  4LRT B;  3V5N A;  1QMI A;  3ZDF A;  1HDG O;  3HQ4 O;  3Q2I A;  1QMH A;  3E5R A;  1VM6 A;  2Q4E A;  1NQA O;  4EW6 A;  4MKX A;  5M6D A;  4R5M A;  3I23 A;  5JYA A;  1XYG A;  1MHM B;  3OQB A;  5JYE A;  4YDR A;  3QV1 A;  1DRV A;  1H93 A;  3NTO A;  4LRS B;  1YL7 A;  3PZR A;  2AXQ A;  4XB2 A;  3WGZ A;  3BTV A;  1PQP A;  5DDI P;  3GPD G;  2NVW A;  3ZJX A;  1LA2 A;  3DAP A;  5JYF A;  1LC3 A;  3DR3 A;  3EC7 A;  5C7O O;  1DC4 A;  3DZ5 B;  3IP3 A;  1CF2 O;  5BNT A;  1P1K A;  3HNP A;  3F4L A;  3HSK A;  3B1J A;  3DOC A;  1NQ5 A;  3EZY A;  1U8F O;  3WBB A;  5KVQ A;  4R41 A;  2VYN D;  4R54 A;  1YWG O;  3WGY A;  3EP8 B;  4WNI A;  1GCU A;  1DC5 A;  3CMC O;  1B7G O;  1S7C A;  3EUW A;  2GZ1 A;  4R3N A;  2BH9 A;  3UUW A;  3NTQ A;  4IQ0 A;  1I33 A;  3C8M A;  2GZ3 A;  4LGV A;  2QZ9 A;  4PG7 A;  1BRM A;  1JN0 A;  1NQO A;  2HJS A;  1E7Y A;  4N54 A;  1PQU A;  1U1I A;  1YS4 A;  3DMT A;  2B4R O;  3E18 A;  3UW3 A;  4PG8 A;  3DB2 A;  2HKI A;  5C7I O;  5EIN A;  4MVJ G;  4WNC A;  3NT2 A;  5GZ3 A;  2DPG A;  4MVJ H;  1ZNQ O;  4XQG A;  2Q49 A;  1TLT A;  3QVS A;  4R4J A;  1VSU A;  3Q1L A;  2Q22 A;  2H63 A;  1RYD A;  2GYY A;  3Q11 A;  4MVJ I;  3V2U A;  3JSA A;  1ZH8 A;  2R00 C;  4MVJ P;  1PR3 A;  3DZ6 B;  3WBF A;  3QY9 A;  3LC1 O;  3VOS A;  4WOJ A;  3DZ3 B;  3TV1 A;  3HJA A;  1JEN B;  1E5L A;  2XF8 A;  3E1K A;  4HAD A;  2DUU A;  3WYC A;  3RCB A;  1H6A A;  2R00 A;  4MVJ D;  3DTY A;  3NTR A;  3LC2 O;  1P9L A;  2OZP A;  3BTU A;  1P1H A;  3EPA B;  1NWH A;  2EJW A;  1JKI A;  1YL5 A;  1OZA A;  3KV3 O;  1H9A A;  4PG6 A;  3DZ2 B;  4H3V A;  5CEF A;  3BTS A;  4MJL A;  1C3V A;  1OFG A;  5AVO A;  2EP7 A;  1F06 A;  1VC2 A;  5A05 A;  1VSV A;  2I3G A;  2PKQ P;  3K9Q O;  3PFW O;  1H6B A;  3IWB B;  2VYN A;  1DSS G;  3B20 A;  1I32 A;  2O4U X;  1RM5 A;  3CIN A;  3DO5 A;  3DZ7 B;  3Q0E A;  4DIB A;  3TUX A;  1RM4 A;  1MC4 A;  1Q7G A;  3L4S O;  1CER A;  3WGO A;  2NQT A;  3IWD B;  1RM0 A;  1GAE O;  3EP9 B;  4DBV O;  3GNQ A;  5A06 A;  3K73 O;  4KOA A;  3EVN A;  3GDO A;  2DAP A;  5JY6 A;  3EP6 B;  2PH5 A;  2GD1 O;  1RM3 A;  1GYQ A;  1PU2 A;  3HXL A;  4P8R A;  1DBV O;  3CIF A;  3M2T A;  3KSD O;  5AQ1 A;  1T4B A;  5C7L O;  3PYL A;  2POQ X;  4L9R A;  1IHY A;  3Q2K A;  1SZJ G;  4Z0H O;  5A03 A;  3K2B A;  3V1Y A;  1GD1 O;  3O9Z A;  3ING A;  1DRU A;  3TW3 A;  3FHL A;  1GYP A;  3IWC B;  1E5Q A;  1I79 B;  4II7 A;  2I5P O;  4IQ8 A;  3NT5 A;  1XEA A;  2P2S A;  4GMF A;  1J5P A;  2D2I A;  3L6O O;  2PKR A;  5EIO A;  1NX6 A;  1E7M A;  1DAP A;  3EP3 B;  5EES A;  4HKT A;  3E9M A;  1IHX A;  1I7M B;  2VYV A;  1A7K A;  3PZB A;  5TVO B;  3WGQ A;  5JW6 A;  2CVO A;  1EBF A;  1DPG A;  1H2H A;  1H9B A;  3DMT C;  1ARZ A;  3RC1 A;  1NVM B;  1RYE A;  3MTJ A;  4ZHS A;  4O8J A;  3ZCX A;  4BOY A;  3OA2 A;  1UYJ A;  3CEA A;  4MVJ M;  2PKQ O;  2X5J O;  1VKN A;  3GFG A;  4R3W A;  3ABI A;  3PYM A;  4GMG A;  3KGD A;  1I7C B;  2I3A A;  2DC1 A;  5A04 A;  3DZ4 B;  5KVS A;  3RC2 A;  2HO5 A;  4MVJ F;  2IXA A;  2G82 A;  5EER A;  1I7B B;  3MZ0 A;  4MVJ E;  3KSZ O;  4XQE A;  3FD8 A;  4XR4 A;  1DC6 A;  3TUT A;  4DPM A;  3C1A A;  1T4D A;  3E6A A;  4F3Y A;  1E77 A;  1P1I A;  2B4T O;  1NPT O;  1DIH A;  1LC0 A;  1MB4 A;  2VYV D;  2X0N A;  1TA4 A;  5J9G A;  3IDS A;  4PG4 A;  3RC7 A;  4MVJ A;  3QVW A;  4NHE A;  5GZ6 A;  3PWS A;  3PWK A;  3QVX A;  4CLQ A;  3H0V B;  1TVE A;  1NWC A;  1GAD O;  2GZ2 A;  3IJP A;  2CZC A;  4PLP A;  1JKF A;  4XQC A;  3LC7 O;  3LVF O;  3OHS X;  3RBV A;  2YYY A;  3U3X A;  4XRG A;  1CRW G;  4R5H A;  4DPL A;  4QX6 A;  4R51 A;  3PYX A;  4XQ9 A;  1P1F A;  4L8V A;  1ML3 A;  4O59 O;  4ZIC A;  1OBF O;  4GQA A;  2X5K O;  4YWJ A;  3QW2 A;  1VKO A;  3H0W B;  1P1J A;  1H6C A;  4FB5 A;  3STH A;  2IXB A;  1YDW A;  3CPS A;  5T73 A;  4MIE A;  3PQV A;  2G17 A;  1K3T A;  1PS8 A;  3L0D A;  1H6D A;  4AK1 A;  4LSM A;  1GPD G;  1GR0 A;  3RC9 A;  4RL6 A;  4PG5 A;  4DPK A;  1QXS A;  1DRW A; 
#chains in the Genus database with same CATH homology
 3EP8 A;  3EP3 A;  3DZ7 A;  1I79 A;  1JL0 A;  1I7B B;  3DZ5 B;  1TMI A;  3EP5 A;  3DZ5 A;  1I7B A;  3DZ6 B;  1MSV A;  1MHM B;  3H0W A;  1I72 B;  3EP3 B;  3DZ6 A;  3EPB A;  3EP6 B;  1I72 A;  1MHM A;  1I7M A;  3EPA B;  3DZ3 B;  3EP7 A;  1I7M B;  1I79 B;  3DZ7 B;  3DZ4 A;  5TVO B;  1I7C B;  1JEN B;  1JEN A;  3H0W B;  3DZ2 B;  1I7C A;  3EP9 A;  3H0V A;  3DZ4 B;  3EP4 B;  3EP5 B;  5TVO A;  3EP4 A;  2III A;  3EP7 B;  3EP9 B;  3DZ3 A;  1TLU A;  3DZ2 A;  3EPA A;  3H0V B;  1VR7 A;  3EP6 A;  3EPB B;  3EP8 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...