1I73A

Complex of pro-leu-l-trp phosphonate with the catalitic domain of matrix metallo proteinase-8 (met80 form)
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
163
structure length
163
Chain Sequence
MLTPGNPKWERTNLTYRIRNYTPQLSEAEVERAIKDAFELWSVASPLIFTRISQGEADINIAFYQRDHGDNSPFDGPNGILAHAFQPGQGIGGDAHFDAEETWTNTSANYNLFLVAAHEFGHSLGLAHSSDPGALMYPNYAFRETSNYSLPQDDIDGIQAIYG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Two crystal structures of human neutrophil collagenase, one complexed with a primed- and the other with an unprimed-side inhibitor: implications for drug design.
pubmed doi rcsb
molecule keywords NEUTROPHIL COLLAGENASE
molecule tags Hydrolase/hydrolase inhibitor
source organism Homo sapiens
total genus 50
structure length 163
sequence length 163
ec nomenclature ec 3.4.24.34: Neutrophil collagenase.
pdb deposition date 2001-03-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00413 Peptidase_M10 Matrixin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.390.10 Alpha Beta 3-Layer(aba) Sandwich Collagenase (Catalytic Domain) Collagenase (Catalytic Domain) 1i73A00
1OO9A 3AIGA 3HB2P 4R3VA 4GR0A 2MZIA 1JANA 5D1UA 3U1RA 1QJJA 2USNA 3KRYA 2CKIA 1CAQA 3LUNA 1ZVXA 456CA 4WKIA 3RTSA 3K7LA 1G9KA 1QICA 1AYKA 4PKWA 1SATA 1Y93A 1D5JA 1JAOA 2L0RA 3K7NA 1JAPA 2FV5A 5B5PA 4HX3A 3F15A 1GE6A 1CGEA 2RJPA 3HDBA 830CA 1ZXVA 2QPJA 1YOUA 2PJTA 1S4BP 1OS9A 5L7FA 4ZR5A 1JK3A 1O0QA 2A8HA 3TS4A 4AYKA 5L79A 4PKRA 3OHLA 1MMPA 1H71P 2JNPA 1AKLA 1A85A 2X3BA 1BIWA 2Z2DA 2MZEA 2OXZA 3HDAP 4A3WA 1XFWA 1BKCI 1JKYA 2X3AA 3HYGA 3LIRA 2JSDA 1R1IA 1GKCA 3HY9A 1Y8JA 3KMEA 4PKTA 1OM6A 4H2EA 5I12A 1K7IA 4L63A 1G4KA 3F19A 4I03A 3LK8A 5CZMA 1EAKA 3DL1A 3LEAA 3B8ZA 4WF6A 2OVZA 1ZXCA 1MMBA 2OW9A 4H82A 4FU4A 4AXQA 2POJA 1G49A 1YQYA 1BSWA 1HV5A 1Z3JA 3N2VA 3EDGA 3B92A 4I35A 1XUCA 1SRPA 2I47A 1PWQA 3ELMA 2W15A 1DMTA 3ZXHA 2O36A 2YIGA 1KAPP 4GF1A 2OY4A 2WOAA 4WZVA 3SHIA 1R55A 3LKAA 2K2GA 2ERQA 2K9CA 1I1IP 4JQGA 4PKVA 2JT5A 1Y0VA 2DW2A 1IAGA 4L19A 1ATLA 4XM6A 4HMAA 1K7GA 4DD8A 1SLMA 4H49A 4PKSA 2OW1A 3TT4A 3EDZA 1C7KA 2V4BA 3G42A 4EFSA 3LILA 3LQBA 2KRJA 1R1HA 3TSKA 5I2ZA 3F17A 3LJGA 2X7MA 3Q2HA 1BKCA 2X3CA 1B8YA 1PWUA 4DPEA 3ZVSA 5I4OA 2Y6DA 4GUYA 4JIJA 1XURA 3DSLA 3HBUP 1KUFA 1R54A 1B3DA 1OS2A 3F16A 1XFYA 2D1OA 1L6JA 1HFSA 1FM1A 2ERPA 3P1VA 5BOYA 1GKDA 1EUBA 1KUKA 1MNCA 1ROSA 4H30A 1XUDA 1G12A 2Y6CA 1BZSA 1UTTA 3DPFA 4IUWA 1FLSA 4QKZA 2D1NA 1HFCA 3DNGA 3E8RA 2W13A 1IAEA 3HBVP 5H8XA 1O0TA 1UEAA 2YB9A 5D7WA 1WNIA 1BQOA 1JIZA 1GO7P 4XBHA 2RJQA 1UMTA 1RMZA 5LABA 3N2UA 1SLNA 3EDIA 5CXAA 2W12A 4DF9A 5I0LA 1IACA 4L6TA 2WO9A 2W0DA 1KBCA 2WO8A 2DW1A 1YCMA 1D7XA 1CK7A 3LJTA 1MMRA 1CIZA 1GE7A 4JPAA 1GXDA 3ZUKA 4XCTA 1KUGA 3P24A 3DWBA 1PWWA 3G5CA 3RTTA 4H76A 1JJ9A 3EWJA 1JIWP 3LUMA 1KUHA 2OW0A 2MLRA 1C3IA 3AYUA 1C8TA 1CQRA 4JA1A 2HU6A 5B5OA 2EROA 1XFVA 2N8RA 1IADA 3VTGA 1I73A 1SU3A 2TCLA 3NX7A 4XM8A 1ND1A 3MA2A 4FVLA 2OVXA 3F1AA 5D3CA 2MZHA 1CGLA 4J4MA 1JAQA 2OXUA 3KECA 1PWVA 1AF0A 1Q3AA 2DDYA 3I7GA 3L0TA 1SMPA 3L0VA 3USNA 2DDFA 1BKCE 4H84A 3KMCA 3DPEA 1KUIA 1OM7A 3KEJA 3LGPA 5BOTA 2JT6A 4PKQA 3EHYA 1G05A 4AUOA 1MMQA 3I7IA 4FXQA 2OXWA 3GBOA 4JP4A 1ASTA 2SRTA 1BM6A 1J7NA 1QJIA 2E3XA 1ZTQA 2DW0A 3Q2GA 1DTHA 3LQ0A 2AYKA 3WV2A 1OM8A 4G9LA 1YP1A 1FBLA 1R1JA 4GWNA 1HOVA 4GR8A 4Q1LA 4XM7A 4A7BA 3O2XA 2OZRA 4PKUA 5D1SA 3O64A 1XFUA 3CKIA 3VI1A 2J0TA 1A86A 1GE5A 1IAAA 1BUDA 2OY2A 4GQLA 5I43A 4GWMA 5D1TA 3WV3A 2OI0A 3EHXA 5CUHA 1EB6A 5D2BA 1I76A 2E2DA 1UTZA 1USNA 4IJOA 1K7QA 3LMCA 1ZP5A 2FV9A 4GR3A 3LE9A 4ON1A 3B2ZA 3KWVC 4CTHA 3BA0A 1RM8A 4H1QA 3AYKA 5I3MA 3EDHA 1PWPA 2CLTA 3KHIA 1D8FA 1UMSA 3HY7A 2J83A 3OHOA 1IABA 2JIHA 3LIKA 3F18A 2MLSA 1XFZA 4AIGA 3LJZA 4ILWD 3WV1A 1HTDA 1HY7A 1ZS0A 966CA 4G0DA 2XS4A 1CGFA 1QIBA 1XFXA 4H3XA 3UVCA 2OW2A 5BPAA 1GO8P 3TVCA 1JH1A 1BQQM 2W14A 4WKEA 3KEKA 1CXVA 1D8MA 4FXYP 4WK7A 2AIGP 1QIAA 4DV8A 4IN9A 2O3EA 2XS3A 1OMJA 3V96B 1BUVM 1QUAA 5JMYA
chains in the Genus database with same CATH superfamily
1OO9A 3AIGA 3HB2P 4R3VA 4GR0A 2MZIA 1JANA 5D1UA 3U1RA 1QJJA 2USNA 3KRYA 2CKIA 1CAQA 3LUNA 1ZVXA 456CA 4WKIA 3RTSA 3K7LA 1G9KA 1QICA 1AYKA 4PKWA 1SATA 1Y93A 1D5JA 1JAOA 2L0RA 3K7NA 1JAPA 2FV5A 5B5PA 4HX3A 3F15A 1GE6A 1CGEA 2RJPA 3HDBA 830CA 1ZXVA 2QPJA 1YOUA 2PJTA 1S4BP 3DTKA 1OS9A 5L7FA 4ZR5A 1JK3A 1O0QA 2A8HA 3TS4A 1TVIA 4AYKA 5L79A 4PKRA 3OHLA 1MMPA 1H71P 2JNPA 1AKLA 1A85A 2X3BA 1BIWA 2Z2DA 2MZEA 2OXZA 3HDAP 4A3WA 1XFWA 1BKCI 1JKYA 2X3AA 3HYGA 3LIRA 1XM5A 2YUFA 2JSDA 1R1IA 1GKCA 3HY9A 1Y8JA 3KMEA 4PKTA 1OM6A 4H2EA 5I12A 1K7IA 4L63A 1G4KA 3F19A 4I03A 3LK8A 5CZMA 1EAKA 3DL1A 3LEAA 3B8ZA 4WF6A 2OVZA 1ZXCA 1MMBA 2OW9A 4H82A 4FU4A 4AXQA 2POJA 1G49A 1YQYA 1BSWA 1HV5A 1Z3JA 3N2VA 3EDGA 3B92A 4I35A 1XUCA 1SRPA 2I47A 1PWQA 3ELMA 2W15A 1DMTA 3ZXHA 2O36A 2YIGA 1KAPP 4GF1A 2OY4A 2WOAA 4WZVA 3SHIA 1R55A 3LKAA 2K2GA 2ERQA 2K9CA 1I1IP 4JQGA 4PKVA 2JT5A 1Y0VA 2DW2A 1IAGA 4L19A 1ATLA 4XM6A 4HMAA 1K7GA 4DD8A 1SLMA 4H49A 4PKSA 2OW1A 3TT4A 3EDZA 1C7KA 2V4BA 3G42A 4EFSA 3LILA 3LQBA 2KRJA 1R1HA 3TSKA 5I2ZA 3F17A 3LJGA 2X7MA 3Q2HA 1BKCA 2X3CA 1B8YA 1PWUA 4DPEA 3ZVSA 5I4OA 2Y6DA 4GUYA 4JIJA 1XURA 3DSLA 3HBUP 1KUFA 1R54A 1B3DA 1OS2A 3F16A 1XFYA 2D1OA 1L6JA 1HFSA 1FM1A 2ERPA 3P1VA 5BOYA 1GKDA 1EUBA 1KUKA 1MNCA 1ROSA 4H30A 1XUDA 1G12A 2Y6CA 1BZSA 1UTTA 3DPFA 4IUWA 1FLSA 4QKZA 2D1NA 1HFCA 3DNGA 3E8RA 2W13A 1IAEA 3HBVP 5H8XA 1O0TA 1UEAA 2YB9A 5D7WA 1WNIA 1BQOA 1JIZA 1GO7P 4XBHA 2RJQA 3DTIA 1UMTA 1RMZA 5LABA 3N2UA 1SLNA 3EDIA 5CXAA 2W12A 4DF9A 5I0LA 1IACA 4L6TA 2WO9A 2W0DA 1KBCA 2WO8A 2DW1A 1YCMA 1D7XA 1CK7A 3LJTA 1MMRA 1XAXA 1CIZA 1GE7A 4JPAA 1GXDA 3ZUKA 4XCTA 1KUGA 3P24A 3DWBA 1PWWA 3G5CA 3RTTA 4H76A 1JJ9A 3EWJA 1JIWP 3LUMA 1KUHA 2OW0A 2MLRA 1C3IA 3AYUA 1C8TA 1CQRA 4JA1A 2HU6A 5B5OA 2EROA 1XFVA 2N8RA 1IADA 3VTGA 1I73A 1SU3A 2TCLA 3NX7A 4XM8A 1ND1A 3MA2A 4FVLA 2OVXA 3F1AA 5D3CA 2MZHA 1CGLA 4J4MA 1JAQA 2OXUA 3KECA 1PWVA 1AF0A 1Q3AA 2DDYA 3I7GA 3L0TA 1SMPA 3L0VA 3USNA 2DDFA 1BKCE 4H84A 3KMCA 3DPEA 1KUIA 1OM7A 3KEJA 3LGPA 5BOTA 2JT6A 4PKQA 3EHYA 1G05A 4AUOA 1MMQA 3I7IA 4FXQA 2OXWA 3GBOA 4JP4A 1ASTA 2SRTA 1BM6A 1J7NA 1QJIA 2E3XA 1ZTQA 2DW0A 3Q2GA 1DTHA 3LQ0A 2AYKA 3WV2A 1OM8A 4G9LA 1YP1A 1FBLA 1R1JA 4GWNA 1HOVA 4GR8A 4Q1LA 4XM7A 4A7BA 3O2XA 2OZRA 4PKUA 5D1SA 3O64A 1XFUA 3CKIA 3VI1A 2J0TA 1A86A 1GE5A 1IAAA 1BUDA 2OY2A 4GQLA 5I43A 4GWMA 5D1TA 3WV3A 2OI0A 3EHXA 5CUHA 1OZ9A 1EB6A 5D2BA 1I76A 2E2DA 1UTZA 1USNA 4IJOA 1K7QA 3LMCA 1ZP5A 2FV9A 4GR3A 3LE9A 4ON1A 3B2ZA 3KWVC 4CTHA 3BA0A 1RM8A 4H1QA 3AYKA 5I3MA 3EDHA 1PWPA 2CLTA 3KHIA 1D8FA 1UMSA 3HY7A 2J83A 3OHOA 1IABA 2JIHA 3LIKA 3F18A 2MLSA 1XFZA 4AIGA 3LJZA 4ILWD 3WV1A 1HTDA 1HY7A 1ZS0A 966CA 4G0DA 2XS4A 1CGFA 1QIBA 1XFXA 4H3XA 3UVCA 2OW2A 5BPAA 1GO8P 3TVCA 1JH1A 1BQQM 2W14A 4WKEA 3KEKA 1CXVA 1D8MA 3DTEA 4L7AA 4FXYP 4WK7A 2AIGP 1QIAA 4DV8A 4IN9A 2O3EA 2XS3A 1OMJA 3V96B 1BUVM 1QUAA 5JMYA
chains in the Genus database with same CATH topology
1OO9A 3AIGA 3HB2P 4R3VA 4GR0A 2MZIA 1JANA 5D1UA 3U1RA 1QJJA 2USNA 3KRYA 2CKIA 1CAQA 3LUNA 1ZVXA 456CA 4WKIA 3RTSA 3K7LA 1G9KA 1QICA 1AYKA 4PKWA 1SATA 1Y93A 1D5JA 1JAOA 2L0RA 3K7NA 1JAPA 2FV5A 5B5PA 4HX3A 3F15A 1GE6A 1CGEA 2RJPA 3HDBA 830CA 1ZXVA 2QPJA 1YOUA 2PJTA 1S4BP 3DTKA 1OS9A 5L7FA 4ZR5A 1JK3A 1O0QA 2A8HA 3TS4A 4AYKA 5L79A 4PKRA 3OHLA 1MMPA 1H71P 2JNPA 1AKLA 1A85A 2X3BA 1BIWA 2Z2DA 2MZEA 2OXZA 3HDAP 4A3WA 1XFWA 1BKCI 1JKYA 2X3AA 3HYGA 3LIRA 2YUFA 2JSDA 1R1IA 1GKCA 3HY9A 1Y8JA 3KMEA 4PKTA 1OM6A 4H2EA 5I12A 1K7IA 4L63A 1G4KA 3F19A 4I03A 3LK8A 5CZMA 1EAKA 3DL1A 3LEAA 3B8ZA 4WF6A 2OVZA 1ZXCA 1MMBA 2OW9A 4H82A 4FU4A 4AXQA 2POJA 1G49A 1YQYA 1BSWA 1HV5A 1Z3JA 3N2VA 3EDGA 3B92A 4I35A 1XUCA 1SRPA 2I47A 1PWQA 3ELMA 2W15A 1DMTA 3ZXHA 2O36A 2YIGA 1KAPP 4GF1A 2OY4A 2WOAA 4WZVA 3SHIA 1R55A 3LKAA 2K2GA 2ERQA 2K9CA 1I1IP 4JQGA 4PKVA 2JT5A 1Y0VA 2DW2A 1IAGA 4L19A 1ATLA 4XM6A 4HMAA 1K7GA 4DD8A 1SLMA 4H49A 4PKSA 2OW1A 3TT4A 3EDZA 1C7KA 2V4BA 3G42A 4EFSA 3LILA 3LQBA 2KRJA 1R1HA 3TSKA 5I2ZA 3F17A 3LJGA 2X7MA 3Q2HA 1BKCA 2X3CA 1B8YA 1PWUA 4DPEA 3ZVSA 5I4OA 2Y6DA 4GUYA 4JIJA 1XURA 3DSLA 3HBUP 1KUFA 1R54A 1B3DA 1OS2A 3F16A 1XFYA 2D1OA 1L6JA 1HFSA 1FM1A 2ERPA 3P1VA 5BOYA 1GKDA 1EUBA 1KUKA 1MNCA 1ROSA 4H30A 1XUDA 1G12A 2Y6CA 1BZSA 1UTTA 3DPFA 4IUWA 1FLSA 4QKZA 2D1NA 1HFCA 3DNGA 3E8RA 2W13A 1IAEA 3HBVP 5H8XA 1O0TA 1UEAA 2YB9A 5D7WA 1WNIA 1BQOA 1JIZA 1GO7P 4XBHA 2RJQA 3DTIA 1UMTA 1RMZA 5LABA 3N2UA 1SLNA 3EDIA 5CXAA 2W12A 4DF9A 5I0LA 1IACA 4L6TA 2WO9A 2W0DA 1KBCA 2WO8A 2DW1A 1YCMA 1D7XA 1CK7A 3LJTA 1MMRA 1CIZA 1GE7A 4JPAA 1GXDA 3ZUKA 4XCTA 1KUGA 3P24A 3DWBA 1PWWA 3G5CA 3RTTA 4H76A 1JJ9A 3EWJA 1JIWP 3LUMA 1KUHA 2OW0A 2MLRA 1C3IA 3AYUA 1C8TA 1CQRA 4JA1A 2HU6A 5B5OA 2EROA 1XFVA 2N8RA 1IADA 3VTGA 1I73A 1SU3A 2TCLA 3NX7A 4XM8A 1ND1A 3MA2A 4FVLA 2OVXA 3F1AA 5D3CA 2MZHA 1CGLA 4J4MA 1JAQA 2OXUA 3KECA 1PWVA 1AF0A 1Q3AA 2DDYA 3I7GA 3L0TA 1SMPA 3L0VA 3USNA 2DDFA 1BKCE 4H84A 3KMCA 3DPEA 1KUIA 1OM7A 3KEJA 3LGPA 5BOTA 2JT6A 4PKQA 3EHYA 1G05A 4AUOA 1MMQA 3I7IA 4FXQA 2OXWA 3GBOA 4JP4A 1ASTA 2SRTA 1BM6A 1J7NA 1QJIA 2E3XA 1ZTQA 2DW0A 3Q2GA 1DTHA 3LQ0A 2AYKA 3WV2A 1OM8A 4G9LA 1YP1A 1FBLA 1R1JA 4GWNA 1HOVA 4GR8A 4Q1LA 4XM7A 4A7BA 3O2XA 2OZRA 4PKUA 5D1SA 3O64A 1XFUA 3CKIA 3VI1A 2J0TA 1A86A 1GE5A 1IAAA 1BUDA 2OY2A 4GQLA 5I43A 4GWMA 5D1TA 3WV3A 2OI0A 3EHXA 5CUHA 1EB6A 5D2BA 1I76A 2E2DA 1UTZA 1USNA 4IJOA 1K7QA 3LMCA 1ZP5A 2FV9A 4GR3A 3LE9A 4ON1A 3B2ZA 3KWVC 4CTHA 3BA0A 1RM8A 4H1QA 3AYKA 5I3MA 3EDHA 1PWPA 2CLTA 3KHIA 1D8FA 1UMSA 3HY7A 2J83A 3OHOA 1IABA 2JIHA 3LIKA 3F18A 2MLSA 1XFZA 4AIGA 3LJZA 4ILWD 3WV1A 1HTDA 1HY7A 1ZS0A 966CA 4G0DA 2XS4A 1CGFA 1QIBA 1XFXA 4H3XA 3UVCA 2OW2A 5BPAA 1GO8P 3TVCA 1JH1A 1BQQM 2W14A 4WKEA 3KEKA 1CXVA 1D8MA 3DTEA 4L7AA 4FXYP 4WK7A 2AIGP 1QIAA 4DV8A 4IN9A 2O3EA 2XS3A 1OMJA 3V96B 1BUVM 1QUAA 5JMYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1OO9 A;  3AIG A;  3HB2 P;  4R3V A;  4GR0 A;  2MZI A;  1JAN A;  5D1U A;  3U1R A;  1QJJ A;  2USN A;  3KRY A;  2CKI A;  1CAQ A;  3LUN A;  1ZVX A;  456C A;  4WKI A;  3RTS A;  3K7L A;  1G9K A;  1QIC A;  1AYK A;  4PKW A;  1SAT A;  1Y93 A;  1D5J A;  1JAO A;  2L0R A;  3K7N A;  1JAP A;  2FV5 A;  5B5P A;  4HX3 A;  3F15 A;  1GE6 A;  1CGE A;  2RJP A;  3HDB A;  830C A;  1ZXV A;  2QPJ A;  1YOU A;  2PJT A;  1S4B P;  1OS9 A;  5L7F A;  4ZR5 A;  1JK3 A;  1O0Q A;  2A8H A;  3TS4 A;  4AYK A;  5L79 A;  4PKR A;  3OHL A;  1MMP A;  1H71 P;  2JNP A;  1AKL A;  1A85 A;  2X3B A;  1BIW A;  2Z2D A;  2MZE A;  2OXZ A;  3HDA P;  4A3W A;  1XFW A;  1BKC I;  1JKY A;  2X3A A;  3HYG A;  3LIR A;  2JSD A;  1R1I A;  1GKC A;  3HY9 A;  1Y8J A;  3KME A;  4PKT A;  1OM6 A;  4H2E A;  5I12 A;  1K7I A;  4L63 A;  1G4K A;  3F19 A;  4I03 A;  3LK8 A;  5CZM A;  1EAK A;  3DL1 A;  3LEA A;  3B8Z A;  4WF6 A;  2OVZ A;  1ZXC A;  1MMB A;  2OW9 A;  4H82 A;  4FU4 A;  4AXQ A;  2POJ A;  1G49 A;  1YQY A;  1BSW A;  1HV5 A;  1Z3J A;  3N2V A;  3EDG A;  3B92 A;  4I35 A;  1XUC A;  1SRP A;  2I47 A;  1PWQ A;  3ELM A;  2W15 A;  1DMT A;  3ZXH A;  2O36 A;  2YIG A;  1KAP P;  4GF1 A;  2OY4 A;  2WOA A;  4WZV A;  3SHI A;  1R55 A;  3LKA A;  2K2G A;  2ERQ A;  2K9C A;  1I1I P;  4JQG A;  4PKV A;  2JT5 A;  1Y0V A;  2DW2 A;  1IAG A;  4L19 A;  1ATL A;  4XM6 A;  4HMA A;  1K7G A;  4DD8 A;  1SLM A;  4H49 A;  4PKS A;  2OW1 A;  3TT4 A;  3EDZ A;  1C7K A;  2V4B A;  3G42 A;  4EFS A;  3LIL A;  3LQB A;  2KRJ A;  1R1H A;  3TSK A;  5I2Z A;  3F17 A;  3LJG A;  2X7M A;  3Q2H A;  1BKC A;  2X3C A;  1B8Y A;  1PWU A;  4DPE A;  3ZVS A;  5I4O A;  2Y6D A;  4GUY A;  4JIJ A;  1XUR A;  3DSL A;  3HBU P;  1KUF A;  1R54 A;  1B3D A;  1OS2 A;  3F16 A;  1XFY A;  2D1O A;  1L6J A;  1HFS A;  1FM1 A;  2ERP A;  3P1V A;  5BOY A;  1GKD A;  1EUB A;  1KUK A;  1MNC A;  1ROS A;  4H30 A;  1XUD A;  1G12 A;  2Y6C A;  1BZS A;  1UTT A;  3DPF A;  4IUW A;  1FLS A;  4QKZ A;  2D1N A;  1HFC A;  3DNG A;  3E8R A;  2W13 A;  1IAE A;  3HBV P;  5H8X A;  1O0T A;  1UEA A;  2YB9 A;  5D7W A;  1WNI A;  1BQO A;  1JIZ A;  1GO7 P;  4XBH A;  2RJQ A;  1UMT A;  1RMZ A;  5LAB A;  3N2U A;  1SLN A;  3EDI A;  5CXA A;  2W12 A;  4DF9 A;  5I0L A;  1IAC A;  4L6T A;  2WO9 A;  2W0D A;  1KBC A;  2WO8 A;  2DW1 A;  1YCM A;  1D7X A;  1CK7 A;  3LJT A;  1MMR A;  1CIZ A;  1GE7 A;  4JPA A;  1GXD A;  3ZUK A;  4XCT A;  1KUG A;  3P24 A;  3DWB A;  1PWW A;  3G5C A;  3RTT A;  4H76 A;  1JJ9 A;  3EWJ A;  1JIW P;  3LUM A;  1KUH A;  2OW0 A;  2MLR A;  1C3I A;  3AYU A;  1C8T A;  1CQR A;  4JA1 A;  2HU6 A;  5B5O A;  2ERO A;  1XFV A;  2N8R A;  1IAD A;  3VTG A;  1I73 A;  1SU3 A;  2TCL A;  3NX7 A;  4XM8 A;  1ND1 A;  3MA2 A;  4FVL A;  2OVX A;  3F1A A;  5D3C A;  2MZH A;  1CGL A;  4J4M A;  1JAQ A;  2OXU A;  3KEC A;  1PWV A;  1AF0 A;  1Q3A A;  2DDY A;  3I7G A;  3L0T A;  1SMP A;  3L0V A;  3USN A;  2DDF A;  1BKC E;  4H84 A;  3KMC A;  3DPE A;  1KUI A;  1OM7 A;  3KEJ A;  3LGP A;  5BOT A;  2JT6 A;  4PKQ A;  3EHY A;  1G05 A;  4AUO A;  1MMQ A;  3I7I A;  4FXQ A;  2OXW A;  3GBO A;  4JP4 A;  1AST A;  2SRT A;  1BM6 A;  1J7N A;  1QJI A;  2E3X A;  1ZTQ A;  2DW0 A;  3Q2G A;  1DTH A;  3LQ0 A;  2AYK A;  3WV2 A;  1OM8 A;  4G9L A;  1YP1 A;  1FBL A;  1R1J A;  4GWN A;  1HOV A;  4GR8 A;  4Q1L A;  4XM7 A;  4A7B A;  3O2X A;  2OZR A;  4PKU A;  5D1S A;  3O64 A;  1XFU A;  3CKI A;  3VI1 A;  2J0T A;  1A86 A;  1GE5 A;  1IAA A;  1BUD A;  2OY2 A;  4GQL A;  5I43 A;  4GWM A;  5D1T A;  3WV3 A;  2OI0 A;  3EHX A;  5CUH A;  1EB6 A;  5D2B A;  1I76 A;  2E2D A;  1UTZ A;  1USN A;  4IJO A;  1K7Q A;  3LMC A;  1ZP5 A;  2FV9 A;  4GR3 A;  3LE9 A;  4ON1 A;  3B2Z A;  3KWV C;  4CTH A;  3BA0 A;  1RM8 A;  4H1Q A;  3AYK A;  5I3M A;  3EDH A;  1PWP A;  2CLT A;  3KHI A;  1D8F A;  1UMS A;  3HY7 A;  2J83 A;  3OHO A;  1IAB A;  2JIH A;  3LIK A;  3F18 A;  2MLS A;  1XFZ A;  4AIG A;  3LJZ A;  4ILW D;  3WV1 A;  1HTD A;  1HY7 A;  1ZS0 A;  966C A;  4G0D A;  2XS4 A;  1CGF A;  1QIB A;  1XFX A;  4H3X A;  3UVC A;  2OW2 A;  5BPA A;  1GO8 P;  3TVC A;  1JH1 A;  1BQQ M;  2W14 A;  4WKE A;  3KEK A;  1CXV A;  1D8M A;  4FXY P;  4WK7 A;  2AIG P;  1QIA A;  4DV8 A;  4IN9 A;  2O3E A;  2XS3 A;  1OMJ A;  3V96 B;  1BUV M;  1QUA A;  5JMY A; 
#chains in the Genus database with same CATH topology
 1OO9 A;  3AIG A;  3HB2 P;  4R3V A;  4GR0 A;  2MZI A;  1JAN A;  5D1U A;  3U1R A;  1QJJ A;  2USN A;  3KRY A;  2CKI A;  1CAQ A;  3LUN A;  1ZVX A;  456C A;  4WKI A;  3RTS A;  3K7L A;  1G9K A;  1QIC A;  1AYK A;  4PKW A;  1SAT A;  1Y93 A;  1D5J A;  1JAO A;  2L0R A;  3K7N A;  1JAP A;  2FV5 A;  5B5P A;  4HX3 A;  3F15 A;  1GE6 A;  1CGE A;  2RJP A;  3HDB A;  830C A;  1ZXV A;  2QPJ A;  1YOU A;  2PJT A;  1S4B P;  3DTK A;  1OS9 A;  5L7F A;  4ZR5 A;  1JK3 A;  1O0Q A;  2A8H A;  3TS4 A;  1TVI A;  4AYK A;  5L79 A;  4PKR A;  3OHL A;  1MMP A;  1H71 P;  2JNP A;  1AKL A;  1A85 A;  2X3B A;  1BIW A;  2Z2D A;  2MZE A;  2OXZ A;  3HDA P;  4A3W A;  1XFW A;  1BKC I;  1JKY A;  2X3A A;  3HYG A;  3LIR A;  1XM5 A;  2YUF A;  2JSD A;  1R1I A;  1GKC A;  3HY9 A;  1Y8J A;  3KME A;  4PKT A;  1OM6 A;  4H2E A;  5I12 A;  1K7I A;  4L63 A;  1G4K A;  3F19 A;  4I03 A;  3LK8 A;  5CZM A;  1EAK A;  3DL1 A;  3LEA A;  3B8Z A;  4WF6 A;  2OVZ A;  1ZXC A;  1MMB A;  2OW9 A;  4H82 A;  4FU4 A;  4AXQ A;  2POJ A;  1G49 A;  1YQY A;  1BSW A;  1HV5 A;  1Z3J A;  3N2V A;  3EDG A;  3B92 A;  4I35 A;  1XUC A;  1SRP A;  2I47 A;  1PWQ A;  3ELM A;  2W15 A;  1DMT A;  3ZXH A;  2O36 A;  2YIG A;  1KAP P;  4GF1 A;  2OY4 A;  2WOA A;  4WZV A;  3SHI A;  1R55 A;  3LKA A;  2K2G A;  2ERQ A;  2K9C A;  1I1I P;  4JQG A;  4PKV A;  2JT5 A;  1Y0V A;  2DW2 A;  1IAG A;  4L19 A;  1ATL A;  4XM6 A;  4HMA A;  1K7G A;  4DD8 A;  1SLM A;  4H49 A;  4PKS A;  2OW1 A;  3TT4 A;  3EDZ A;  1C7K A;  2V4B A;  3G42 A;  4EFS A;  3LIL A;  3LQB A;  2KRJ A;  1R1H A;  3TSK A;  5I2Z A;  3F17 A;  3LJG A;  2X7M A;  3Q2H A;  1BKC A;  2X3C A;  1B8Y A;  1PWU A;  4DPE A;  3ZVS A;  5I4O A;  2Y6D A;  4GUY A;  4JIJ A;  1XUR A;  3DSL A;  3HBU P;  1KUF A;  1R54 A;  1B3D A;  1OS2 A;  3F16 A;  1XFY A;  2D1O A;  1L6J A;  1HFS A;  1FM1 A;  2ERP A;  3P1V A;  5BOY A;  1GKD A;  1EUB A;  1KUK A;  1MNC A;  1ROS A;  4H30 A;  1XUD A;  1G12 A;  2Y6C A;  1BZS A;  1UTT A;  3DPF A;  4IUW A;  1FLS A;  4QKZ A;  2D1N A;  1HFC A;  3DNG A;  3E8R A;  2W13 A;  1IAE A;  3HBV P;  5H8X A;  1O0T A;  1UEA A;  2YB9 A;  5D7W A;  1WNI A;  1BQO A;  1JIZ A;  1GO7 P;  4XBH A;  2RJQ A;  3DTI A;  1UMT A;  1RMZ A;  5LAB A;  3N2U A;  1SLN A;  3EDI A;  5CXA A;  2W12 A;  4DF9 A;  5I0L A;  1IAC A;  4L6T A;  2WO9 A;  2W0D A;  1KBC A;  2WO8 A;  2DW1 A;  1YCM A;  1D7X A;  1CK7 A;  3LJT A;  1MMR A;  1XAX A;  1CIZ A;  1GE7 A;  4JPA A;  1GXD A;  3ZUK A;  4XCT A;  1KUG A;  3P24 A;  3DWB A;  1PWW A;  3G5C A;  3RTT A;  4H76 A;  1JJ9 A;  3EWJ A;  1JIW P;  3LUM A;  1KUH A;  2OW0 A;  2MLR A;  1C3I A;  3AYU A;  1C8T A;  1CQR A;  4JA1 A;  2HU6 A;  5B5O A;  2ERO A;  1XFV A;  2N8R A;  1IAD A;  3VTG A;  1I73 A;  1SU3 A;  2TCL A;  3NX7 A;  4XM8 A;  1ND1 A;  3MA2 A;  4FVL A;  2OVX A;  3F1A A;  5D3C A;  2MZH A;  1CGL A;  4J4M A;  1JAQ A;  2OXU A;  3KEC A;  1PWV A;  1AF0 A;  1Q3A A;  2DDY A;  3I7G A;  3L0T A;  1SMP A;  3L0V A;  3USN A;  2DDF A;  1BKC E;  4H84 A;  3KMC A;  3DPE A;  1KUI A;  1OM7 A;  3KEJ A;  3LGP A;  5BOT A;  2JT6 A;  4PKQ A;  3EHY A;  1G05 A;  4AUO A;  1MMQ A;  3I7I A;  4FXQ A;  2OXW A;  3GBO A;  4JP4 A;  1AST A;  2SRT A;  1BM6 A;  1J7N A;  1QJI A;  2E3X A;  1ZTQ A;  2DW0 A;  3Q2G A;  1DTH A;  3LQ0 A;  2AYK A;  3WV2 A;  1OM8 A;  4G9L A;  1YP1 A;  1FBL A;  1R1J A;  4GWN A;  1HOV A;  4GR8 A;  4Q1L A;  4XM7 A;  4A7B A;  3O2X A;  2OZR A;  4PKU A;  5D1S A;  3O64 A;  1XFU A;  3CKI A;  3VI1 A;  2J0T A;  1A86 A;  1GE5 A;  1IAA A;  1BUD A;  2OY2 A;  4GQL A;  5I43 A;  4GWM A;  5D1T A;  3WV3 A;  2OI0 A;  3EHX A;  5CUH A;  1OZ9 A;  1EB6 A;  5D2B A;  1I76 A;  2E2D A;  1UTZ A;  1USN A;  4IJO A;  1K7Q A;  3LMC A;  1ZP5 A;  2FV9 A;  4GR3 A;  3LE9 A;  4ON1 A;  3B2Z A;  3KWV C;  4CTH A;  3BA0 A;  1RM8 A;  4H1Q A;  3AYK A;  5I3M A;  3EDH A;  1PWP A;  2CLT A;  3KHI A;  1D8F A;  1UMS A;  3HY7 A;  2J83 A;  3OHO A;  1IAB A;  2JIH A;  3LIK A;  3F18 A;  2MLS A;  1XFZ A;  4AIG A;  3LJZ A;  4ILW D;  3WV1 A;  1HTD A;  1HY7 A;  1ZS0 A;  966C A;  4G0D A;  2XS4 A;  1CGF A;  1QIB A;  1XFX A;  4H3X A;  3UVC A;  2OW2 A;  5BPA A;  1GO8 P;  3TVC A;  1JH1 A;  1BQQ M;  2W14 A;  4WKE A;  3KEK A;  1CXV A;  1D8M A;  3DTE A;  4L7A A;  4FXY P;  4WK7 A;  2AIG P;  1QIA A;  4DV8 A;  4IN9 A;  2O3E A;  2XS3 A;  1OMJ A;  3V96 B;  1BUV M;  1QUA A;  5JMY A; 
#chains in the Genus database with same CATH homology
 1OO9 A;  3AIG A;  3HB2 P;  4R3V A;  4GR0 A;  2MZI A;  1JAN A;  5D1U A;  3U1R A;  1QJJ A;  2USN A;  3KRY A;  2CKI A;  1CAQ A;  3LUN A;  1ZVX A;  456C A;  4WKI A;  3RTS A;  3K7L A;  1G9K A;  1QIC A;  1AYK A;  4PKW A;  1SAT A;  1Y93 A;  1D5J A;  1JAO A;  2L0R A;  3K7N A;  1JAP A;  2FV5 A;  5B5P A;  4HX3 A;  3F15 A;  1GE6 A;  1CGE A;  2RJP A;  3HDB A;  830C A;  1ZXV A;  2QPJ A;  1YOU A;  2PJT A;  1S4B P;  3DTK A;  1OS9 A;  5L7F A;  4ZR5 A;  1JK3 A;  1O0Q A;  2A8H A;  3TS4 A;  4AYK A;  5L79 A;  4PKR A;  3OHL A;  1MMP A;  1H71 P;  2JNP A;  1AKL A;  1A85 A;  2X3B A;  1BIW A;  2Z2D A;  2MZE A;  2OXZ A;  3HDA P;  4A3W A;  1XFW A;  1BKC I;  1JKY A;  2X3A A;  3HYG A;  3LIR A;  2YUF A;  2JSD A;  1R1I A;  1GKC A;  3HY9 A;  1Y8J A;  3KME A;  4PKT A;  1OM6 A;  4H2E A;  5I12 A;  1K7I A;  4L63 A;  1G4K A;  3F19 A;  4I03 A;  3LK8 A;  5CZM A;  1EAK A;  3DL1 A;  3LEA A;  3B8Z A;  4WF6 A;  2OVZ A;  1ZXC A;  1MMB A;  2OW9 A;  4H82 A;  4FU4 A;  4AXQ A;  2POJ A;  1G49 A;  1YQY A;  1BSW A;  1HV5 A;  1Z3J A;  3N2V A;  3EDG A;  3B92 A;  4I35 A;  1XUC A;  1SRP A;  2I47 A;  1PWQ A;  3ELM A;  2W15 A;  1DMT A;  3ZXH A;  2O36 A;  2YIG A;  1KAP P;  4GF1 A;  2OY4 A;  2WOA A;  4WZV A;  3SHI A;  1R55 A;  3LKA A;  2K2G A;  2ERQ A;  2K9C A;  1I1I P;  4JQG A;  4PKV A;  2JT5 A;  1Y0V A;  2DW2 A;  1IAG A;  4L19 A;  1ATL A;  4XM6 A;  4HMA A;  1K7G A;  4DD8 A;  1SLM A;  4H49 A;  4PKS A;  2OW1 A;  3TT4 A;  3EDZ A;  1C7K A;  2V4B A;  3G42 A;  4EFS A;  3LIL A;  3LQB A;  2KRJ A;  1R1H A;  3TSK A;  5I2Z A;  3F17 A;  3LJG A;  2X7M A;  3Q2H A;  1BKC A;  2X3C A;  1B8Y A;  1PWU A;  4DPE A;  3ZVS A;  5I4O A;  2Y6D A;  4GUY A;  4JIJ A;  1XUR A;  3DSL A;  3HBU P;  1KUF A;  1R54 A;  1B3D A;  1OS2 A;  3F16 A;  1XFY A;  2D1O A;  1L6J A;  1HFS A;  1FM1 A;  2ERP A;  3P1V A;  5BOY A;  1GKD A;  1EUB A;  1KUK A;  1MNC A;  1ROS A;  4H30 A;  1XUD A;  1G12 A;  2Y6C A;  1BZS A;  1UTT A;  3DPF A;  4IUW A;  1FLS A;  4QKZ A;  2D1N A;  1HFC A;  3DNG A;  3E8R A;  2W13 A;  1IAE A;  3HBV P;  5H8X A;  1O0T A;  1UEA A;  2YB9 A;  5D7W A;  1WNI A;  1BQO A;  1JIZ A;  1GO7 P;  4XBH A;  2RJQ A;  3DTI A;  1UMT A;  1RMZ A;  5LAB A;  3N2U A;  1SLN A;  3EDI A;  5CXA A;  2W12 A;  4DF9 A;  5I0L A;  1IAC A;  4L6T A;  2WO9 A;  2W0D A;  1KBC A;  2WO8 A;  2DW1 A;  1YCM A;  1D7X A;  1CK7 A;  3LJT A;  1MMR A;  1CIZ A;  1GE7 A;  4JPA A;  1GXD A;  3ZUK A;  4XCT A;  1KUG A;  3P24 A;  3DWB A;  1PWW A;  3G5C A;  3RTT A;  4H76 A;  1JJ9 A;  3EWJ A;  1JIW P;  3LUM A;  1KUH A;  2OW0 A;  2MLR A;  1C3I A;  3AYU A;  1C8T A;  1CQR A;  4JA1 A;  2HU6 A;  5B5O A;  2ERO A;  1XFV A;  2N8R A;  1IAD A;  3VTG A;  1I73 A;  1SU3 A;  2TCL A;  3NX7 A;  4XM8 A;  1ND1 A;  3MA2 A;  4FVL A;  2OVX A;  3F1A A;  5D3C A;  2MZH A;  1CGL A;  4J4M A;  1JAQ A;  2OXU A;  3KEC A;  1PWV A;  1AF0 A;  1Q3A A;  2DDY A;  3I7G A;  3L0T A;  1SMP A;  3L0V A;  3USN A;  2DDF A;  1BKC E;  4H84 A;  3KMC A;  3DPE A;  1KUI A;  1OM7 A;  3KEJ A;  3LGP A;  5BOT A;  2JT6 A;  4PKQ A;  3EHY A;  1G05 A;  4AUO A;  1MMQ A;  3I7I A;  4FXQ A;  2OXW A;  3GBO A;  4JP4 A;  1AST A;  2SRT A;  1BM6 A;  1J7N A;  1QJI A;  2E3X A;  1ZTQ A;  2DW0 A;  3Q2G A;  1DTH A;  3LQ0 A;  2AYK A;  3WV2 A;  1OM8 A;  4G9L A;  1YP1 A;  1FBL A;  1R1J A;  4GWN A;  1HOV A;  4GR8 A;  4Q1L A;  4XM7 A;  4A7B A;  3O2X A;  2OZR A;  4PKU A;  5D1S A;  3O64 A;  1XFU A;  3CKI A;  3VI1 A;  2J0T A;  1A86 A;  1GE5 A;  1IAA A;  1BUD A;  2OY2 A;  4GQL A;  5I43 A;  4GWM A;  5D1T A;  3WV3 A;  2OI0 A;  3EHX A;  5CUH A;  1EB6 A;  5D2B A;  1I76 A;  2E2D A;  1UTZ A;  1USN A;  4IJO A;  1K7Q A;  3LMC A;  1ZP5 A;  2FV9 A;  4GR3 A;  3LE9 A;  4ON1 A;  3B2Z A;  3KWV C;  4CTH A;  3BA0 A;  1RM8 A;  4H1Q A;  3AYK A;  5I3M A;  3EDH A;  1PWP A;  2CLT A;  3KHI A;  1D8F A;  1UMS A;  3HY7 A;  2J83 A;  3OHO A;  1IAB A;  2JIH A;  3LIK A;  3F18 A;  2MLS A;  1XFZ A;  4AIG A;  3LJZ A;  4ILW D;  3WV1 A;  1HTD A;  1HY7 A;  1ZS0 A;  966C A;  4G0D A;  2XS4 A;  1CGF A;  1QIB A;  1XFX A;  4H3X A;  3UVC A;  2OW2 A;  5BPA A;  1GO8 P;  3TVC A;  1JH1 A;  1BQQ M;  2W14 A;  4WKE A;  3KEK A;  1CXV A;  1D8M A;  3DTE A;  4L7A A;  4FXY P;  4WK7 A;  2AIG P;  1QIA A;  4DV8 A;  4IN9 A;  2O3E A;  2XS3 A;  1OMJ A;  3V96 B;  1BUV M;  1QUA A;  5JMY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...