1I73A

Complex of pro-leu-l-trp phosphonate with the catalitic domain of matrix metallo proteinase-8 (met80 form)
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
163
structure length
163
Chain Sequence
MLTPGNPKWERTNLTYRIRNYTPQLSEAEVERAIKDAFELWSVASPLIFTRISQGEADINIAFYQRDHGDNSPFDGPNGILAHAFQPGQGIGGDAHFDAEETWTNTSANYNLFLVAAHEFGHSLGLAHSSDPGALMYPNYAFRETSNYSLPQDDIDGIQAIYG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords NEUTROPHIL COLLAGENASE
publication title Two crystal structures of human neutrophil collagenase, one complexed with a primed- and the other with an unprimed-side inhibitor: implications for drug design.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase/hydrolase inhibitor
total genus 50
structure length 163
sequence length 163
ec nomenclature ec 3.4.24.34: Neutrophil collagenase.
pdb deposition date 2001-03-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00413 Peptidase_M10 Matrixin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.390.10 Alpha Beta 3-Layer(aba) Sandwich Collagenase (Catalytic Domain) Collagenase (Catalytic Domain) 1i73A00
4H1QA 1PWUA 1IAAA 1CQRA 2AYKA 3LJGA 4ON1A 1SLNA 3F17A 2J0TA 1PWWA 1DTHA 3N2UA 1B3DA 3CKIA 1ROSA 2D1NA 2QPJA 1GKCA 3K7LA 3F19A 3NX7A 4WK7A 4H3XA 1FLSA 5I0LA 2N8RA 1QIBA 3HY9A 3G42A 2J83A 4XM6A 3DL1A 1R54A 3EWJA 1ZXCA 5CXAA 3LE9A 1D5JA 3LK8A 4I35A 1JAOA 2HU6A 2MZHA 4CTHA 3OHLA 3N2VA 1KUKA 3LUNA 3TVCA 3DPEA 3AYUA 4PKUA 1K7IA 1R1JA 3F15A 4WZVA 1OM6A 1UTTA 3L0VA 3LJZA 3WV1A 4R3VA 2X3BA 3KMCA 4FXYP 3K7NA 4L6TA 4JP4A 3KEJA 4PKVA 1BIWA 2OW1A 1Q3AA 4H82A 4FXQA 1G4KA 1QJIA 4GR3A 2A8HA 1CGFA 2JT6A 1KUFA 3LIKA 4PKTA 2W14A 1XFVA 3VI1A 1QIAA 1BUDA 4ZR5A 2Y6CA 4H84A 2MLSA 1XUDA 2AIGP 3DNGA 2RJPA 1FM1A 1RMZA 1R55A 1HTDA 1K7GA 5D2BA 3I7GA 1G9KA 1GE6A 1CGLA 3RTSA 1R1IA 3ZVSA 4GF1A 2O3EA 1SRPA 1JIZA 5I2ZA 3WV2A 1ZVXA 1BM6A 4XBHA 2Z2DA 2POJA 1SLMA 2JNPA 2DW2A 3VTGA 3TT4A 3GBOA 4WKIA 4A7BA 2OW9A 3KRYA 4XCTA 3O2XA 1KUHA 3MA2A 1AKLA 2JSDA 2I47A 3KHIA 4AIGA 3ZUKA 1QICA 1CIZA 3EHYA 4XM7A 4WF6A 1SATA 2RJQA 4IJOA 1IABA 1MMQA 1XFYA 3LILA 5D1SA 3ELMA 1C7KA 1MMBA 2V4BA 1HY7A 1HFCA 3G5CA 5BOYA 4GWNA 1YQYA 1A85A 5I43A 4G0DA 2W12A 2MZIA 3I7IA 1MMRA 1ZXVA 1ZTQA 3AIGA 3LMCA 1CXVA 1BQQM 1K7QA 4J4MA 1GXDA 3OHOA 3KWVC 3U1RA 1AF0A 2MLRA 5I12A 1Y93A 4JQGA 1JJ9A 3LGPA 2CLTA 2ERPA 1PWVA 3KEKA 1YCMA 4FU4A 4JIJA 1JK3A 2USNA 3WV3A 1EUBA 2DW1A 5BPAA 3LEAA 1GO8P 2Y6DA 1PWPA 4AYKA 3P1VA 1G12A 2OVZA 1EB6A 3LJTA 2K2GA 3LQBA 4Q1LA 3DWBA 4FVLA 2MZEA 1HFSA 4L19A 5L7FA 4DPEA 1IAGA 4PKWA 3V96B 1WNIA 2L0RA 2O36A 1JIWP 4AXQA 1SU3A 1XFWA 1KBCA 1JKYA 2OW2A 3EDZA 3O64A 2JT5A 2XS4A 1OS9A 5I4OA 1L6JA 2OVXA 2FV9A 1PWQA 1H71P 1KUGA 4H49A 2OXUA 2OXZA 4HMAA 1HV5A 3F16A 1XUCA 1UEAA 1DMTA 4XM8A 2FV5A 4GR8A 1BZSA 3HYGA 3DSLA 1R1HA 3E8RA 4G9LA 1OM8A 3EDHA 4L63A 2OI0A 4I03A 1RM8A 2YB9A 2W0DA 4DF9A 1BKCI 1XURA 3HBVP 5LABA 3LQ0A 3SHIA 830CA 2YIGA 1JANA 1D8FA 4GWMA 2PJTA 1OMJA 1BKCE 3TSKA 1GO7P 3USNA 4QKZA 2CKIA 3UVCA 2DDFA 2OY2A 2K9CA 3TS4A 1OO9A 3HDAP 3KMEA 4PKQA 1OM7A 4AUOA 4H76A 2JIHA 1O0QA 1ATLA 1O0TA 1G49A 5D7WA 2OY4A 2WO9A 3B92A 3EDGA 1AYKA 2DW0A 3F1AA 5CUHA 1D8MA 1QUAA 1BSWA 1A86A 1UMTA 1I1IP 1GE7A 1ASTA 4PKSA 1Z3JA 3F18A 4JA1A 1J7NA 3BA0A 5D3CA 1ZS0A 2WOAA 3EDIA 1ND1A 3DPFA 966CA 1IAEA 2ERQA 1YOUA 2OW0A 1B8YA 1OS2A 1C8TA 1GE5A 3RTTA 2X7MA 2OZRA 3HY7A 1G05A 1BQOA 1USNA 4GQLA 1KAPP 4GUYA 1QJJA 3B8ZA 3LIRA 3AYKA 1I76A 3LKAA 4JPAA 2W13A 1MNCA 2DDYA 1Y0VA 3LUMA 1S4BP 2KRJA 3ZXHA 5JMYA 1JH1A 1IADA 3HDBA 2E2DA 1MMPA 2EROA 1FBLA 5H8XA 1ZP5A 4IN9A 2SRTA 4IUWA 4A3WA 1BKCA 1UTZA 1XFUA 1C3IA 2E3XA 1JAQA 5D1UA 5L79A 2TCLA 1GKDA 3EHXA 1CAQA 1CGEA 1HOVA 1EAKA 3HB2P 3Q2GA 4PKRA 2WO8A 2D1OA 4DV8A 4HX3A 1UMSA 4EFSA 4H30A 5B5PA 4WKEA 1D7XA 3HBUP 2XS3A 5I3MA 5D1TA 3B2ZA 1XFXA 5BOTA 4DD8A 3L0TA 1JAPA 4H2EA 1KUIA 1Y8JA 1SMPA 3Q2HA 2OXWA 2W15A 2X3CA 5CZMA 4GR0A 4ILWD 3P24A 3KECA 456CA 1YP1A 1CK7A 1BUVM 1IACA 5B5OA 1I73A 1XFZA 2X3AA
chains in the Genus database with same CATH superfamily
4H1QA 1PWUA 1IAAA 1CQRA 1XM5A 2AYKA 3LJGA 4ON1A 1SLNA 3F17A 2J0TA 1PWWA 1DTHA 3N2UA 1B3DA 3CKIA 1ROSA 2D1NA 2QPJA 1GKCA 3K7LA 3F19A 3NX7A 4WK7A 4H3XA 1FLSA 5I0LA 2N8RA 1QIBA 3HY9A 3G42A 2J83A 4XM6A 3DL1A 1R54A 3EWJA 1ZXCA 5CXAA 3LE9A 1D5JA 3LK8A 4I35A 1JAOA 2HU6A 2MZHA 4CTHA 3OHLA 3N2VA 1KUKA 3LUNA 3TVCA 3DPEA 3AYUA 4PKUA 1K7IA 1R1JA 3F15A 4WZVA 1OM6A 1UTTA 3L0VA 3LJZA 3WV1A 4R3VA 2X3BA 3KMCA 4FXYP 3K7NA 4L6TA 4JP4A 3KEJA 4PKVA 1BIWA 2OW1A 1Q3AA 4H82A 4FXQA 1G4KA 1QJIA 4GR3A 2A8HA 1CGFA 2JT6A 1KUFA 3LIKA 4PKTA 2W14A 1XFVA 3VI1A 1QIAA 1BUDA 4ZR5A 2Y6CA 4H84A 2MLSA 1XUDA 2AIGP 3DNGA 2RJPA 1FM1A 1RMZA 1R55A 1HTDA 1K7GA 5D2BA 3I7GA 1G9KA 1GE6A 1CGLA 3RTSA 1R1IA 3ZVSA 4GF1A 2O3EA 1SRPA 1JIZA 5I2ZA 3WV2A 1ZVXA 1BM6A 4XBHA 2Z2DA 2POJA 1SLMA 2JNPA 2DW2A 3VTGA 3TT4A 3GBOA 4WKIA 4A7BA 2OW9A 3KRYA 4XCTA 3O2XA 1KUHA 3MA2A 1AKLA 2JSDA 2I47A 3KHIA 4AIGA 3ZUKA 1QICA 1CIZA 3EHYA 4XM7A 4WF6A 1SATA 2RJQA 4IJOA 1IABA 1MMQA 1XFYA 3LILA 5D1SA 3ELMA 1C7KA 1MMBA 2V4BA 1HY7A 1HFCA 3G5CA 5BOYA 4GWNA 1YQYA 1A85A 5I43A 4G0DA 2W12A 2MZIA 3I7IA 1MMRA 2YUFA 1ZXVA 1ZTQA 3AIGA 3LMCA 1CXVA 1BQQM 1K7QA 4J4MA 1GXDA 3OHOA 3KWVC 3U1RA 1AF0A 2MLRA 5I12A 1Y93A 4JQGA 1JJ9A 3LGPA 2CLTA 2ERPA 1PWVA 3KEKA 1YCMA 4FU4A 4JIJA 1JK3A 2USNA 3WV3A 1EUBA 2DW1A 5BPAA 3LEAA 1GO8P 2Y6DA 1PWPA 4AYKA 3DTKA 3P1VA 1G12A 2OVZA 1EB6A 3LJTA 2K2GA 3LQBA 4Q1LA 3DWBA 4FVLA 2MZEA 1HFSA 4L19A 5L7FA 4DPEA 1IAGA 4PKWA 3V96B 1WNIA 2L0RA 2O36A 1JIWP 4AXQA 1SU3A 1XFWA 1KBCA 1JKYA 2OW2A 3EDZA 3O64A 2JT5A 2XS4A 1OS9A 5I4OA 1L6JA 2OVXA 2FV9A 1PWQA 1H71P 1OZ9A 1KUGA 4H49A 2OXUA 2OXZA 4HMAA 1HV5A 3F16A 1XUCA 1UEAA 1DMTA 4XM8A 2FV5A 4GR8A 1BZSA 3HYGA 3DSLA 1R1HA 3E8RA 4G9LA 1OM8A 3EDHA 4L63A 1TVIA 2OI0A 4I03A 1RM8A 2YB9A 2W0DA 4DF9A 1BKCI 1XURA 3HBVP 5LABA 3LQ0A 3SHIA 830CA 2YIGA 1JANA 1D8FA 4GWMA 2PJTA 1OMJA 1BKCE 3TSKA 1GO7P 3USNA 4QKZA 2CKIA 3UVCA 2DDFA 2OY2A 2K9CA 3TS4A 1OO9A 3HDAP 3KMEA 4PKQA 1OM7A 4AUOA 4H76A 2JIHA 1O0QA 1ATLA 1O0TA 1G49A 5D7WA 2OY4A 2WO9A 3B92A 3EDGA 1AYKA 2DW0A 3F1AA 5CUHA 1D8MA 1QUAA 1BSWA 1A86A 1UMTA 1I1IP 1GE7A 1ASTA 4PKSA 1Z3JA 3F18A 4JA1A 1J7NA 3BA0A 5D3CA 1ZS0A 2WOAA 3EDIA 1ND1A 3DPFA 966CA 1IAEA 2ERQA 1YOUA 2OW0A 1B8YA 1OS2A 1C8TA 1GE5A 3RTTA 2X7MA 2OZRA 3HY7A 3DTIA 1G05A 1BQOA 1USNA 4GQLA 1KAPP 4GUYA 1QJJA 3B8ZA 3LIRA 3AYKA 1I76A 3LKAA 4JPAA 2W13A 1MNCA 2DDYA 1Y0VA 3DTEA 3LUMA 1S4BP 2KRJA 3ZXHA 5JMYA 1JH1A 1IADA 3HDBA 2E2DA 1MMPA 2EROA 1FBLA 5H8XA 1ZP5A 4IN9A 2SRTA 4IUWA 4A3WA 1BKCA 1UTZA 1XFUA 1C3IA 2E3XA 1JAQA 5D1UA 5L79A 2TCLA 1GKDA 3EHXA 1CAQA 1CGEA 1HOVA 1EAKA 3HB2P 3Q2GA 4PKRA 2WO8A 2D1OA 4DV8A 4HX3A 1UMSA 4EFSA 4H30A 5B5PA 4WKEA 1D7XA 3HBUP 2XS3A 5I3MA 5D1TA 3B2ZA 1XFXA 5BOTA 4DD8A 3L0TA 1JAPA 1XAXA 4H2EA 1KUIA 1Y8JA 1SMPA 3Q2HA 2OXWA 4L7AA 2W15A 2X3CA 5CZMA 4GR0A 4ILWD 3P24A 3KECA 456CA 1YP1A 1CK7A 1BUVM 1IACA 5B5OA 1I73A 1XFZA 2X3AA
chains in the Genus database with same CATH topology
4H1QA 1PWUA 1IAAA 1CQRA 2AYKA 3LJGA 4ON1A 1SLNA 3F17A 2J0TA 1PWWA 1DTHA 3N2UA 1B3DA 3CKIA 1ROSA 2D1NA 2QPJA 1GKCA 3K7LA 3F19A 3NX7A 4WK7A 4H3XA 1FLSA 5I0LA 2N8RA 1QIBA 3HY9A 3G42A 2J83A 4XM6A 3DL1A 1R54A 3EWJA 1ZXCA 5CXAA 3LE9A 1D5JA 3LK8A 4I35A 1JAOA 2HU6A 2MZHA 4CTHA 3OHLA 3N2VA 1KUKA 3LUNA 3TVCA 3DPEA 3AYUA 4PKUA 1K7IA 1R1JA 3F15A 4WZVA 1OM6A 1UTTA 3L0VA 3LJZA 3WV1A 4R3VA 2X3BA 3KMCA 4FXYP 3K7NA 4L6TA 4JP4A 3KEJA 4PKVA 1BIWA 2OW1A 1Q3AA 4H82A 4FXQA 1G4KA 1QJIA 4GR3A 2A8HA 1CGFA 2JT6A 1KUFA 3LIKA 4PKTA 2W14A 1XFVA 3VI1A 1QIAA 1BUDA 4ZR5A 2Y6CA 4H84A 2MLSA 1XUDA 2AIGP 3DNGA 2RJPA 1FM1A 1RMZA 1R55A 1HTDA 1K7GA 5D2BA 3I7GA 1G9KA 1GE6A 1CGLA 3RTSA 1R1IA 3ZVSA 4GF1A 2O3EA 1SRPA 1JIZA 5I2ZA 3WV2A 1ZVXA 1BM6A 4XBHA 2Z2DA 2POJA 1SLMA 2JNPA 2DW2A 3VTGA 3TT4A 3GBOA 4WKIA 4A7BA 2OW9A 3KRYA 4XCTA 3O2XA 1KUHA 3MA2A 1AKLA 2JSDA 2I47A 3KHIA 4AIGA 3ZUKA 1QICA 1CIZA 3EHYA 4XM7A 4WF6A 1SATA 2RJQA 4IJOA 1IABA 1MMQA 1XFYA 3LILA 5D1SA 3ELMA 1C7KA 1MMBA 2V4BA 1HY7A 1HFCA 3G5CA 5BOYA 4GWNA 1YQYA 1A85A 5I43A 4G0DA 2W12A 2MZIA 3I7IA 1MMRA 2YUFA 1ZXVA 1ZTQA 3AIGA 3LMCA 1CXVA 1BQQM 1K7QA 4J4MA 1GXDA 3OHOA 3KWVC 3U1RA 1AF0A 2MLRA 5I12A 1Y93A 4JQGA 1JJ9A 3LGPA 2CLTA 2ERPA 1PWVA 3KEKA 1YCMA 4FU4A 4JIJA 1JK3A 2USNA 3WV3A 1EUBA 2DW1A 5BPAA 3LEAA 1GO8P 2Y6DA 1PWPA 4AYKA 3DTKA 3P1VA 1G12A 2OVZA 1EB6A 3LJTA 2K2GA 3LQBA 4Q1LA 3DWBA 4FVLA 2MZEA 1HFSA 4L19A 5L7FA 4DPEA 1IAGA 4PKWA 3V96B 1WNIA 2L0RA 2O36A 1JIWP 4AXQA 1SU3A 1XFWA 1KBCA 1JKYA 2OW2A 3EDZA 3O64A 2JT5A 2XS4A 1OS9A 5I4OA 1L6JA 2OVXA 2FV9A 1PWQA 1H71P 1KUGA 4H49A 2OXUA 2OXZA 4HMAA 1HV5A 3F16A 1XUCA 1UEAA 1DMTA 4XM8A 2FV5A 4GR8A 1BZSA 3HYGA 3DSLA 1R1HA 3E8RA 4G9LA 1OM8A 3EDHA 4L63A 2OI0A 4I03A 1RM8A 2YB9A 2W0DA 4DF9A 1BKCI 1XURA 3HBVP 5LABA 3LQ0A 3SHIA 830CA 2YIGA 1JANA 1D8FA 4GWMA 2PJTA 1OMJA 1BKCE 3TSKA 1GO7P 3USNA 4QKZA 2CKIA 3UVCA 2DDFA 2OY2A 2K9CA 3TS4A 1OO9A 3HDAP 3KMEA 4PKQA 1OM7A 4AUOA 4H76A 2JIHA 1O0QA 1ATLA 1O0TA 1G49A 5D7WA 2OY4A 2WO9A 3B92A 3EDGA 1AYKA 2DW0A 3F1AA 5CUHA 1D8MA 1QUAA 1BSWA 1A86A 1UMTA 1I1IP 1GE7A 1ASTA 4PKSA 1Z3JA 3F18A 4JA1A 1J7NA 3BA0A 5D3CA 1ZS0A 2WOAA 3EDIA 1ND1A 3DPFA 966CA 1IAEA 2ERQA 1YOUA 2OW0A 1B8YA 1OS2A 1C8TA 1GE5A 3RTTA 2X7MA 2OZRA 3HY7A 3DTIA 1G05A 1BQOA 1USNA 4GQLA 1KAPP 4GUYA 1QJJA 3B8ZA 3LIRA 3AYKA 1I76A 3LKAA 4JPAA 2W13A 1MNCA 2DDYA 1Y0VA 3DTEA 3LUMA 1S4BP 2KRJA 3ZXHA 5JMYA 1JH1A 1IADA 3HDBA 2E2DA 1MMPA 2EROA 1FBLA 5H8XA 1ZP5A 4IN9A 2SRTA 4IUWA 4A3WA 1BKCA 1UTZA 1XFUA 1C3IA 2E3XA 1JAQA 5D1UA 5L79A 2TCLA 1GKDA 3EHXA 1CAQA 1CGEA 1HOVA 1EAKA 3HB2P 3Q2GA 4PKRA 2WO8A 2D1OA 4DV8A 4HX3A 1UMSA 4EFSA 4H30A 5B5PA 4WKEA 1D7XA 3HBUP 2XS3A 5I3MA 5D1TA 3B2ZA 1XFXA 5BOTA 4DD8A 3L0TA 1JAPA 4H2EA 1KUIA 1Y8JA 1SMPA 3Q2HA 2OXWA 4L7AA 2W15A 2X3CA 5CZMA 4GR0A 4ILWD 3P24A 3KECA 456CA 1YP1A 1CK7A 1BUVM 1IACA 5B5OA 1I73A 1XFZA 2X3AA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4H1Q A;  1PWU A;  1IAA A;  1CQR A;  2AYK A;  3LJG A;  4ON1 A;  1SLN A;  3F17 A;  2J0T A;  1PWW A;  1DTH A;  3N2U A;  1B3D A;  3CKI A;  1ROS A;  2D1N A;  2QPJ A;  1GKC A;  3K7L A;  3F19 A;  3NX7 A;  4WK7 A;  4H3X A;  1FLS A;  5I0L A;  2N8R A;  1QIB A;  3HY9 A;  3G42 A;  2J83 A;  4XM6 A;  3DL1 A;  1R54 A;  3EWJ A;  1ZXC A;  5CXA A;  3LE9 A;  1D5J A;  3LK8 A;  4I35 A;  1JAO A;  2HU6 A;  2MZH A;  4CTH A;  3OHL A;  3N2V A;  1KUK A;  3LUN A;  3TVC A;  3DPE A;  3AYU A;  4PKU A;  1K7I A;  1R1J A;  3F15 A;  4WZV A;  1OM6 A;  1UTT A;  3L0V A;  3LJZ A;  3WV1 A;  4R3V A;  2X3B A;  3KMC A;  4FXY P;  3K7N A;  4L6T A;  4JP4 A;  3KEJ A;  4PKV A;  1BIW A;  2OW1 A;  1Q3A A;  4H82 A;  4FXQ A;  1G4K A;  1QJI A;  4GR3 A;  2A8H A;  1CGF A;  2JT6 A;  1KUF A;  3LIK A;  4PKT A;  2W14 A;  1XFV A;  3VI1 A;  1QIA A;  1BUD A;  4ZR5 A;  2Y6C A;  4H84 A;  2MLS A;  1XUD A;  2AIG P;  3DNG A;  2RJP A;  1FM1 A;  1RMZ A;  1R55 A;  1HTD A;  1K7G A;  5D2B A;  3I7G A;  1G9K A;  1GE6 A;  1CGL A;  3RTS A;  1R1I A;  3ZVS A;  4GF1 A;  2O3E A;  1SRP A;  1JIZ A;  5I2Z A;  3WV2 A;  1ZVX A;  1BM6 A;  4XBH A;  2Z2D A;  2POJ A;  1SLM A;  2JNP A;  2DW2 A;  3VTG A;  3TT4 A;  3GBO A;  4WKI A;  4A7B A;  2OW9 A;  3KRY A;  4XCT A;  3O2X A;  1KUH A;  3MA2 A;  1AKL A;  2JSD A;  2I47 A;  3KHI A;  4AIG A;  3ZUK A;  1QIC A;  1CIZ A;  3EHY A;  4XM7 A;  4WF6 A;  1SAT A;  2RJQ A;  4IJO A;  1IAB A;  1MMQ A;  1XFY A;  3LIL A;  5D1S A;  3ELM A;  1C7K A;  1MMB A;  2V4B A;  1HY7 A;  1HFC A;  3G5C A;  5BOY A;  4GWN A;  1YQY A;  1A85 A;  5I43 A;  4G0D A;  2W12 A;  2MZI A;  3I7I A;  1MMR A;  1ZXV A;  1ZTQ A;  3AIG A;  3LMC A;  1CXV A;  1BQQ M;  1K7Q A;  4J4M A;  1GXD A;  3OHO A;  3KWV C;  3U1R A;  1AF0 A;  2MLR A;  5I12 A;  1Y93 A;  4JQG A;  1JJ9 A;  3LGP A;  2CLT A;  2ERP A;  1PWV A;  3KEK A;  1YCM A;  4FU4 A;  4JIJ A;  1JK3 A;  2USN A;  3WV3 A;  1EUB A;  2DW1 A;  5BPA A;  3LEA A;  1GO8 P;  2Y6D A;  1PWP A;  4AYK A;  3P1V A;  1G12 A;  2OVZ A;  1EB6 A;  3LJT A;  2K2G A;  3LQB A;  4Q1L A;  3DWB A;  4FVL A;  2MZE A;  1HFS A;  4L19 A;  5L7F A;  4DPE A;  1IAG A;  4PKW A;  3V96 B;  1WNI A;  2L0R A;  2O36 A;  1JIW P;  4AXQ A;  1SU3 A;  1XFW A;  1KBC A;  1JKY A;  2OW2 A;  3EDZ A;  3O64 A;  2JT5 A;  2XS4 A;  1OS9 A;  5I4O A;  1L6J A;  2OVX A;  2FV9 A;  1PWQ A;  1H71 P;  1KUG A;  4H49 A;  2OXU A;  2OXZ A;  4HMA A;  1HV5 A;  3F16 A;  1XUC A;  1UEA A;  1DMT A;  4XM8 A;  2FV5 A;  4GR8 A;  1BZS A;  3HYG A;  3DSL A;  1R1H A;  3E8R A;  4G9L A;  1OM8 A;  3EDH A;  4L63 A;  2OI0 A;  4I03 A;  1RM8 A;  2YB9 A;  2W0D A;  4DF9 A;  1BKC I;  1XUR A;  3HBV P;  5LAB A;  3LQ0 A;  3SHI A;  830C A;  2YIG A;  1JAN A;  1D8F A;  4GWM A;  2PJT A;  1OMJ A;  1BKC E;  3TSK A;  1GO7 P;  3USN A;  4QKZ A;  2CKI A;  3UVC A;  2DDF A;  2OY2 A;  2K9C A;  3TS4 A;  1OO9 A;  3HDA P;  3KME A;  4PKQ A;  1OM7 A;  4AUO A;  4H76 A;  2JIH A;  1O0Q A;  1ATL A;  1O0T A;  1G49 A;  5D7W A;  2OY4 A;  2WO9 A;  3B92 A;  3EDG A;  1AYK A;  2DW0 A;  3F1A A;  5CUH A;  1D8M A;  1QUA A;  1BSW A;  1A86 A;  1UMT A;  1I1I P;  1GE7 A;  1AST A;  4PKS A;  1Z3J A;  3F18 A;  4JA1 A;  1J7N A;  3BA0 A;  5D3C A;  1ZS0 A;  2WOA A;  3EDI A;  1ND1 A;  3DPF A;  966C A;  1IAE A;  2ERQ A;  1YOU A;  2OW0 A;  1B8Y A;  1OS2 A;  1C8T A;  1GE5 A;  3RTT A;  2X7M A;  2OZR A;  3HY7 A;  1G05 A;  1BQO A;  1USN A;  4GQL A;  1KAP P;  4GUY A;  1QJJ A;  3B8Z A;  3LIR A;  3AYK A;  1I76 A;  3LKA A;  4JPA A;  2W13 A;  1MNC A;  2DDY A;  1Y0V A;  3LUM A;  1S4B P;  2KRJ A;  3ZXH A;  5JMY A;  1JH1 A;  1IAD A;  3HDB A;  2E2D A;  1MMP A;  2ERO A;  1FBL A;  5H8X A;  1ZP5 A;  4IN9 A;  2SRT A;  4IUW A;  4A3W A;  1BKC A;  1UTZ A;  1XFU A;  1C3I A;  2E3X A;  1JAQ A;  5D1U A;  5L79 A;  2TCL A;  1GKD A;  3EHX A;  1CAQ A;  1CGE A;  1HOV A;  1EAK A;  3HB2 P;  3Q2G A;  4PKR A;  2WO8 A;  2D1O A;  4DV8 A;  4HX3 A;  1UMS A;  4EFS A;  4H30 A;  5B5P A;  4WKE A;  1D7X A;  3HBU P;  2XS3 A;  5I3M A;  5D1T A;  3B2Z A;  1XFX A;  5BOT A;  4DD8 A;  3L0T A;  1JAP A;  4H2E A;  1KUI A;  1Y8J A;  1SMP A;  3Q2H A;  2OXW A;  2W15 A;  2X3C A;  5CZM A;  4GR0 A;  4ILW D;  3P24 A;  3KEC A;  456C A;  1YP1 A;  1CK7 A;  1BUV M;  1IAC A;  5B5O A;  1I73 A;  1XFZ A;  2X3A A; 
#chains in the Genus database with same CATH topology
 4H1Q A;  1PWU A;  1IAA A;  1CQR A;  1XM5 A;  2AYK A;  3LJG A;  4ON1 A;  1SLN A;  3F17 A;  2J0T A;  1PWW A;  1DTH A;  3N2U A;  1B3D A;  3CKI A;  1ROS A;  2D1N A;  2QPJ A;  1GKC A;  3K7L A;  3F19 A;  3NX7 A;  4WK7 A;  4H3X A;  1FLS A;  5I0L A;  2N8R A;  1QIB A;  3HY9 A;  3G42 A;  2J83 A;  4XM6 A;  3DL1 A;  1R54 A;  3EWJ A;  1ZXC A;  5CXA A;  3LE9 A;  1D5J A;  3LK8 A;  4I35 A;  1JAO A;  2HU6 A;  2MZH A;  4CTH A;  3OHL A;  3N2V A;  1KUK A;  3LUN A;  3TVC A;  3DPE A;  3AYU A;  4PKU A;  1K7I A;  1R1J A;  3F15 A;  4WZV A;  1OM6 A;  1UTT A;  3L0V A;  3LJZ A;  3WV1 A;  4R3V A;  2X3B A;  3KMC A;  4FXY P;  3K7N A;  4L6T A;  4JP4 A;  3KEJ A;  4PKV A;  1BIW A;  2OW1 A;  1Q3A A;  4H82 A;  4FXQ A;  1G4K A;  1QJI A;  4GR3 A;  2A8H A;  1CGF A;  2JT6 A;  1KUF A;  3LIK A;  4PKT A;  2W14 A;  1XFV A;  3VI1 A;  1QIA A;  1BUD A;  4ZR5 A;  2Y6C A;  4H84 A;  2MLS A;  1XUD A;  2AIG P;  3DNG A;  2RJP A;  1FM1 A;  1RMZ A;  1R55 A;  1HTD A;  1K7G A;  5D2B A;  3I7G A;  1G9K A;  1GE6 A;  1CGL A;  3RTS A;  1R1I A;  3ZVS A;  4GF1 A;  2O3E A;  1SRP A;  1JIZ A;  5I2Z A;  3WV2 A;  1ZVX A;  1BM6 A;  4XBH A;  2Z2D A;  2POJ A;  1SLM A;  2JNP A;  2DW2 A;  3VTG A;  3TT4 A;  3GBO A;  4WKI A;  4A7B A;  2OW9 A;  3KRY A;  4XCT A;  3O2X A;  1KUH A;  3MA2 A;  1AKL A;  2JSD A;  2I47 A;  3KHI A;  4AIG A;  3ZUK A;  1QIC A;  1CIZ A;  3EHY A;  4XM7 A;  4WF6 A;  1SAT A;  2RJQ A;  4IJO A;  1IAB A;  1MMQ A;  1XFY A;  3LIL A;  5D1S A;  3ELM A;  1C7K A;  1MMB A;  2V4B A;  1HY7 A;  1HFC A;  3G5C A;  5BOY A;  4GWN A;  1YQY A;  1A85 A;  5I43 A;  4G0D A;  2W12 A;  2MZI A;  3I7I A;  1MMR A;  2YUF A;  1ZXV A;  1ZTQ A;  3AIG A;  3LMC A;  1CXV A;  1BQQ M;  1K7Q A;  4J4M A;  1GXD A;  3OHO A;  3KWV C;  3U1R A;  1AF0 A;  2MLR A;  5I12 A;  1Y93 A;  4JQG A;  1JJ9 A;  3LGP A;  2CLT A;  2ERP A;  1PWV A;  3KEK A;  1YCM A;  4FU4 A;  4JIJ A;  1JK3 A;  2USN A;  3WV3 A;  1EUB A;  2DW1 A;  5BPA A;  3LEA A;  1GO8 P;  2Y6D A;  1PWP A;  4AYK A;  3DTK A;  3P1V A;  1G12 A;  2OVZ A;  1EB6 A;  3LJT A;  2K2G A;  3LQB A;  4Q1L A;  3DWB A;  4FVL A;  2MZE A;  1HFS A;  4L19 A;  5L7F A;  4DPE A;  1IAG A;  4PKW A;  3V96 B;  1WNI A;  2L0R A;  2O36 A;  1JIW P;  4AXQ A;  1SU3 A;  1XFW A;  1KBC A;  1JKY A;  2OW2 A;  3EDZ A;  3O64 A;  2JT5 A;  2XS4 A;  1OS9 A;  5I4O A;  1L6J A;  2OVX A;  2FV9 A;  1PWQ A;  1H71 P;  1OZ9 A;  1KUG A;  4H49 A;  2OXU A;  2OXZ A;  4HMA A;  1HV5 A;  3F16 A;  1XUC A;  1UEA A;  1DMT A;  4XM8 A;  2FV5 A;  4GR8 A;  1BZS A;  3HYG A;  3DSL A;  1R1H A;  3E8R A;  4G9L A;  1OM8 A;  3EDH A;  4L63 A;  1TVI A;  2OI0 A;  4I03 A;  1RM8 A;  2YB9 A;  2W0D A;  4DF9 A;  1BKC I;  1XUR A;  3HBV P;  5LAB A;  3LQ0 A;  3SHI A;  830C A;  2YIG A;  1JAN A;  1D8F A;  4GWM A;  2PJT A;  1OMJ A;  1BKC E;  3TSK A;  1GO7 P;  3USN A;  4QKZ A;  2CKI A;  3UVC A;  2DDF A;  2OY2 A;  2K9C A;  3TS4 A;  1OO9 A;  3HDA P;  3KME A;  4PKQ A;  1OM7 A;  4AUO A;  4H76 A;  2JIH A;  1O0Q A;  1ATL A;  1O0T A;  1G49 A;  5D7W A;  2OY4 A;  2WO9 A;  3B92 A;  3EDG A;  1AYK A;  2DW0 A;  3F1A A;  5CUH A;  1D8M A;  1QUA A;  1BSW A;  1A86 A;  1UMT A;  1I1I P;  1GE7 A;  1AST A;  4PKS A;  1Z3J A;  3F18 A;  4JA1 A;  1J7N A;  3BA0 A;  5D3C A;  1ZS0 A;  2WOA A;  3EDI A;  1ND1 A;  3DPF A;  966C A;  1IAE A;  2ERQ A;  1YOU A;  2OW0 A;  1B8Y A;  1OS2 A;  1C8T A;  1GE5 A;  3RTT A;  2X7M A;  2OZR A;  3HY7 A;  3DTI A;  1G05 A;  1BQO A;  1USN A;  4GQL A;  1KAP P;  4GUY A;  1QJJ A;  3B8Z A;  3LIR A;  3AYK A;  1I76 A;  3LKA A;  4JPA A;  2W13 A;  1MNC A;  2DDY A;  1Y0V A;  3DTE A;  3LUM A;  1S4B P;  2KRJ A;  3ZXH A;  5JMY A;  1JH1 A;  1IAD A;  3HDB A;  2E2D A;  1MMP A;  2ERO A;  1FBL A;  5H8X A;  1ZP5 A;  4IN9 A;  2SRT A;  4IUW A;  4A3W A;  1BKC A;  1UTZ A;  1XFU A;  1C3I A;  2E3X A;  1JAQ A;  5D1U A;  5L79 A;  2TCL A;  1GKD A;  3EHX A;  1CAQ A;  1CGE A;  1HOV A;  1EAK A;  3HB2 P;  3Q2G A;  4PKR A;  2WO8 A;  2D1O A;  4DV8 A;  4HX3 A;  1UMS A;  4EFS A;  4H30 A;  5B5P A;  4WKE A;  1D7X A;  3HBU P;  2XS3 A;  5I3M A;  5D1T A;  3B2Z A;  1XFX A;  5BOT A;  4DD8 A;  3L0T A;  1JAP A;  1XAX A;  4H2E A;  1KUI A;  1Y8J A;  1SMP A;  3Q2H A;  2OXW A;  4L7A A;  2W15 A;  2X3C A;  5CZM A;  4GR0 A;  4ILW D;  3P24 A;  3KEC A;  456C A;  1YP1 A;  1CK7 A;  1BUV M;  1IAC A;  5B5O A;  1I73 A;  1XFZ A;  2X3A A; 
#chains in the Genus database with same CATH homology
 4H1Q A;  1PWU A;  1IAA A;  1CQR A;  2AYK A;  3LJG A;  4ON1 A;  1SLN A;  3F17 A;  2J0T A;  1PWW A;  1DTH A;  3N2U A;  1B3D A;  3CKI A;  1ROS A;  2D1N A;  2QPJ A;  1GKC A;  3K7L A;  3F19 A;  3NX7 A;  4WK7 A;  4H3X A;  1FLS A;  5I0L A;  2N8R A;  1QIB A;  3HY9 A;  3G42 A;  2J83 A;  4XM6 A;  3DL1 A;  1R54 A;  3EWJ A;  1ZXC A;  5CXA A;  3LE9 A;  1D5J A;  3LK8 A;  4I35 A;  1JAO A;  2HU6 A;  2MZH A;  4CTH A;  3OHL A;  3N2V A;  1KUK A;  3LUN A;  3TVC A;  3DPE A;  3AYU A;  4PKU A;  1K7I A;  1R1J A;  3F15 A;  4WZV A;  1OM6 A;  1UTT A;  3L0V A;  3LJZ A;  3WV1 A;  4R3V A;  2X3B A;  3KMC A;  4FXY P;  3K7N A;  4L6T A;  4JP4 A;  3KEJ A;  4PKV A;  1BIW A;  2OW1 A;  1Q3A A;  4H82 A;  4FXQ A;  1G4K A;  1QJI A;  4GR3 A;  2A8H A;  1CGF A;  2JT6 A;  1KUF A;  3LIK A;  4PKT A;  2W14 A;  1XFV A;  3VI1 A;  1QIA A;  1BUD A;  4ZR5 A;  2Y6C A;  4H84 A;  2MLS A;  1XUD A;  2AIG P;  3DNG A;  2RJP A;  1FM1 A;  1RMZ A;  1R55 A;  1HTD A;  1K7G A;  5D2B A;  3I7G A;  1G9K A;  1GE6 A;  1CGL A;  3RTS A;  1R1I A;  3ZVS A;  4GF1 A;  2O3E A;  1SRP A;  1JIZ A;  5I2Z A;  3WV2 A;  1ZVX A;  1BM6 A;  4XBH A;  2Z2D A;  2POJ A;  1SLM A;  2JNP A;  2DW2 A;  3VTG A;  3TT4 A;  3GBO A;  4WKI A;  4A7B A;  2OW9 A;  3KRY A;  4XCT A;  3O2X A;  1KUH A;  3MA2 A;  1AKL A;  2JSD A;  2I47 A;  3KHI A;  4AIG A;  3ZUK A;  1QIC A;  1CIZ A;  3EHY A;  4XM7 A;  4WF6 A;  1SAT A;  2RJQ A;  4IJO A;  1IAB A;  1MMQ A;  1XFY A;  3LIL A;  5D1S A;  3ELM A;  1C7K A;  1MMB A;  2V4B A;  1HY7 A;  1HFC A;  3G5C A;  5BOY A;  4GWN A;  1YQY A;  1A85 A;  5I43 A;  4G0D A;  2W12 A;  2MZI A;  3I7I A;  1MMR A;  2YUF A;  1ZXV A;  1ZTQ A;  3AIG A;  3LMC A;  1CXV A;  1BQQ M;  1K7Q A;  4J4M A;  1GXD A;  3OHO A;  3KWV C;  3U1R A;  1AF0 A;  2MLR A;  5I12 A;  1Y93 A;  4JQG A;  1JJ9 A;  3LGP A;  2CLT A;  2ERP A;  1PWV A;  3KEK A;  1YCM A;  4FU4 A;  4JIJ A;  1JK3 A;  2USN A;  3WV3 A;  1EUB A;  2DW1 A;  5BPA A;  3LEA A;  1GO8 P;  2Y6D A;  1PWP A;  4AYK A;  3DTK A;  3P1V A;  1G12 A;  2OVZ A;  1EB6 A;  3LJT A;  2K2G A;  3LQB A;  4Q1L A;  3DWB A;  4FVL A;  2MZE A;  1HFS A;  4L19 A;  5L7F A;  4DPE A;  1IAG A;  4PKW A;  3V96 B;  1WNI A;  2L0R A;  2O36 A;  1JIW P;  4AXQ A;  1SU3 A;  1XFW A;  1KBC A;  1JKY A;  2OW2 A;  3EDZ A;  3O64 A;  2JT5 A;  2XS4 A;  1OS9 A;  5I4O A;  1L6J A;  2OVX A;  2FV9 A;  1PWQ A;  1H71 P;  1KUG A;  4H49 A;  2OXU A;  2OXZ A;  4HMA A;  1HV5 A;  3F16 A;  1XUC A;  1UEA A;  1DMT A;  4XM8 A;  2FV5 A;  4GR8 A;  1BZS A;  3HYG A;  3DSL A;  1R1H A;  3E8R A;  4G9L A;  1OM8 A;  3EDH A;  4L63 A;  2OI0 A;  4I03 A;  1RM8 A;  2YB9 A;  2W0D A;  4DF9 A;  1BKC I;  1XUR A;  3HBV P;  5LAB A;  3LQ0 A;  3SHI A;  830C A;  2YIG A;  1JAN A;  1D8F A;  4GWM A;  2PJT A;  1OMJ A;  1BKC E;  3TSK A;  1GO7 P;  3USN A;  4QKZ A;  2CKI A;  3UVC A;  2DDF A;  2OY2 A;  2K9C A;  3TS4 A;  1OO9 A;  3HDA P;  3KME A;  4PKQ A;  1OM7 A;  4AUO A;  4H76 A;  2JIH A;  1O0Q A;  1ATL A;  1O0T A;  1G49 A;  5D7W A;  2OY4 A;  2WO9 A;  3B92 A;  3EDG A;  1AYK A;  2DW0 A;  3F1A A;  5CUH A;  1D8M A;  1QUA A;  1BSW A;  1A86 A;  1UMT A;  1I1I P;  1GE7 A;  1AST A;  4PKS A;  1Z3J A;  3F18 A;  4JA1 A;  1J7N A;  3BA0 A;  5D3C A;  1ZS0 A;  2WOA A;  3EDI A;  1ND1 A;  3DPF A;  966C A;  1IAE A;  2ERQ A;  1YOU A;  2OW0 A;  1B8Y A;  1OS2 A;  1C8T A;  1GE5 A;  3RTT A;  2X7M A;  2OZR A;  3HY7 A;  3DTI A;  1G05 A;  1BQO A;  1USN A;  4GQL A;  1KAP P;  4GUY A;  1QJJ A;  3B8Z A;  3LIR A;  3AYK A;  1I76 A;  3LKA A;  4JPA A;  2W13 A;  1MNC A;  2DDY A;  1Y0V A;  3DTE A;  3LUM A;  1S4B P;  2KRJ A;  3ZXH A;  5JMY A;  1JH1 A;  1IAD A;  3HDB A;  2E2D A;  1MMP A;  2ERO A;  1FBL A;  5H8X A;  1ZP5 A;  4IN9 A;  2SRT A;  4IUW A;  4A3W A;  1BKC A;  1UTZ A;  1XFU A;  1C3I A;  2E3X A;  1JAQ A;  5D1U A;  5L79 A;  2TCL A;  1GKD A;  3EHX A;  1CAQ A;  1CGE A;  1HOV A;  1EAK A;  3HB2 P;  3Q2G A;  4PKR A;  2WO8 A;  2D1O A;  4DV8 A;  4HX3 A;  1UMS A;  4EFS A;  4H30 A;  5B5P A;  4WKE A;  1D7X A;  3HBU P;  2XS3 A;  5I3M A;  5D1T A;  3B2Z A;  1XFX A;  5BOT A;  4DD8 A;  3L0T A;  1JAP A;  4H2E A;  1KUI A;  1Y8J A;  1SMP A;  3Q2H A;  2OXW A;  4L7A A;  2W15 A;  2X3C A;  5CZM A;  4GR0 A;  4ILW D;  3P24 A;  3KEC A;  456C A;  1YP1 A;  1CK7 A;  1BUV M;  1IAC A;  5B5O A;  1I73 A;  1XFZ A;  2X3A A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...