1I74A

Streptococcus mutans inorganic pyrophosphatase
Total Genus 97
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
97
sequence length
309
structure length
309
Chain Sequence
b'SKILVFGHQNPDSDAIGSSMAYAYLKRQLGVDAQAVALGNPNEETAFVLDYFGIQAPPVVKSAQAEGAKQVILTDHNEFQQSIADIREVEVVEVVDHHRVANFETANPLYMRLEPVGSASSIVYRLYKENGVAIPKEIAGVMLSGLISDTLLLKSPTTHASDPAVAEDLAKIAGVDLQEYGLAMLKAGTNLASKTAAQLVDIDAKTFELNGSQVRVAQVNTVDINEVLERQNEIEEAIKASQAANGYSDFVLMITDILNSNSEILALGNNTDKVEAAFNFTLKNNHAFLAGAVSRKKQVVPQLTESFNG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROBABLE MANGANESE-DEPENDENT INORGANIC PYROPHOSPHATASE
publication title Crystal structure of Streptococcus mutans pyrophosphatase: a new fold for an old mechanism.
pubmed doi rcsb
source organism Streptococcus mutans
molecule tags Hydrolase
total genus 97
structure length 309
sequence length 309
chains with identical sequence B
ec nomenclature ec 3.6.1.1: Inorganic diphosphatase.
pdb deposition date 2001-03-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01368 DHH DHH family
A PF02833 DHHA2 DHHA2 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.310.20 Alpha Beta Roll Diaminopimelate Epimerase; Chain A, domain 1 Diaminopimelate Epimerase; Chain A, domain 1 1i74A02
3.90.1640.10 Alpha Beta Alpha-Beta Complex inorganic pyrophosphatase (n-terminal core) inorganic pyrophosphatase (n-terminal core) 1i74A01
4RPAA 2EB0A 4LS9A 1K20A 3DEVA 2IW4A 1K23A 1WPNA 2QB8A 3W5WA 2ENXA 1I74A 2QB7A 1WPPA 4PY9A 2HAWA 1WPMA 2QB6A
chains in the Genus database with same CATH superfamily
2ZXRA 5GL3A 1IR6A 1S7JA 5H2YA 4PY9A 4K7XA 3G7KA 4JD7A 2PVZA 2QB7A 2IW4A 4K7GB 1I74A 1QY9A 2YMAA 1XUBA 5GL4A 4FC5A 2GKEA 2H9FA 2QB6A 4DUNA 4LS9A 1K23A 2ZXPA 1XUAA 3G98A 3PVHA 3EKMA 1W62A 4J9WA 3PW9A 2PW0A 2HAWA 2Q9JA 1T6KA 3EJXA 5GKXA 1U1VA 4IK0A 5M47A 2AZPA 2GKJA 4RPAA 4DWZA 3PTJA 4Q60A 2Q9HA 3WQZA 1QYAA 3IGHX 3W5WA 1WPNA 2KPTA 2KW7A 2ZVFA 2ZXOA 1TM0A 5HA4A 1SDJA 4IJZA 1WPMA 4OA3A 1K20A 1U0KA 4K8LA 1GQZA 4JUUA 1BWZA 3FVEA 4GL6A 1W61A 3DEVA 5H2GA 2QB8A 2MPBA 1YM5A 3ICJA 1U1WA 5ANPA 4LB0A 1WPPA 1U1XA 2LT2A 5GL2A 2OTNA 5IWEA 2ENXA 4JBDA 3EDNA 4JCIA 2EB0A 4Q2HA 4J9XA 4LG3A
chains in the Genus database with same CATH topology
2ZXRA 5GL3A 1IR6A 1S7JA 5H2YA 4PY9A 4K7XA 3G7KA 4JD7A 2PVZA 2QB7A 2IW4A 4K7GB 1I74A 1QY9A 2YMAA 1XUBA 5GL4A 4FC5A 2GKEA 2H9FA 2QB6A 4DUNA 4LS9A 1K23A 2ZXPA 1XUAA 3G98A 3PVHA 3EKMA 1W62A 4J9WA 3PW9A 2PW0A 2HAWA 2Q9JA 1T6KA 3EJXA 5GKXA 1U1VA 4IK0A 5M47A 2AZPA 2GKJA 4RPAA 4DWZA 3PTJA 4Q60A 2Q9HA 3WQZA 1QYAA 3IGHX 3W5WA 1WPNA 2KPTA 2KW7A 2ZVFA 2ZXOA 1TM0A 5HA4A 1SDJA 4IJZA 1WPMA 4OA3A 1K20A 1U0KA 4K8LA 1GQZA 4JUUA 1BWZA 3FVEA 4GL6A 1W61A 3DEVA 5H2GA 2QB8A 2MPBA 1YM5A 3ICJA 1U1WA 5ANPA 4LB0A 1WPPA 1U1XA 2LT2A 5GL2A 2OTNA 5IWEA 2ENXA 4JBDA 3EDNA 4JCIA 2EB0A 4Q2HA 4J9XA 4LG3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4RPA A;  2EB0 A;  4LS9 A;  1K20 A;  3DEV A;  2IW4 A;  1K23 A;  1WPN A;  2QB8 A;  3W5W A;  2ENX A;  1I74 A;  2QB7 A;  1WPP A;  4PY9 A;  2HAW A;  1WPM A;  2QB6 A; 
#chains in the Genus database with same CATH topology
 2ZXR A;  5GL3 A;  1IR6 A;  1S7J A;  5H2Y A;  4PY9 A;  4K7X A;  3G7K A;  4JD7 A;  2PVZ A;  2QB7 A;  2IW4 A;  4K7G B;  1I74 A;  1QY9 A;  2YMA A;  1XUB A;  5GL4 A;  4FC5 A;  2GKE A;  2H9F A;  2QB6 A;  4DUN A;  4LS9 A;  1K23 A;  2ZXP A;  1XUA A;  3G98 A;  3PVH A;  3EKM A;  1W62 A;  4J9W A;  3PW9 A;  2PW0 A;  2HAW A;  2Q9J A;  1T6K A;  3EJX A;  5GKX A;  1U1V A;  4IK0 A;  5M47 A;  2AZP A;  2GKJ A;  4RPA A;  4DWZ A;  3PTJ A;  4Q60 A;  2Q9H A;  3WQZ A;  1QYA A;  3IGH X;  3W5W A;  1WPN A;  2KPT A;  2KW7 A;  2ZVF A;  2ZXO A;  1TM0 A;  5HA4 A;  1SDJ A;  4IJZ A;  1WPM A;  4OA3 A;  1K20 A;  1U0K A;  4K8L A;  1GQZ A;  4JUU A;  1BWZ A;  3FVE A;  4GL6 A;  1W61 A;  3DEV A;  5H2G A;  2QB8 A;  2MPB A;  1YM5 A;  3ICJ A;  1U1W A;  5ANP A;  4LB0 A;  1WPP A;  1U1X A;  2LT2 A;  5GL2 A;  2OTN A;  5IWE A;  2ENX A;  4JBD A;  3EDN A;  4JCI A;  2EB0 A;  4Q2H A;  4J9X A;  4LG3 A; 
#chains in the Genus database with same CATH homology
 2ZXR A;  5GL3 A;  1IR6 A;  1S7J A;  5H2Y A;  4PY9 A;  4K7X A;  3G7K A;  4JD7 A;  2PVZ A;  2QB7 A;  2IW4 A;  4K7G B;  1I74 A;  1QY9 A;  2YMA A;  1XUB A;  5GL4 A;  4FC5 A;  2GKE A;  2H9F A;  2QB6 A;  4DUN A;  4LS9 A;  1K23 A;  2ZXP A;  1XUA A;  3G98 A;  3PVH A;  3EKM A;  1W62 A;  4J9W A;  3PW9 A;  2PW0 A;  2HAW A;  2Q9J A;  1T6K A;  3EJX A;  5GKX A;  1U1V A;  4IK0 A;  5M47 A;  2AZP A;  2GKJ A;  4RPA A;  4DWZ A;  3PTJ A;  4Q60 A;  2Q9H A;  3WQZ A;  1QYA A;  3IGH X;  3W5W A;  1WPN A;  2KPT A;  2KW7 A;  2ZVF A;  2ZXO A;  1TM0 A;  5HA4 A;  1SDJ A;  4IJZ A;  1WPM A;  4OA3 A;  1K20 A;  1U0K A;  4K8L A;  1GQZ A;  4JUU A;  1BWZ A;  3FVE A;  4GL6 A;  1W61 A;  3DEV A;  5H2G A;  2QB8 A;  2MPB A;  1YM5 A;  3ICJ A;  1U1W A;  5ANP A;  4LB0 A;  1WPP A;  1U1X A;  2LT2 A;  5GL2 A;  2OTN A;  5IWE A;  2ENX A;  4JBD A;  3EDN A;  4JCI A;  2EB0 A;  4Q2H A;  4J9X A;  4LG3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...