1I74A

Streptococcus mutans inorganic pyrophosphatase
Total Genus 97
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
97
sequence length
309
structure length
309
Chain Sequence
SKILVFGHQNPDSDAIGSSMAYAYLKRQLGVDAQAVALGNPNEETAFVLDYFGIQAPPVVKSAQAEGAKQVILTDHNEFQQSIADIREVEVVEVVDHHRVANFETANPLYMRLEPVGSASSIVYRLYKENGVAIPKEIAGVMLSGLISDTLLLKSPTTHASDPAVAEDLAKIAGVDLQEYGLAMLKAGTNLASKTAAQLVDIDAKTFELNGSQVRVAQVNTVDINEVLERQNEIEEAIKASQAANGYSDFVLMITDILNSNSEILALGNNTDKVEAAFNFTLKNNHAFLAGAVSRKKQVVPQLTESFNG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of Streptococcus mutans pyrophosphatase: a new fold for an old mechanism.
pubmed doi rcsb
source organism Streptococcus mutans
molecule tags Hydrolase
molecule keywords PROBABLE MANGANESE-DEPENDENT INORGANIC PYROPHOSPHATASE
total genus 97
structure length 309
sequence length 309
chains with identical sequence B
ec nomenclature ec 3.6.1.1: Inorganic diphosphatase.
pdb deposition date 2001-03-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01368 DHH DHH family
A PF02833 DHHA2 DHHA2 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.310.20 Alpha Beta Roll Diaminopimelate Epimerase; Chain A, domain 1 Diaminopimelate Epimerase; Chain A, domain 1 1i74A02
3.90.1640.10 Alpha Beta Alpha-Beta Complex inorganic pyrophosphatase (n-terminal core) inorganic pyrophosphatase (n-terminal core) 1i74A01
1K20A 1WPNA 2QB8A 4RPAA 1WPMA 3DEVA 2ENXA 3W5WA 4PY9A 1I74A 2IW4A 1WPPA 2QB7A 1K23A 2QB6A 4LS9A 2EB0A 2HAWA
chains in the Genus database with same CATH superfamily
1GQZA 4Q2HA 1YM5A 4LG3A 4IK0A 4K7GB 1WPNA 1U0KA 3W5WA 4OA3A 2KPTA 2ZXPA 3ICJA 1IR6A 2Q9JA 5ANPA 3G7KA 4GL6A 1QY9A 2ZXRA 4LS9A 4LB0A 1U1VA 2PW0A 1SDJA 2EB0A 5M47A 3IGHX 2QB8A 1XUAA 2HAWA 2ZVFA 2AZPA 4JD7A 2GKJA 2YMAA 3PW9A 5HA4A 4DUNA 2GKEA 5H2YA 3WQZA 1U1WA 2QB6A 5H2GA 2OTNA 3EKMA 3G98A 2QB7A 1K20A 4K8LA 1BWZA 5GL4A 4RPAA 4PY9A 3EJXA 1W61A 4FC5A 5GL2A 3PVHA 2KW7A 4J9WA 2ZXOA 2ENXA 4DWZA 1WPPA 1XUBA 3EDNA 2LT2A 1I74A 2H9FA 4JUUA 5IWEA 4K7XA 3FVEA 5GKXA 5GL3A 2MPBA 2PVZA 1T6KA 4Q60A 3DEVA 2Q9HA 1W62A 4J9XA 4JBDA 1TM0A 4IJZA 1WPMA 1K23A 1U1XA 2IW4A 1S7JA 1QYAA 4JCIA 3PTJA
chains in the Genus database with same CATH topology
1GQZA 4Q2HA 1YM5A 4LG3A 4IK0A 4K7GB 1WPNA 1U0KA 3W5WA 4OA3A 2KPTA 2ZXPA 3ICJA 1IR6A 2Q9JA 5ANPA 3G7KA 4GL6A 1QY9A 2ZXRA 4LS9A 4LB0A 1U1VA 2PW0A 1SDJA 2EB0A 5M47A 3IGHX 2QB8A 1XUAA 2HAWA 2ZVFA 2AZPA 4JD7A 2GKJA 2YMAA 3PW9A 5HA4A 4DUNA 2GKEA 5H2YA 3WQZA 1U1WA 2QB6A 5H2GA 2OTNA 3EKMA 3G98A 2QB7A 1K20A 4K8LA 1BWZA 5GL4A 4RPAA 4PY9A 3EJXA 1W61A 4FC5A 5GL2A 3PVHA 2KW7A 4J9WA 2ZXOA 2ENXA 4DWZA 1WPPA 1XUBA 3EDNA 2LT2A 1I74A 2H9FA 4JUUA 5IWEA 4K7XA 3FVEA 5GKXA 5GL3A 2MPBA 2PVZA 1T6KA 4Q60A 3DEVA 2Q9HA 1W62A 4J9XA 4JBDA 1TM0A 4IJZA 1WPMA 1K23A 1U1XA 2IW4A 1S7JA 1QYAA 4JCIA 3PTJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1K20 A;  1WPN A;  2QB8 A;  4RPA A;  1WPM A;  3DEV A;  2ENX A;  3W5W A;  4PY9 A;  1I74 A;  2IW4 A;  1WPP A;  2QB7 A;  1K23 A;  2QB6 A;  4LS9 A;  2EB0 A;  2HAW A; 
#chains in the Genus database with same CATH topology
 1GQZ A;  4Q2H A;  1YM5 A;  4LG3 A;  4IK0 A;  4K7G B;  1WPN A;  1U0K A;  3W5W A;  4OA3 A;  2KPT A;  2ZXP A;  3ICJ A;  1IR6 A;  2Q9J A;  5ANP A;  3G7K A;  4GL6 A;  1QY9 A;  2ZXR A;  4LS9 A;  4LB0 A;  1U1V A;  2PW0 A;  1SDJ A;  2EB0 A;  5M47 A;  3IGH X;  2QB8 A;  1XUA A;  2HAW A;  2ZVF A;  2AZP A;  4JD7 A;  2GKJ A;  2YMA A;  3PW9 A;  5HA4 A;  4DUN A;  2GKE A;  5H2Y A;  3WQZ A;  1U1W A;  2QB6 A;  5H2G A;  2OTN A;  3EKM A;  3G98 A;  2QB7 A;  1K20 A;  4K8L A;  1BWZ A;  5GL4 A;  4RPA A;  4PY9 A;  3EJX A;  1W61 A;  4FC5 A;  5GL2 A;  3PVH A;  2KW7 A;  4J9W A;  2ZXO A;  2ENX A;  4DWZ A;  1WPP A;  1XUB A;  3EDN A;  2LT2 A;  1I74 A;  2H9F A;  4JUU A;  5IWE A;  4K7X A;  3FVE A;  5GKX A;  5GL3 A;  2MPB A;  2PVZ A;  1T6K A;  4Q60 A;  3DEV A;  2Q9H A;  1W62 A;  4J9X A;  4JBD A;  1TM0 A;  4IJZ A;  1WPM A;  1K23 A;  1U1X A;  2IW4 A;  1S7J A;  1QYA A;  4JCI A;  3PTJ A; 
#chains in the Genus database with same CATH homology
 1GQZ A;  4Q2H A;  1YM5 A;  4LG3 A;  4IK0 A;  4K7G B;  1WPN A;  1U0K A;  3W5W A;  4OA3 A;  2KPT A;  2ZXP A;  3ICJ A;  1IR6 A;  2Q9J A;  5ANP A;  3G7K A;  4GL6 A;  1QY9 A;  2ZXR A;  4LS9 A;  4LB0 A;  1U1V A;  2PW0 A;  1SDJ A;  2EB0 A;  5M47 A;  3IGH X;  2QB8 A;  1XUA A;  2HAW A;  2ZVF A;  2AZP A;  4JD7 A;  2GKJ A;  2YMA A;  3PW9 A;  5HA4 A;  4DUN A;  2GKE A;  5H2Y A;  3WQZ A;  1U1W A;  2QB6 A;  5H2G A;  2OTN A;  3EKM A;  3G98 A;  2QB7 A;  1K20 A;  4K8L A;  1BWZ A;  5GL4 A;  4RPA A;  4PY9 A;  3EJX A;  1W61 A;  4FC5 A;  5GL2 A;  3PVH A;  2KW7 A;  4J9W A;  2ZXO A;  2ENX A;  4DWZ A;  1WPP A;  1XUB A;  3EDN A;  2LT2 A;  1I74 A;  2H9F A;  4JUU A;  5IWE A;  4K7X A;  3FVE A;  5GKX A;  5GL3 A;  2MPB A;  2PVZ A;  1T6K A;  4Q60 A;  3DEV A;  2Q9H A;  1W62 A;  4J9X A;  4JBD A;  1TM0 A;  4IJZ A;  1WPM A;  1K23 A;  1U1X A;  2IW4 A;  1S7J A;  1QYA A;  4JCI A;  3PTJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...