1I74A

Streptococcus mutans inorganic pyrophosphatase
Total Genus 97
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
97
sequence length
309
structure length
309
Chain Sequence
SKILVFGHQNPDSDAIGSSMAYAYLKRQLGVDAQAVALGNPNEETAFVLDYFGIQAPPVVKSAQAEGAKQVILTDHNEFQQSIADIREVEVVEVVDHHRVANFETANPLYMRLEPVGSASSIVYRLYKENGVAIPKEIAGVMLSGLISDTLLLKSPTTHASDPAVAEDLAKIAGVDLQEYGLAMLKAGTNLASKTAAQLVDIDAKTFELNGSQVRVAQVNTVDINEVLERQNEIEEAIKASQAANGYSDFVLMITDILNSNSEILALGNNTDKVEAAFNFTLKNNHAFLAGAVSRKKQVVPQLTESFNG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of Streptococcus mutans pyrophosphatase: a new fold for an old mechanism.
pubmed doi rcsb
source organism Streptococcus mutans
molecule tags Hydrolase
molecule keywords PROBABLE MANGANESE-DEPENDENT INORGANIC PYROPHOSPHATASE
total genus 97
structure length 309
sequence length 309
chains with identical sequence B
ec nomenclature ec 3.6.1.1: Inorganic diphosphatase.
pdb deposition date 2001-03-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01368 DHH DHH family
A PF02833 DHHA2 DHHA2 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.310.20 Alpha Beta Roll Diaminopimelate Epimerase; Chain A, domain 1 Diaminopimelate Epimerase; Chain A, domain 1 1i74A02
3.90.1640.10 Alpha Beta Alpha-Beta Complex inorganic pyrophosphatase (n-terminal core) inorganic pyrophosphatase (n-terminal core) 1i74A01
2IW4A 2QB7A 2QB8A 1WPPA 2EB0A 4LS9A 2HAWA 1WPNA 3DEVA 1K20A 1WPMA 1K23A 3W5WA 4RPAA 2ENXA 1I74A 2QB6A 4PY9A
chains in the Genus database with same CATH superfamily
2ZXPA 1U1WA 3ICJA 2ZXRA 4IJZA 4J9WA 1U1VA 1WPPA 2Q9JA 1WPMA 4JCIA 4JD7A 2ENXA 4JBDA 2GKJA 1K23A 3W5WA 4OA3A 3EDNA 5GKXA 1W61A 2KPTA 1YM5A 3G7KA 2AZPA 2EB0A 4K8LA 3IGHX 1K20A 3PTJA 5GL2A 3PW9A 2ZXOA 2PW0A 3EJXA 1IR6A 2PVZA 5H2YA 2ZVFA 4LG3A 2QB6A 1XUBA 3FVEA 4GL6A 5ANPA 2HAWA 2OTNA 4IK0A 4K7XA 1SDJA 5GL3A 4PY9A 3WQZA 1BWZA 2QB7A 5GL4A 5M47A 5H2GA 2GKEA 5IWEA 3PVHA 1QYAA 2KW7A 1I74A 4DUNA 4DWZA 1U0KA 4LS9A 1QY9A 1S7JA 3G98A 4LB0A 2LT2A 1T6KA 1GQZA 4FC5A 2MPBA 2Q9HA 4K7GB 2IW4A 1XUAA 1TM0A 5HA4A 4JUUA 4J9XA 2H9FA 4Q2HA 4Q60A 3DEVA 1WPNA 4RPAA 2YMAA 2QB8A 3EKMA 1W62A 1U1XA
chains in the Genus database with same CATH topology
2ZXPA 1U1WA 3ICJA 2ZXRA 4IJZA 4J9WA 1U1VA 1WPPA 2Q9JA 1WPMA 4JCIA 4JD7A 2ENXA 4JBDA 2GKJA 1K23A 3W5WA 4OA3A 3EDNA 5GKXA 1W61A 2KPTA 1YM5A 3G7KA 2AZPA 2EB0A 4K8LA 3IGHX 1K20A 3PTJA 5GL2A 3PW9A 2ZXOA 2PW0A 3EJXA 1IR6A 2PVZA 5H2YA 2ZVFA 4LG3A 2QB6A 1XUBA 3FVEA 4GL6A 5ANPA 2HAWA 2OTNA 4IK0A 4K7XA 1SDJA 5GL3A 4PY9A 3WQZA 1BWZA 2QB7A 5GL4A 5M47A 5H2GA 2GKEA 5IWEA 3PVHA 1QYAA 2KW7A 1I74A 4DUNA 4DWZA 1U0KA 4LS9A 1QY9A 1S7JA 3G98A 4LB0A 2LT2A 1T6KA 1GQZA 4FC5A 2MPBA 2Q9HA 4K7GB 2IW4A 1XUAA 1TM0A 5HA4A 4JUUA 4J9XA 2H9FA 4Q2HA 4Q60A 3DEVA 1WPNA 4RPAA 2YMAA 2QB8A 3EKMA 1W62A 1U1XA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2IW4 A;  2QB7 A;  2QB8 A;  1WPP A;  2EB0 A;  4LS9 A;  2HAW A;  1WPN A;  3DEV A;  1K20 A;  1WPM A;  1K23 A;  3W5W A;  4RPA A;  2ENX A;  1I74 A;  2QB6 A;  4PY9 A; 
#chains in the Genus database with same CATH topology
 2ZXP A;  1U1W A;  3ICJ A;  2ZXR A;  4IJZ A;  4J9W A;  1U1V A;  1WPP A;  2Q9J A;  1WPM A;  4JCI A;  4JD7 A;  2ENX A;  4JBD A;  2GKJ A;  1K23 A;  3W5W A;  4OA3 A;  3EDN A;  5GKX A;  1W61 A;  2KPT A;  1YM5 A;  3G7K A;  2AZP A;  2EB0 A;  4K8L A;  3IGH X;  1K20 A;  3PTJ A;  5GL2 A;  3PW9 A;  2ZXO A;  2PW0 A;  3EJX A;  1IR6 A;  2PVZ A;  5H2Y A;  2ZVF A;  4LG3 A;  2QB6 A;  1XUB A;  3FVE A;  4GL6 A;  5ANP A;  2HAW A;  2OTN A;  4IK0 A;  4K7X A;  1SDJ A;  5GL3 A;  4PY9 A;  3WQZ A;  1BWZ A;  2QB7 A;  5GL4 A;  5M47 A;  5H2G A;  2GKE A;  5IWE A;  3PVH A;  1QYA A;  2KW7 A;  1I74 A;  4DUN A;  4DWZ A;  1U0K A;  4LS9 A;  1QY9 A;  1S7J A;  3G98 A;  4LB0 A;  2LT2 A;  1T6K A;  1GQZ A;  4FC5 A;  2MPB A;  2Q9H A;  4K7G B;  2IW4 A;  1XUA A;  1TM0 A;  5HA4 A;  4JUU A;  4J9X A;  2H9F A;  4Q2H A;  4Q60 A;  3DEV A;  1WPN A;  4RPA A;  2YMA A;  2QB8 A;  3EKM A;  1W62 A;  1U1X A; 
#chains in the Genus database with same CATH homology
 2ZXP A;  1U1W A;  3ICJ A;  2ZXR A;  4IJZ A;  4J9W A;  1U1V A;  1WPP A;  2Q9J A;  1WPM A;  4JCI A;  4JD7 A;  2ENX A;  4JBD A;  2GKJ A;  1K23 A;  3W5W A;  4OA3 A;  3EDN A;  5GKX A;  1W61 A;  2KPT A;  1YM5 A;  3G7K A;  2AZP A;  2EB0 A;  4K8L A;  3IGH X;  1K20 A;  3PTJ A;  5GL2 A;  3PW9 A;  2ZXO A;  2PW0 A;  3EJX A;  1IR6 A;  2PVZ A;  5H2Y A;  2ZVF A;  4LG3 A;  2QB6 A;  1XUB A;  3FVE A;  4GL6 A;  5ANP A;  2HAW A;  2OTN A;  4IK0 A;  4K7X A;  1SDJ A;  5GL3 A;  4PY9 A;  3WQZ A;  1BWZ A;  2QB7 A;  5GL4 A;  5M47 A;  5H2G A;  2GKE A;  5IWE A;  3PVH A;  1QYA A;  2KW7 A;  1I74 A;  4DUN A;  4DWZ A;  1U0K A;  4LS9 A;  1QY9 A;  1S7J A;  3G98 A;  4LB0 A;  2LT2 A;  1T6K A;  1GQZ A;  4FC5 A;  2MPB A;  2Q9H A;  4K7G B;  2IW4 A;  1XUA A;  1TM0 A;  5HA4 A;  4JUU A;  4J9X A;  2H9F A;  4Q2H A;  4Q60 A;  3DEV A;  1WPN A;  4RPA A;  2YMA A;  2QB8 A;  3EKM A;  1W62 A;  1U1X A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...