1I76A

Complex of 2-(biphenyl-4-sulfonyl)-1,2,3,4-tetrahydro-isoquinoline-3-carboxylic acid (d-tic derivative) with t catalitic domain of matrix metallo proteinase-8 (met80 form)
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
163
structure length
163
Chain Sequence
MLTPGNPKWERTNLTYRIRNYTPQLSEAEVERAIKDAFELWSVASPLIFTRISQGEADINIAFYQRDHGDNSPFDGPNGILAHAFQPGQGIGGDAHFDAEETWTNTSANYNLFLVAAHEFGHSLGLAHSSDPGALMYPNYAFRETSNYSLPQDDIDGIQAIYG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords NEUTROPHIL COLLAGENASE
publication title Two crystal structures of human neutrophil collagenase, one complexed with a primed- and the other with an unprimed-side inhibitor: implications for drug design.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 49
structure length 163
sequence length 163
ec nomenclature ec 3.4.24.34: Neutrophil collagenase.
pdb deposition date 2001-03-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00413 Peptidase_M10 Matrixin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.390.10 Alpha Beta 3-Layer(aba) Sandwich Collagenase (Catalytic Domain) Collagenase (Catalytic Domain) 1i76A00
3L0VA 1XFWA 2OY4A 1ATLA 2AYKA 4L19A 4G0DA 3TSKA 1HOVA 5D3CA 2OW1A 2JT5A 2X3AA 3G5CA 3K7NA 3MA2A 1ZXCA 1IACA 1Y8JA 2MZEA 3LK8A 2J0TA 2HU6A 2PJTA 4DD8A 3AYKA 4GQLA 5I4OA 4PKSA 1GKCA 1YP1A 2JNPA 2OZRA 3LJGA 3Q2GA 3LJTA 4DV8A 3HY7A 1CXVA 1IABA 4FXQA 1CAQA 1KAPP 2OW0A 2WOAA 3U1RA 1HFSA 1B8YA 1SLNA 4H1QA 3OHOA 1H71P 4JIJA 3L0TA 3F17A 1ND1A 3LKAA 2OVXA 1WNIA 3EHXA 5L7FA 5I2ZA 1C3IA 3TS4A 1MMRA 4I03A 3K7LA 4WK7A 1K7QA 3OHLA 3O64A 1XUCA 1I1IP 5D7WA 3HBUP 4WKIA 3LGPA 1SRPA 2N8RA 3HB2P 1FBLA 4CTHA 1G05A 1KUKA 1BUDA 1ZTQA 2ERQA 4H3XA 2W13A 1B3DA 1GO8P 2K2GA 4GR8A 3LJZA 1RMZA 2D1OA 1CGEA 1FLSA 2OY2A 3VI1A 1FM1A 2RJPA 2O3EA 2D1NA 2XS3A 1JIZA 1QUAA 1JKYA 4GWMA 1IAGA 1JH1A 3USNA 2OW9A 2V4BA 2X3CA 3BA0A 4R3VA 1R1IA 1MMPA 4WZVA 1OO9A 4ZR5A 1QIBA 2I47A 3TT4A 1EB6A 5D1UA 4A7BA 1I73A 1O0QA 5I12A 3RTTA 1IAEA 2W0DA 1BIWA 1CK7A 3EDZA 3F16A 1UTTA 3SHIA 4XM7A 1GXDA 3P1VA 2X7MA 3KRYA 3Q2HA 2DW1A 1DMTA 1OM8A 2DW0A 1XUDA 3DSLA 3E8RA 2CKIA 2E3XA 4JQGA 3VTGA 3WV1A 4EFSA 2OXWA 2MLRA 2J83A 3DL1A 1C8TA 4AUOA 456CA 1D8FA 1Y0VA 3N2VA 2OI0A 1UMSA 2DDFA 5BOTA 4FXYP 1K7GA 1UMTA 1QICA 4PKRA 1MMBA 3LQBA 4JP4A 3KMEA 4L63A 3V96B 1GO7P 3HYGA 2YIGA 4Q1LA 3TVCA 4XM6A 3LILA 4XBHA 2MZHA 3KHIA 4IJOA 1SATA 2KRJA 5JMYA 1XFXA 1G49A 1R55A 3I7GA 1DTHA 5LABA 4H82A 4GR0A 2JSDA 4PKQA 3ZVSA 1YOUA 1BKCI 1HTDA 1J7NA 2OXUA 1R1HA 5BPAA 1XURA 1ASTA 1ROSA 1ZVXA 1AF0A 1PWVA 3EDIA 1ZP5A 4GF1A 5I0LA 2K9CA 1YQYA 1BKCE 830CA 3B8ZA 3DPEA 1XFZA 1GKDA 2JT6A 5CXAA 3AYUA 1OS2A 4J4MA 3F18A 4A3WA 1JANA 3NX7A 1KBCA 1QJIA 5I43A 1PWUA 4JPAA 4AYKA 2XS4A 4IN9A 2SRTA 1QJJA 3LE9A 1MMQA 1YCMA 3RTSA 3F15A 1D5JA 5BOYA 3KWVC 4DF9A 2FV9A 4AXQA 2QPJA 1GE5A 4H2EA 2EROA 2RJQA 3EWJA 1D8MA 1GE7A 3EDHA 3LMCA 3KEJA 4WF6A 2OW2A 3WV3A 5B5OA 1CGLA 1G12A 5L79A 1OM6A 2Z2DA 2A8HA 1JJ9A 4PKVA 4GWNA 3DWBA 2OXZA 4L6TA 3B92A 1XFYA 3KEKA 2FV5A 5B5PA 4JA1A 3UVCA 1D7XA 2AIGP 1HV5A 3O2XA 1BKCA 1EAKA 1PWQA 5H8XA 2DW2A 1O0TA 3LIKA 1OM7A 3ZXHA 1Z3JA 1R54A 1UTZA 2USNA 1QIAA 3WV2A 1C7KA 1ZS0A 1OS9A 2W12A 1Q3AA 3F1AA 1S4BP 2MZIA 5I3MA 1CIZA 1JAOA 4PKWA 2MLSA 2Y6DA 1L6JA 2W14A 4IUWA 2TCLA 1A85A 1KUHA 2L0RA 5CZMA 3KECA 2WO8A 1G4KA 1ZXVA 2POJA 1AYKA 1I76A 5D1SA 3LUNA 3AIGA 2WO9A 1UEAA 1OMJA 3HBVP 4HX3A 4HMAA 3LIRA 4GUYA 3ZUKA 3HDBA 1SLMA 1AKLA 2CLTA 3HY9A 3CKIA 1PWWA 4GR3A 3EHYA 3KMCA 1XFVA 2OVZA 4I35A 2X3BA 4DPEA 4PKUA 2YB9A 2JIHA 4XCTA 4QKZA 4ON1A 1A86A 1BZSA 1HFCA 1RM8A 4FU4A 1BUVM 3EDGA 1HY7A 4H76A 1KUGA 5D1TA 4H84A 3N2UA 1JIWP 1IADA 2E2DA 1CGFA 1SU3A 5D2BA 1JAPA 4H49A 2O36A 1BQOA 3G42A 3GBOA 1GE6A 3I7IA 3F19A 1KUFA 1MNCA 1KUIA 3LUMA 3DPFA 4G9LA 4ILWD 1BQQM 2ERPA 1XFUA 3LEAA 1BM6A 3LQ0A 1G9KA 4H30A 1JAQA 1R1JA 1PWPA 2Y6CA 3ELMA 5CUHA 4XM8A 1Y93A 1JK3A 3P24A 966CA 3B2ZA 1EUBA 4PKTA 1IAAA 2DDYA 3DNGA 2W15A 4WKEA 1SMPA 1CQRA 3HDAP 1BSWA 1USNA 4AIGA 1K7IA 4FVLA
chains in the Genus database with same CATH superfamily
3L0VA 1XFWA 2OY4A 1ATLA 2AYKA 4L19A 4G0DA 3TSKA 1HOVA 5D3CA 2OW1A 2JT5A 2X3AA 3G5CA 3K7NA 3MA2A 1ZXCA 1IACA 1Y8JA 2MZEA 3LK8A 2J0TA 2HU6A 1OZ9A 2PJTA 4DD8A 3AYKA 4GQLA 5I4OA 4PKSA 1GKCA 1YP1A 2JNPA 2OZRA 3LJGA 3Q2GA 3LJTA 4DV8A 3HY7A 1CXVA 1IABA 4FXQA 1CAQA 1KAPP 2OW0A 2WOAA 3U1RA 1HFSA 1B8YA 1SLNA 4H1QA 3OHOA 1H71P 2YUFA 4JIJA 3L0TA 3DTIA 3F17A 1ND1A 3LKAA 2OVXA 1WNIA 3EHXA 5L7FA 5I2ZA 1C3IA 3TS4A 1MMRA 4I03A 3K7LA 4WK7A 1K7QA 3OHLA 3O64A 1XUCA 1I1IP 5D7WA 3HBUP 4WKIA 3LGPA 1SRPA 3DTEA 2N8RA 3HB2P 1FBLA 4CTHA 1G05A 1KUKA 1BUDA 1ZTQA 2ERQA 4H3XA 2W13A 1B3DA 1GO8P 2K2GA 4GR8A 3LJZA 1RMZA 2D1OA 1CGEA 1FLSA 2OY2A 3VI1A 1FM1A 2RJPA 2O3EA 2D1NA 2XS3A 1JIZA 1QUAA 1JKYA 4GWMA 1IAGA 1JH1A 3USNA 2OW9A 2V4BA 2X3CA 3BA0A 4R3VA 1R1IA 1MMPA 4WZVA 1OO9A 4ZR5A 1QIBA 2I47A 3TT4A 1EB6A 5D1UA 4A7BA 1I73A 1O0QA 5I12A 3RTTA 1IAEA 2W0DA 1BIWA 1CK7A 3EDZA 3F16A 1UTTA 3SHIA 4XM7A 1GXDA 1XM5A 3P1VA 2X7MA 3KRYA 3Q2HA 2DW1A 1DMTA 1OM8A 2DW0A 1XUDA 3DSLA 3E8RA 2CKIA 2E3XA 4JQGA 3VTGA 3WV1A 4EFSA 2OXWA 2MLRA 2J83A 3DL1A 1C8TA 4AUOA 456CA 1D8FA 1Y0VA 3N2VA 2OI0A 1UMSA 2DDFA 5BOTA 4FXYP 1K7GA 1UMTA 1QICA 4PKRA 1MMBA 3LQBA 4JP4A 3KMEA 4L63A 3V96B 1GO7P 3HYGA 2YIGA 4Q1LA 3TVCA 4XM6A 3LILA 4XBHA 2MZHA 3KHIA 4IJOA 1SATA 2KRJA 5JMYA 1XFXA 1G49A 1R55A 3I7GA 1DTHA 5LABA 4H82A 4GR0A 2JSDA 4PKQA 3ZVSA 1YOUA 1BKCI 1HTDA 1J7NA 2OXUA 1R1HA 5BPAA 1XURA 1ASTA 1ROSA 1ZVXA 1AF0A 1PWVA 3EDIA 1ZP5A 4GF1A 5I0LA 2K9CA 1YQYA 1BKCE 830CA 3B8ZA 3DPEA 1XFZA 1GKDA 2JT6A 5CXAA 3AYUA 1OS2A 4J4MA 3F18A 4A3WA 3DTKA 1XAXA 1JANA 3NX7A 1KBCA 1QJIA 5I43A 1PWUA 4JPAA 4AYKA 2XS4A 4IN9A 2SRTA 1QJJA 3LE9A 1MMQA 1YCMA 3RTSA 3F15A 1D5JA 5BOYA 3KWVC 4DF9A 2FV9A 4AXQA 2QPJA 1GE5A 4H2EA 2EROA 2RJQA 3EWJA 1D8MA 1GE7A 3EDHA 3LMCA 3KEJA 4WF6A 2OW2A 3WV3A 5B5OA 1CGLA 1G12A 5L79A 1OM6A 2Z2DA 2A8HA 1JJ9A 4PKVA 4GWNA 3DWBA 2OXZA 4L6TA 3B92A 1XFYA 3KEKA 2FV5A 5B5PA 4JA1A 3UVCA 1D7XA 2AIGP 1HV5A 3O2XA 1BKCA 1EAKA 1PWQA 5H8XA 2DW2A 1O0TA 3LIKA 1OM7A 3ZXHA 1Z3JA 1R54A 1UTZA 2USNA 1QIAA 3WV2A 1C7KA 1ZS0A 1OS9A 2W12A 1Q3AA 3F1AA 1S4BP 2MZIA 5I3MA 1CIZA 1JAOA 4PKWA 2MLSA 2Y6DA 1L6JA 2W14A 4IUWA 2TCLA 1A85A 1KUHA 2L0RA 5CZMA 3KECA 2WO8A 1G4KA 1ZXVA 2POJA 1AYKA 1I76A 5D1SA 3LUNA 3AIGA 2WO9A 1UEAA 1OMJA 3HBVP 4HX3A 4HMAA 3LIRA 4GUYA 3ZUKA 3HDBA 1SLMA 1AKLA 2CLTA 3HY9A 3CKIA 1PWWA 4GR3A 3EHYA 3KMCA 1XFVA 2OVZA 4I35A 2X3BA 4DPEA 4PKUA 2YB9A 2JIHA 4XCTA 4QKZA 4ON1A 4L7AA 1A86A 1BZSA 1HFCA 1RM8A 4FU4A 1BUVM 3EDGA 1HY7A 4H76A 1KUGA 5D1TA 4H84A 3N2UA 1JIWP 1IADA 2E2DA 1CGFA 1SU3A 5D2BA 1JAPA 4H49A 2O36A 1BQOA 3G42A 3GBOA 1GE6A 3I7IA 3F19A 1KUFA 1MNCA 1KUIA 1TVIA 3LUMA 3DPFA 4G9LA 4ILWD 1BQQM 2ERPA 1XFUA 3LEAA 1BM6A 3LQ0A 1G9KA 4H30A 1JAQA 1R1JA 1PWPA 2Y6CA 3ELMA 5CUHA 4XM8A 1Y93A 1JK3A 3P24A 966CA 3B2ZA 1EUBA 4PKTA 1IAAA 2DDYA 3DNGA 2W15A 4WKEA 1SMPA 1CQRA 3HDAP 1BSWA 1USNA 4AIGA 1K7IA 4FVLA
chains in the Genus database with same CATH topology
3L0VA 1XFWA 2OY4A 1ATLA 2AYKA 4L19A 4G0DA 3TSKA 1HOVA 5D3CA 2OW1A 2JT5A 2X3AA 3G5CA 3K7NA 3MA2A 1ZXCA 1IACA 1Y8JA 2MZEA 3LK8A 2J0TA 2HU6A 2PJTA 4DD8A 3AYKA 4GQLA 5I4OA 4PKSA 1GKCA 1YP1A 2JNPA 2OZRA 3LJGA 3Q2GA 3LJTA 4DV8A 3HY7A 1CXVA 1IABA 4FXQA 1CAQA 1KAPP 2OW0A 2WOAA 3U1RA 1HFSA 1B8YA 1SLNA 4H1QA 3OHOA 1H71P 2YUFA 4JIJA 3L0TA 3DTIA 3F17A 1ND1A 3LKAA 2OVXA 1WNIA 3EHXA 5L7FA 5I2ZA 1C3IA 3TS4A 1MMRA 4I03A 3K7LA 4WK7A 1K7QA 3OHLA 3O64A 1XUCA 1I1IP 5D7WA 3HBUP 4WKIA 3LGPA 1SRPA 3DTEA 2N8RA 3HB2P 1FBLA 4CTHA 1G05A 1KUKA 1BUDA 1ZTQA 2ERQA 4H3XA 2W13A 1B3DA 1GO8P 2K2GA 4GR8A 3LJZA 1RMZA 2D1OA 1CGEA 1FLSA 2OY2A 3VI1A 1FM1A 2RJPA 2O3EA 2D1NA 2XS3A 1JIZA 1QUAA 1JKYA 4GWMA 1IAGA 1JH1A 3USNA 2OW9A 2V4BA 2X3CA 3BA0A 4R3VA 1R1IA 1MMPA 4WZVA 1OO9A 4ZR5A 1QIBA 2I47A 3TT4A 1EB6A 5D1UA 4A7BA 1I73A 1O0QA 5I12A 3RTTA 1IAEA 2W0DA 1BIWA 1CK7A 3EDZA 3F16A 1UTTA 3SHIA 4XM7A 1GXDA 3P1VA 2X7MA 3KRYA 3Q2HA 2DW1A 1DMTA 1OM8A 2DW0A 1XUDA 3DSLA 3E8RA 2CKIA 2E3XA 4JQGA 3VTGA 3WV1A 4EFSA 2OXWA 2MLRA 2J83A 3DL1A 1C8TA 4AUOA 456CA 1D8FA 1Y0VA 3N2VA 2OI0A 1UMSA 2DDFA 5BOTA 4FXYP 1K7GA 1UMTA 1QICA 4PKRA 1MMBA 3LQBA 4JP4A 3KMEA 4L63A 3V96B 1GO7P 3HYGA 2YIGA 4Q1LA 3TVCA 4XM6A 3LILA 4XBHA 2MZHA 3KHIA 4IJOA 1SATA 2KRJA 5JMYA 1XFXA 1G49A 1R55A 3I7GA 1DTHA 5LABA 4H82A 4GR0A 2JSDA 4PKQA 3ZVSA 1YOUA 1BKCI 1HTDA 1J7NA 2OXUA 1R1HA 5BPAA 1XURA 1ASTA 1ROSA 1ZVXA 1AF0A 1PWVA 3EDIA 1ZP5A 4GF1A 5I0LA 2K9CA 1YQYA 1BKCE 830CA 3B8ZA 3DPEA 1XFZA 1GKDA 2JT6A 5CXAA 3AYUA 1OS2A 4J4MA 3F18A 4A3WA 3DTKA 1JANA 3NX7A 1KBCA 1QJIA 5I43A 1PWUA 4JPAA 4AYKA 2XS4A 4IN9A 2SRTA 1QJJA 3LE9A 1MMQA 1YCMA 3RTSA 3F15A 1D5JA 5BOYA 3KWVC 4DF9A 2FV9A 4AXQA 2QPJA 1GE5A 4H2EA 2EROA 2RJQA 3EWJA 1D8MA 1GE7A 3EDHA 3LMCA 3KEJA 4WF6A 2OW2A 3WV3A 5B5OA 1CGLA 1G12A 5L79A 1OM6A 2Z2DA 2A8HA 1JJ9A 4PKVA 4GWNA 3DWBA 2OXZA 4L6TA 3B92A 1XFYA 3KEKA 2FV5A 5B5PA 4JA1A 3UVCA 1D7XA 2AIGP 1HV5A 3O2XA 1BKCA 1EAKA 1PWQA 5H8XA 2DW2A 1O0TA 3LIKA 1OM7A 3ZXHA 1Z3JA 1R54A 1UTZA 2USNA 1QIAA 3WV2A 1C7KA 1ZS0A 1OS9A 2W12A 1Q3AA 3F1AA 1S4BP 2MZIA 5I3MA 1CIZA 1JAOA 4PKWA 2MLSA 2Y6DA 1L6JA 2W14A 4IUWA 2TCLA 1A85A 1KUHA 2L0RA 5CZMA 3KECA 2WO8A 1G4KA 1ZXVA 2POJA 1AYKA 1I76A 5D1SA 3LUNA 3AIGA 2WO9A 1UEAA 1OMJA 3HBVP 4HX3A 4HMAA 3LIRA 4GUYA 3ZUKA 3HDBA 1SLMA 1AKLA 2CLTA 3HY9A 3CKIA 1PWWA 4GR3A 3EHYA 3KMCA 1XFVA 2OVZA 4I35A 2X3BA 4DPEA 4PKUA 2YB9A 2JIHA 4XCTA 4QKZA 4ON1A 4L7AA 1A86A 1BZSA 1HFCA 1RM8A 4FU4A 1BUVM 3EDGA 1HY7A 4H76A 1KUGA 5D1TA 4H84A 3N2UA 1JIWP 1IADA 2E2DA 1CGFA 1SU3A 5D2BA 1JAPA 4H49A 2O36A 1BQOA 3G42A 3GBOA 1GE6A 3I7IA 3F19A 1KUFA 1MNCA 1KUIA 3LUMA 3DPFA 4G9LA 4ILWD 1BQQM 2ERPA 1XFUA 3LEAA 1BM6A 3LQ0A 1G9KA 4H30A 1JAQA 1R1JA 1PWPA 2Y6CA 3ELMA 5CUHA 4XM8A 1Y93A 1JK3A 3P24A 966CA 3B2ZA 1EUBA 4PKTA 1IAAA 2DDYA 3DNGA 2W15A 4WKEA 1SMPA 1CQRA 3HDAP 1BSWA 1USNA 4AIGA 1K7IA 4FVLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3L0V A;  1XFW A;  2OY4 A;  1ATL A;  2AYK A;  4L19 A;  4G0D A;  3TSK A;  1HOV A;  5D3C A;  2OW1 A;  2JT5 A;  2X3A A;  3G5C A;  3K7N A;  3MA2 A;  1ZXC A;  1IAC A;  1Y8J A;  2MZE A;  3LK8 A;  2J0T A;  2HU6 A;  2PJT A;  4DD8 A;  3AYK A;  4GQL A;  5I4O A;  4PKS A;  1GKC A;  1YP1 A;  2JNP A;  2OZR A;  3LJG A;  3Q2G A;  3LJT A;  4DV8 A;  3HY7 A;  1CXV A;  1IAB A;  4FXQ A;  1CAQ A;  1KAP P;  2OW0 A;  2WOA A;  3U1R A;  1HFS A;  1B8Y A;  1SLN A;  4H1Q A;  3OHO A;  1H71 P;  4JIJ A;  3L0T A;  3F17 A;  1ND1 A;  3LKA A;  2OVX A;  1WNI A;  3EHX A;  5L7F A;  5I2Z A;  1C3I A;  3TS4 A;  1MMR A;  4I03 A;  3K7L A;  4WK7 A;  1K7Q A;  3OHL A;  3O64 A;  1XUC A;  1I1I P;  5D7W A;  3HBU P;  4WKI A;  3LGP A;  1SRP A;  2N8R A;  3HB2 P;  1FBL A;  4CTH A;  1G05 A;  1KUK A;  1BUD A;  1ZTQ A;  2ERQ A;  4H3X A;  2W13 A;  1B3D A;  1GO8 P;  2K2G A;  4GR8 A;  3LJZ A;  1RMZ A;  2D1O A;  1CGE A;  1FLS A;  2OY2 A;  3VI1 A;  1FM1 A;  2RJP A;  2O3E A;  2D1N A;  2XS3 A;  1JIZ A;  1QUA A;  1JKY A;  4GWM A;  1IAG A;  1JH1 A;  3USN A;  2OW9 A;  2V4B A;  2X3C A;  3BA0 A;  4R3V A;  1R1I A;  1MMP A;  4WZV A;  1OO9 A;  4ZR5 A;  1QIB A;  2I47 A;  3TT4 A;  1EB6 A;  5D1U A;  4A7B A;  1I73 A;  1O0Q A;  5I12 A;  3RTT A;  1IAE A;  2W0D A;  1BIW A;  1CK7 A;  3EDZ A;  3F16 A;  1UTT A;  3SHI A;  4XM7 A;  1GXD A;  3P1V A;  2X7M A;  3KRY A;  3Q2H A;  2DW1 A;  1DMT A;  1OM8 A;  2DW0 A;  1XUD A;  3DSL A;  3E8R A;  2CKI A;  2E3X A;  4JQG A;  3VTG A;  3WV1 A;  4EFS A;  2OXW A;  2MLR A;  2J83 A;  3DL1 A;  1C8T A;  4AUO A;  456C A;  1D8F A;  1Y0V A;  3N2V A;  2OI0 A;  1UMS A;  2DDF A;  5BOT A;  4FXY P;  1K7G A;  1UMT A;  1QIC A;  4PKR A;  1MMB A;  3LQB A;  4JP4 A;  3KME A;  4L63 A;  3V96 B;  1GO7 P;  3HYG A;  2YIG A;  4Q1L A;  3TVC A;  4XM6 A;  3LIL A;  4XBH A;  2MZH A;  3KHI A;  4IJO A;  1SAT A;  2KRJ A;  5JMY A;  1XFX A;  1G49 A;  1R55 A;  3I7G A;  1DTH A;  5LAB A;  4H82 A;  4GR0 A;  2JSD A;  4PKQ A;  3ZVS A;  1YOU A;  1BKC I;  1HTD A;  1J7N A;  2OXU A;  1R1H A;  5BPA A;  1XUR A;  1AST A;  1ROS A;  1ZVX A;  1AF0 A;  1PWV A;  3EDI A;  1ZP5 A;  4GF1 A;  5I0L A;  2K9C A;  1YQY A;  1BKC E;  830C A;  3B8Z A;  3DPE A;  1XFZ A;  1GKD A;  2JT6 A;  5CXA A;  3AYU A;  1OS2 A;  4J4M A;  3F18 A;  4A3W A;  1JAN A;  3NX7 A;  1KBC A;  1QJI A;  5I43 A;  1PWU A;  4JPA A;  4AYK A;  2XS4 A;  4IN9 A;  2SRT A;  1QJJ A;  3LE9 A;  1MMQ A;  1YCM A;  3RTS A;  3F15 A;  1D5J A;  5BOY A;  3KWV C;  4DF9 A;  2FV9 A;  4AXQ A;  2QPJ A;  1GE5 A;  4H2E A;  2ERO A;  2RJQ A;  3EWJ A;  1D8M A;  1GE7 A;  3EDH A;  3LMC A;  3KEJ A;  4WF6 A;  2OW2 A;  3WV3 A;  5B5O A;  1CGL A;  1G12 A;  5L79 A;  1OM6 A;  2Z2D A;  2A8H A;  1JJ9 A;  4PKV A;  4GWN A;  3DWB A;  2OXZ A;  4L6T A;  3B92 A;  1XFY A;  3KEK A;  2FV5 A;  5B5P A;  4JA1 A;  3UVC A;  1D7X A;  2AIG P;  1HV5 A;  3O2X A;  1BKC A;  1EAK A;  1PWQ A;  5H8X A;  2DW2 A;  1O0T A;  3LIK A;  1OM7 A;  3ZXH A;  1Z3J A;  1R54 A;  1UTZ A;  2USN A;  1QIA A;  3WV2 A;  1C7K A;  1ZS0 A;  1OS9 A;  2W12 A;  1Q3A A;  3F1A A;  1S4B P;  2MZI A;  5I3M A;  1CIZ A;  1JAO A;  4PKW A;  2MLS A;  2Y6D A;  1L6J A;  2W14 A;  4IUW A;  2TCL A;  1A85 A;  1KUH A;  2L0R A;  5CZM A;  3KEC A;  2WO8 A;  1G4K A;  1ZXV A;  2POJ A;  1AYK A;  1I76 A;  5D1S A;  3LUN A;  3AIG A;  2WO9 A;  1UEA A;  1OMJ A;  3HBV P;  4HX3 A;  4HMA A;  3LIR A;  4GUY A;  3ZUK A;  3HDB A;  1SLM A;  1AKL A;  2CLT A;  3HY9 A;  3CKI A;  1PWW A;  4GR3 A;  3EHY A;  3KMC A;  1XFV A;  2OVZ A;  4I35 A;  2X3B A;  4DPE A;  4PKU A;  2YB9 A;  2JIH A;  4XCT A;  4QKZ A;  4ON1 A;  1A86 A;  1BZS A;  1HFC A;  1RM8 A;  4FU4 A;  1BUV M;  3EDG A;  1HY7 A;  4H76 A;  1KUG A;  5D1T A;  4H84 A;  3N2U A;  1JIW P;  1IAD A;  2E2D A;  1CGF A;  1SU3 A;  5D2B A;  1JAP A;  4H49 A;  2O36 A;  1BQO A;  3G42 A;  3GBO A;  1GE6 A;  3I7I A;  3F19 A;  1KUF A;  1MNC A;  1KUI A;  3LUM A;  3DPF A;  4G9L A;  4ILW D;  1BQQ M;  2ERP A;  1XFU A;  3LEA A;  1BM6 A;  3LQ0 A;  1G9K A;  4H30 A;  1JAQ A;  1R1J A;  1PWP A;  2Y6C A;  3ELM A;  5CUH A;  4XM8 A;  1Y93 A;  1JK3 A;  3P24 A;  966C A;  3B2Z A;  1EUB A;  4PKT A;  1IAA A;  2DDY A;  3DNG A;  2W15 A;  4WKE A;  1SMP A;  1CQR A;  3HDA P;  1BSW A;  1USN A;  4AIG A;  1K7I A;  4FVL A; 
#chains in the Genus database with same CATH topology
 3L0V A;  1XFW A;  2OY4 A;  1ATL A;  2AYK A;  4L19 A;  4G0D A;  3TSK A;  1HOV A;  5D3C A;  2OW1 A;  2JT5 A;  2X3A A;  3G5C A;  3K7N A;  3MA2 A;  1ZXC A;  1IAC A;  1Y8J A;  2MZE A;  3LK8 A;  2J0T A;  2HU6 A;  1OZ9 A;  2PJT A;  4DD8 A;  3AYK A;  4GQL A;  5I4O A;  4PKS A;  1GKC A;  1YP1 A;  2JNP A;  2OZR A;  3LJG A;  3Q2G A;  3LJT A;  4DV8 A;  3HY7 A;  1CXV A;  1IAB A;  4FXQ A;  1CAQ A;  1KAP P;  2OW0 A;  2WOA A;  3U1R A;  1HFS A;  1B8Y A;  1SLN A;  4H1Q A;  3OHO A;  1H71 P;  2YUF A;  4JIJ A;  3L0T A;  3DTI A;  3F17 A;  1ND1 A;  3LKA A;  2OVX A;  1WNI A;  3EHX A;  5L7F A;  5I2Z A;  1C3I A;  3TS4 A;  1MMR A;  4I03 A;  3K7L A;  4WK7 A;  1K7Q A;  3OHL A;  3O64 A;  1XUC A;  1I1I P;  5D7W A;  3HBU P;  4WKI A;  3LGP A;  1SRP A;  3DTE A;  2N8R A;  3HB2 P;  1FBL A;  4CTH A;  1G05 A;  1KUK A;  1BUD A;  1ZTQ A;  2ERQ A;  4H3X A;  2W13 A;  1B3D A;  1GO8 P;  2K2G A;  4GR8 A;  3LJZ A;  1RMZ A;  2D1O A;  1CGE A;  1FLS A;  2OY2 A;  3VI1 A;  1FM1 A;  2RJP A;  2O3E A;  2D1N A;  2XS3 A;  1JIZ A;  1QUA A;  1JKY A;  4GWM A;  1IAG A;  1JH1 A;  3USN A;  2OW9 A;  2V4B A;  2X3C A;  3BA0 A;  4R3V A;  1R1I A;  1MMP A;  4WZV A;  1OO9 A;  4ZR5 A;  1QIB A;  2I47 A;  3TT4 A;  1EB6 A;  5D1U A;  4A7B A;  1I73 A;  1O0Q A;  5I12 A;  3RTT A;  1IAE A;  2W0D A;  1BIW A;  1CK7 A;  3EDZ A;  3F16 A;  1UTT A;  3SHI A;  4XM7 A;  1GXD A;  1XM5 A;  3P1V A;  2X7M A;  3KRY A;  3Q2H A;  2DW1 A;  1DMT A;  1OM8 A;  2DW0 A;  1XUD A;  3DSL A;  3E8R A;  2CKI A;  2E3X A;  4JQG A;  3VTG A;  3WV1 A;  4EFS A;  2OXW A;  2MLR A;  2J83 A;  3DL1 A;  1C8T A;  4AUO A;  456C A;  1D8F A;  1Y0V A;  3N2V A;  2OI0 A;  1UMS A;  2DDF A;  5BOT A;  4FXY P;  1K7G A;  1UMT A;  1QIC A;  4PKR A;  1MMB A;  3LQB A;  4JP4 A;  3KME A;  4L63 A;  3V96 B;  1GO7 P;  3HYG A;  2YIG A;  4Q1L A;  3TVC A;  4XM6 A;  3LIL A;  4XBH A;  2MZH A;  3KHI A;  4IJO A;  1SAT A;  2KRJ A;  5JMY A;  1XFX A;  1G49 A;  1R55 A;  3I7G A;  1DTH A;  5LAB A;  4H82 A;  4GR0 A;  2JSD A;  4PKQ A;  3ZVS A;  1YOU A;  1BKC I;  1HTD A;  1J7N A;  2OXU A;  1R1H A;  5BPA A;  1XUR A;  1AST A;  1ROS A;  1ZVX A;  1AF0 A;  1PWV A;  3EDI A;  1ZP5 A;  4GF1 A;  5I0L A;  2K9C A;  1YQY A;  1BKC E;  830C A;  3B8Z A;  3DPE A;  1XFZ A;  1GKD A;  2JT6 A;  5CXA A;  3AYU A;  1OS2 A;  4J4M A;  3F18 A;  4A3W A;  3DTK A;  1XAX A;  1JAN A;  3NX7 A;  1KBC A;  1QJI A;  5I43 A;  1PWU A;  4JPA A;  4AYK A;  2XS4 A;  4IN9 A;  2SRT A;  1QJJ A;  3LE9 A;  1MMQ A;  1YCM A;  3RTS A;  3F15 A;  1D5J A;  5BOY A;  3KWV C;  4DF9 A;  2FV9 A;  4AXQ A;  2QPJ A;  1GE5 A;  4H2E A;  2ERO A;  2RJQ A;  3EWJ A;  1D8M A;  1GE7 A;  3EDH A;  3LMC A;  3KEJ A;  4WF6 A;  2OW2 A;  3WV3 A;  5B5O A;  1CGL A;  1G12 A;  5L79 A;  1OM6 A;  2Z2D A;  2A8H A;  1JJ9 A;  4PKV A;  4GWN A;  3DWB A;  2OXZ A;  4L6T A;  3B92 A;  1XFY A;  3KEK A;  2FV5 A;  5B5P A;  4JA1 A;  3UVC A;  1D7X A;  2AIG P;  1HV5 A;  3O2X A;  1BKC A;  1EAK A;  1PWQ A;  5H8X A;  2DW2 A;  1O0T A;  3LIK A;  1OM7 A;  3ZXH A;  1Z3J A;  1R54 A;  1UTZ A;  2USN A;  1QIA A;  3WV2 A;  1C7K A;  1ZS0 A;  1OS9 A;  2W12 A;  1Q3A A;  3F1A A;  1S4B P;  2MZI A;  5I3M A;  1CIZ A;  1JAO A;  4PKW A;  2MLS A;  2Y6D A;  1L6J A;  2W14 A;  4IUW A;  2TCL A;  1A85 A;  1KUH A;  2L0R A;  5CZM A;  3KEC A;  2WO8 A;  1G4K A;  1ZXV A;  2POJ A;  1AYK A;  1I76 A;  5D1S A;  3LUN A;  3AIG A;  2WO9 A;  1UEA A;  1OMJ A;  3HBV P;  4HX3 A;  4HMA A;  3LIR A;  4GUY A;  3ZUK A;  3HDB A;  1SLM A;  1AKL A;  2CLT A;  3HY9 A;  3CKI A;  1PWW A;  4GR3 A;  3EHY A;  3KMC A;  1XFV A;  2OVZ A;  4I35 A;  2X3B A;  4DPE A;  4PKU A;  2YB9 A;  2JIH A;  4XCT A;  4QKZ A;  4ON1 A;  4L7A A;  1A86 A;  1BZS A;  1HFC A;  1RM8 A;  4FU4 A;  1BUV M;  3EDG A;  1HY7 A;  4H76 A;  1KUG A;  5D1T A;  4H84 A;  3N2U A;  1JIW P;  1IAD A;  2E2D A;  1CGF A;  1SU3 A;  5D2B A;  1JAP A;  4H49 A;  2O36 A;  1BQO A;  3G42 A;  3GBO A;  1GE6 A;  3I7I A;  3F19 A;  1KUF A;  1MNC A;  1KUI A;  1TVI A;  3LUM A;  3DPF A;  4G9L A;  4ILW D;  1BQQ M;  2ERP A;  1XFU A;  3LEA A;  1BM6 A;  3LQ0 A;  1G9K A;  4H30 A;  1JAQ A;  1R1J A;  1PWP A;  2Y6C A;  3ELM A;  5CUH A;  4XM8 A;  1Y93 A;  1JK3 A;  3P24 A;  966C A;  3B2Z A;  1EUB A;  4PKT A;  1IAA A;  2DDY A;  3DNG A;  2W15 A;  4WKE A;  1SMP A;  1CQR A;  3HDA P;  1BSW A;  1USN A;  4AIG A;  1K7I A;  4FVL A; 
#chains in the Genus database with same CATH homology
 3L0V A;  1XFW A;  2OY4 A;  1ATL A;  2AYK A;  4L19 A;  4G0D A;  3TSK A;  1HOV A;  5D3C A;  2OW1 A;  2JT5 A;  2X3A A;  3G5C A;  3K7N A;  3MA2 A;  1ZXC A;  1IAC A;  1Y8J A;  2MZE A;  3LK8 A;  2J0T A;  2HU6 A;  2PJT A;  4DD8 A;  3AYK A;  4GQL A;  5I4O A;  4PKS A;  1GKC A;  1YP1 A;  2JNP A;  2OZR A;  3LJG A;  3Q2G A;  3LJT A;  4DV8 A;  3HY7 A;  1CXV A;  1IAB A;  4FXQ A;  1CAQ A;  1KAP P;  2OW0 A;  2WOA A;  3U1R A;  1HFS A;  1B8Y A;  1SLN A;  4H1Q A;  3OHO A;  1H71 P;  2YUF A;  4JIJ A;  3L0T A;  3DTI A;  3F17 A;  1ND1 A;  3LKA A;  2OVX A;  1WNI A;  3EHX A;  5L7F A;  5I2Z A;  1C3I A;  3TS4 A;  1MMR A;  4I03 A;  3K7L A;  4WK7 A;  1K7Q A;  3OHL A;  3O64 A;  1XUC A;  1I1I P;  5D7W A;  3HBU P;  4WKI A;  3LGP A;  1SRP A;  3DTE A;  2N8R A;  3HB2 P;  1FBL A;  4CTH A;  1G05 A;  1KUK A;  1BUD A;  1ZTQ A;  2ERQ A;  4H3X A;  2W13 A;  1B3D A;  1GO8 P;  2K2G A;  4GR8 A;  3LJZ A;  1RMZ A;  2D1O A;  1CGE A;  1FLS A;  2OY2 A;  3VI1 A;  1FM1 A;  2RJP A;  2O3E A;  2D1N A;  2XS3 A;  1JIZ A;  1QUA A;  1JKY A;  4GWM A;  1IAG A;  1JH1 A;  3USN A;  2OW9 A;  2V4B A;  2X3C A;  3BA0 A;  4R3V A;  1R1I A;  1MMP A;  4WZV A;  1OO9 A;  4ZR5 A;  1QIB A;  2I47 A;  3TT4 A;  1EB6 A;  5D1U A;  4A7B A;  1I73 A;  1O0Q A;  5I12 A;  3RTT A;  1IAE A;  2W0D A;  1BIW A;  1CK7 A;  3EDZ A;  3F16 A;  1UTT A;  3SHI A;  4XM7 A;  1GXD A;  3P1V A;  2X7M A;  3KRY A;  3Q2H A;  2DW1 A;  1DMT A;  1OM8 A;  2DW0 A;  1XUD A;  3DSL A;  3E8R A;  2CKI A;  2E3X A;  4JQG A;  3VTG A;  3WV1 A;  4EFS A;  2OXW A;  2MLR A;  2J83 A;  3DL1 A;  1C8T A;  4AUO A;  456C A;  1D8F A;  1Y0V A;  3N2V A;  2OI0 A;  1UMS A;  2DDF A;  5BOT A;  4FXY P;  1K7G A;  1UMT A;  1QIC A;  4PKR A;  1MMB A;  3LQB A;  4JP4 A;  3KME A;  4L63 A;  3V96 B;  1GO7 P;  3HYG A;  2YIG A;  4Q1L A;  3TVC A;  4XM6 A;  3LIL A;  4XBH A;  2MZH A;  3KHI A;  4IJO A;  1SAT A;  2KRJ A;  5JMY A;  1XFX A;  1G49 A;  1R55 A;  3I7G A;  1DTH A;  5LAB A;  4H82 A;  4GR0 A;  2JSD A;  4PKQ A;  3ZVS A;  1YOU A;  1BKC I;  1HTD A;  1J7N A;  2OXU A;  1R1H A;  5BPA A;  1XUR A;  1AST A;  1ROS A;  1ZVX A;  1AF0 A;  1PWV A;  3EDI A;  1ZP5 A;  4GF1 A;  5I0L A;  2K9C A;  1YQY A;  1BKC E;  830C A;  3B8Z A;  3DPE A;  1XFZ A;  1GKD A;  2JT6 A;  5CXA A;  3AYU A;  1OS2 A;  4J4M A;  3F18 A;  4A3W A;  3DTK A;  1JAN A;  3NX7 A;  1KBC A;  1QJI A;  5I43 A;  1PWU A;  4JPA A;  4AYK A;  2XS4 A;  4IN9 A;  2SRT A;  1QJJ A;  3LE9 A;  1MMQ A;  1YCM A;  3RTS A;  3F15 A;  1D5J A;  5BOY A;  3KWV C;  4DF9 A;  2FV9 A;  4AXQ A;  2QPJ A;  1GE5 A;  4H2E A;  2ERO A;  2RJQ A;  3EWJ A;  1D8M A;  1GE7 A;  3EDH A;  3LMC A;  3KEJ A;  4WF6 A;  2OW2 A;  3WV3 A;  5B5O A;  1CGL A;  1G12 A;  5L79 A;  1OM6 A;  2Z2D A;  2A8H A;  1JJ9 A;  4PKV A;  4GWN A;  3DWB A;  2OXZ A;  4L6T A;  3B92 A;  1XFY A;  3KEK A;  2FV5 A;  5B5P A;  4JA1 A;  3UVC A;  1D7X A;  2AIG P;  1HV5 A;  3O2X A;  1BKC A;  1EAK A;  1PWQ A;  5H8X A;  2DW2 A;  1O0T A;  3LIK A;  1OM7 A;  3ZXH A;  1Z3J A;  1R54 A;  1UTZ A;  2USN A;  1QIA A;  3WV2 A;  1C7K A;  1ZS0 A;  1OS9 A;  2W12 A;  1Q3A A;  3F1A A;  1S4B P;  2MZI A;  5I3M A;  1CIZ A;  1JAO A;  4PKW A;  2MLS A;  2Y6D A;  1L6J A;  2W14 A;  4IUW A;  2TCL A;  1A85 A;  1KUH A;  2L0R A;  5CZM A;  3KEC A;  2WO8 A;  1G4K A;  1ZXV A;  2POJ A;  1AYK A;  1I76 A;  5D1S A;  3LUN A;  3AIG A;  2WO9 A;  1UEA A;  1OMJ A;  3HBV P;  4HX3 A;  4HMA A;  3LIR A;  4GUY A;  3ZUK A;  3HDB A;  1SLM A;  1AKL A;  2CLT A;  3HY9 A;  3CKI A;  1PWW A;  4GR3 A;  3EHY A;  3KMC A;  1XFV A;  2OVZ A;  4I35 A;  2X3B A;  4DPE A;  4PKU A;  2YB9 A;  2JIH A;  4XCT A;  4QKZ A;  4ON1 A;  4L7A A;  1A86 A;  1BZS A;  1HFC A;  1RM8 A;  4FU4 A;  1BUV M;  3EDG A;  1HY7 A;  4H76 A;  1KUG A;  5D1T A;  4H84 A;  3N2U A;  1JIW P;  1IAD A;  2E2D A;  1CGF A;  1SU3 A;  5D2B A;  1JAP A;  4H49 A;  2O36 A;  1BQO A;  3G42 A;  3GBO A;  1GE6 A;  3I7I A;  3F19 A;  1KUF A;  1MNC A;  1KUI A;  3LUM A;  3DPF A;  4G9L A;  4ILW D;  1BQQ M;  2ERP A;  1XFU A;  3LEA A;  1BM6 A;  3LQ0 A;  1G9K A;  4H30 A;  1JAQ A;  1R1J A;  1PWP A;  2Y6C A;  3ELM A;  5CUH A;  4XM8 A;  1Y93 A;  1JK3 A;  3P24 A;  966C A;  3B2Z A;  1EUB A;  4PKT A;  1IAA A;  2DDY A;  3DNG A;  2W15 A;  4WKE A;  1SMP A;  1CQR A;  3HDA P;  1BSW A;  1USN A;  4AIG A;  1K7I A;  4FVL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...