1I76A

Complex of 2-(biphenyl-4-sulfonyl)-1,2,3,4-tetrahydro-isoquinoline-3-carboxylic acid (d-tic derivative) with t catalitic domain of matrix metallo proteinase-8 (met80 form)
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
163
structure length
163
Chain Sequence
MLTPGNPKWERTNLTYRIRNYTPQLSEAEVERAIKDAFELWSVASPLIFTRISQGEADINIAFYQRDHGDNSPFDGPNGILAHAFQPGQGIGGDAHFDAEETWTNTSANYNLFLVAAHEFGHSLGLAHSSDPGALMYPNYAFRETSNYSLPQDDIDGIQAIYG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Two crystal structures of human neutrophil collagenase, one complexed with a primed- and the other with an unprimed-side inhibitor: implications for drug design.
pubmed doi rcsb
molecule keywords NEUTROPHIL COLLAGENASE
molecule tags Hydrolase
source organism Homo sapiens
total genus 49
structure length 163
sequence length 163
ec nomenclature ec 3.4.24.34: Neutrophil collagenase.
pdb deposition date 2001-03-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00413 Peptidase_M10 Matrixin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.390.10 Alpha Beta 3-Layer(aba) Sandwich Collagenase (Catalytic Domain) Collagenase (Catalytic Domain) 1i76A00
3LILA 1BKCA 4EFSA 1ZXVA 3AYUA 2W12A 1K7GA 4GF1A 1Y0VA 4DD8A 4H3XA 1G9KA 1ZVXA 2MZEA 2CLTA 1AKLA 3B2ZA 3G5CA 1XFUA 3AIGA 5B5PA 2OXWA 1RM8A 1GKDA 1BQOA 5D1TA 3TSKA 3TS4A 3EWJA 4G9LA 1K7IA 1CAQA 1ZS0A 5LABA 5I2ZA 1Q3AA 1IACA 1SRPA 966CA 1ROSA 1AYKA 1KUHA 3EDHA 5D1SA 3BA0A 1KBCA 1KUKA 5CZMA 3VTGA 2CKIA 4J4MA 1ASTA 1OM8A 1GO7P 1WNIA 1Z3JA 3Q2HA 3P1VA 1XUCA 1BQQM 4GUYA 4JPAA 2DDFA 1GXDA 1UEAA 1OS2A 3I7GA 4AIGA 3OHLA 3F15A 4GWMA 1JAQA 1L6JA 5I0LA 4H84A 1QJIA 1QIAA 3HBVP 1JAPA 1PWVA 3O64A 1HFCA 3HY7A 4ZR5A 4A7BA 4I35A 1QJJA 1SLMA 2A8HA 3LUNA 1Y8JA 2YB9A 3P24A 3WV3A 1I76A 4DF9A 1MMPA 1DMTA 1I1IP 2N8RA 1A86A 4AXQA 4H76A 4GWNA 1CIZA 3AYKA 1HTDA 1IAEA 1BM6A 1DTHA 3UVCA 3Q2GA 1KUFA 1JAOA 1K7QA 4PKWA 1YOUA 4FXYP 2AIGP 2OY2A 3B8ZA 2W14A 3LIKA 1JH1A 5I43A 1IAAA 2TCLA 3DNGA 4G0DA 3RTSA 2USNA 4H1QA 5CUHA 1C3IA 4WKIA 2K9CA 3NX7A 1ATLA 2Z2DA 3CKIA 2MZHA 2OZRA 2W13A 1QICA 3LJGA 2W0DA 1CXVA 1OM6A 5BOTA 2ERQA 2OXZA 1XUDA 5B5OA 4DPEA 1FBLA 1IAGA 1BIWA 2OXUA 1PWPA 2L0RA 3F19A 1PWUA 3LJZA 3ZUKA 1HV5A 4IN9A 4R3VA 2XS3A 2JT5A 2POJA 1BKCE 1BUVM 3HBUP 2MLRA 3LK8A 2V4BA 3N2VA 1HY7A 1XFVA 5CXAA 4FVLA 3V96B 5L7FA 4ON1A 2WO8A 3EHXA 1S4BP 1PWWA 3VI1A 3G42A 830CA 2HU6A 2MZIA 1BUDA 3K7NA 2RJQA 2OI0A 1YQYA 3LKAA 3E8RA 3TT4A 1OO9A 5I4OA 2I47A 1GO8P 1R1JA 4XM8A 1SU3A 4H49A 3KHIA 2OVXA 3HB2P 1D5JA 4XM7A 2AYKA 1B3DA 1USNA 3EDIA 2E2DA 4XBHA 3DPEA 3K7LA 3HYGA 1JKYA 4PKSA 2ERPA 2OW1A 4WK7A 1MMBA 5D2BA 1D8MA 4A3WA 4WKEA 1EUBA 2EROA 1YCMA 2WO9A 3F16A 1QIBA 3O2XA 3LUMA 2D1OA 4L63A 1XFZA 3LJTA 1R55A 3U1RA 2E3XA 1O0QA 2XS4A 1OM7A 3ZXHA 3LIRA 3HDBA 1ZP5A 1MMQA 456CA 4L19A 2O36A 3F17A 1FM1A 3EDZA 2FV9A 1I73A 3USNA 2WOAA 1JJ9A 4DV8A 5D3CA 1G49A 3LE9A 3ELMA 1CQRA 2DW1A 4H82A 2OW0A 2X3CA 2D1NA 2RJPA 4L6TA 4PKRA 2MLSA 1J7NA 2O3EA 3WV2A 1D8FA 4H30A 1UMSA 3KEJA 4IJOA 5D7WA 1YP1A 1G05A 1XFYA 1G12A 2Y6DA 5BOYA 3DSLA 4ILWD 3L0TA 4HMAA 4XCTA 3EHYA 1RMZA 2X7MA 2JNPA 4JP4A 4HX3A 1SATA 2JSDA 4I03A 3I7IA 1OMJA 1XFWA 3F1AA 1GE6A 2OW2A 3GBOA 4GR3A 3B92A 4AUOA 3ZVSA 1G4KA 1ZXCA 2J83A 1ND1A 1XFXA 2KRJA 1A85A 3LQBA 1R1IA 5D1UA 4H2EA 3KMCA 3F18A 4CTHA 4PKTA 4GR8A 2OW9A 1O0TA 1EB6A 3MA2A 1CGFA 1KAPP 4IUWA 1Y93A 4FU4A 3SHIA 3WV1A 3N2UA 1JK3A 1B8YA 1GE7A 3KRYA 3DWBA 1C8TA 1XURA 5BPAA 1C7KA 1H71P 3KMEA 2OVZA 2DW2A 3EDGA 2Y6CA 4JQGA 2J0TA 1UTZA 1EAKA 2X3AA 4QKZA 1IABA 1HOVA 5I3MA 3LQ0A 3KECA 1GKCA 3TVCA 2QPJA 1R54A 2K2GA 1MMRA 1UTTA 2PJTA 1UMTA 1IADA 3DPFA 2JIHA 4PKVA 1JIZA 4Q1LA 4WF6A 3LGPA 5JMYA 1SMPA 1OS9A 4JA1A 1QUAA 1KUIA 3RTTA 2W15A 3KEKA 5I12A 4GR0A 1AF0A 1PWQA 1HFSA 1GE5A 3LEAA 4AYKA 2X3BA 4WZVA 1SLNA 1JANA 1FLSA 1CGEA 4JIJA 4PKUA 4XM6A 1BKCI 1D7XA 4PKQA 4GQLA 3DL1A 3KWVC 3L0VA 2OY4A 2SRTA 3OHOA 1R1HA 3HDAP 2DDYA 1CGLA 5L79A 5H8XA 4FXQA 3HY9A 1KUGA 1MNCA 1CK7A 2YIGA 2DW0A 1BSWA 2JT6A 1JIWP 3LMCA 1BZSA 2FV5A 1ZTQA
chains in the Genus database with same CATH superfamily
3LILA 1BKCA 4EFSA 1ZXVA 3AYUA 2W12A 1K7GA 4GF1A 1Y0VA 4DD8A 4H3XA 1G9KA 1ZVXA 2MZEA 2CLTA 1AKLA 3B2ZA 3G5CA 1XFUA 3AIGA 5B5PA 2OXWA 1RM8A 1GKDA 1BQOA 5D1TA 3TSKA 3TS4A 3EWJA 4G9LA 1OZ9A 1K7IA 1CAQA 1ZS0A 5LABA 5I2ZA 1Q3AA 1IACA 1SRPA 966CA 1ROSA 1AYKA 1KUHA 3EDHA 5D1SA 3BA0A 1KBCA 1KUKA 5CZMA 3VTGA 2CKIA 4J4MA 1ASTA 1OM8A 1GO7P 1WNIA 1Z3JA 3Q2HA 3P1VA 1XUCA 1BQQM 4GUYA 4JPAA 2DDFA 1GXDA 1UEAA 1OS2A 3I7GA 4AIGA 3OHLA 3F15A 4GWMA 1JAQA 1L6JA 5I0LA 4H84A 3DTKA 1QJIA 1QIAA 3HBVP 1JAPA 1PWVA 3O64A 1HFCA 3HY7A 1XM5A 4ZR5A 4A7BA 4I35A 1QJJA 1SLMA 2A8HA 3LUNA 1Y8JA 2YB9A 3P24A 3WV3A 1I76A 4DF9A 1MMPA 1XAXA 1DMTA 1I1IP 2N8RA 1A86A 4AXQA 4H76A 4GWNA 1CIZA 3AYKA 1HTDA 1IAEA 1BM6A 1DTHA 3UVCA 3Q2GA 1KUFA 3DTEA 1JAOA 1K7QA 4PKWA 1YOUA 4FXYP 2AIGP 2OY2A 3B8ZA 2W14A 3LIKA 1JH1A 5I43A 1IAAA 2TCLA 3DNGA 4G0DA 3RTSA 2USNA 4H1QA 5CUHA 1C3IA 4WKIA 2K9CA 3NX7A 1ATLA 2Z2DA 3CKIA 2MZHA 2OZRA 2W13A 1QICA 3LJGA 2W0DA 1CXVA 1OM6A 5BOTA 2ERQA 2OXZA 1XUDA 5B5OA 4DPEA 1FBLA 1IAGA 1BIWA 2OXUA 1PWPA 2L0RA 3F19A 1PWUA 3LJZA 3ZUKA 1HV5A 4IN9A 4R3VA 2XS3A 2JT5A 2POJA 1BKCE 1BUVM 3HBUP 2MLRA 3LK8A 2V4BA 3N2VA 1HY7A 1XFVA 5CXAA 4FVLA 3V96B 5L7FA 4ON1A 2WO8A 3EHXA 1S4BP 1PWWA 3VI1A 3G42A 830CA 2HU6A 2MZIA 1BUDA 3K7NA 2RJQA 2OI0A 1YQYA 3LKAA 3E8RA 3TT4A 1OO9A 5I4OA 2I47A 1GO8P 1R1JA 4XM8A 1SU3A 4H49A 3KHIA 2OVXA 3HB2P 1D5JA 4XM7A 2AYKA 1B3DA 1USNA 3EDIA 2E2DA 4XBHA 3DPEA 3K7LA 3HYGA 1JKYA 4PKSA 2ERPA 2OW1A 4WK7A 1MMBA 5D2BA 1D8MA 4A3WA 4WKEA 1EUBA 2EROA 4L7AA 1YCMA 2WO9A 3F16A 1QIBA 3O2XA 3LUMA 2D1OA 4L63A 1XFZA 3LJTA 1R55A 3U1RA 2E3XA 1O0QA 2XS4A 1OM7A 3ZXHA 3LIRA 3HDBA 1ZP5A 1MMQA 456CA 4L19A 2O36A 3F17A 1FM1A 3EDZA 2FV9A 1I73A 3USNA 2WOAA 1JJ9A 4DV8A 5D3CA 1G49A 3LE9A 3ELMA 1CQRA 2DW1A 4H82A 2OW0A 2X3CA 2D1NA 2RJPA 4L6TA 4PKRA 2MLSA 1J7NA 2O3EA 3WV2A 1D8FA 4H30A 1UMSA 3KEJA 4IJOA 5D7WA 1YP1A 1G05A 1XFYA 1G12A 2Y6DA 5BOYA 3DSLA 4ILWD 3L0TA 4HMAA 4XCTA 3EHYA 1RMZA 2X7MA 2JNPA 4JP4A 4HX3A 1SATA 2JSDA 4I03A 3I7IA 1OMJA 1XFWA 3F1AA 1GE6A 2OW2A 3GBOA 4GR3A 3B92A 4AUOA 3ZVSA 1G4KA 1ZXCA 2J83A 1ND1A 1XFXA 2KRJA 1A85A 3LQBA 1R1IA 5D1UA 4H2EA 3KMCA 3F18A 4CTHA 4PKTA 4GR8A 2OW9A 1O0TA 1EB6A 3MA2A 1CGFA 1KAPP 4IUWA 1Y93A 4FU4A 3SHIA 3WV1A 3N2UA 1JK3A 1B8YA 1GE7A 3KRYA 3DWBA 1C8TA 1XURA 5BPAA 1C7KA 1H71P 3KMEA 2OVZA 2DW2A 3EDGA 2Y6CA 4JQGA 2J0TA 1UTZA 1EAKA 2X3AA 4QKZA 1IABA 1HOVA 5I3MA 3LQ0A 2YUFA 3KECA 1GKCA 3TVCA 2QPJA 1R54A 2K2GA 1MMRA 1UTTA 2PJTA 1UMTA 1IADA 3DPFA 1TVIA 2JIHA 4PKVA 1JIZA 4Q1LA 4WF6A 3LGPA 5JMYA 1SMPA 1OS9A 4JA1A 1QUAA 1KUIA 3RTTA 2W15A 3KEKA 5I12A 4GR0A 1AF0A 1PWQA 1HFSA 1GE5A 3LEAA 4AYKA 2X3BA 4WZVA 1SLNA 1JANA 1FLSA 1CGEA 4JIJA 4PKUA 4XM6A 1BKCI 1D7XA 4PKQA 4GQLA 3DL1A 3KWVC 3L0VA 2OY4A 2SRTA 3OHOA 1R1HA 3HDAP 2DDYA 1CGLA 5L79A 5H8XA 4FXQA 3DTIA 3HY9A 1KUGA 1MNCA 1CK7A 2YIGA 2DW0A 1BSWA 2JT6A 1JIWP 3LMCA 1BZSA 2FV5A 1ZTQA
chains in the Genus database with same CATH topology
3LILA 1BKCA 4EFSA 1ZXVA 3AYUA 2W12A 1K7GA 4GF1A 1Y0VA 4DD8A 4H3XA 1G9KA 1ZVXA 2MZEA 2CLTA 1AKLA 3B2ZA 3G5CA 1XFUA 3AIGA 5B5PA 2OXWA 1RM8A 1GKDA 1BQOA 5D1TA 3TSKA 3TS4A 3EWJA 4G9LA 1K7IA 1CAQA 1ZS0A 5LABA 5I2ZA 1Q3AA 1IACA 1SRPA 966CA 1ROSA 1AYKA 1KUHA 3EDHA 5D1SA 3BA0A 1KBCA 1KUKA 5CZMA 3VTGA 2CKIA 4J4MA 1ASTA 1OM8A 1GO7P 1WNIA 1Z3JA 3Q2HA 3P1VA 1XUCA 1BQQM 4GUYA 4JPAA 2DDFA 1GXDA 1UEAA 1OS2A 3I7GA 4AIGA 3OHLA 3F15A 4GWMA 1JAQA 1L6JA 5I0LA 4H84A 3DTKA 1QJIA 1QIAA 3HBVP 1JAPA 1PWVA 3O64A 1HFCA 3HY7A 4ZR5A 4A7BA 4I35A 1QJJA 1SLMA 2A8HA 3LUNA 1Y8JA 2YB9A 3P24A 3WV3A 1I76A 4DF9A 1MMPA 1DMTA 1I1IP 2N8RA 1A86A 4AXQA 4H76A 4GWNA 1CIZA 3AYKA 1HTDA 1IAEA 1BM6A 1DTHA 3UVCA 3Q2GA 1KUFA 3DTEA 1JAOA 1K7QA 4PKWA 1YOUA 4FXYP 2AIGP 2OY2A 3B8ZA 2W14A 3LIKA 1JH1A 5I43A 1IAAA 2TCLA 3DNGA 4G0DA 3RTSA 2USNA 4H1QA 5CUHA 1C3IA 4WKIA 2K9CA 3NX7A 1ATLA 2Z2DA 3CKIA 2MZHA 2OZRA 2W13A 1QICA 3LJGA 2W0DA 1CXVA 1OM6A 5BOTA 2ERQA 2OXZA 1XUDA 5B5OA 4DPEA 1FBLA 1IAGA 1BIWA 2OXUA 1PWPA 2L0RA 3F19A 1PWUA 3LJZA 3ZUKA 1HV5A 4IN9A 4R3VA 2XS3A 2JT5A 2POJA 1BKCE 1BUVM 3HBUP 2MLRA 3LK8A 2V4BA 3N2VA 1HY7A 1XFVA 5CXAA 4FVLA 3V96B 5L7FA 4ON1A 2WO8A 3EHXA 1S4BP 1PWWA 3VI1A 3G42A 830CA 2HU6A 2MZIA 1BUDA 3K7NA 2RJQA 2OI0A 1YQYA 3LKAA 3E8RA 3TT4A 1OO9A 5I4OA 2I47A 1GO8P 1R1JA 4XM8A 1SU3A 4H49A 3KHIA 2OVXA 3HB2P 1D5JA 4XM7A 2AYKA 1B3DA 1USNA 3EDIA 2E2DA 4XBHA 3DPEA 3K7LA 3HYGA 1JKYA 4PKSA 2ERPA 2OW1A 4WK7A 1MMBA 5D2BA 1D8MA 4A3WA 4WKEA 1EUBA 2EROA 4L7AA 1YCMA 2WO9A 3F16A 1QIBA 3O2XA 3LUMA 2D1OA 4L63A 1XFZA 3LJTA 1R55A 3U1RA 2E3XA 1O0QA 2XS4A 1OM7A 3ZXHA 3LIRA 3HDBA 1ZP5A 1MMQA 456CA 4L19A 2O36A 3F17A 1FM1A 3EDZA 2FV9A 1I73A 3USNA 2WOAA 1JJ9A 4DV8A 5D3CA 1G49A 3LE9A 3ELMA 1CQRA 2DW1A 4H82A 2OW0A 2X3CA 2D1NA 2RJPA 4L6TA 4PKRA 2MLSA 1J7NA 2O3EA 3WV2A 1D8FA 4H30A 1UMSA 3KEJA 4IJOA 5D7WA 1YP1A 1G05A 1XFYA 1G12A 2Y6DA 5BOYA 3DSLA 4ILWD 3L0TA 4HMAA 4XCTA 3EHYA 1RMZA 2X7MA 2JNPA 4JP4A 4HX3A 1SATA 2JSDA 4I03A 3I7IA 1OMJA 1XFWA 3F1AA 1GE6A 2OW2A 3GBOA 4GR3A 3B92A 4AUOA 3ZVSA 1G4KA 1ZXCA 2J83A 1ND1A 1XFXA 2KRJA 1A85A 3LQBA 1R1IA 5D1UA 4H2EA 3KMCA 3F18A 4CTHA 4PKTA 4GR8A 2OW9A 1O0TA 1EB6A 3MA2A 1CGFA 1KAPP 4IUWA 1Y93A 4FU4A 3SHIA 3WV1A 3N2UA 1JK3A 1B8YA 1GE7A 3KRYA 3DWBA 1C8TA 1XURA 5BPAA 1C7KA 1H71P 3KMEA 2OVZA 2DW2A 3EDGA 2Y6CA 4JQGA 2J0TA 1UTZA 1EAKA 2X3AA 4QKZA 1IABA 1HOVA 5I3MA 3LQ0A 2YUFA 3KECA 1GKCA 3TVCA 2QPJA 1R54A 2K2GA 1MMRA 1UTTA 2PJTA 1UMTA 1IADA 3DPFA 2JIHA 4PKVA 1JIZA 4Q1LA 4WF6A 3LGPA 5JMYA 1SMPA 1OS9A 4JA1A 1QUAA 1KUIA 3RTTA 2W15A 3KEKA 5I12A 4GR0A 1AF0A 1PWQA 1HFSA 1GE5A 3LEAA 4AYKA 2X3BA 4WZVA 1SLNA 1JANA 1FLSA 1CGEA 4JIJA 4PKUA 4XM6A 1BKCI 1D7XA 4PKQA 4GQLA 3DL1A 3KWVC 3L0VA 2OY4A 2SRTA 3OHOA 1R1HA 3HDAP 2DDYA 1CGLA 5L79A 5H8XA 4FXQA 3DTIA 3HY9A 1KUGA 1MNCA 1CK7A 2YIGA 2DW0A 1BSWA 2JT6A 1JIWP 3LMCA 1BZSA 2FV5A 1ZTQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3LIL A;  1BKC A;  4EFS A;  1ZXV A;  3AYU A;  2W12 A;  1K7G A;  4GF1 A;  1Y0V A;  4DD8 A;  4H3X A;  1G9K A;  1ZVX A;  2MZE A;  2CLT A;  1AKL A;  3B2Z A;  3G5C A;  1XFU A;  3AIG A;  5B5P A;  2OXW A;  1RM8 A;  1GKD A;  1BQO A;  5D1T A;  3TSK A;  3TS4 A;  3EWJ A;  4G9L A;  1K7I A;  1CAQ A;  1ZS0 A;  5LAB A;  5I2Z A;  1Q3A A;  1IAC A;  1SRP A;  966C A;  1ROS A;  1AYK A;  1KUH A;  3EDH A;  5D1S A;  3BA0 A;  1KBC A;  1KUK A;  5CZM A;  3VTG A;  2CKI A;  4J4M A;  1AST A;  1OM8 A;  1GO7 P;  1WNI A;  1Z3J A;  3Q2H A;  3P1V A;  1XUC A;  1BQQ M;  4GUY A;  4JPA A;  2DDF A;  1GXD A;  1UEA A;  1OS2 A;  3I7G A;  4AIG A;  3OHL A;  3F15 A;  4GWM A;  1JAQ A;  1L6J A;  5I0L A;  4H84 A;  1QJI A;  1QIA A;  3HBV P;  1JAP A;  1PWV A;  3O64 A;  1HFC A;  3HY7 A;  4ZR5 A;  4A7B A;  4I35 A;  1QJJ A;  1SLM A;  2A8H A;  3LUN A;  1Y8J A;  2YB9 A;  3P24 A;  3WV3 A;  1I76 A;  4DF9 A;  1MMP A;  1DMT A;  1I1I P;  2N8R A;  1A86 A;  4AXQ A;  4H76 A;  4GWN A;  1CIZ A;  3AYK A;  1HTD A;  1IAE A;  1BM6 A;  1DTH A;  3UVC A;  3Q2G A;  1KUF A;  1JAO A;  1K7Q A;  4PKW A;  1YOU A;  4FXY P;  2AIG P;  2OY2 A;  3B8Z A;  2W14 A;  3LIK A;  1JH1 A;  5I43 A;  1IAA A;  2TCL A;  3DNG A;  4G0D A;  3RTS A;  2USN A;  4H1Q A;  5CUH A;  1C3I A;  4WKI A;  2K9C A;  3NX7 A;  1ATL A;  2Z2D A;  3CKI A;  2MZH A;  2OZR A;  2W13 A;  1QIC A;  3LJG A;  2W0D A;  1CXV A;  1OM6 A;  5BOT A;  2ERQ A;  2OXZ A;  1XUD A;  5B5O A;  4DPE A;  1FBL A;  1IAG A;  1BIW A;  2OXU A;  1PWP A;  2L0R A;  3F19 A;  1PWU A;  3LJZ A;  3ZUK A;  1HV5 A;  4IN9 A;  4R3V A;  2XS3 A;  2JT5 A;  2POJ A;  1BKC E;  1BUV M;  3HBU P;  2MLR A;  3LK8 A;  2V4B A;  3N2V A;  1HY7 A;  1XFV A;  5CXA A;  4FVL A;  3V96 B;  5L7F A;  4ON1 A;  2WO8 A;  3EHX A;  1S4B P;  1PWW A;  3VI1 A;  3G42 A;  830C A;  2HU6 A;  2MZI A;  1BUD A;  3K7N A;  2RJQ A;  2OI0 A;  1YQY A;  3LKA A;  3E8R A;  3TT4 A;  1OO9 A;  5I4O A;  2I47 A;  1GO8 P;  1R1J A;  4XM8 A;  1SU3 A;  4H49 A;  3KHI A;  2OVX A;  3HB2 P;  1D5J A;  4XM7 A;  2AYK A;  1B3D A;  1USN A;  3EDI A;  2E2D A;  4XBH A;  3DPE A;  3K7L A;  3HYG A;  1JKY A;  4PKS A;  2ERP A;  2OW1 A;  4WK7 A;  1MMB A;  5D2B A;  1D8M A;  4A3W A;  4WKE A;  1EUB A;  2ERO A;  1YCM A;  2WO9 A;  3F16 A;  1QIB A;  3O2X A;  3LUM A;  2D1O A;  4L63 A;  1XFZ A;  3LJT A;  1R55 A;  3U1R A;  2E3X A;  1O0Q A;  2XS4 A;  1OM7 A;  3ZXH A;  3LIR A;  3HDB A;  1ZP5 A;  1MMQ A;  456C A;  4L19 A;  2O36 A;  3F17 A;  1FM1 A;  3EDZ A;  2FV9 A;  1I73 A;  3USN A;  2WOA A;  1JJ9 A;  4DV8 A;  5D3C A;  1G49 A;  3LE9 A;  3ELM A;  1CQR A;  2DW1 A;  4H82 A;  2OW0 A;  2X3C A;  2D1N A;  2RJP A;  4L6T A;  4PKR A;  2MLS A;  1J7N A;  2O3E A;  3WV2 A;  1D8F A;  4H30 A;  1UMS A;  3KEJ A;  4IJO A;  5D7W A;  1YP1 A;  1G05 A;  1XFY A;  1G12 A;  2Y6D A;  5BOY A;  3DSL A;  4ILW D;  3L0T A;  4HMA A;  4XCT A;  3EHY A;  1RMZ A;  2X7M A;  2JNP A;  4JP4 A;  4HX3 A;  1SAT A;  2JSD A;  4I03 A;  3I7I A;  1OMJ A;  1XFW A;  3F1A A;  1GE6 A;  2OW2 A;  3GBO A;  4GR3 A;  3B92 A;  4AUO A;  3ZVS A;  1G4K A;  1ZXC A;  2J83 A;  1ND1 A;  1XFX A;  2KRJ A;  1A85 A;  3LQB A;  1R1I A;  5D1U A;  4H2E A;  3KMC A;  3F18 A;  4CTH A;  4PKT A;  4GR8 A;  2OW9 A;  1O0T A;  1EB6 A;  3MA2 A;  1CGF A;  1KAP P;  4IUW A;  1Y93 A;  4FU4 A;  3SHI A;  3WV1 A;  3N2U A;  1JK3 A;  1B8Y A;  1GE7 A;  3KRY A;  3DWB A;  1C8T A;  1XUR A;  5BPA A;  1C7K A;  1H71 P;  3KME A;  2OVZ A;  2DW2 A;  3EDG A;  2Y6C A;  4JQG A;  2J0T A;  1UTZ A;  1EAK A;  2X3A A;  4QKZ A;  1IAB A;  1HOV A;  5I3M A;  3LQ0 A;  3KEC A;  1GKC A;  3TVC A;  2QPJ A;  1R54 A;  2K2G A;  1MMR A;  1UTT A;  2PJT A;  1UMT A;  1IAD A;  3DPF A;  2JIH A;  4PKV A;  1JIZ A;  4Q1L A;  4WF6 A;  3LGP A;  5JMY A;  1SMP A;  1OS9 A;  4JA1 A;  1QUA A;  1KUI A;  3RTT A;  2W15 A;  3KEK A;  5I12 A;  4GR0 A;  1AF0 A;  1PWQ A;  1HFS A;  1GE5 A;  3LEA A;  4AYK A;  2X3B A;  4WZV A;  1SLN A;  1JAN A;  1FLS A;  1CGE A;  4JIJ A;  4PKU A;  4XM6 A;  1BKC I;  1D7X A;  4PKQ A;  4GQL A;  3DL1 A;  3KWV C;  3L0V A;  2OY4 A;  2SRT A;  3OHO A;  1R1H A;  3HDA P;  2DDY A;  1CGL A;  5L79 A;  5H8X A;  4FXQ A;  3HY9 A;  1KUG A;  1MNC A;  1CK7 A;  2YIG A;  2DW0 A;  1BSW A;  2JT6 A;  1JIW P;  3LMC A;  1BZS A;  2FV5 A;  1ZTQ A; 
#chains in the Genus database with same CATH topology
 3LIL A;  1BKC A;  4EFS A;  1ZXV A;  3AYU A;  2W12 A;  1K7G A;  4GF1 A;  1Y0V A;  4DD8 A;  4H3X A;  1G9K A;  1ZVX A;  2MZE A;  2CLT A;  1AKL A;  3B2Z A;  3G5C A;  1XFU A;  3AIG A;  5B5P A;  2OXW A;  1RM8 A;  1GKD A;  1BQO A;  5D1T A;  3TSK A;  3TS4 A;  3EWJ A;  4G9L A;  1OZ9 A;  1K7I A;  1CAQ A;  1ZS0 A;  5LAB A;  5I2Z A;  1Q3A A;  1IAC A;  1SRP A;  966C A;  1ROS A;  1AYK A;  1KUH A;  3EDH A;  5D1S A;  3BA0 A;  1KBC A;  1KUK A;  5CZM A;  3VTG A;  2CKI A;  4J4M A;  1AST A;  1OM8 A;  1GO7 P;  1WNI A;  1Z3J A;  3Q2H A;  3P1V A;  1XUC A;  1BQQ M;  4GUY A;  4JPA A;  2DDF A;  1GXD A;  1UEA A;  1OS2 A;  3I7G A;  4AIG A;  3OHL A;  3F15 A;  4GWM A;  1JAQ A;  1L6J A;  5I0L A;  4H84 A;  3DTK A;  1QJI A;  1QIA A;  3HBV P;  1JAP A;  1PWV A;  3O64 A;  1HFC A;  3HY7 A;  1XM5 A;  4ZR5 A;  4A7B A;  4I35 A;  1QJJ A;  1SLM A;  2A8H A;  3LUN A;  1Y8J A;  2YB9 A;  3P24 A;  3WV3 A;  1I76 A;  4DF9 A;  1MMP A;  1XAX A;  1DMT A;  1I1I P;  2N8R A;  1A86 A;  4AXQ A;  4H76 A;  4GWN A;  1CIZ A;  3AYK A;  1HTD A;  1IAE A;  1BM6 A;  1DTH A;  3UVC A;  3Q2G A;  1KUF A;  3DTE A;  1JAO A;  1K7Q A;  4PKW A;  1YOU A;  4FXY P;  2AIG P;  2OY2 A;  3B8Z A;  2W14 A;  3LIK A;  1JH1 A;  5I43 A;  1IAA A;  2TCL A;  3DNG A;  4G0D A;  3RTS A;  2USN A;  4H1Q A;  5CUH A;  1C3I A;  4WKI A;  2K9C A;  3NX7 A;  1ATL A;  2Z2D A;  3CKI A;  2MZH A;  2OZR A;  2W13 A;  1QIC A;  3LJG A;  2W0D A;  1CXV A;  1OM6 A;  5BOT A;  2ERQ A;  2OXZ A;  1XUD A;  5B5O A;  4DPE A;  1FBL A;  1IAG A;  1BIW A;  2OXU A;  1PWP A;  2L0R A;  3F19 A;  1PWU A;  3LJZ A;  3ZUK A;  1HV5 A;  4IN9 A;  4R3V A;  2XS3 A;  2JT5 A;  2POJ A;  1BKC E;  1BUV M;  3HBU P;  2MLR A;  3LK8 A;  2V4B A;  3N2V A;  1HY7 A;  1XFV A;  5CXA A;  4FVL A;  3V96 B;  5L7F A;  4ON1 A;  2WO8 A;  3EHX A;  1S4B P;  1PWW A;  3VI1 A;  3G42 A;  830C A;  2HU6 A;  2MZI A;  1BUD A;  3K7N A;  2RJQ A;  2OI0 A;  1YQY A;  3LKA A;  3E8R A;  3TT4 A;  1OO9 A;  5I4O A;  2I47 A;  1GO8 P;  1R1J A;  4XM8 A;  1SU3 A;  4H49 A;  3KHI A;  2OVX A;  3HB2 P;  1D5J A;  4XM7 A;  2AYK A;  1B3D A;  1USN A;  3EDI A;  2E2D A;  4XBH A;  3DPE A;  3K7L A;  3HYG A;  1JKY A;  4PKS A;  2ERP A;  2OW1 A;  4WK7 A;  1MMB A;  5D2B A;  1D8M A;  4A3W A;  4WKE A;  1EUB A;  2ERO A;  4L7A A;  1YCM A;  2WO9 A;  3F16 A;  1QIB A;  3O2X A;  3LUM A;  2D1O A;  4L63 A;  1XFZ A;  3LJT A;  1R55 A;  3U1R A;  2E3X A;  1O0Q A;  2XS4 A;  1OM7 A;  3ZXH A;  3LIR A;  3HDB A;  1ZP5 A;  1MMQ A;  456C A;  4L19 A;  2O36 A;  3F17 A;  1FM1 A;  3EDZ A;  2FV9 A;  1I73 A;  3USN A;  2WOA A;  1JJ9 A;  4DV8 A;  5D3C A;  1G49 A;  3LE9 A;  3ELM A;  1CQR A;  2DW1 A;  4H82 A;  2OW0 A;  2X3C A;  2D1N A;  2RJP A;  4L6T A;  4PKR A;  2MLS A;  1J7N A;  2O3E A;  3WV2 A;  1D8F A;  4H30 A;  1UMS A;  3KEJ A;  4IJO A;  5D7W A;  1YP1 A;  1G05 A;  1XFY A;  1G12 A;  2Y6D A;  5BOY A;  3DSL A;  4ILW D;  3L0T A;  4HMA A;  4XCT A;  3EHY A;  1RMZ A;  2X7M A;  2JNP A;  4JP4 A;  4HX3 A;  1SAT A;  2JSD A;  4I03 A;  3I7I A;  1OMJ A;  1XFW A;  3F1A A;  1GE6 A;  2OW2 A;  3GBO A;  4GR3 A;  3B92 A;  4AUO A;  3ZVS A;  1G4K A;  1ZXC A;  2J83 A;  1ND1 A;  1XFX A;  2KRJ A;  1A85 A;  3LQB A;  1R1I A;  5D1U A;  4H2E A;  3KMC A;  3F18 A;  4CTH A;  4PKT A;  4GR8 A;  2OW9 A;  1O0T A;  1EB6 A;  3MA2 A;  1CGF A;  1KAP P;  4IUW A;  1Y93 A;  4FU4 A;  3SHI A;  3WV1 A;  3N2U A;  1JK3 A;  1B8Y A;  1GE7 A;  3KRY A;  3DWB A;  1C8T A;  1XUR A;  5BPA A;  1C7K A;  1H71 P;  3KME A;  2OVZ A;  2DW2 A;  3EDG A;  2Y6C A;  4JQG A;  2J0T A;  1UTZ A;  1EAK A;  2X3A A;  4QKZ A;  1IAB A;  1HOV A;  5I3M A;  3LQ0 A;  2YUF A;  3KEC A;  1GKC A;  3TVC A;  2QPJ A;  1R54 A;  2K2G A;  1MMR A;  1UTT A;  2PJT A;  1UMT A;  1IAD A;  3DPF A;  1TVI A;  2JIH A;  4PKV A;  1JIZ A;  4Q1L A;  4WF6 A;  3LGP A;  5JMY A;  1SMP A;  1OS9 A;  4JA1 A;  1QUA A;  1KUI A;  3RTT A;  2W15 A;  3KEK A;  5I12 A;  4GR0 A;  1AF0 A;  1PWQ A;  1HFS A;  1GE5 A;  3LEA A;  4AYK A;  2X3B A;  4WZV A;  1SLN A;  1JAN A;  1FLS A;  1CGE A;  4JIJ A;  4PKU A;  4XM6 A;  1BKC I;  1D7X A;  4PKQ A;  4GQL A;  3DL1 A;  3KWV C;  3L0V A;  2OY4 A;  2SRT A;  3OHO A;  1R1H A;  3HDA P;  2DDY A;  1CGL A;  5L79 A;  5H8X A;  4FXQ A;  3DTI A;  3HY9 A;  1KUG A;  1MNC A;  1CK7 A;  2YIG A;  2DW0 A;  1BSW A;  2JT6 A;  1JIW P;  3LMC A;  1BZS A;  2FV5 A;  1ZTQ A; 
#chains in the Genus database with same CATH homology
 3LIL A;  1BKC A;  4EFS A;  1ZXV A;  3AYU A;  2W12 A;  1K7G A;  4GF1 A;  1Y0V A;  4DD8 A;  4H3X A;  1G9K A;  1ZVX A;  2MZE A;  2CLT A;  1AKL A;  3B2Z A;  3G5C A;  1XFU A;  3AIG A;  5B5P A;  2OXW A;  1RM8 A;  1GKD A;  1BQO A;  5D1T A;  3TSK A;  3TS4 A;  3EWJ A;  4G9L A;  1K7I A;  1CAQ A;  1ZS0 A;  5LAB A;  5I2Z A;  1Q3A A;  1IAC A;  1SRP A;  966C A;  1ROS A;  1AYK A;  1KUH A;  3EDH A;  5D1S A;  3BA0 A;  1KBC A;  1KUK A;  5CZM A;  3VTG A;  2CKI A;  4J4M A;  1AST A;  1OM8 A;  1GO7 P;  1WNI A;  1Z3J A;  3Q2H A;  3P1V A;  1XUC A;  1BQQ M;  4GUY A;  4JPA A;  2DDF A;  1GXD A;  1UEA A;  1OS2 A;  3I7G A;  4AIG A;  3OHL A;  3F15 A;  4GWM A;  1JAQ A;  1L6J A;  5I0L A;  4H84 A;  3DTK A;  1QJI A;  1QIA A;  3HBV P;  1JAP A;  1PWV A;  3O64 A;  1HFC A;  3HY7 A;  4ZR5 A;  4A7B A;  4I35 A;  1QJJ A;  1SLM A;  2A8H A;  3LUN A;  1Y8J A;  2YB9 A;  3P24 A;  3WV3 A;  1I76 A;  4DF9 A;  1MMP A;  1DMT A;  1I1I P;  2N8R A;  1A86 A;  4AXQ A;  4H76 A;  4GWN A;  1CIZ A;  3AYK A;  1HTD A;  1IAE A;  1BM6 A;  1DTH A;  3UVC A;  3Q2G A;  1KUF A;  3DTE A;  1JAO A;  1K7Q A;  4PKW A;  1YOU A;  4FXY P;  2AIG P;  2OY2 A;  3B8Z A;  2W14 A;  3LIK A;  1JH1 A;  5I43 A;  1IAA A;  2TCL A;  3DNG A;  4G0D A;  3RTS A;  2USN A;  4H1Q A;  5CUH A;  1C3I A;  4WKI A;  2K9C A;  3NX7 A;  1ATL A;  2Z2D A;  3CKI A;  2MZH A;  2OZR A;  2W13 A;  1QIC A;  3LJG A;  2W0D A;  1CXV A;  1OM6 A;  5BOT A;  2ERQ A;  2OXZ A;  1XUD A;  5B5O A;  4DPE A;  1FBL A;  1IAG A;  1BIW A;  2OXU A;  1PWP A;  2L0R A;  3F19 A;  1PWU A;  3LJZ A;  3ZUK A;  1HV5 A;  4IN9 A;  4R3V A;  2XS3 A;  2JT5 A;  2POJ A;  1BKC E;  1BUV M;  3HBU P;  2MLR A;  3LK8 A;  2V4B A;  3N2V A;  1HY7 A;  1XFV A;  5CXA A;  4FVL A;  3V96 B;  5L7F A;  4ON1 A;  2WO8 A;  3EHX A;  1S4B P;  1PWW A;  3VI1 A;  3G42 A;  830C A;  2HU6 A;  2MZI A;  1BUD A;  3K7N A;  2RJQ A;  2OI0 A;  1YQY A;  3LKA A;  3E8R A;  3TT4 A;  1OO9 A;  5I4O A;  2I47 A;  1GO8 P;  1R1J A;  4XM8 A;  1SU3 A;  4H49 A;  3KHI A;  2OVX A;  3HB2 P;  1D5J A;  4XM7 A;  2AYK A;  1B3D A;  1USN A;  3EDI A;  2E2D A;  4XBH A;  3DPE A;  3K7L A;  3HYG A;  1JKY A;  4PKS A;  2ERP A;  2OW1 A;  4WK7 A;  1MMB A;  5D2B A;  1D8M A;  4A3W A;  4WKE A;  1EUB A;  2ERO A;  4L7A A;  1YCM A;  2WO9 A;  3F16 A;  1QIB A;  3O2X A;  3LUM A;  2D1O A;  4L63 A;  1XFZ A;  3LJT A;  1R55 A;  3U1R A;  2E3X A;  1O0Q A;  2XS4 A;  1OM7 A;  3ZXH A;  3LIR A;  3HDB A;  1ZP5 A;  1MMQ A;  456C A;  4L19 A;  2O36 A;  3F17 A;  1FM1 A;  3EDZ A;  2FV9 A;  1I73 A;  3USN A;  2WOA A;  1JJ9 A;  4DV8 A;  5D3C A;  1G49 A;  3LE9 A;  3ELM A;  1CQR A;  2DW1 A;  4H82 A;  2OW0 A;  2X3C A;  2D1N A;  2RJP A;  4L6T A;  4PKR A;  2MLS A;  1J7N A;  2O3E A;  3WV2 A;  1D8F A;  4H30 A;  1UMS A;  3KEJ A;  4IJO A;  5D7W A;  1YP1 A;  1G05 A;  1XFY A;  1G12 A;  2Y6D A;  5BOY A;  3DSL A;  4ILW D;  3L0T A;  4HMA A;  4XCT A;  3EHY A;  1RMZ A;  2X7M A;  2JNP A;  4JP4 A;  4HX3 A;  1SAT A;  2JSD A;  4I03 A;  3I7I A;  1OMJ A;  1XFW A;  3F1A A;  1GE6 A;  2OW2 A;  3GBO A;  4GR3 A;  3B92 A;  4AUO A;  3ZVS A;  1G4K A;  1ZXC A;  2J83 A;  1ND1 A;  1XFX A;  2KRJ A;  1A85 A;  3LQB A;  1R1I A;  5D1U A;  4H2E A;  3KMC A;  3F18 A;  4CTH A;  4PKT A;  4GR8 A;  2OW9 A;  1O0T A;  1EB6 A;  3MA2 A;  1CGF A;  1KAP P;  4IUW A;  1Y93 A;  4FU4 A;  3SHI A;  3WV1 A;  3N2U A;  1JK3 A;  1B8Y A;  1GE7 A;  3KRY A;  3DWB A;  1C8T A;  1XUR A;  5BPA A;  1C7K A;  1H71 P;  3KME A;  2OVZ A;  2DW2 A;  3EDG A;  2Y6C A;  4JQG A;  2J0T A;  1UTZ A;  1EAK A;  2X3A A;  4QKZ A;  1IAB A;  1HOV A;  5I3M A;  3LQ0 A;  2YUF A;  3KEC A;  1GKC A;  3TVC A;  2QPJ A;  1R54 A;  2K2G A;  1MMR A;  1UTT A;  2PJT A;  1UMT A;  1IAD A;  3DPF A;  2JIH A;  4PKV A;  1JIZ A;  4Q1L A;  4WF6 A;  3LGP A;  5JMY A;  1SMP A;  1OS9 A;  4JA1 A;  1QUA A;  1KUI A;  3RTT A;  2W15 A;  3KEK A;  5I12 A;  4GR0 A;  1AF0 A;  1PWQ A;  1HFS A;  1GE5 A;  3LEA A;  4AYK A;  2X3B A;  4WZV A;  1SLN A;  1JAN A;  1FLS A;  1CGE A;  4JIJ A;  4PKU A;  4XM6 A;  1BKC I;  1D7X A;  4PKQ A;  4GQL A;  3DL1 A;  3KWV C;  3L0V A;  2OY4 A;  2SRT A;  3OHO A;  1R1H A;  3HDA P;  2DDY A;  1CGL A;  5L79 A;  5H8X A;  4FXQ A;  3DTI A;  3HY9 A;  1KUG A;  1MNC A;  1CK7 A;  2YIG A;  2DW0 A;  1BSW A;  2JT6 A;  1JIW P;  3LMC A;  1BZS A;  2FV5 A;  1ZTQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...