1I7LA

Crystal structure analysis of the complex of the c domain of synapsin ii from rat with atp
Total Genus 89
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
89
sequence length
309
structure length
309
Chain Sequence
KAKVLLVVDEPHTDWAKCFRGKKILGDYDIKVEQAEFSELNLVAHADGTYAVDMQVLRNGTKVVRSFRPDFVLIRQHAFGMAENEDFRHLVIGMQYAGLPSINSLESIYNFCDKPWVFAQMVAIFKTLGGEKFPLIEQTYYPNHREMLTLPTFPVVVKIGHAHSGMGKVKVENHYDFQDIASVVALTQTYATAEPFIDAKYDIRVQKIGNNYKAYMRTSISGNWKTNTGSAMLEQIAMSDRYKLWVDACSEMFGGLDICAVKAVHGKDGKDYIFEVMDCSMPLIGEHQVEDRQLITDLVISKMNQLLSR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title ATP Binding Independent of Metal Cations in Synapsin II
rcsb
source organism Rattus norvegicus
molecule tags Neuropeptide
molecule keywords SYNAPSIN II
total genus 89
structure length 309
sequence length 309
chains with identical sequence B
ec nomenclature
pdb deposition date 2001-03-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02750 Synapsin_C Synapsin, ATP binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.470.20 Alpha Beta 2-Layer Sandwich D-amino Acid Aminotransferase; Chain A, domain 1 ATP-grasp fold, B domain 1i7lA03
3.30.1490.20 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 ATP-grasp fold, A domain 1i7lA01
3.40.50.20 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1i7lA02
5JVLA 4WBNF 3V4SA 4O84A 1KUTA 4FE2A 4O4JF 2GPSA 3BSSA 4ZOLF 1VKZA 1UC9A 4MA5A 5BPFA 1WR2A 4MV6A 3LWBA 4EGQA 4IHJF 2DIKA 4E4TA 4Y8VB 4I50F 5CAEB 3K5HA 4O81A 5CB4F 5HV6A 1KJ9A 2CNVA 3U9TA 4O7VA 2FP4B 1EHIA 1OBDA 5HBRB 3JRXA 1KJJA 2V59A 3GIDA 4IIJF 4YAKB 1DV2A 2PVPA 1EYZA 4TUYF 2W6PA 3MWDA 3VPBA 3BFPA 3NUAA 3WO0A 3HO8A 2CNQA 1AUXA 1KJQA 1EUCB 4C5AA 4FFMA 2VHEA 2R86A 1B6RA 4O4IF 3KALA 2FB9A 3R23A 2ZDQA 3VA7A 5EZYF 3TIGA 3K5IA 2PN1A 3DF7A 3K3PA 1IOWA 3GLKA 1BNCA 3Q2OA 4M98A 5LA6F 1DIKA 3BSYA 4MV7A 2YZMA 1AUVA 2QK4A 4WD3A 3TIIA 4EGJA 1Z2PX 4XZ3B 2GQSA 4O7TA 4EA7A 3KAJA 1CS0A 3VPDA 5LOVF 1DV1A 2YZLA 3AX6A 2W6MA 2ZDGA 1C30A 2W6QA 4MV3A 4O7YA 1KBLA 4FFNA 2IP4A 1CE8A 3JZFA 5LXTF 1I7NA 3WO1A 3BSWA 1UC8A 2NU6B 4YBZB 4O7LA 2YS6A 4ZHQF 4FFRA 2R87A 1KJ8A 3HB9A 2DLNA 1GSOA 3RV3A 2R7LA 4J6EA 2ZDHA 4TV8F 4ME6A 3OUUA 5C1OA 4DIMA 4FGRA 4HNVA 4NYEA 1A48A 4EABA 1EZ1A 1W93A 2Z02A 4O2BF 3R5FA 2FPIB 2HJWA 4O7WA 2Z04A 3G8DA 2NUAB 4XYMB 3KREA 4YJ3F 2W6ZA 2I80A 2NU7B 3MJFA 2FPPB 2GPWA 2X0SA 4M9CA 4MV9A 4O7NA 3Q1KA 4EAAA 4O83A 4MA0A 4HNTA 2CQYA 2GQRA 5CA1F 1SCUB 3I12A 2FPGB 4MAMA 4EA8A 2WYOA 1E4EA 1PK8A 4MV8A 2YZNA 4ZI7F 4HNUA 4M99A 2DZDA 3ORQA 4O7RA 1M0WA 5KKNB 4HQ6A 2W6NA 2XD4A 4O2AF 1A9XA 2R85A 5CA0F 5C8YF 5D8DA 5FNVF 4MV4A 5JQGF 5BPHA 4O7ZA 1ULZA 2DWCA 2R7NA 5JH7F 3ORRA 2R84A 1CQIB 2PBZA 3VMMA 5GONF 2YL2A 4FFLA 2YYAA 4GGMX 3HBLA 1W96A 4FFPA 4C5CA 4YB8B 5JQWA 2R7MA 4YAJB 1GSHA 4MV1A 5DMXA 2W6OA 4O4HF 1VBHA 3QFFA 3UFXB 4IZOA 4ZQIA 4O7SA 3JZIA 4FU0A 3R9RA 3U55A 2XCLA 2I8CA 3N6RA 4C5BA 4EA9A 5BMVF 3TW6A 5LP6F 2OLSA 4IWXA 3VPCA 1EUDB 3V4ZA 5J2UF 5H80A 4I55F 2P0AA 1JLLB 2W70A 3OUZA 4FFOA 1PX2A 1T36A 3MWEA 3R5HA 2YZGA 1E4EB 5C1PA 1GLVA 4XX0B 3RV4A 3JRWA 3U54A 3AW8A 2YS7A 1B6SA 5K2MA 1VBGA 4IWYA 1M0TA 2SCUB 2V5AA 4M9UA 5J2TF 2VQDA 2NU8B 5I47A 2J9GA 2YWVA 3SE7A 1KEEA 1KJIA 3BG5A 3TQTA 1KC7A 3U9SA 1C3OA 2R7KA 1GGOA 4YJ2F 1Z2NX 1JDEA 5IYZF 5KX5F 5LYJF 2CZGA 3TINA 3KAKA 3ETJA 1I7LA 2NU9B 1GSAA 3WNZA 4I4TF 2YW2A 4O86A 2W71A 4HR7A 3G8CA 3ETHA 2HGSA 2VPQA 1JDBB 3RUPA 1JKJB 1BXRA 2R82A 2R6FA 2V58A 2GLTA 2VR1A 4EG0A 4O4LF 4TV9F 5JVDF 3N8DA 3E5NA 4DLKA 2QF7A 3VOTA 3RFCA 2I87A 1Z2OX 4RZQA 2YRWA 1OBGA 2C00A 3R5XA 2CNUA 1CQJB 2YRXA 4QSHA 4L1KA 4O82A 2NPOA 1IOVA 4XYLB 3LP8A 1M6VA
chains in the Genus database with same CATH superfamily
1RQXA 1KYIA 3ZWNA 3UW1A 3IULA 5ES3A 2XVZA 3ND5A 1QRRA 1RJQA 3KVVA 2PZAA 3R7SA 1JHVA 4IH1A 5MFPA 4OSEA 3U1TA 3V9PA 3VH1A 2F4NA 1B8PA 1TD1A 4RJKA 3LECA 3H0CA 1E3WA 1U0OC 2DJ5A 4YY3B 1G7SA 2VP9A 2JLWA 2ZIXB 3K0EA 4QXRA 4C76A 1GNVA 3ZHUA 2BEVB 2EKQA 2XZOA 1N33B 2WIBA 3L0YA 3WI7A 2NQ8A 2PX3A 1USIA 3ESXA 1E2NA 3ZWBA 1A5SB 5B58C 2RG1A 5K3FA 1U9YA 3D0RA 1UK8A 3F8WA 1PE0A 4NAVA 4NCAA 3V33A 4YMWA 4N65A 3PZPA 4CETA 4O81A 1A5TA 3IQDB 5AVQA 4N54A 4ZVQA 3ESZA 1Q6YA 1DUIA 2EZ9A 2W9CB 2DFNA 2PBRA 3ANTA 4AUKA 3ZE9A 5E7QA 1Q1QA 1SBIA 1J23A 2OHIA 3NHKA 1HDRA 1XHLA 3KDPA 3PE4A 1PS0A 4JVSB 4QX6A 1HQDA 1W1WA 3JRXA 4Y9SA 5AHOA 4AWAA 1JSLA 4R51A 1L7DA 3LX8A 4WKBA 2V03A 3RD5A 3GIDA 1LTKA 2QPOA 3KOUA 4HDNB 3MS4A 3RYHB 3IMCA 1H6DA 2J4DA 3BEDA 3P94A 1B14A 3LUAA 5HK8A 1V2GA 2P91A 4JQYA 2PMZE 1IYDA 4IX1A 4MQ4A 4MUGA 3AZQA 4TSFA 1X86B 4P3KA 1E3IA 4HEA1 3F8TA 1E79A 3DEHA 3RRXA 1K3FA 3GNLA 1EUCB 3PC4A 4D46A 3T5BA 5TE9A 3R0IA 3OQIA 5EMNA 4ZI7B 3RVLA 4RMIA 1WKCA 2I78A 2BHRA 1X9NA 4QUAA 2UUBB 4G63A 2ETVA 1MH9A 3CRQA 4J7AA 1EFRA 1YH3A 3ITNA 3ESYA 3CPHA 3KALA 2G9NA 1CUVA 1OB5A 2CD7A 2WSLA 3DL2A 4H6PA 3AV0B 1SQFA 3I9KA 4UTOA 2BV3A 2Q0SA 1AN9A 2PZ8A 3IP8A 3W1EA 1H85A 4OK6A 4AYWA 2XMGA 2DHCA 3ZVRA 5I3ZA 3V6LA 2IXTA 4IRKA 5MDHA 4RPCA 5EZ5A 2CJWA 2CV1A 1CF4A 4NYMQ 4RVUA 1E1RD 2TMGA 1QRSA 5LQMA 4RVGA 2AUMA 3ZY3A 3BMQA 2V6IA 3RFXA 4KMRA 2FFJA 5HZMA 1IONA 1LTQA 2QW1A 1FPQA 4L2IA 2JEGA 4CF7A 1DKRA 4HWPA 5BW8A 3OEED 4EWLA 1THGA 4OREX 4QGHA 5ALUA 3BJYA 1JQJC 1MB0A 2JNWA 4L73A 4XIIA 1JHZA 1UAYA 4TKZA 4L28A 3T8YA 3QYFA 2DTXA 4NENA 4XGNA 2XKKA 1T5LA 1E2UA 2WQ7A 3MK31 3RAGA 5LP6B 3V8PA 1B1AA 2C88A 3OCYA 5HVNA 3R6WA 3HA3A 4KQ2A 1QTQA 4M7RA 4NV1A 1JDZA 4UM5A 5JCPA 4GNRA 4GG1A 2QRZA 4KKXB 4V0QA 5HNKA 1RXWA 5C3EG 1LTHR 1WRBA 3MUNA 1ECGA 3KZNA 2ZDGA 4GLXA 2REQA 5CM8B 4BYMA 4HDAA 1CQWA 1XXLA 4ZJPA 1EFVA 2O2JA 1GKIA 1OMOA 2AQIA 2W58A 4BZPA 5ADUS 3COJA 3KK0A 3KTAA 3GQBB 5LLDA 3N8NA 1AB6A 2ZYGA 3B85A 3L9WA 3TFQA 3R0ZA 2QT0A 4KXUA 4U7WA 1D2CA 1Q15A 1G4HA 1I5RA 2XW6A 5CLIA 4APMA 1MOZA 1PJCA 3HY6A 4O29A 5DNVA 3AGPA 2WNSA 2DPMA 3PLAE 1M5RA 3IUMA 4MCIA 4ER7A 4EY7A 4YMUA 5JY1A 1XZQA 3EIWA 2SCUA 5JYBA 5BWVA 1SXJB 3TTYA 1CW2B 4GEGA 2WKRA 5DBOA 5IBRA 5ENZA 2PKCA 3SGLA 3IEKA 4ITVA 3OQ1A 4QLAA 4RHTA 4TV9A 3PC8C 5BURA 1FVFA 2YMMA 1CF9A 2X5XA 3O26A 3EEFA 3WYNA 1F8UA 3SZRA 3UXHA 4TZKA 1OFGA 3GG9A 1BMQA 3ENQA 1DC6A 1PSWA 3EXIB 1QMPA 1V48A 1UFOA 2H52A 2JHFA 3H8JA 1FNSA 2PFSA 2RHCA 3WK7A 2R87A 3K35A 1MIOA 3F0TA 3KG2A 4Q00A 5F9MA 4YV1A 1VPTA 4JXUA 1AZLA 1YA4A 2GJKA 4BCBA 1Y37A 2JBAB 1D04A 3C3PA 2FMAA 4BWGA 3ZN2A 5DYGA 1XRSB 1PT8A 1YNSA 2C82A 4RSRA 3HTXA 3O2QB 4ZXPA 3WNDA 3GFVA 4F6RB 4QEZA 1B43A 4Z4IA 3VDMA 3M6LA 3FUUA 3HLKA 3HMQA 2GZSA 3N86A 5EIFA 5JC1A 3EXIA 2QKYA 3MJEA 3V7NA 2FCRA 3G0CA 4AG5A 4MS1B 4N7RA 1UODA 2IUEA 3RUIA 1WOMA 1RYNA 1X94A 2VPYA 3EZ9A 3JSXA 1THZA 4JR2A 2AYXA 2BAGA 4RW0A 3SBOA 1EJ0A 2XNSA 3ELDA 5KCZA 3LUKA 1E3JA 3UEOA 3C3EA 4R16A 4NYEA 3EBPA 1A48A 2FR0A 1ZCAA 1BW9B 2SHKA 4XUGB 1WVMA 4ALIA 4OFWA 1PNVA 3UKJA 4HH1A 2PH3A 4RYLA 4DLVA 1P0PA 2IYPA 2CJXA 1P7CA 3IDOA 4MWSA 2FMIA 2J41A 2P5TB 4RELA 4EFDA 3K70C 1TUBA 3RS3A 1SKMA 1YIDA 1ZAKA 4I3GA 4V24A 4DJEC 4O4LB 2OQIA 1JRLA 4QOFA 2JK1A 2CDBA 3UB2A 3SYKA 4O7WA 4KXFB 2FHSA 4EPYA 4AKSA 3LTNC 1II9A 3GYGA 5EWFA 2QAGA 4F4YA 3GA7A 4DSTA 4MHTA 4C4OA 3N7TA 2O8FA 3PE6A 4KWEA 3V2GA 1JALA 2DAPA 5EZSA 3PUZA 5IEJA 4AZ3B 4B4OA 4XGKA 1XXHE 3R5KA 4JOBA 2ZQYA 1T1SA 4UCWA 1EGHA 3T99A 3RH0A 3SNKA 1G64A 2FGKA 5CURA 5JU6A 3T1OA 1Z7BA 2H7XA 1BH2A 3KO8A 5AJUA 3CH6A 2W7TA 4DS3A 5IRCD 2V5UA 2JVIA 1RBMA 2QORA 5F9HA 1PG0A 2AK2A 4IOKA 3T7JA 3IERA 2AWNA 2Q2WA 2VBGA 4P7FA 4OUDA 2HYIC 5ALFA 5KYGA 4UU0A 3S5UA 3NC1C 5B4UA 1JVSA 3MUFA 1PDVA 3TW8A 3IN5A 4GLLA 1C3JA 1P9LA 1OYVA 3F1LA 4RMHA 5HJ5A 2FWNA 4EFEA 1GILA 4CQMB 1HWYA 5L4NA 3WJ7A 3O4JA 2WHRA 1QGUB 4OQYA 1PQYA 1QAOA 2FFRA 3VR4A 1YZFA 2O03A 1VE5A 3AY3A 1LK0A 2PMDA 3ZY5A 4ECZA 3L06A 3O1LA 1DAGA 3BBPA 2VT2A 4ZOQI 4RUCA 3IOCA 2A57A 5DYNA 2ZE7A 4EUHA 3WMFA 1JECA 4US1R 3WNQA 3HCEA 2O7QA 4IILA 4A6DA 1FP2A 1FRFS 1QORA 1AZSC 2OUKA 2PH5A 3EIFA 3OSZA 3TPCA 2ZUEA 5AI8A 2ZRLA 2BFNA 4ZA2A 5BVGB 5JS7A 4H1HA 1SHJA 2HQSA 4YV0A 3V2UA 4W5NA 1TOAA 1RACA 2ZUFA 1T2UA 4MINA 1I10A 1H22A 3FI9A 3GLQA 3IX7A 3L6BA 1M1YB 2QTZA 1Z6PA 4YTEA 5HS6A 3BXHA 1RWQA 2X58A 4W6ZA 1MF7A 2EJCA 4YCBA 3AVOA 5BPHA 4Q02A 2Q1TA 3FYTA 3BIWA 3QU7A 5DYIA 2BSQA 3BCHA 4HXFB 2XWPA 1T6XA 1MR3F 4RNMA 1KQ3A 2XYPA 3NUGA 3NTOA 5EEHA 3EYYA 3I6BA 2R7NA 4F85A 2G8NA 2JA7G 3TSZA 4LYFA 4RPJA 3USES 2X8WA 1NRIA 4CQNA 3ORRA 2Z5GA 3PT5A 4Y2YA 1EK6A 2O14A 4LWZA 1CQIB 1AG9A 4F4IA 1PJTA 2HMWA 3TQ1A 2PBZA 1T3SA 3RB6A 1GL3A 4W8OA 1NGSA 3RKUA 4OX9H 2PSFA 3IQHX 4IMIB 4B4VA 4KJXA 1DELA 2CJPA 3PDCA 2R8YA 4HDRA 4K28A 3KSAC 2AH5A 2FUG1 4PX5A 3HKCA 4JK3A 4EKGA 3MXOA 1JI3A 1Z4LA 3PHLA 4Q7QA 1KP9A 2HHCA 3GEGA 4JJ4A 4JJEA 1SEVA 1G9TA 5JQWA 4P58A 3H5LA 5AKKA 1K5GA 2OPHA 4F86A 3G79A 1C3OB 1RP1A 1USUA 2V4QA 3VH4A 2WSBA 3GXOA 4FZ5A 3U17A 1H2FA 2GSWA 3DHVA 4JLUA 4FVTA 3ORFA 1B04A 2ZU0C 3RAJA 2R6JA 1ARZA 2BZ0A 1DX9A 3TRHA 1BC5A 5B1HA 1YQGA 4QYWA 1BW9A 4J8PA 3NBKA 4YT4A 2HCRA 3GEMA 5HIJA 1VIYA 3PPYA 5ENVA 3VOBA 4DYVA 5AHKA 2ON6A 1A8UA 5EFZA 5T14A 4B6JA 2ZU6A 2JGAA 4KXYA 1RAFA 1ZYUA 4Z4QA 2JBHA 2OHHA 4NL4H 5E1OA 3RFVA 3L2PA 4DARA 1QVRA 2DBRA 1YQUA 4JR1A 1OC2A 1GV1A 1S9HA 1FLAA 1XC7A 4YJFA 1E5LA 1PIWA 3EBLA 3M1AA 4YRFA 5D3ZA 1JHQA 4FYIA 3ZE6A 3NOVA 2WTNA 2X8AA 1OC4A 1PT7A 3FHOA 4MP3A 2EYUA 4PHHA 3QZUA 3RB3A 3KQUA 1X8XA 1ZD9A 4TKMA 4EJSA 4HXGA 2G1UA 1GKKA 1J8VA 3GJ0A 2IH5A 4BWSC 1HMYA 1RRGA 3NFRA 2VI5A 4QL3A 4EVSA 2WTFA 1Q3KA 4B9AA 2O0HA 3PRHA 3T5LA 4NR0A 2I9KA 3SQXA 4OU5A 2R96A 3W6ZA 4I99A 1JTEA 2O2GA 2PKWA 2GEDA 3H83A 4QTUB 1I01A 3AY6A 2HRQA 4M0DA 2RGDA 3FKIA 1RS0A 2GI4A 4ZI5A 5KMGA 1RWNA 3QX7A 4TS1A 3GLFA 4MCHA 1JIUA 1OI3A 4XR9A 3D4PA 2C2BA 5C8ZA 5F35A 3NCTA 5FO1A 7MDHA 4C0BA 3S24A 2FJPA 4MCAA 5A5VA 3LT0A 1VLMA 2QTVA 3G59A 3G2KA 4RPLA 2NVYA 2P9EA 2RI1A 2RKBA 1BMFD 3BL5A 3F74A 2WSIA 3QXSA 2H07A 2X0JA 2GFHA 2EJ3A 5KSPA 3TXAA 1YFLA 1F6DA 1N2ZA 1IN5A 1P44A 4XVRA 1SVUA 2K2QB 3O83A 5FI0B 1TWCA 2AN5A 5I47A 3P2KA 4HP8A 4R0NA 5FEMA 2I33A 4O2BA 2F4VH 3IRVA 1N7GA 3H4IA 4Q4AA 3PKZA 4B8YA 1UBMS 4H60A 2C99A 2NO0A 3ESQA 4NEHB 4D9IA 5DM2A 4AM8A 4J0CA 5CFPA 3JYOA 2PS9A 4QGSA 4WXEA 3ZLTA 2FFQA 1XZJA 2PUTA 2Y66A 2H48A 2PEYA 3NRJA 4ZT5A 1M6EX 3KOMA 4J0HA 1K4MA 3QIAA 1ACMA 3C7TA 4DZRA 1ZY2A 3J80A 2ST1A 3I0NA 2XITA 2CYAA 3NIBA 4ZYWA 1FTWA 2AUNA 5CR5A 3LC0A 4PZ9A 3UJBA 1ZISA 1JEQA 5AKGA 3AJAA 4RHFA 1FDUA 1MJNA 1EB9A 1C7ZA 2D0IA 2GUGA 1XZLA 1Y1PA 3BWEA 3FF1A 3H8VA 4JLKA 3W1VA 3TLXA 4DCCA 1YA8A 4C29A 2P9QA 2VJLA 4HAOA 1J1ZA 3UJPA 2Y99A 4MQLA 3EOBI 4L07A 4M1SA 1UNNC 3Q72A 1R0KA 2EQAA 2UXBB 2GM4A 4Q18A 2R9VA 4AY2A 1M0EA 4KWHA 2EYQA 3OKFA 2JA7A 3AVVA 4M22A 4ED8A 1HG0A 2FMXA 3B52X 1DUSA 4GYKA 5D3MA 2UU9B 4ED9A 4A5OA 5BYBA 2XTAA 1XQ9A 1G7TA 1P6XA 2RMKA 1KDZA 1S4QA 4X64H 3V6HA 2ODWA 2FLNA 4NG4A 2FWJA 2HU7A 2AHRA 1H0KA 2XJ9A 3ANYB 3OPMA 1QG6A 4BLRA 4DMHA 2PRZA 2VSYA 4ZDIA 5AIBA 4LWOA 4KQ6A 4O4LF 4A3CG 1VGQA 3H1GA 3IV7A 3PWTA 3MWLA 4R2HA 3SIPA 3RCBA 3WKBA 1KIAA 3A1SA 4W5QA 1ZMXA 1M5UA 3BM5A 3FWYA 1XUOA 3HVRA 4K86A 1AQUA 1KVTA 2QF7A 4C7BA 3KCNA 4KCGA 1JR3E 1M8FA 3L84A 1RXEA 2P9FA 2IU0A 4WAUA 3IIKA 4ZQCB 1EKPA 2ODPA 3WMEA 1HYEA 2C9MA 5KNCA 1IAVA 3SCZA 1WCWA 4M60A 5BN5B 1DLJA 1II8A 1SCKA 1XP8A 3T1HH 2Q5HA 2FOIA 1DKLA 2QUJA 3HRIA 4KDEA 3TLAA 2P75A 3TJRA 4PNZA 2OO7A 3HZRA 3IMGA 4IIHA 4UUBA 3ZY6A 4KQKA 5A04A 3R41A 2C5LA 4EECA 4D4LA 3IPLA 5DNWA 5LQCA 2C00A 4BUCA 1W47A 4ZK2A 2ATEA 2WUDA 1G3RA 3JY6A 4L74A 3UF0A 3ZOZA 3I8OA 4LF9B 3F90A 5IT0A 3JYNA 3CMCO 4MDHA 3GZ4A 2PU5A 2CLIB 2GLXA 3NAGA 3OLWA 1W1IA 2YJTD 3DYBA 2NPOA 3AEZA 4BTVA 4WJKB 1UPFA 5D01A 4HXEB 3GB9A 2A9OA 3VZQA 1FU7A 2O8NA 4LDRA 1NUQA 1DAMA 3PR2B 3UK2A 3IG0A 4RCVA 4YQYA 5T6BA 3GOQA 2YKGA 1MT3A 3HR4A 2Q5IA 2BFFB 2VA8A 4DY6A 2XF2A 4A82A 1MX5A 2A9VA 3KPJA 1OXKB 1YXMA 2BSAA 3IQGX 3P7MA 1EHCA 3TQRA 1JXMA 1SUCA 3H5NA 4MRMB 1RI5A 2FX3A 4YRIA 2WHEA 1JWBB 1K1EA 2F9MA 3IUSA 4WQMA 3MFHA 3DD1A 1EVJA 3EPHA 3GJSA 5E6UA 3TLMA 3VBEA 3UV6A 3THYB 5LKRA 3OQPA 2IS1A 3GTKA 2D6FA 3ND8A 1ENOA 3LWBA 1DMSA 3EQ2A 2W7OA 1XYYA 1CWUA 2WA2A 1PV2A 1VIVA 4I50F 1Z36A 1K6XA 2VK8A 5DGCA 5BRJA 4C22A 3Q7IA 1ZIPA 5D85A 2DY0A 1ORRA 3BXZA 3ZWPA 4DG5A 4GKKH 1F17A 4YAGA 4LHEA 5JWHA 1KWGA 4V39A 1QF7A 4NLGA 5LXTB 4YP1A 2CNVA 1IQRA 5AJHA 5JVDB 3HVHA 5DGDA 4DIDA 2FA9A 2HPZA 2C4NA 2FEWB 2XD9A 1TADA 2Z8YA 2BUAA 1VBKA 2J6TA 2ZTVA 2V1XA 2J3LA 4O3PA 4PLPA 5EYPA 4MR7B 3GUZA 4UVGA 4ZZ3A 1P91A 1VB5A 5DE3A 5BQPA 5EMLA 5CXSA 4TTSA 4J0IA 4WNIA 5AQEA 3EZ6A 1JEDA 2FRVA 4D9FA 1C7RA 2OPBA 5D86A 4KOEC 5KQSA 3EZYA 1ICEA 2IX3A 2GBFA 1C0IA 2NXJA 4E2WA 1NDUA 1P7YA 3VKWA 5C35A 4EUFA 1P4SA 2PXAA 1FCJA 3DE0X 4G4SO 4OSPA 3VO1A 2YVQA 3A6ZA 5F51A 4E7OA 4LF6B 3L7AA 4HRYA 3T3EA 1SY7A 4EARA 2V6FA 4DLUA 2BR3A 3SKXA 3AIIA 3VYVA 2JFNA 4QRIA 3SFVA 1B6RA 5DTEA 5AVWA 1E2QA 2IZ0A 4M1YA 1M1NB 4E1AA 5A1JA 4J03A 2G4VA 3CVOA 4DMGA 4MPJA 3AKYA 1EXVA 5DGXA 3K94A 2WM8A 1KYYA 1QE5A 1ZC4A 2A14A 2IXBA 1FFGA 2IYRA 4CV2A 1DAIA 1Q7EA 4I6GA 2ZDQA 3KWLA 1NWCA 1LQ2A 3Q2KA 3WIEA 4HO1X 4YCJA 2H7VA 4YMHA 3WRWA 2GGSA 5KYYB 2C1XA 2X2PA 4HYTA 4Z54A 1C9DB 5FLYA 3A6GA 2PKQP 2L0XA 2POQX 1KOJA 3RYFB 5AJZA 5BR8B 2FU5C 3F6EX 5GWXA 4N6OA 4HNQA 2EKDA 4EYQA 1XMVA 2C20A 2JHGA 4BEVA 1JLKA 2XIJA 1G2QA 4ZCSA 4D8UA 1KVUA 5G41A 4FINA 4BDSA 2OHJA 5KT7A 4GU5A 3QQ5A 3CX8A 5JSZA 1JP7A 5ILQA 2UVDA 1ZJZA 4DDMA 4RB0A 1CUBA 5HUJA 1MRSA 3EXHC 5J63A 1HURA 3RIMA 2Z9DA 4MR8B 5KOHA 5J2TB 1EAYA 4NXNH 4GKJB 2IKQA 3RAXA 4FUTA 1CNEA 4EJMA 1I1HA 2TSYB 1X19A 4II7A 3PYMA 5DGBA 4DLNA 3PI6A 1B2RA 4HLNA 4EM6A 4OXIA 4CL0A 2JCBA 4IIUA 1PJ8A 2OFWA 1A2OA 3A4IA 5LOVF 3OKPA 4UCSA 2I1WA 3S8MA 1ZZGA 5A71A 3TOZA 3I2JA 3GTJA 2VP3A 4XUCA 3X1MA 2R5WA 4DGQA 2A0WA 4J9QA 3M1LA 3R77A 2GNOA 4XX0A 1Z2AA 3ZOKA 3C3XA 3QJYA 1Y6FA 4ZTBA 2WSYB 2O8DA 1OFIA 1WPQA 1L7PA 2QVLA 3LRTA 3MT0A 4N0PA 2IIQA 5IAEA 4HVAA 4YRCA 3MBKA 4FHDA 2IW3A 1OOEA 4XAQA 3EVGA 3PIIA 4CR8A 4L16A 3IE0A 3OCZA 2CHGA 3E1SA 4J7UA 4PFSA 4U2GA 3TLZA 4DJDC 1GU1A 3DDCA 3UT0A 1V7PC 4L4YA 2J0UB 3TNJA 4BB6A 1KI6A 5LXTF 3TAUA 2IY9A 4I4IA 4X62B 4DR7H 5JWRA 2JI6A 1G8YA 1IHYA 3EGDB 4B3HA 3C8UA 4LJSA 1QHXA 2WR8A 1JKIA 3CKYA 4L15A 4RE5A 5HIIA 5J2UB 4EL5A 2ZJZA 3NM4A 3U6BA 3CO0S 2FH5B 4BGEA 1XE3A 1E9BA 3HU1A 2QLTA 1DEAA 2HBQA 3L4KA 1M73E 2GVZC 3T4PA 1F2TA 1SA0B 1R6UA 1U8YA 2JFYA 4OUDB 5DEOA 3ABRB 4KIFA 3I3OA 5HZHA 4I2VA 3PXUA 4JIGA 1U65A 4FKZA 4WV3A 5AW8A 4JYAB 1YI1A 1MH1A 1XDBA 5AM0A 2OXRA 1RVDA 4X84A 3OM0A 1AKMA 3SDSA 1DQZA 1HTBA 3DAYA 4ZAXA 5BNIA 3AEQA 3IQXA 3MTGA 5E2AA 4CQLA 2XR1A 5JHGB 4JYMA 3QF7A 2GZ2A 3PCXA 2VQEB 1YBFA 3I37X 2OCYC 1IZ9A 3UJ9A 4D8TA 3HB9A 3W7VA 1YZUA 3AOEC 3A6LA 1M1XB 5KWJA 4CF6A 1Z4OA 4EY6A 2QD2A 4L5AA 2NTYC 2PKQO 4PINA 5BXYA 3CX7A 5ITWA 2WJYA 5IP7G 4MS4A 3IB6A 2JFVA 1OXVA 2RBEA 3L8FA 3WZ2A 1GYRA 1YGPA 5EE9A 5BVGA 1PF7E 1A2BA 1QDLB 3AEQB 1WCXA 4NCHA 3UAOA 4TZTA 5CFQA 1IJBA 9GPBA 2VCYA 5AM3A 3NS7A 4DIMA 5DHPA 2Q6KA 2C83A 1LPBB 3G9XA 4RSMA 3TVDA 3WV4A 1PFWA 3GU3A 4CCAA 1FZQA 1QB8A 4A8JB 4ZDJA 3ADKA 2IH2A 1FFCA 2FE3A 2FZGA 3PDUA 5E6SA 4BNUA 2VSXA 4HDMB 4F46A 9LDTA 2V3VA 1IEXA 2YIVX 3BJIC 3OM9A 2QLBA 2XBLA 2HRDA 4PAQA 2HQRA 3LCUA 5A3QA 1CS4C 1YB6A 1SHUX 4JLPA 3SZMA 3MCZA 3HEAA 3OLQA 1RQGA 1SC1A 2GR9A 3GRUA 3KP1A 3SZUA 1E1YA 3V1KA 1A71A 4AZ0A 1COZA 4QJ5A 4BP8A 2G83A 5D7BA 1HOTA 1DT5A 4NQRA 1BX0A 3HCOA 1IG0A 3GUHA 2YOGA 3G5LA 4L4SA 2NUAB 1W0KD 2M2IA 4QEKA 5CB6A 2E5LH 4DR5H 2GAAA 4JZKA 3C6BA 4HDKB 4LVUA 4B40A 5ALYA 3T7KA 5FI3A 4M1ZA 2VWHA 1GFIA 3BWYA 4DLTA 3ADOA 2HH9A 4JOQA 5EJGA 5IC5A 3ZUPA 2C9YA 3WDSA 5BVHB 4U7DA 4IIDA 3A3NA 4ZOLA 3B6ZA 2VQFH 2EV9A 1QH9A 1U1EA 1MUUA 1EDOA 1SC3A 2Y1LA 2P11A 3OHMA 4FDLA 4KB5A 4RTOA 1TLLA 2Z98A 3W8FA 4E46A 4X65B 3Q1KA 1FUIA 2PX4A 1ZMBA 2RBKA 4ALNA 1RCUA 1XRRA 5JFTA 3QXCA 1QFZA 2OCXA 4H1VA 3VPAA 3VV2A 5JJKA 4C2MA 4QBIA 4XQGA 4M0JA 2CL7X 4MSUA 5AXAA 3H13A 3QU9A 2IU4A 1D2EA 2L2QA 5EA2A 2W4IA 3IAHA 4YYEA 3ZDXB 4ZHQA 2WIDA 3NAQA 1O5TA 4WERA 5EJ6A 1MV5A 2Y0DA 3ZYCA 4BV3A 4F97A 2FXIA 3EEYA 4PCLA 5BMVA 1L7AA 4RDIA 4XJXA 5IAKA 4B0PA 3SWWA 3VR1A 2W0SA 2ACEA 1YSCA 3RIHA 2FRXA 2CKMA 3U4GA 4YJFB 1OFUX 4RWEA 5FA5A 3UYLA 3I5UA 4ND2A 4P9NA 4EYEA 2EZ4A 1M0WA 3LA6A 2XRMA 1NUTA 2AT1A 2XE6A 3OECA 2C95A 5ALQA 4D43A 1XEXB 1Z2EA 2EATA 1F3LA 1FP6A 1SEIA 2G4LA 2QRPA 3C3WA 3KD2A 3ORSA 4Y6RA 1KZGB 1TM3E 2DRIA 3SMQA 5JD4A 5L8VA 3DFUA 1Y1LA 3KKMA 3MHTA 5HUHA 1UEIA 2V9ZA 1U2TA 1A9XA 4LGMA 2WW8A 3E9DA 2FMUA 4LEIA 5L40A 1IN8A 3SZGA 1ZITA 1KH2A 3HP1A 2R2GA 2PRYA 5EG5A 3RYIA 4AXXA 5C8YF 3DE7X 1SQSA 1PK9A 3T4EA 5FNVF 5LLSA 4JJ7A 3AM3A 3O4HA 4R8UA 4NYIQ 1QKKA 3W5HA 2B37A 4J9SA 4DV6H 5IWCA 2J30A 5KDDA 1J1UA 2YWBA 4KK4A 1OTXA 2C2YA 3AEKA 1M2VB 3B9BA 3LK7A 3HEMA 3RS2A 2AL7A 3ZY4A 2PZKA 4N3BA 4B09A 1PGNA 5KX5B 1Y34E 5KYXA 4TV8B 4PHFA 1H69A 4RJLA 1XHFA 2GM9A 2CBZA 4WK6A 5IDYA 3TRJA 1Q50A 3CT4A 1KKUA 3NCHA 4ZQBA 3NXKA 3G88A 4NAUA 5D7NA 3HY4A 3T9EA 1SBTA 5AJXA 2IE8A 5DHSA 5HIKA 3THWA 2FSPA 5LFAA 1DXOA 2VRCD 2YYAA 1T6YA 1YS7A 2BFDB 2JAXA 3JTEA 3E1GA 4TX1A 8OHMA 5IBCA 1SCJA 3WFZA 4U7JA 3V48A 3C8MA 3V8MA 5LD2C 1ZNYA 3F67A 3U4IA 3S8EA 3RJ5A 3G0DA 1WQ4A 4BRZA 1DDGA 3CF2A 3HFGA 5B30A 1P4JA 4TWIA 1J0BA 1CBUA 1P81A 3AT1A 3RWMB 1SZDA 6NULA 1OREA 2WF5A 2P2YA 4TM7A 1UZMA 3U4HA 1EXNA 3AR2A 3OJEA 2W6OA 2Q3FA 2XA9A 5HF6A 3SC4A 1AA9A 1CUAA 5JH7A 1JSRA 1AGNA 4NEGA 2IPMA 4UMFA 5EIHA 1AQJA 2NNWB 4G5SA 4W9RA 4RDHA 4ZQIA 1PEYA 1TYBE 2H9IA 1UZNA 1NU8A 2R1ZA 2JHPA 4J91A 4NFLA 5C1DA 1I94B 1H5UA 2C8VA 3G1TA 1EFPB 1IJKA 1DQYA 1GLNA 2HUPA 4L51A 1N2OA 3U19A 3QBDA 5HG0A 4BY1G 2HM7A 3IVAA 1PYDA 4U7HA 3BT7A 2WU4A 5F1KA 1Y1RA 3QKTA 4LHXA 3H87A 5G0TA 3IOMA 2I2WA 2H51A 4WFIA 4ZO6A 5J1TB 4DNOA 2FPMA 3UWMA 1NNI1 3GLSA 2QX7A 1UFKA 3EJ6A 1IZYA 1PN3A 3BHJA 1I1QB 3JQEA 3DLIA 4YFVA 2REXB 3BD7A 5I5WA 4JL5A 2JAQA 2P30A 1NBAA 1Q0QA 3CCCA 4K9LA 1RAHA 2OBYA 4U2EA 5C5CA 2JLVA 2QLJA 4YRKA 3VPCA 1V8PA 3SNOA 1VE1A 3NYRA 2HKIA 4WZ6A 1CIVA 4C30A 2NYRA 1EDEA 1KYXA 4LE0A 1ZPDA 3HKEB 3PRYA 4BMVA 4F0JA 5CPFA 2FW8A 3NBZC 4FOOA 3N1UA 4I55F 2VUMA 2ZKIA 3E7WA 5I7HA 2WTXA 2ECKA 1KIMA 4UD2A 3MT9A 2DGDA 3PN1A 1I4DD 3Q6IA 3OUZA 3GV5B 4EMBA 4P33A 2ZSJA 4DCSA 1ENYA 3A28A 1FKAH 4D3YA 2GH1A 5THXA 4MVJE 4X1YA 4WN9B 4Z4EA 2OLKA 5F1PA 1RYHA 5KSZA 2IIPA 1IWOA 4JBYA 4LYEA 1XNQB 1Z6QA 1QFSA 5EWLA 3WK6A 4A26A 4EBCA 2IOQA 4TQAA 3EQZA 1WLSA 2ZSUA 3BIFA 1IQ0A 3GN2A 3NC4A 2AC4A 1WMSA 3R5TA 3O82A 4EF6A 4PX3A 4YR7A 4BNIA 1X80A 5DULA 4DVJA 1XZNA 4YJ2B 2BW0A 4PTZA 2BHSA 4TOIA 1QHGA 2H29A 4ZYLA 1YS4A 1W2WB 1VCNA 4P34A 4S04A 4RTJA 5TF0A 4MRMA 2YMLA 5DOVA 4X61A 4L4UA 3OP4A 5HE8A 1LWNA 3B78A 4KAXA 2HUNA 4RM3A 1RQPA 1X0VA 2B6NA 1KC3A 3VNQA 1A7KA 1SVMA 2OFOA 4PLYA 2D1RA 2GFIA 1SHZA 3TECE 2WU3A 3L6OO 5EPOA 4JL8A 2DPHA 3O90A 3EVAA 3TLGB 2F1RA 4Y2PA 3Q7SA 3QVLA 3RRJA 4DR3B 4MXDA 1P2FA 5C34B 4UKDA 4DPMA 5AW2A 1LVUA 2UVWA 1VJ5A 4CM6A 5B2EA 5BNWA 3QF4A 2FW6A 2XMRA 2IOFA 3M33A 3ANSA 4MA4A 1NRXA 3DXXA 5KYXB 1NXOA 2HIGA 1SPBS 1LNSA 3MJVA 1KYTA 1R50A 3WGQA 4D5EA 3WNZA 4DR1B 2FRDC 1OWOA 3S40A 2JFGA 4LJAA 3EFEA 2AQHA 1DB3A 3RBZA 4O86A 2DUWA 2QMQA 3ABZA 3E2IA 2B63G 3ROQA 3G8AA 4FMDF 4ECEA 2YXDA 2GWHA 5BSGA 1RQ7A 4H1UA 3AG5A 4EYIB 4YHHB 2J8ZA 1GDDA 2WABA 1RYDA 4LRXA 4FZVA 4WZAE 4KW7A 1C0KA 4KOAA 5EP3A 1NQ5A 4NJOA 4C03A 2WMNB 1PTJA 2NLOA 2BGRA 3SZLA 3UWSA 1Z0KA 3ONWA 4ZIRB 5C5JA 5EJ9A 2I0FA 4WK4B 1N9ZA 1DHTA 4D2IA 4AJHA 1NLFA 4EJFA 4R8KA 4NKRA 5I9LA 5CA0A 1W2HA 3W8EA 1PRYA 1ULHA 5TQ0A 3EDCA 2ZT8A 2AZXA 3WE7A 4K9QA 3EOAI 4RKYA 2HGZA 4M0KA 2GPAA 1K7SN 4G25A 1PDOA 1SXJC 2R48A 3ZWCA 5CLFA 1JHXA 4HDKA 4ITUA 1Y3HA 1J39A 1OIXA 3ZV3A 3UWKA 4Z7JA 2GAFA 1UJ5A 3FNQA 1XF1A 4DT1A 1NN0A 4L3VA 5IT5A 5FJ8G 4C0XA 5CU7A 4AAYA 5IH3A 1ZQ7A 2AF3C 4FLFA 4XIGS 3BMOB 3K5WA 1MAVA 4YP5A 3FVRA 1P7ZA 4CV0A 4RNNA 4YCSA 4Q16A 2VLIA 1YDWA 3MELA 3WAJA 1OBGA 1ZWKA 3DMRA 3PQDA 3WYBA 2AMFA 2F3RA 4N7JA 5DCYA 1UCFA 5JZBA 3ML1A 1Z13A 1VHDA 2FPXA 2HOQA 2X3UA 1FRNA 2MSCB 4UCOA 5ALJA 4O1MA 3HGQA 3M89A 4OQFA 3PUVA 5JWOA 4BJ1A 5E3JA 4HKTA 4ZAYA 1G20B 3IMKA 4PV7A 1Z6AA 1WW2A 1L8OA 5U1PA 2XUHA 1H6AA 2H06A 3FW1A 3O8DA 4FMDB 3UGKA 5ULLA 3EVZA 5KG5A 1D8AA 1W5SA 3DV0A 4P80A 4Q1VA 3U1VA 4DR1H 3I5AA 3U9LA 1F8GA 3WB1A 3ZHXA 4CL8A 4EPRA 5KINB 3GLGE 1F8YA 1NVTA 3GPLA 2QLLA 5JPIA 1K5PA 2BP7B 3MF4A 3T1QA 2VT6A 4NTZA 2NM0A 3A3YA 5DT9A 2DB3A 4PAWA 1FK8A 5LMUB 4ECVA 1S96A 1O6ZA 2J48A 2W2PA 4ZWNA 4DV2B 3WNVA 3GVIA 1XZPA 3IQEA 4PPQA 4F4FA 2LCIA 4RTPA 2UYCA 5HGXA 2WWIA 1E63A 2PQ6A 3VO9A 4WJLA 1C0LA 1ZK1A 2XMBA 1JKJA 2XGQA 3VH3A 5EOYA 4MI1A 1W94A 4E5KA 4JASB 4WGFA 5CFMA 2ONKA 2JIBA 3GX1A 4OJNA 5ALXA 1VP3A 5F5XA 1Z5GA 2Q49A 3ZV5A 3FYSA 3B3FA 4B82A 4DQ0A 4AK9A 2PYZA 1KSJA 2ASEA 2P9TA 3QBTA 3FB4A 5IM4F 4IR9A 2GARA 2HXSA 3R3VA 1EU1A 2G07A 3WQBA 1G55A 1ODLA 3S29A 2Q9UA 1CDDA 4KYUA 4OH7A 4NABA 5HA5A 5AW0A 5H68A 2O59A 2P9HA 3REFA 3W7AA 3QKRB 4AIRA 5I5SA 2GILA 1CZOA 2QE6A 3JZAA 1PL6A 4YR3A 2ZSIA 4RACA 1GQFA 4KZPA 3RS5A 4RTRA 4E03A 2PUGA 4MW0A 5EXDA 3OTQA 4F2WA 2GEUA 5LNK1 3K9HA 4IIJA 3OX2A 3ZCSA 1MO5A 4IKEA 1LDYA 2Z9CA 3CG0A 3NT2A 3DUFA 4O4IF 4CN8A 2JVJA 3OOEA 1HFKA 5DH9A 3B3QA 3ZIAD 2E55A 1S1CA 2A0FA 1E3SA 1ZGBA 3OAAA 4MJ3A 1MD9A 4B47A 4BAZA 5IASA 3VBCA 3VH2A 1W0JD 4JU9A 4KVZA 3JATA 2FWBA 4E07A 5BV1A 3LDFA 2H6EA 3H0EA 4BNXA 3CKKA 1WX1A 1RI3A 3A1DA 1JV2B 4BTEA 4MUIA 2C4TA 5T67A 2IYYA 4P35A 3DHNA 2ZEJA 1LRLA 1WDLA 2VQ6A 1HLFA 3CZ4A 3FLAA 3OEEA 3LX6A 3UENA 5A5FA 4H31A 2WWYA 3QIVA 4DV0B 1MJGA 2AE2A 1R6AA 2B83A 1NUAA 2CZQA 4NJEA 1WHTA 3MFYA 2YWFA 2PWPA 1DJLA 1V1MA 2ALZA 1Y5NA 2W9BA 3TZLA 1GR0A 4CJXA 1I94H 3IA2A 1IU9A 5CH3A 3ZHYA 3GCGA 3BJEA 1NX9A 3GZNB 3Q0EA 3LBAA 3IUPA 3JXEA 1UXOA 1YQDA 2ZWIA 5HBGA 3OLCX 1ZX1A 3I2IA 4RXMA 3WQQA 4HADA 2QGNA 2EARA 4Y6SA 4XX1A 1X7YA 4OQPA 3TYXA 1QTNA 3IAM6 3UAXA 5LQKA 1GAJA 5HTOA 1DQRA 2YIMA 1Q2XA 3SIXA 4HWOA 3ACCA 4ZEOA 2Q5EA 4LRUA 1M5TA 2DKNA 3CVZA 2L18A 4RIIA 5THKA 3K3VA 3U4DA 3M4XA 2IV3A 4V03A 1U3TA 2GBGA 2IZOA 2FE1A 4IYRA 1HEUA 5IDWA 1J9GA 4Q4DA 4MIEA 5IBQA 1XCMA 2E4VA 1T2CA 1I50A 2VBFA 4BE4A 2C9BA 5A6SA 3RAFC 4OSOA 4BO6A 2ID7A 3OF2A 2PLWA 2XOXA 3DQZA 4JB3A 4KQCA 4EEKA 2C8JA 1YGYA 2Z6QA 3K2EA 1QYCA 3ACBA 1YZNA 1NHGA 3OHPA 3WICA 4D4GA 2DU8A 3MTQA 3AX6A 3BEOA 4YJGB 1ZOSA 2PANA 1CEYA 2NSLA 4KLCA 4MV3A 4O7YA 1ISGA 3EN0A 4Y18A 3PNLA 5KCMA 4B85A 1RXYA 2B35A 2JRCA 2Z3WA 4D25A 1GL9B 1KZ9A 3EY9A 1KMMA 3K6SA 2Z5LA 1P5RA 2GEKA 1CE8A 3IKMB 4A8HA 2BEWB 3AJ8A 3RSOA 4MDEA 2XWSA 1Z38A 4FLEA 1TA8A 2ZFUA 5CVCA 3R1IA 4B6QA 5J2TA 5CM0A 4GVXA 3OP1A 4IV8A 5IAJA 2GX6A 4KAJA 5L4SA 4K03A 3DWIA 3GVCA 3JWHA 1OUMA 4UVDA 5DM70 3E2PA 2IE0A 1OJLA 5J5CA 1OU0A 3WV5A 4C7VA 2AS0A 4MVJA 2OHOA 5KG3A 1N2CB 3IP6A 3GVPA 3QVTA 4NBRA 5A2QA 4GVLA 3ZVMA 3NP7A 1BXZA 5C7OO 2RDIA 2FJ0A 1UXIA 3QMMA 3V32A 4QDKA 4H6VA 4LFAB 2R60A 4GI7A 4HZGA 2YHAA 4GC5A 2J9FB 4ZHQB 3D6UA 1C1DA 1Q0UA 1UR5A 1Y48E 3I9V1 5E1BA 1HNXB 4HDSA 4M8LA 4HVCA 3V6KA 1PP4A 1XD9A 2V0NA 3LBYA 1CP2A 4RXUA 1IOLA 5B1DA 3WYCA 1T3HA 2Q5OA 3P9PA 4PN7A 2BGNA 5AVXA 4NYMR 3S81A 4LVCA 4GMHA 1V0JA 1D2GA 4BKPA 2VDVE 3HSKA 3ACDA 1ML4A 4XSHA 1NXQA 1RI2A 3GFFA 3TZ6A 4DA9A 2G5PA 4OQZA 2W2XA 3FPEA 4ADSG 3HO1A 5KNBD 3MGBA 4AZ3A 4TUYA 2ZETA 4B4KA 4TTIA 4K6OA 1XMQH 3KL4A 4FX2A 6ADHA 3I28A 3WGIA 1L4BA 3Q6MA 1OT5A 2PSHA 3OVMA 3PJGA 2VDNB 3PW5A 1E69A 1S2GA 1XRQA 1BS1A 4BBSG 2VK2A 4L78A 3RTGA 5CA0B 5LMCA 1ZM9A 2DUNA 2G17A 3LW8A 3G7SA 2BFPA 4XW2A 2ZJ6A 3RS9A 2Z02A 2ZIEA 3M3DA 5E38A 1RM5A 3OHAA 4DM3A 2EGHA 2OM2A 4DBLE 4I9GA 4IEEA 4JGGA 2CKZB 3O8QA 1H2BA 4QOHA 5IABA 4C6TB 1KK0A 1TQHA 3WXBA 3RBAA 4AB1A 4B1FA 3DKVA 1RE0A 4AKEA 1M2HA 4PNEA 4BQEA 5I5VA 1UJ4A 2W8BB 2SICE 5D3KA 4YH1A 1T6BY 3H18A 1CRQA 1VYVA 3QUCA 5BSWA 1J49A 2NU7B 2ZUBA 3QVXA 5ECWA 5SY6A 3OFVA 4RJ2A 1F2VA 4AMUA 4RL6A 3Q9LA 5GADl 2BDUA 2C2RA 4IY1A 2WDPA 2YWHA 2XI4A 1EKXA 1LY1A 5F1YA 1OTHA 1RRVA 2O1EA 4EF4A 4O8ZA 4MB6A 3B1YA 4GYWA 5IAOA 221PA 2AI2A 2ATXA 4JH0A 1UOOA 2W8BA 2W2LD 1XEWY 4G41A 3AYZB 5FBQB 5KU7A 3CIFA 1ECLA 3U37A 3A1UA 2YCLA 3EODA 4F92B 1GTL1 3GDEA 1CUCA 3X2EA 1ATIA 5AR1A 1PK8A 4G1EB 4AJOA 4OGGA 3J80W 4AJPA 3GDOA 1V9SA 1M83A 3JQ7B 4M1WA 4Y67A 2OSBA 2WWHA 3AHIA 4IRUB 1E61A 3IV9A 1R6XA 4O2RA 1GV0A 1M9NA 1L8AA 2X5KO 3UMYA 4KX5A 3QPVA 1X1SA 4X1KA 1JFFA 2C78A 5K8JB 5E2BA 2WHPA 4D41A 4QU0A 3UTCA 3OQJA 2IUUA 3NMUF 1KFEB 4V0ME 3GQBA 1E2PA 2IMWP 4N9WA 3UMVA 2CDNA 1SU7A 4BJ3A 4DBVO 4MR9B 2SNIE 4F56A 4BKQA 1UKCA 1Y42X 5B6IA 3OCUA 1CRZA 4CMBA 3LPCA 3EZ7A 3T3IA 1O5OA 1OXSC 4X6UA 4X7PA 1GTRA 2I67A 3QLUA 4COKA 3R8FA 1ODIA 4RF3A 2ZLBA 3DZDA 3RABA 2ZXUA 2J85A 3A9CA 1ORVA 4N0MA 2VTEA 2P9GA 4F72A 4XIJA 2CNDA 3DAGA 1NJSA 1RRPA 1E32A 1SIBE 2B1GA 3RASA 1EMDA 2P7IA 1I32A 3M3PA 5IJAA 3GIWA 2FZ5A 1ULZA 2A5FA 4GPAA 1QIIA 3FCOA 4WE3A 3GLUA 2J5QA 1S7CA 3LO8A 3KQWA 1WSBA 4M86A 4WZZA 4ESHA 1LK5A 2W22A 2R84A 4Q7EA 2ZJ7A 1QO9A 1EGAA 1R6DA 4JJIA 3W3AD 3CB4A 1XF9A 3V4OA 3T5JA 4BASA 3MR3A 1OT3A 4FXPA 5GONF 1MLDA 1DL5A 1RM3A 2OESA 3LUCA 5IJ0A 5A0TA 3V4PB 1FNDA 5KFBA 2DF8A 3PEEA 1N6HA 3EGCA 4GGMX 4AUNA 1QF6A 3AP2A 5A4JA 1PKXA 2CL6X 2WD8A 3QYAA 5CE8A 5A3SA 3LD9A 3MFIA 1W0KA 3NTUA 3O47A 3ZWMA 2WMDA 4H6XA 1P0CA 4PGHA 1QLHA 1HEIA 1U1GA 2AN4A 2ORIA 4I8XA 4KXMA 4KNWA 4LYGA 1L5SA 1QHHB 1DAHA 2CD9A 3LT4A 1ZM2A 4Y2QA 5K0LA 3TLCA 5JAHA 1KS2A 1QFXA 1SXJE 2XXAB 2VBCA 2IUSA 4J9UE 4M36A 4OJQA 4UEJA 2XNDD 5DU2A 2XPCA 1PHRA 1RZUA 1G4AE 3RYCA 3T1YB 3X2FA 3ZV6A 1R9TA 1DFIA 1ECFA 5B57C 4DILA 1ZCZA 3D6FA 3BQ0A 4NRDA 4NCNA 3JQQA 1GZ5A 5D6NA 2I3GA 3PUWA 4II3A 4RLFA 2PT7A 4YDQA 2QP3A 4QUBA 1GPYA 1MQ8B 4J43A 4WDQA 3DMDA 1VAJA 4X45A 2WZDA 2FUEA 1A88A 4H0FA 2Q2OA 2XXAA 3V1NA 1W6RA 1NYTA 3GPIA 1Y1WA 1H1TA 2YASA 4I08A 5FI1B 2P5SA 1XWIA 2ZBFA 4EZBA 1CEXA 1T1EA 3P0FA 1NPDA 2WJPA 4V0OA 1DKQA 3DBIA 4G1CA 3D7MA 2QU8A 1T4CA 2P3SA 2IY7A 4NAHA 4NOJA 4UOZA 3ZE2B 1PD1A 3Q7RA 1O89A 2E9SA 2N1BA 4V0RA 2QS9A 3MQFA 4QUKA 4B74A 4MUJA 1CY7A 4U3JA 4HRVA 2WF9A 4F6CA 1LQTA 1FIUA 2XH8A 1ZZEA 4IM7A 4N3GA 1O6BA 3AQ4A 3T35A 2FG7C 1ZR2A 2K6GA 4CI0B 1NNEA 3M4ZA 4O6VA 1ZIDA 1NN5A 2ZUCA 3OFNA 3G23A 4J9VA 2JK0A 1T94A 3DHEA 5K3EA 3CW2A 4H7KA 5EP2A 3KR1A 4PC2A 3VNAA 4QUIA 4A3JG 1TQ2A 4UBLA 2P0EA 4RD4A 4FYJA 1GLGA 3WL4A 3CSUA 4GMXA 2FW1A 4D96A 4Z4CA 3IP1A 3KZXA 4W7HA 2FF5A 2W6JA 3NHLA 3T3NA 4RLHA 4LQCA 1MAAA 2F55A 3ETEA 3WLLA 2NP6A 4ETSA 4YROA 3C0FB 2I7TA 1A1SA 3EGIA 5B12A 3IP7A 3G85A 4CCWA 1SUIA 3HI4A 3HY3A 1V39A 1TYEB 2NU8B 3I0MA 3UA4A 5ESRA 5KKAA 4KR3A 4QKQA 2RC5A 3HACA 4IQ4A 4QOSA 1E79D 4NXMH 4QQ8A 3E05A 3EPPA 5F52A 3HVJA 5HDBB 5BR4A 1RQLA 5F5LA 2H2DA 4G2NA 2H3EA 4OMDA 3SHTA 3HA7A 3CLUC 1HH4A 3K72B 2RGRA 5CX4A 5AKYA 2I5PO 2O3RA 3IR6A 4CR6A 2R6R1 3F6YA 3JQRA 3LUBA 4MYHA 3OCVA 3DLHA 4XEUA 4YIHA 1XJWA 4YLYA 3DVAA 3KEFA 2GEBA 3H1AA 2C94A 1EEXB 1PJSA 3NGLA 4KRYA 3HJHA 3DV0B 3LMLA 3RC9A 3MILA 2I2AA 2IK8A 1N5JA 1V1RA 1JDUA 2YHUA 3AF2A 2C5AA 5L1IA 2HVQA 4QIHA 1NN1A 2X9QA 4S1NA 5DYTA 5I9MA 1FRVA 3DTGA 3KKEA 4GZ5A 2FZ4A 3ZWKA 4BNNA 2C3YA 3WGYA 4H3KB 4ND8B 4NYJQ 3MM4A 2HA4A 5KHLB 1NJFA 1O9GA 1ZETA 2OHVA 1TCVA 4Z51A 1VL5A 2HRZA 2LIVA 4LUCA 3R3YA 4ZRDA 5HFNA 3WMRA 1SBQA 4FHFA 7REQB 2MSNA 4URXR 1KZYC 5K3OA 1C2YA 1JDBB 1A2QA 2PZLA 3KB2A 3MLAA 3REOA 2QEQA 3VYWA 3PW4A 3I09A 4TL6A 4RQBA 4E09A 4DBLC 1KQOA 5DCLA 3I8SA 3OC6A 3ZZ0A 5CIYA 5JVDF 4KQXA 3TL2A 1XR3A 3GGSA 3QG1A 2I2XB 1UDCA 4MVJF 3NBMA 3EVBA 4Y6PA 3VQTA 4MRSA 4DLKA 4HYQA 4MVJD 3K9CA 1QV9A 4FTWA 4G0PA 4P32A 5KFDA 1QQTA 3NTLA 4C0SA 3U0GA 2GM3A 2JLAA 1V4BA 1XAHA 2CF6A 3AF0A 1G8FA 3MJCA 2IXFA 3S5JA 4D6YA 2Z95A 5DLEA 1GPNA 3PFGA 4CLXA 4KPYA 4DCNA 1OF1A 3K73O 1G6Q1 4Q48A 1HLDA 1T91A 1U7WA 2RH5A 2XGMA 2EFJA 1BYUA 3D5TA 4GPZA 4WFQA 2JCVA 4JMPA 1X6VA 1AXEA 3AI2A 4KFRA 2MCFA 1WCMA 3RW9A 5A4FS 4RVFA 5C9ZA 4YP0A 3Q8SB 1VDMA 3GVXA 2WB1E 5BYKA 1ZGJA 1TTQB 2F17A 2ZRDA 4R3WA 1R8QA 5LN1A 1Z12A 3FTCA 2IP2A 3AJEA 3QELB 3ER8A 2EWVA 2OP1A 3CUTA 2FPSA 2XCTB 1W25A 1UEXC 5CJPA 1YR6A 5CFLA 1LX6A 3BILA 1RC8A 4O82A 2XODA 1GTSA 4GOKA 3UATA 5BSKA 4G8CA 4TTRA 4BLSA 4YCLA 2VYQA 2BY4A 2HJVA 4IDEA 3LIPA 1NVVQ 5JVLA 3B38A 3EGXB 4FHEA 2X1VA 4H7FA 2QSZA 3P71T 5HHTA 5DWQA 4A93G 2R6ZA 1YJAA 3IVMA 4AY6A 4GI5A 2II6A 2V7XA 2I6TA 4Z7QB 2WTUA 1FRZA 1U3GA 3DR5A 3PFBA 4KBFA 5AI0A 1WUHS 3A6DA 3PVSA 4KI0A 4OHWA 4R2XA 3SICE 3OOHA 3P9YA 3SBXA 3GLFB 2PPLA 4IH9A 4DUGD 4TS9A 1F06A 2QVBA 1L3BA 2C5SA 3EIXA 3H4MA 4DDVA 5EUCA 5IYCG 4J9OA 2HIAA 4TTPA 3RQIA 1LRKA 3I92A 3D54D 1E60A 2DPXA 4QTZA 3U3OA 3EEBA 4JP5A 3T41A 4GI2A 3KZVA 1UT6A 3VAYA 1UQUA 2AJCA 4P7BA 1TM5E 4LOHA 4CMEA 1DINA 5K2OA 4HFNA 1E4GT 1Z0AA 3YASA 3I76A 1IB0A 3NAZA 3RGZA 2OZEA 4B2IA 4MYUA 1P74A 2PT9A 1YQ9A 4QODA 3QENA 1EK1A 1BDIA 4PZAA 1QNFA 3M9MB 3MJHA 4HQRA 4PBCA 2CXRA 2XQJA 2Y05A 2IP1A 5TT0A 3GYBA 3OLXA 4CTNA 4YR9A 4GX5A 5KFQA 2XMQA 4HNAB 1VOTA 2ZSDA 4IDFA 4NBNA 2IYQA 4CM8B 3GCWA 4XJSA 3TOXA 4UCFA 1BD4A 2O7NA 3AF1A 5G4KB 3VC7A 3WWPA 1U9CA 4OH1A 2WKSA 4DL4A 2QAIA 3FDZB 4LJLA 4Q01A 4WEQA 2DWPA 5LBIA 3SZ3A 3W6PA 5KWVA 4KXLA 1YDFA 4MV5A 3HT5A 3WO0A 3BDVA 1X1CA 3KTAB 2J6UA 2VKTA 4PWZA 4GP9A 4E32A 1C0EA 1ENZA 1GGHA 2DY1A 2VXYA 1NI4B 1EA5A 5GV7A 5CFZA 3GAZA 2IYFA 4M8KA 1CRWG 3VR4H 4M8IA 3T7RA 1G5TA 4KQMA 5IM4A 4EJ2A 1FXWA 1UWLA 4RVSA 2UXCH 3IEUA 3AL3A 2R86A 3SQMA 3FDZA 5JRZA 4H08A 5FUQA 4CKCA 2EVWX 1Z3CA 3INYA 3NRCA 3BQ1A 3DCIA 1ZICA 2ECPA 5SZJA 1JIKA 2AKAB 2QX8A 3KUKA 3AO0B 4O0LA 4Y2HA 4KO4S 4ZQHA 4JI1H 5P21A 1TCBA 4OXYA 1T8YA 4EKYA 3V1MA 3HVIA 1DQNA 1TZJA 1YDMA 3K5IA 2A0YA 2N47A 1QO0D 3STVA 2IELA 1OR8A 1P5ZB 4IZ6A 4PYNA 4BO5A 4ZGGA 4FDMA 4MTDA 3L7CA 4FEYA 4OHKA 3JALB 3DV9A 3RJMA 4CHIA 3W5OA 1BGWA 3HFRA 3EASA 3F7OA 3LPAA 4H35A 1I7PA 2OBBA 3PA8A 3IXLA 4UHFA 5EYPB 1I5OA 4ND1A 3L7NA 1WHSA 4H0NA 5E7IA 4FE4A 4WD3A 2EHDA 3AP1A 3M5DA 2MYPA 4H7IA 5KFCA 4KSYA 1E2KA 4GC6A 1K8RA 3VDXA 3N2YA 5FUWA 1U28A 4B84A 2XKAA 4R2KA 5GPBA 3T5GA 2GF0A 1JH8A 1TAQA 4O7TA 3U6KA 1K8YB 4PZZA 1N2CE 4ARCA 4KQIA 4LDPA 4WKPA 3VO2A 1QOQB 2OLJA 3KAJA 4LBZA 3VR2A 1E1KA 1WD7A 4FCWA 4ENRA 3T1YH 5IXYA 4CC5A 2VDQB 2XYRA 1SCUA 4KR9A 1SCIA 1V8OA 3OUTA 3DWEX 4UJ3A 5K3AA 1M7BA 1UKEA 1WF3A 1PQWA 1T0PA 3AUKA 4RA6A 4ZAFA 3VVBA 1CSEE 4XWWA 1PWHA 2JIRA 3OPXA 4Z2AA 5KFXA 3ET4A 4DV7B 3DDWA 5BQ3A 4GW3A 2B78A 2XUJA 3I6IA 3QVMA 2OC9A 4D8YA 1MZPA 1K7EB 3NLLA 4YCDA 5CK4A 2AXEA 4KGDA 4GXRA 4UUGA 5FR2A 3W5IA 2BLLA 5DNCA 4BGUA 5CB4B 2CC2A 1GNRA 4UHDA 4PW0A 1W5EA 3OG9A 4TMZA 2HF2A 2OILA 3CVYA 4P53A 1F0YA 1U0NA 4WKOA 5ILGA 2D5AA 3WL8A 4BVHA 1CRPA 5IPFA 1E6WA 4BOYA 1A8QA 4WSOA 4TT3A 1L5YA 4A8TA 3QEOA 3HZZA 4IL5A 1Q91A 2YUTA 5IKMA 1L8QA 3UAGA 1JA9A 5CT4A 4CT4B 1UC8A 4F1WA 3I64A 3S1AB 1ABEA 1AV7A 1A3GA 4A2BA 3L1KA 5DGHA 3QFTA 4FFBA 4Y6LA 4BZQA 2HHFA 4O7LA 3FY4A 4KDFA 1TECE 2IS2A 5AW5A 2G3YA 3CCBA 4JEHA 4MTEA 2GTHA 2XE8A 4BV9A 2JFWA 1GADO 4WXHA 2C5GA 1DTEA 2M1XA 1P72A 4LF4H 3PFWO 3UJ8A 1IRXA 4MVXA 2JJ2A 2CNNA 5ED4A 1NKSA 1PR3A 1OZHA 5DYYA 5J2UA 1ZVJA 1VB3A 2FRDA 2YVUA 3BCRA 4MRVA 5ITSA 3PGXA 4OI2A 1J5EB 3HB7A 4EI9A 5LWHA 1C9JA 4NK4A 5CHYA 1IM8A 1RWMA 3WNBA 3OZCA 5E4FA 2JJ1A 4ZEXA 2VYNA 4ZU6X 1HDZA 1H2XA 2FSIA 4F38A 5BWUA 4PSUA 1AKWA 2KPOA 5SZKB 4A2QA 1PU2A 4PLCA 4A3FG 2FQYA 4OX9B 2QUHA 1NI4A 4JKYA 5H82A 3IBSA 2CK3D 3OUUA 3ZDQA 5FH9A 2O8DB 1MDFA 2P3QA 1T8TA 1NUPA 2GA8A 2CMFA 2D62A 2WMOB 4R9UC 4V2UA 4BNZA 4BQNA 4U2DA 1IBLB 3R44A 5IBPA 1A1VA 1VE6A 4UUQA 4E0BA 3KT8A 2ZBRA 2ZVDA 3VZBA 4U2CA 3ED5A 2DG2A 4YJKA 4XPIA 2JCXA 4RUAA 3M82A 3PR4A 4X54A 2D8AA 3N8KA 1T8RA 4YT2A 1JG7A 3K16A 1QS0B 4IOJA 4DPLA 5BY2A 3VSBA 1OBOA 3MINB 1YA6A 5IWAB 3KOZA 2G6BA 3NBQA 3UMCA 3ZKAA 4CG0A 1TTTA 3KXKA 3KKLA 4ZCIA 4BZWA 2VCEA 2JCSA 3PW7A 1NBHA 1RD4A 1FW8A 3CQZA 3C7AA 2PGDA 3EUFA 1TT7A 3K0FB 4GNKA 2VSQA 2ZYWX 4IWNA 4AJKA 1MA0A 5IWAH 4ALMA 2W6ZA 1U3FA 4EHFA 3H9QA 1GO2A 3H5RA 3P9CA 4BDTA 4JT2A 3JVIA 3JQ8A 2X0SA 2QL7A 5BSFA 1NLZA 1NL3A 5DGIA 4FIZA 3FFXA 4AJ4A 1V5GA 2GT1A 2D8MA 1NULA 2WJHA 4NX2A 4CPDA 1TWFA 1RPTA 4BXOA 1Y6RA 3BRWA 4K9MA 5J5VA 5KFYA 3WIBA 1ZH6A 4MV9A 1VC2A 4PANA 3ABQB 1JLSA 5ALDA 2VQ3A 3RSZA 3TKYA 1ZAYA 3TUZC 3CVJA 2CW8A 2V0CA 3MUOA 4Y1FA 1F8FA 4TM5A 4YRMA 6CHYA 2OWOA 3R9XA 4AC9A 5I60A 1VI2A 4YBZA 3ABIA 1ZJ4A 2D2EA 3RROA 3VZCA 1Z33A 2Q27A 2XT6A 5AK5A 3QYPA 3NNSA 1A97A 5K0SA 5CYPA 3RIYA 3Q8WA 5I7VA 1PO7A 1VKHA 3HJTA 2FHPA 2K4MA 3LW7A 4P3XA 3PTAA 2COEA 5G1NA 1IXKA 1V8FA 2IUFA 2I3ZA 2M1ZA 2QRGA 3NGXA 4P4NA 2FWAA 4DT1B 3B1KA 3K05A 4XCVA 2X86A 1YRBA 1QCYA 1Z0IA 1L5VA 3KB8A 4RFVA 5EUQB 5K5EA 1M6WA 5K8UA 1QQBA 1RQNA 3F7MA 3VYUB 3UG7A 2CK3A 4UAVA 2WD9A 5EQDA 1ISJA 2H4FA 1W76A 2IXDA 4ONEA 4X8MA 4Y2UA 3WLKX 1JIIA 5M2QA 4M88A 4M9RA 2YMPA 2GCIA 3B51X 1GIAA 4K9DA 4D4KA 1KI6B 2VQSA 2ZCVA 3FGOA 1V5IA 2HK7A 2JJ1D 3QVVA 1BJKA 1XX6A 4NZ9A 3UOAB 4DDUA 2XUPA 4ATNA 1ADYA 2CFRA 3ONNA 1NONA 5D8DA 2EG9A 2R8XA 3VSAA 3I5YA 2H2GA 4LG1A 4Z0TA 5FWYA 3ER9A 3P9SA 4NZPA 3OEWA 4DA7A 3D6AA 4JMLA 2JJ2D 2WIFA 4XTCS 5CIQA 4MUEA 3SR4A 3LWZA 1DCFA 1L5OA 1BWSA 2ZB2A 2FFAA 5ED0A 5FV4A 3OJWA 3KQKA 4DA4A 1UPUA 2PSSA 1G0NA 4GLWA 9LDBA 5CCEA 3EXHB 1H2AS 2HO4A 4RVHA 3HO6A 4U4AA 1EX1A 1OA1A 1C29B 4OGWA 3W4KA 1L9XA 4KXXA 1GCGA 2G09A 1AN7A 1VGVA 1CR1A 1ZUD1 1Q19A 4UTXA 4PZEA 3TD9A 3VMMA 3P32A 2ODAA 3X1JA 1C1XA 3EF0A 4BMOB 3NT4A 4DV7H 3UUGA 1DOHA 1SQ0A 1XA3A 4QRDA 5JXJA 1NR1A 3CZQA 4GZMA 4CKCB 1Z8HA 1EA7A 5D00A 2FW0A 4J16A 4ZYYA 4DANA 1SG6A 3MEQA 4C2BA 3GRAA 3S27A 2XMPA 1SPXA 4U1RA 1UP6A 1GSHA 1FS4A 1MZVA 2UVUA 3MTAA 2VUTA 4JFAA 2B63A 3NPMA 2QTTA 3RU7A 3LRPA 1FQWA 4JCOA 5BUSA 3THWB 1AU9A 1ITZA 4OGFA 4PSAA 2ZITA 4WY5A 1X1QA 2WTBA 1EVKA 2H9AA 3ZU2A 3I61A 3CUSA 4RHUA 4D80A 1G5PA 1TTPB 4GGOA 4XPIB 3VU8A 3RYHA 5JS2A 1IVYA 1JDVA 1MX1A 1ZEMA 2Y3IA 4NH4A 4ARVA 3M8KA 3GW8A 2DHDA 2A2ZA 2EF1A 5L3ZA 1WHSB 5LVAA 4JI0H 4UVIA 3OKAA 4RTMA 1DX6A 1E8MA 1H3EA 2JEOA 2FFBA 1D7OA 2TS1A 3FDSA 2NVWA 4NNJA 2QB5A 1U2ZA 5FUYA 4RKRA 1Z6YA 3D4NA 1N3BA 1LBIA 3ILXA 4C7JA 4MW1A 3CJQA 1U9JA 3SEZA 1J0CA 4DLAA 1IC6A 3TW6A 4Q6WA 4LRSB 5BN4B 4FMPA 2WQ6A 3QEBZ 2LDBA 4ER0A 2YWGA 4S0XA 4B3MB 1JG6A 1MC8A 3GLRA 2Q4DA 2UAGA 4JROA 4BU0A 2CNWA 1V7ZA 2P41A 2XRFA 1XPOA 4Q9LA 1Z0FA 1V6SA 4FDAA 3DWFA 4I81A 4XDGA 3B2QA 4BO2A 1NVUQ 4CM4A 3OFKA 3S8YA 2UXCB 3KKQA 1DDOA 1OV4A 3C5HA 5T8KA 5JANA 1A4IA 3LJKA 3KLNA 1Z63A 4F4ZA 1O9HA 1PBNA 3ZJVA 2P9JA 1Q1BA 3A3PA 6PFKA 3EVCA 4ZODA 3KT0A 2FJZA 3OQOA 1GO3E 3OZBA 4BMXA 3HKCB 2FKNA 4JUBA 1MMFB 3PQ7A 3NBYB 1FDWA 4G5OA 3I2YX 4G5GA 1AHNA 4HGZA 3U54A 2HDWA 3AW8A 1OBHA 1QAMA 1AK2A 2YS7A 2XB4A 2YH2A 2UVRA 4LYAA 3ZI0A 1I2CA 4ZICA 3IR5A 1JB9A 5K2MA 1M6VB 3P0JA 4MW2A 3E15A 1BWPA 5FD6A 3FRJA 4LY9A 5BYJA 3PL5A 4XWKA 1IIRA 4KHZA 4R84A 4WEOA 2W83A 3O4FA 2WWWA 1IBCA 1WW3A 5JIBA 4EX6A 1PFGA 2AE1A 4X1YB 5EGNA 2FMFA 3MCTA 3UMRA 3C6YA 3FGNA 3FJYA 1I33A 2G4CA 2H65A 3KYBA 4NCJA 4OL0A 1C14A 3L8GA 2YHBA 4HH0A 4UXJA 4P7KA 3NC0B 3SYNA 2P78A 2EGGA 1UKBA 2DHRA 3TLBA 1FQJA 2FDRA 1K27A 5FTNA 4L0DA 3CJTA 4DRXB 1NE2A 4RANA 5KVSA 4ZANA 3K4HA 3OCWA 4QBGB 2GKOA 3KAKA 3MPUA 3RM3A 5TJHA 1ESDA 1KVSA 2NUTB 3CLHA 1SCQA 3HKEA 4E6EA 4PAMA 2ZG6A 2EBFX 2G28A 2W90A 4NZZA 4Q1FA 3FYHA 1EP9A 1GSAA 4EG4A 5J23A 1JU3A 5L53A 5K0FA 3GJQA 3GTQA 3H99A 5HKBA 1RWPA 3W4IA 3CLSC 4Q34A 4JT9A 3SQLA 4D99A 4M9XA 4L5CA 1R4MA 3GRYA 4A3GG 1BVRA 3QPBA 4MZXA 2Q2TA 4QBHA 5CBKA 2LCFA 5KNDA 1WETA 2CVFA 2O2YA 1XEWX 4MUFA 4BB5A 4CKBB 2W37A 4LF5B 1BMDA 4RNDB 1DAPA 1TLTA 4JC4A 3BN3A 1R1DA 2IA5A 2V97A 3A9TA 1IEVA 1ZN9A 2JEJA 1Y9EA 2W2LA 2ZAYA 5LA6A 1Y98A 3G2MA 2OG2A 3L1JA 2IW1A 1A4UA 1KMHA 1WXFA 4I0WB 1HZZA 4WUTA 4WKGA 1O97C 2PM8A 3NKLA 2VDRB 3E5MA 1MXFA 3CLVA 3DFIA 3KZCA 1R5OA 4G86A 5DGTA 3RU3A 4J0EA 2CKDA 2O3SA 4KR6A 3T3OA 4BNHA 5JVDA 3W5VA 4QHTA 2QQ5A 5TDHA 2VC2B 1GNPA 1UM9A 1YL7A 4DBZA 2RDJA 1U2PA 4WZAB 2B4YA 1QX4A 3OE5A 2A88A 1ZMOA 1H2ZA 4OI4A 4E5YA 5B36A 3FETA 5JJCA 5JTUA 4DB2A 4V1CA 3C8DA 4D4HA 2JHAA 1CZRA 2QYTA 4N8EA 2PSDA 2HLDD 2R00A 4G0OA 1BEUB 5KFFA 5TQ0B 1OSNA 1PJ2A 1JLRA 3CSWA 2PFGA 2VNJA 3EMBA 4B3RH 3FPFA 1AKUA 1JZSA 4LHVA 5IDXA 1VJDA 3D6HA 3MD9A 1NQXA 1I7DA 1S68A 2XUOA 3P4XA 3MAGA 4DMFA 1SCAA 2OCIA 3QFCA 5AHRA 1Z68A 3I8XA 2UZ4A 2H4YA 2QYHA 3BZUA 4E30A 4WXRA 5HZKA 5CXXA 3T1VA 4XOUA 4WBNF 5ALIA 2ZBUA 1IHOA 3PFFA 4XCXA 5FPOA 2WG1A 3VU1A 5B6PA 3AVPA 2V45A 1GG2A 1P3JA 4J3NA 2L19A 3RC8A 1JR6A 3NTVA 2VPSA 2WAQE 2XV1A 3WWIA 4OKNA 2GF2A 3IRUA 3PFIA 4I9HA 2R93G 1UC9A 3HOXG 1C0PA 1V8ZA 2VDWB 2YV5A 3L7BA 2Q9AA 4AY4A 1CY8A 1GGKA 3ADDA 2FSVC 5JDCC 2AFHE 3G8YA 1CUWA 4LVOA 5GIPE 4JP8A 1SIWA 1WNFA 4RHYA 5ESXA 2W0MA 1LBHA 3F3YA 4W1SA 1VSBA 3GBVA 3DTFA 2BBOA 3HADA 4LYYA 5DT2A 1VG8A 5A2QW 1L4EA 5IARA 3ZBQA 1P8JA 2QM7A 4BL5A 1GGMA 2B8NA 2LRHA 4FYKA 2A3RA 1ZN8A 4FR2A 4F9GA 1JR3A 3KOWA 2FZCA 4HTAA 3U2QA 2BKEA 5A7FA 1PWYE 2NV6A 4Y9DA 2LXNA 4O7VA 4KVGA 5JRJA 5FD8A 1ULUA 2ICAA 2VSOA 2YUIA 2ZXFA 3E70C 4PRYA 4LE2A 4R9VA 2OWDA 3W05A 4DCMA 2COUA 1X7GA 5ER6A 1W85B 3VHXA 1T9AA 3HXQA 4GOMD 4BLTA 3KYCA 3LU1A 3GJ6A 3OHSX 1FSSA 1WQ3A 3KR0A 4IKOA 4BX3A 5JNUA 5LZ4A 3GFTA 1HNXH 1AF7A 2CLSA 2ZTSA 3TGWA 2YY6A 3CN9A 5KREA 2HR1A 5HM6A 4YRZA 2JH3A 5BSUA 4R98A 7GPBA 3K7EA 2ENWA 4E3WA 2H4WA 3AJRA 2VJDA 1RNLA 1N6IA 2R8PA 3KE9A 3R3ZA 2VUUA 4JT4A 2Z56A 4INAA 4MV0A 2Y76A 2J9YB 2V4ZA 3DPSA 4IHQA 3ZTTA 2H4JA 1GVHA 3EZNA 3I05A 2A9FA 5A02A 4K9RA 2IT1A 3BERA 5BYAA 2LD4A 1DADA 4EO4A 3IJPA 1PUIA 2ZIVB 1L3CA 4KGZA 2I6UA 3S99A 3WYDA 1WR8A 4YXWD 5DJ5A 3I62A 4Z0NA 3D7SA 4JT8A 5ALOA 4QDUA 3PP8A 4RZHA 1BS2A 1L1EA 1XTQA 3T4XA 4EG3A 4BRSA 1B3BA 4LYJA 1EFVB 5I9NA 1Q7CA 1EM8B 4I9NA 4BEWA 2QUIA 2E4WA 3PHIA 1TMYA 1V4YA 3FAZA 4DV5B 1WUIS 3C15C 3KSMA 3DF7A 1XSEA 3VYRB 1Z3IX 3A25A 3HXMA 1TFRA 4FJ2A 2D0DA 5MF6A 3DYVA 4DV3B 2G88A 4QFMA 3HA2A 3TS1A 2G76A 4JI6B 3UANA 2CLHB 2FPLA 4UNRA 3OLYA 4MWBA 3CQ9A 1KGSA 1EP3B 3ONVA 2JGNA 4QJBA 1PWXA 4HPWA 4MV7A 1QB7A 1SC4A 4R2IA 5KTSA 1LSSA 2CB9A 2ISCA 2WK1A 3TZKA 4RULA 3G5MA 4L5IA 4DREA 2X2OA 1DC3A 4Z4HA 2FY8A 3FVWA 1NOJA 2QD1A 3H9JA 1ZMTA 3RRNA 4CDNA 4CVNA 3A1NA 3F9RA 5GGXA 3IT3A 1ZSNA 3I45A 1D0SA 4HTFB 3QA9A 4PBRA 5E4YA 3UOGA 2CLKB 2KLHA 3WB2A 4I8IA 4NNPA 5FBLB 3BJZA 3STTA 4K2HA 3HUDA 2VZ9A 1I1MA 4B6PA 1HORA 2DPJA 1Z4NA 3RIXA 1OE0A 1P3DA 1R00A 2AFIE 2BHTA 2PS0A 3RTBA 1T36B 1U7HA 3JZDA 1JF8A 5SZHB 5GMOA 2YZLA 3LYAA 3M5CA 4MICA 3U4AA 3WC4A 4CF5A 2R5NA 4IJ5A 4B45A 1KBQA 2BZGA 1HBJA 1NV8A 4L08A 4BXOB 4FCCA 5LZ9A 2DECA 2R8EA 3JATB 2P7HA 1U2SA 1Y3BE 3RGWS 3V8RA 5LP1A 3DVRX 4CUKA 3BAAA 1W5FA 5EJ7A 2RGCA 1G7RA 5IYDG 3OM8A 3TSCA 2WAAA 1E98A 1VA4A 2YXPX 3KPYA 2PL1A 3OQVA 5HF5A 1KZ4A 1JBEA 2Z2IA 3JQ6A 4FEGA 1CY6A 2QE7A 3QV2A 4PGGA 4QQRA 4XH9B 4ZXFA 1IHPA 3E9EA 5TPWA 4ALJA 5F1OA 2G9QA 1SQ6A 2OHXA 1MOSA 3ENZA 5C31A 2V0GA 4Z2YA 3BYZA 2KHZA 3W3AA 4DZTA 2X6QA 4R31A 5LB2A 2FMTA 3EF1A 2NO4A 3KT6A 2WV9A 3QITA 1ISFA 2WTAA 2W2OA 4Q7MB 4PZ6A 1U8FO 3CA8A 1J5XA 2VIIA 4PTYA 3PFCA 5TMBA 2OYRA 4HLCA 1EVIA 2QM8A 3RTCA 4L4RA 1SCNE 1Z75A 1V2HE 1KJ8A 3EXFA 2VHJA 3IO3A 4BPBA 1Q22A 1N9KA 3E9RA 3ZQJA 5IU6A 1BDJA 1QCCA 2LNDA 4KSCA 4KIWA 1J2EA 1ZNQO 3P0EA 4NV3A 4AVYA 3Q4GA 5K0EA 3EH2A 4XUDA 1JPJA 2XNKA 3E3AA 4UE3S 3BGDA 3HRKA 5B53A 4A3MG 4YQWA 2JHCA 2MYUA 4G37A 1NMXA 2ZI9A 1KMIY 1KF0A 2FQXA 5M3BA 2ABWA 4XWTA 3GNQA 4Z1OA 3NKVA 1Z17A 2HIMA 2PJDA 2QXTA 1JHOA 1T4BA 3TBKA 4CMKA 3U60B 2Y9PB 1U0BB 2XLCA 2ODNA 1TU3A 2FN9A 1I1KA 1AK1A 3AXTA 3FPAA 3HDGA 3CUUA 2D5CA 3GP3A 4HNVA 521PA 1T35A 3G02A 1YC2A 1WVIA 2CVHA 4K7JA 1KFKB 5E95A 5HF9A 4Q1DA 5HPYB 1OXUA 1KE1A 5JDIA 2EJWA 1PW7A 2O1SA 3V55A 4CDRA 3KYHC 3TR6A 5F64A 1CKMA 2HEGA 3W8NA 1DIOB 5CDYA 4O2BF 1EM8A 1JDSA 4Y1RB 1H5QA 3CRVA 1M2JA 3K0BA 2J6BA 4RAZA 3BF8A 2JGEA 2J32A 5B7GA 4BCCA 2HJWA 3TBHA 3DZCA 4QGFA 1E0AA 1B6GA 2WG0A 1J5PA 3OFSA 5AXCA 2HHHB 3K32A 2ZUVA 4KO8A 1XDSA 2ZYSA 2Q3MA 4UJ5A 4X41A 2X0EA 1IIBA 3KREA 1X3SA 3TTUA 3C1UA 4FZ3A 2BFWA 3E8SA 2GNPA 3T9AA 3AB8A 3INTA 2MINA 4ZAZA 1HFWA 2AJLI 4AMYA 2DBVO 4BAUA 1E6EA 4WKNA 3HOUG 2OKGA 5JD3A 2R47A 4H15A 1J70A 2GHIA 3B36A 5K9ZA 3GJYA 4O3QA 3WWEA 2WSMA 5KIAA 1Z15A 4YB8A 3VZDA 4LH6A 3K9QO 4G36A 4H17A 4JITA 4M9CA 2VHTA 3CEAA 3CF4A 3PX3A 3T7EA 3FTPA 2R7ZG 3TZEA 3NJ8A 2O1WA 1YZKA 3V3KA 2WIKA 3CHYA 3OOJA 3G0HA 4KQJA 1P9NA 1HE3A 2BPOA 3GT3A 3HE3A 4KFUA 1GM5A 5CA1F 4YUAA 3FTEA 1QE0A 1PJ3A 1NKVA 4KHPB 3ZK9A 4ECAA 2G7MC 4U6PA 1DJOA 3B1ZA 3SKVA 1D0VA 2I6XA 5L7TA 1E4EA 4MV8A 2B98A 3E9QA 1DTWB 3D3KA 4HI0E 3VR5A 4IBOA 2ADMA 4UQLA 4E94A 3E27A 4MI9A 4XD2A 4JB2A 3ZEAA 1R15A 4BO3A 4DIFA 1IEWA 1VHTA 4M37A 2DR2A 3WWDA 3ZE7A 3HOZG 1JLMA 4UXIA 5AOBA 5EXSA 3UFXA 1NFFA 4C7XA 4D3SA 1HM5A 2NSYA 5BQXA 1DXQA 5C37A 3ANMA 1KEEB 5L3VA 2CF5A 4EHDA 4BO0A 4OLAA 1QF9A 2N46A 5DW0A 2GZAA 4E2FA 3L92A 3M6XA 1Y1KE 2PZBA 5CA1B 3HJUA 5ECDA 4DJFC 5KNBA 4URWR 1FVHA 4OYRA 4WECA 1UJBA 3RVDA 4EW6A 2QM3A 1G63A 1I2LA 2R85A 1FUYB 1GZDA 1NXTA 1SWWA 2ATIA 2EFCB 2HAEA 2JJMA 2RHBA 4G24A 1VPEA 1Y3AA 4P0TA 4PHCA 3VU9B 3X2SA 1HE4A 5M29A 1XBTA 3H86A 3OZVA 4E5NA 121PA 3ULKA 2JLXA 2F43B 4PLFA 2DQ4A 1BIFA 1FQOA 1UJ2A 2GK3A 1S8OA 4HMQA 4NU6A 5T64A 1MC5A 3BH0A 4RZSA 2CBXA 2FP4A 5CNKA 3KU4A 4IXDA 1FFEA 4Z9BA 5CG1A 4XDYA 1MP0A 3QLVA 2OV1A 4NMXB 4R1LA 4UUOA 1MT0A 3FOEC 1HQKA 5CDFE 3ES9A 2F00A 3FA2A 1IY8A 1JJAA 3JV7A 5BWRA 2XOKD 1NVFA 2QRVA 1D1QA 3A37A 3G5TA 3KKOA 3O6VA 2GK4A 2H3HA 3HBMA 3ORYA 5FP0A 1I2KA 4TWZA 2AFVA 2FZEA 1K4YA 3MR2A 3BFKA 1J0AA 1DFGA 3ISVA 4N5HX 2H31A 2AHOA 2W4MA 3VGPA 3HBLA 4L8YA 3CF6R 3I83A 1OLSA 3QNUA 1SRRA 4W8GA 3KYIB 3WB0A 1BXGB 4DOMA 4GM4A 2LW7A 2F9LA 2J1LA 2BFMA 2R7MA 4LIPD 1ZD2P 4UAUA 2Z8YM 5HCUA 3ZX5A 2PYDA 3ORHA 3T5AA 1RRKA 1U4OA 3REQB 3W9YA 3DMPA 4B3GA 3NHZA 1LEHA 3P2JA 1DOAA 3E7DA 1JFLA 2J5RA 3KFVA 3SFTA 1Z25A 4Q9HA 4NDAA 4OAPA 1WXEA 2Q07A 1H1LA 1W9HA 3RVOA 3W79A 2YWDA 3DKIA 3H9GA 4O7SA 2C04A 4II2A 1P7PA 3OURA 4PSDA 3CPEA 3TMYA 5CXUA 3ERCA 4Y1EA 1Y33E 2QQFA 1MO6A 2ZPAA 3QU5A 4P4LA 3TQFA 5LMZA 4EJSC 1R4ZA 4IDNA 1U0FA 4M89A 5CDSA 1WVGA 1EKFA 2AJTA 2CVZA 4FC7A 3DAHA 1KSGA 4YUXA 3HDTA 4MMXB 5HMLA 2FUCA 1M1YE 2XBUA 5A03A 3IUBA 2R6GA 4EI2A 4G09A 3OJLA 3RYIB 2G5GX 4X71A 3JAS