1I80A

Crystal structure of m. tuberculosis pnp in complex with iminoribitol, 9-deazahypoxanthine and phosphate ion
Total Genus 75
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
75
sequence length
266
structure length
266
Chain Sequence
DPRPDPDELARRAAQVIADRTGIGEHDVAVVLGSGWLPAVAALGSPTTVLPQAELPGFVPPTAAGHAGELLSVPIGAHRVLVLAGRIHAYEGHDLRYVVHPVRAARAAGAQIMVLTNAAGGLRADLQVGQPVLISDHLNLTARSPLVGGEFVDLTDAYSPRLRELARQSDPQLAEGVYAGLPGPHYETPAEIRMLQTLGADLVGMSTVHETIAARAAGAEVLGVSLVTNLAAGITGEPLSHAEVLAAGAASATRMGALLADVIARF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structures of purine nucleoside phosphorylase from Mycobacterium tuberculosis in complexes with immucillin-H and its pieces.
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Transferase
molecule keywords PURINE NUCLEOSIDE PHOSPHORYLASE
total genus 75
structure length 266
sequence length 266
chains with identical sequence B, C
ec nomenclature ec 2.4.2.1: Purine-nucleoside phosphorylase.
pdb deposition date 2001-03-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01048 PNP_UDP_1 Phosphorylase superfamily
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1580 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1i80A00
1ZL2A 1Z39A 2Q7OE 3EEIA 4LKRA 3DJFA 1LX7A 4QATA 5CXQA 1Y6QA 5EUBA 4G41A 3UAVA 4F1WA 2XRFA 3MMSA 3KU4A 4BMXA 1RXYA 1ECPA 4YO8A 3DPSA 3EMVA 5EPUA 5KB3A 1JDZA 2A0YA 1OUMA 5F73A 5F7OA 3NM5A 1ULBA 4RJ2A 4X24A 5F7ZA 1JPVA 2HN9A 1T8YA 2QDKA 1NC1A 4E1VA 4YMLA 2H8GA 3IEXA 4QAQA 1G2OA 1A9SA 1Z36A 4G8JA 4JWTA 1CG6A 1PR1A 4UC0A 4NS1A 3UAYA 4DA7A 1JYSA 4IP0A 5JPCA 1ODJA 1PWYE 4DANA 5CCEA 3QPBA 1T0UA 4H1TA 3INYA 4GLFA 3FUCA 1PR2A 1PF7E 1Z34A 2A8YA 4KN5A 1Z5OA 1PR0A 4NSNA 1LVUA 4TTIA 1Z35A 1FXUA 3BL6A 1Z33A 1V45E 4M1EA 3U40A 1PK7A 4OJTA 4LNHA 1RXUA 1V41E 4JP5A 2I4TA 4R2XA 1OTYA 3KUKA 1YR3A 4DAOA 1NC3A 1Y1RA 1A9RA 1K9SA 1PR4A 2AI2A 4F2PA 2A0XA 4G89A 4L0MA 1M73E 4OGLA 2HWUA 4DARA 4LZWA 3LA8A 1A9PA 1U1EA 3KVVA 4M3NA 1RXSA 3BGSA 4TS3A 1RYZA 1Z5PA 1B8NA 2QTGA 4OGKA 4OEHA 1ULAA 3E9RA 1JDVA 5IFKA 1Y6RA 3NBQA 5F77A 1YQQA 4TS9A 3EUEA 1V2HE 5I3CA 3KVRA 1LV8A 5DK6A 1XE3A 4WKNA 3GGSA 2I8AA 4WKBA 4ECEA 3E0QA 4R2WA 4D9HA 5B7PA 4M7WA 2OXFA 3FAZA 3UAXA 1PR5A 1T8SA 5B7QA 4JOSA 5CYFA 2AI3A 1VHJA 1T8WA 1RCTE 4YJKA 1V48A 4EARA 3C74A 4YNBA 1RSZA 1JDUA 1OVGA 1A9OA 3PNPA 1TD1A 5C80A 4GLJA 4BMYA 1RXCA 2QTTA 3LGSA 3OZEA 3T94A 1NW4A 1TGVA 4MCHA 1TCVA 2PGAA 5B7GA 4TXLA 1RFGE 4BMZA 4QFBA 3NM4A 3OZBA 1PR6A 5F78A 3MB8A 3ONVA 3IOMA 2AC7A 5ETJA 4QASA 1OV6A 3UAZA 4EB8A 3D1VA 3ODGA 3EUFA 4DAEA 1A69A 4LDNA 1ODLA 1ODIA 3P0EA 3FB1A 4L6IA 1K3FA 1VMKA 4MCIA 3F8WA 4GMHA 4D8YA 1SD1A 3OZDA 1CB0A 4GKAA 4WKPA 4BN0A 4OF4A 1JE0A 3SCZA 1SJ9A 1Y1SA 4U2KA 3OF3A 3O4VA 1VHWA 4WKOA 1C3XA 4DA8A 5F7XA 3DDOA 4K6OA 1VFNA 3KHSA 3O6VA 3LBAA 5CXSA 1T8RA 4MARA 4TXJA 3BJEA 4PNPA 3OCCA 1TGYA 3DP9A 4P54A 1SD2A 5F7JA 5B7NA 4OY3A 4TYMA 3NM6B 1U1CA 3TL6A 4TXNA 1JE1A 3E9ZA 5CCDA 4F2WA 2QPLA 1Y1TA 1RT9A 3FOWA 1PW7A 3PHBE 1ZOSA 1U1DA 3UAWA 4DABA 4TTJA 1OTXA 2HSWA 2HRDA 2IQ5A 3DF9A 1B8OA 2QSUA 1PK9A 1JDTA 3OPVA 4L5CA 4R31A 4D98A 1JP7A 4LNAA 1Q1GA 4F3KA 2OECA 4D8VA 1PKEA 1K27A 4DA6A 3UT6A 3FWPA 1A9TA 1RR6A 4D8XA 2ISCA 2A0WA 1Z38A 3OOEA 3K8QA 1Z5NA 2OC4A 2P4SA 1JDSA 1YRYE 4TTAA 3OZCA 4NY1A 3K8OE 1ODKA 4QEZA 3PHCA 3FNQA 2ON6A 1A9QA 5K1ZA 2RJ3A 4FFSA 4QARA 1U1GA 3ENZA 4L5AA 3P0FA 5CYGA 1U1FA 1I80A 3PNSA 1V3QE 2B94A 2AI1A 5F76A 4WKCA 4DA0A 1OU4A 2BSXA 1Y1QA 4TXHA 1QE5A 1YQUA 2OC9A 1Z37A 1YBFA 4I2VA 5EFOA 4TXMA 2GUWA 5FAKA 3OOHA 1WTAA 1V4NA 4L5YA 3GB9A 1TCUA 1PBNA 3BSFA 3KVYA 5IU6A 1N3IA 1SQ6A 4PR3A 4F3CA
chains in the Genus database with same CATH superfamily
2XQJA 3BSWA 4KNWA 4L4SA 1F06A 4BO7A 1DEKA 4CJXA 3I42A 3IP9A 5CGZA 2GASA 1XSEA 1EU1A 1PWHA 1Z39A 4MEAA 2BSAA 2DQYA 3ROZA 5A6SA 1A4IA 5DHRA 3DJFA 4X66B 5HZGA 4HUJA 1XNQB 2OV1A 1PTJC 3UJBA 3MUEA 1RQPA 2QT1A 2IHBA 4HSEA 4UMDA 5T4EA 2W2LA 3ISJA 4CEHB 2HCRA 1WW8A 2E4ZA 2Z9CA 1WB4A 3LTEA 1X39A 2BGKA 3OTHA 3ND9A 2OZLB 3VU8A 4TV9B 4EQZA 1DBQA 1KQOA 3IEUA 4FGKA 4M1SA 4PCAA 2GXQA 4G5YA 1YZGA 1Q7TA 2V9ZA 3GJ8A 5FWXA 5TQ0B 2V7VA 4D3SA 1K5GA 1XWIA 2BKLA 4YV0A 5KIAA 5IM4A 4B0OA 2BHRA 4G6ZA 3ADCA 1Z7BA 1I2DA 2G88A 2QS9A 4BB5A 1ZY2A 5G0VA 5BSEA 5JOQA 4C6TB 1HEUA 5CA0A 3ETHA 3GVPA 3EMVA 4GT1A 4O1MA 5K3FA 2W11A 4I99A 1VP9A 3H8SA 3CNHA 4KKXB 4RPGA 5CAEB 1VL5A 3DVQX 1KI3A 1U2GC 4AG5A 4MUIA 1X1SA 3DV2A 5SZIA 2QEQA 3WQSB 3DMTC 1RM4A 4GQBA 3TOVA 1Z8NA 4MVCA 4A10A 2XWPA 2ZK7A 3RC7A 4AN1A 3J81k 2XOXA 1WB9A 2XGOA 1PFUA 4R8SA 2COUA 2Q4OA 1LI5A 3JZIA 3NHFA 1YCFA 4OA8A 2HN9A 1UK8A 3C6KA 1JHDA 1OH8A 3RUCA 2FN4A 3HI4A 1KI6B 2PRJA 2VA8A 3CRNA 3K32A 3T5TA 2QSZA 2O2XA 3WKCA 1ORWA 3TTVA 1SKMA 4BAUA 1QHIA 2BJHA 2KX7A 4MH0R 3WJAA 1KJNA 5D5QA 5JAHA 4KDCA 3DTVD 4O4LA 3I72A 3A3NA 4ZZ3A 3H9QA 3IV7A 1TUEA 5DHFA 3A1EA 3IVGA 4WRRA 3DD1A 1E7SA 3GW8A 5AI4A 5MGBA 2M6SA 5B4TA 5L7TA 4AKHA 2XNJA 1E7MA 1QHHB 2LE0A 3DAGA 1NBMD 3H6KA 3G2OA 3HP1A 4LPKA 5AVTA 3M6XA 1L5RA 1T91A 1SUAA 2NZVG 2YJZA 1GDDA 4CG2A 4EHHA 4RPJA 4UBOA 2VEOA 2I55A 3CX7A 4LEIA 2HHLA 4UNQA 2IYSA 1B6TA 4V0OA 4WH0A 4JI6B 1YWGO 4MQLA 3O1LA 3A0RB 5F7OA 2FWRA 3L8YA 4LSMA 4MPRA 1XN1A 4RDHA 2F8SA 3K9LA 5KQPA 1V5GA 1C0IA 4MHTA 3X1MA 1KFJB 3P9IA 4UD6A 3K70B 3H8VA 4LXTA 1XYGA 1FTGA 4H60A 2NYVA 1SKUA 3BMOB 3II6X 1TIBA 4QULA 5E2BA 5JS7A 4LOIA 1LVUA 3DB1A 4BCCA 1L7AA 3PXBA 2Z04A 3EVCA 5F3RA 2GRAA 2AZXA 3CBQA 1YZNA 3WDMA 4OQLA 4ZZ2A 1M1YE 3TLGB 4ZEOA 3QKWA 5JH7B 4BNDA 1P5JA 2QOEA 5EI5A 3L7BA 2Q4DA 2JFXA 3NIFB 3R7FA 4GMGA 4AQDA 1E79D 4G9GA 2PS1A 1ISRA 3DWIA 4X54A 2QBYB 4AY6A 4R2XA 4AY5A 1XTSA 1VDMA 3N8DA 1DUSA 1JHUA 1JLLB 4PSVA 4BFLA 1AKQA 4D2IA 4N9QA 3DTTA 4PLVA 3RS3A 4C21A 1SUFA 1W5EA 2QMUA 3NHYA 3NOOA 1YGPA 4MWSA 4PC7A 3FPBA 2UYHA 2VHEA 1C0PA 1YR1A 2QQEA 3L0PA 1ESZA 1H42A 5EN4A 3ROFA 1H23A 1XAGA 1NW9B 2DBZA 2RC6A 2AI2A 2P3QA 3DTVB 3N75A 3O2QB 3VZDA 2ZJ0A 1Y48E 1STOA 2P41A 4E09A 4EPYA 4QYSA 2H4FA 4DQKA 3GRVA 3MJFA 2IV2X 1QDLB 1R6BX 3DM5A 2P6NA 4RPLA 1O4WA 3ZI4A 5LYJB 4IXMA 1HEYA 1UC8A 1M34B 4RPKA 1JEJA 3RVQA 3WRYC 5CURA 4H7KA 5I7EA 4D4LA 3UMVA 2V65A 1OPRA 3W7BA 3MUNA 2C4VA 1KDZA 3RF7A 4NOLA 1BTOA 3A9TA 3FOAA 4M1YA 2QV0A 5ALHA 4DJ5X 5AO9A 4QUEA 4BVAA 4OGFA 1L3CA 2VSQA 1SVMA 1Y6JA 3KUUA 1KAOA 3S27A 2ZI4A 4TKMA 1XPOA 3FJOA 4OJMX 3VC2A 2XI4A 4Z3KA 1E1CB 3GYBA 3PKZA 4C7BA 1FJXA 2VDWA 4TTSA 5FR2A 5HP4A 3R0IA 4UXIA 4MGYR 2J9ZB 4Z2AA 4DRXA 2FUG1 3CB4A 1OZGA 3MHPA 2RD2A 1AUPA 2OE2A 1N6NA 3L4SO 5KYYA 3KTFA 2RHMA 2WINI 3Q8XB 4HR7A 2PUCA 4L7QA 3A6EA 4Y9TA 5KNLA 2KS6A 5J2UA 4L78A 1VZ2A 2FOLA 1T2FA 3DFZA 1A0OA 4RQUA 1MPTA 5F12A 4BO4A 2O7VA 4WBSA 1EBFA 1ZD8A 4YFYA 1TOAA 3IELA 5E2AA 5I3CA 4CMEA 4WCFA 1KERA 5DK6A 1N9ZA 5E4FA 2QUIA 2QGFA 3D2AA 4WKNA 4B09A 1ZX1A 2J59A 3DTVA 3K9HA 1UINA 2ZCVA 3C6QA 5J9FA 1FXSA 4B3RB 1Q5PA 1M2WA 4C76A 1KH2A 2VCYA 1RAAA 5B58T 3SLKA 4EMTA 1H1TA 3C41J 3NV9A 4WKBA 3UK1A 5LA6F 1ZNQO 1AKYA 4NMHA 5AESA 4NR0A 3MT8A 5AW5A 3TIGA 1LF0A 3ON5A 4BFCA 4FLMA 3H2BA 1M2FA 2ZRNA 4EG4A 4LXXA 2H2FA 4UBLA 3U9SA 4QUHA 2PM8A 3RG2A 2VATA 3K3PA 3OIDA 4LDQA 1NVGA 1UWVA 3RKSA 2QZ9A 3WA7A 4Y3UA 3AEQA 3RRBA 1T8WA 2ARKA 2B1GA 1U9JA 2PKXA 4I0WB 2AUMA 5D87A 3WFJA 1H6CA 4KOAA 5TF0A 3U56A 2G4CA 1MF7A 3CH6A 1H6BA 4HQOA 4R68A 5ALWA 3MGBA 4QPPA 5T3YA 2YRWA 3OC6A 3EDRA 4N6OA 3O84A 1G8FA 3STYA 3ABOB 1E0DA 5KQGA 4U9HS 2R1VB 3HBMA 4JELA 4LX0A 5CDHA 4CEIA 1FPQA 2ONYA 1KRWA 1JDUA 5FTKA 3R74A 1KK0A 1QF6A 4BNHA 1VIDA 3WSWA 4MAMA 3KEQA 3SKYA 2NXEA 1HX7A 1FBNA 4PGHA 4RENA 1KSFX 2HF9A 4L9AA 3WBBA 1W1WA 1ZEJA 3KQWA 3TKLA 4OYYA 2YYSA 3RFCA 2MDTA 4A2CA 4N5NA 3FNBA 2HMUA 5C34B 2H2GA 2Q9CA 1KAGA 4ZJPA 3DLTA 2R4TA 2JFZA 1R15A 1CC1S 3RCBA 1TC2A 1QYIA 2PV0A 2QUAA 4MKXA 2GO7A 4MR9B 4DCVA 1RXWA 5JDIA 3SYLA 2RGGA 4GAEA 1PR6A 4MWCA 1NBAA 5AXBA 1KVQA 3ECCA 3R9XB 3DZ8A 3GFOA 1DMSA 1O1YA 4LDJA 1BVRA 1P1KA 2WU8A 3PUVA 3SYRA 3QLEA 1DAFA 1RRGA 2FKNA 3WZLA 2AC7A 5TMEA 1U1IA 2Y68A 1J00A 4ZI7B 2W6OA 3SX0A 4CNQA 3E23A 1AE1A 1W29A 3NTQA 4ENVA 1NJ1A 2O8DB 5D3MA 4OHOA 4WNYA 1JJFA 1ECFA 1IUOA 2OYSA 4EYGA 4BMPB 4YROA 3VV2A 1GD1O 4PX2A 2GAIA 4D0RA 2AJLI 1RI5A 2ZJ7A 1SZPA 2JC3A 3L3BA 1FDOA 3PGKA 13PKA 4IVQA 2LKCA 2QP9X 3D6TB 5ALGA 4NJMA 1YHNA 1L5MA 1Q3HA 1A7KA 3TZ6A 2P2ZA 1P19A 2YJ6A 3MWGA 1K7EB 2J32A 3JQEA 3PFBA 5FOUA 5I6DA 3E3OA 5BPFA 2JAQA 1ADGA 4ZVTA 2AOXA 1V4BA 4J3NA 3TBFA 3KYDA 3DF7A 3KQHA 5A0VA 4QSMA 1EJ6A 3M2PA 5I5GA 2PLNA 3CNQS 1EZ1A 4H3HB 1ADFA 1KY3A 1EAMA 2F43A 4WI1A 2NO5A 1T0BA 4WQMA 1VBMA 3B12A 3HEBA 1NMZA 1GG2A 3AJDA 4DOMA 1UPFA 4YJ3A 1OBFO 3D7RA 5EXSA 4O4LB 2ZWIA 1P2GA 5FBZA 4ANFA 2QRZA 3TTUA 1IZYA 1AKUA 3RTCA 1Q1QA 1SC3A 2A0KA 4ZZ0A 2R8BA 1PL8A 4DPKA 1NMYA 4FFNA 3RLFA 2L18A 1ZOIA 3GFTA 4LY3A 3Q2IA 4DQVA 3E3NA 5LDDC 5H68A 1I3KA 1CJKC 3KZVA 3M33A 4K6OA 1YCDA 4K0KB 4F9GA 1OREA 2VDVE 2WUGA 1QUFA 3SR0A 2FWIA 4G81A 4HGZA 4AF6A 2NYAA 1KA9H 3F9IA 1YE3A 4YP5A 1ZJWA 1OE0A 3SDZA 1EWRA 4PNPA 1LBHA 1CS0A 4Y2YA 1TGYA 2R751 1B4DA 2CSXA 4X1IB 4JBIA 2NU7B 4QL3A 3QOFA 2Z30A 3H2JA 1IQ0A 2H5LA 3COSA 3GGPA 4A5SA 4UHEA 4AMYA 1DOZA 2PGXA 3CEAA 1WXEA 3OKCA 2VUHB 4ZYZA 1PP4A 1GTMA 3WQHA 2B8TA 4GE3A 5ALVA 3F3SA 3KT6A 4ZVRA 1ATZA 3FOBA 1AKVA 4XM2A 1W8IA 3MCAA 4RDXA 1QBKC 3BWCA 3HBNA 4I08A 1P1BA 4PTZA 3G2QA 4FXOA 3LUCA 4X9XA 4YJHB 1E4VA 2JAOA 2OQVA 2ATEA 2B4TO 1ZL0A 2VK2A 4D81A 5WRFA 1JE1A 4YTEA 2Z58A 3D4IA 4H7FA 4MVWA 2BELA 4HWGA 5CLIA 4YRJA 4YXWD 3IAXA 4QSHA 1VB5A 5F2EA 3PFCA 3KTAA 1JKIA 4W7IA 1QYRA 4DIKA 2WM9B 5SZJA 4V38A 5SZKB 3Q8KA 4L4ZA 4U9UA 1D5CA 3SE0A 4Y2XA 1NU8A 1KMHB 5TQVA 3MG9A 4AO7A 4DTIA 4MV5A 5EMHA 3F47A 2BBWA 1VJ1A 3DOIA 4MJ7A 2ZB8A 1G8SA 3OCUA 4ABYA 3T9FA 3C8UA 3GQVA 2HMTA 2J45A 1V6AA 2ZJ5A 1COZA 1Z5GA 1YRBA 3KXLA 2Y0PA 2PUTA 4H7IA 4G5XA 4JUCA 4TTJA 3RRXA 1RRFA 4E6EA 1V71A 2I6QA 1SBTA 3NVAA 2AGVA 3ZCUA 1AS2A 2DPLA 2XUDA 1BMFA 2FSVA 3RYIA 4C5AA 1RPZA 5IVDA 4JUIA 4DLVA 2O54A 2UUAB 2Y6UA 4XDHA 4FNAA 3B6ZA 2C2GA 3V8EA 5EE9A 4JIGA 3JASB 3WL4A 3ZV4A 3T1HB 5DX1A 1HYQA 3TL2A 4AJLA 3LQ4A 3ZCVA 3ER9A 4QZVA 1BXKA 5CDYA 3H1BA 1G8PA 1ZAKA 3AUAA 4G5SA 1TECE 5CT9A 3LF1A 4EI7A 2BM9A 2UZ3A 3M2TA 3TIIA 3U9LA 3ZPXA 2KE5A 1RR6A 2QMYA 3GRKA 3LQRA 1SRQA 3FVWA 1X1CA 2B20A 2ODAA 3BK7A 1DWOA 4G1BA 4RF3A 3QEMA 4KMRA 4S1TA 3QXCA 5CB6A 2XUJA 4YAOA 1LU9A 3GIWA 2IE8A 2ZQZA 5IKXA 1GKIA 4RO0A 4W9MC 1T2NA 1RKBA 2ZG6A 4FX5A 5FD8A 3Q7SA 2FF5A 2QI9F 1DTWB 1RE1A 1O94C 2ZB4A 2IGTA 4LJ4A 3ZS8A 2O59A 1OAKA 5LBIA 2QG6A 3OZCA 1C8LA 1E9CA 1N5KA 1W5BA 1ZU4A 2ZBVA 4GYJA 3UJ8A 4B3FX 4DCNA 1USVA 1IQRA 4GICA 1MIOA 1N6OA 2PS0A 2EJCA 4EJ2A 2FQQA 3PHCA 3OY7A 4QICA 3EXEB 1XVLA 2RGEA 4C78A 4RD3A 1U2TA 3LWZA 4AP6A 3TSCA 1W6RA 2IX9A 1A9QA 3T0FA 5FI3A 3K5IA 3JSAA 3L7MA 1D6MA 5K4HA 4IDHA 3TTXA 1UR5A 1KFBB 3HL0A 1JMYA 4BFSA 3ZVKA 2V7QD 5ILQA 1M5RA 3QQ5A 2WYWA 1WB6A 4HNHA 4HS4A 4PSCA 4MQ4A 3U62A 2IITA 3ZLBA 2IS2A 3EYWA 3KOWA 2QJRA 2JH9A 1PJ3A 4MGZR 2PKWA 3SEAA 3BGIA 5JSKA 4O4HB 1EDBA 3JXEA 4R4JA 3P2JA 4EHFA 2C9CA 2YW9A 3A4VA 3B85A 5ESRA 4OPMA 3NHBA 3EWSA 1F5NA 5FOQA 2O8EA 1E5DA 2YHIB 4XTCS 1CUEA 2R00C 3DZDA 4C3OB 2FNAA 1SPXA 3FM9A 1MNAA 5DV9A 2AWNA 2IE0A 3KKPA 1S96A 3MMNA 3V7FA 4X1YA 4A9AA 1NQTA 5H5JA 2IPOA 4HADA 4CMKA 1Q3TA 3Q3VA 4C7VA 2WM2A 1GA6A 2JFPA 1YQDA 2R1VA 3T9AA 3WWPA 1YQUA 1PUXA 4AZ3B 4KE9A 2AN5A 1DHTA 4NBUA 4FBLA 3PCTA 4N0QA 4D8WA 1PZXA 4F2DA 4R6XA 3TJZA 1B15A 1Q2UA 1E5VA 1X15A 1OXBB 2E5FA 4IH4A 1QZ3A 3VR6A 2ZU6A 3JQCA 1Z4QA 1PJRA 4HUQA 4UASA 1EQ2A 4HB2A 4QYIB 1DEAA 2PBLA 3RC9A 2ZS8A 3EXHC 1GPNA 3BCRA 3K09A 4V3BA 1PBNA 1NUHA 2BI4A 2NN3C 2XWQA 3ESZA 1FFHA 1GGKA 2R65A 1MENA 2DTDA 3A27A 3I12A 3E9CA 3PEVA 3WLKX 1TYEB 5IM4F 2YUTA 3CISA 4B4WA 4ESHA 4XAQA 3U31A 1I3MA 2Z56A 1XYVA 3CUSA 3RG8A 3L6EA 4BCBA 1DQYA 3ETJA 4D4GA 1HE3A 3BIFA 4A16A 5KWEA 1N33B 3LDUA 3EDOA 2F9MA 7ABPA 1P7WA 4INPA 4X8MA 5A04A 1H2YA 2E4VA 1ZD1A 3A1WA 3EQZA 3IJ5A 4L76A 4LSWA 1GPDG 1BMFD 1M8GA 4F11A 3ND7A 3TLEA 4K86A 5BWNA 4QATA 1I5OA 4LF5B 3ILVA 4U6NA 2YWHA 3I6YA 4TL6A 2G1KA 4MI9A 4WESB 4XPZA 4PGFA 4ZPXA 3D81A 4BLOA 3EC1A 2AG1A 3DDHA 3HFSA 1ZISA 2HBRA 3KQVA 4BNMA 4WVFA 5IF3A 2G9RA 2YNMD 3RJZA 2HJHA 3FRHA 1KETA 1J09A 2BEKA 2BEJA 1SK9A 4JSTA 2GVDC 4BASA 4YAKA 1K4KA 1F48A 4CKZA 2X5JO 3DO8A 2LZ0A 5FLKA 2ZU0C 5FFFA 1DG1G 3HLKA 2WD9A 4Q6WA 1JRLA 1Q0SA 4TRRA 5E6SB 1UBSB 2PQ6A 2X5OA 5ALYA 3V1YA 5BN1A 4MV7A 4WGGA 2LP4Y 5CNMA 1KS2A 1DBVO 4JT8A 2V3CC 3O31A 1NRIA 1NR7A 1C4XA 1XCLA 3K15A 1A8PA 1CY7A 1T8YA 4XJXA 5EHGA 4BVJA 4EH1A 5L3QB 1NMQA 3QI7A 2W6PA 2MSCB 2FN9A 4NHOA 4PF1A 4Q15A 1PKXA 1VE7A 4AVYA 4TMVA 4F4CA 4RF2A 1U2QA 2NU9B 1KOFA 1MEJA 2NSLA 2WJIA 1G18A 1JW9B 3TR5A 3KT8A 4OXYA 4L16A 4Y30A 3E3MA 2VHXA 1LSSA 4RK6A 4AI6A 3WLOA 1NBEA 4R2JA 4UC0A 1X1TA 5DX8A 3TQHA 2OBNA 1UJ5A 2HA7A 4B4VA 2A3RA 1R00A 1RPNA 1ZGJA 4OP1A 1WOYA 4KQFA 3FFTA 2QT0A 1XFAA 2OVFA 5FADA 4KI7A 3I5XA 1TLFA 3PIDA 4WGFA 4X64B 3JQBA 4DB4A 1MW8X 4ZQEA 2DYKA 2HNBA 2H1WA 2NTVA 5FBLB 4Y6RA 5KTNA 1XHEA 1UXJA 1P0CA 4QJ5A 3BXZA 1VQ1A 2N42A 2F3SA 3CUYA 5HW0A 1Y42X 4CM8A 2YDXA 1G19A 2NSHA 2HCBA 5AKYA 4BNDB 2QYTA 4GBED 1WZEA 3X1KA 2BFDA 3L8ZA 2WUEA 2YWDA 1U8ZA 3E8SA 3K2IA 2R0QC 3C3AA 3O38A 3F6PA 4LXGA 4ZVVA 2UUOA 3I5MA 3UNXA 3JD1A 4EY8A 2WWRA 3DOJA 4BMZA 2FZEA 2J4CA 4IHQA 4LQLA 1RI3A 3RB8A 3T4PA 3L1KA 3VDRA 4K8OA 4O0MA 2ZLBA 4KFUA 4L2IA 4ZN6A 5JS6A 4B3JA 2J9XB 3VPBA 1S2MA 2J6BA 3PFGA 3AVPA 3UQYS 1DHRA 3RBVA 3ROKA 4J9UE 1RXUA 4JL6A 3ICVA 1A71A 1BE8A 2C5EA 4M87A 4KE6A 4M60A 3AHFA 3A1SA 3CXRA 4KUGA 3REQA 3L4BA 3L18A 3NJRA 2Q5CA 1NPYA 2R8EA 2RHHA 2BCGY 2VJYA 3CF4A 3FPLA 4K9KA 1CNFA 4M1TA 3GVCA 3OHSX 4LMAA 2CDCA 4PO1A 1P5HA 5DNAA 2CHQA 1B42A 5AXDA 5FBKA 2ZUFA 3NNSA 2AL7A 3OP4A 1E62A 1IJBA 1BXRA 3D0KA 4XLLA 4JI1B 2ZRDA 4IWYA 5BVGA 2ZR7A 3E1KA 4BDSA 1VPWA 4AS1A 2NADA 2IU3A 1M34E 2AB0A 2YJNA 1S2IA 4UU8A 2PRIA 4UATA 3D3NA 2BZGA 2I4LA 5H80A 4LFCB 3TCKA 1RWPA 2NZJA 3ZZ1A 5ILOA 4D4IA 1BEZA 1MV5A 2VRWA 3BDIA 1Z4KA 3JQGA 1MJ5A 3THOA 4N40A 4UQLA 3GLGA 1QH8A 1N9GB 3L79A 2ZYSA 3EDCA 3R7WA 4S35A 3KVVA 4KCGA 3K1ZA 5IC5A 4NOMA 1BW9A 1MGOA 2HFKA 2XNDA 5GM2A 2VP5A 1Z7GA 2QM8A 2LWIA 2GHTA 4RAQA 1RQLA 1AG9A 4QUGA 5DTQA 1Z5PA 5EJ5A 1HDIA 2AG6A 2GNOA 4DREA 1EP2B 3CO0S 1UFKA 3AXTA 4KWIA 2VHYA 1R4MA 2RARA 3QNUA 3RGWS 1G3QA 5SY9A 3H2SA 3H9EO 5C3MA 4ZK6A 1NW6A 1RXVA 4NBLA 1H5NA 1E1LA 2J0UB 1ZMOA 2DT5A 3DFKA 1J39A 3L0OA 1IVYA 1ICIA 1XCMA 1LI7A 2QMZA 2XNSA 3B9QA 1N0UA 2OK7A 3BN3A 3CG0A 1X6VA 3I52A 2UDPA 3GDGA 3O95A 2HF7A 3BJMA 2RHTA 2BCJQ 4Q3DA 3T7AA 4GR9A 5GOZA 4B7CA 1MVNA 1IOWA 2DJIA 1GO2A 2VHCA 3CCCA 4F86A 1M6NA 4CEHA 1E1RD 3KQPA 1I3OA 4RPIA 1JPJA 4TMXA 3EBLA 1SAYA 2LKDA 5LFAA 3UJNA 1RJFA 2FSGA 3PXXA 4M4SA 2E4YA 2BI7A 1XR3A 1RJ9B 1GYPA 1DQSA 3HR7A 4AICA 5HIAA 2FZWA 1TQ2A 2V6BA 3GGSA 1E2DA 3M7IA 4QM6A 1V7ZA 4FE7A 4BLRA 3QLUC 4FEEA 4NIMA 1XAJA 4EMUA 5BT8A 1NBIA 2D1SA 1M2OB 5DW3A 1CQZA 2IXGA 3C70A 1JHRA 1XU7A 2WWXA 2OL4A 2Y2UA 3H2KA 4O33A 3UAXA 4YYEA 4GXTA 1W0JA 1FEZA 1JKXA 2X8BA 3HCOA 3MWFA 4I5EA 1FYDA 3F5SA 4IJ5A 1R6VA 1QQBA 5HNKA 2IKQA 2XF2A 4DR5B 1C4WA 2C3MA 1QH1B 3H13A 5E7QA 1T43A 1O5TA 2V7WA 2Y9MB 1LK0A 3ANLA 1NMSA 3CLVA 5L3SB 4YRMA 3EODA 4LFAB 3GLIE 3HDGA 2PBFA 5DTIA 2P3SA 3MVEA 1MBZA 1V48A 2FR8A 2Z09A 1Z4MA 2R6DA 3OIVA 1FRVA 3TG2A 2XT6A 5ENVA 2GX6A 1M2VA 3I6ZA 4FSDA 1V1MB 1X8LA 4YV2A 5DXJA 4P34A 4E5NA 2VF8A 2W5UA 3M5DA 3ZNNA 2XXBA 4K3VA 2REQA 2VYVA 3KIPA 1E6UA 3KT0A 4B31A 1NXWA 5EMNA 1B74A 2UZ4A 1MB4A 4BNIA 3LGSA 2YXNA 1INLA 5E95A 3C3KA 3O1JC 4XVQA 5EJIA 3Q0TA 1R9GA 5F1YA 5CEJA 3H1PA 5TF4A 5JNUA 3JQGB 5K3EA 3ILHA 2HK9A 3DCJA 4AWAA 4R8VA 2OFPA 1CQWA 4X7BA 4R1SA 3R76A 3AOGA 5FQNA 4N54A 2FFAA 3C2QA 2DFLA 4NCHA 4C03A 5TEVA 1RJ9A 1CVIA 2PTHA 3R5SA 3VPFA 4EY3A 5ICCA 5KVAA 1SVKA 3SC4A 4OHZA 4BNLA 2FKAA 4WZAE 5CCBA 5BO5A 1BCRA 3KKKA 1E2IA 2A88A 5LU8A 4JI7B 1FUYB 3D1VA 2JPDA 1URPA 1H8HA 2CDBA 4W9RA 1MKYA 1I6WA 4TWAA 1NQ5A 1Y4SA 3RHSA 3PEWA 4BZQA 2WWYA 4KRXA 4JYZA 1AZSC 5F5LA 3GLKA 2PSJA 1JSXA 2VDRB 2RBKA 4BZWA 3LRTA 3LQ1A 3R77A 4RTPA 4JITA 4LI0A 3GUZA 1NMEA 2FFHA 5FL7A 2GPTA 1KYWA 1R0YA 4IX9A 3BOSA 4ND3A 2J5BA 1XVUA 4CQLA 2PJUA 2IEAA 4LTDA 2PUHA 2N75A 3DLCA 4OHRA 1XZDA 2ODQA 2IDKA 3QF4A 2FRDA 1VSTA 2PKEA 4RLQA 2FFJA 1H0HA 3DZBA 5BWMA 3FR7A 3OZDA 1Y9JA 4KO4S 5CM8B 5MGNA 3DD5A 2AFIB 3GNQA 2JGEA 1DXYA 2C2KA 3AB3A 4XM0A 5E1MA 3NU1A 4BPBA 4NU6A 2PXXA 4JLWA 3TDKA 2C2ZA 2GHRA 4O4IB 3SX2A 1ILEA 1GTJ1 3ND5A 4PG6A 1V26A 5A4JA 1RYYA 3WG9A 3CLTD 4CZ2A 1Z15A 1VGRA 4G2TA 1QR6A 1CZRA 1A8UA 2BBTA 2G5GX 2CMDA 2B4AA 1J42A 1FU7A 4L4RA 2GKGA 1PQYA 4E3WA 5A71A 3AR7A 1QJ4A 2BGNA 2CHEA 1NUSA 2WWVD 4R7GA 2APJA 4LDAA 3SYTA 4OAOA 2VVTA 2D2XA 2NVUB 3AG6A 1KPGA 3O6VA 5IN5A 3GPCA 4PSAA 4DUYB 4C6TA 4DV3B 5DHAA 1YRLA 4RF5A 1C9DB 5I4IA 3M6FA 3I9FA 2VPYA 3O4FA 4KQ1A 4PBTA 4RK4A 5CFOA 4C08A 4AY4A 1T6NA 2C0CA 1NM5C 4XSHA 2CKMA 4XD7A 3ZWWA 5AVOA 1JYEA 4QOSA 2KLHA 5LOVB 1YS1X 2BGRA 1P4JA 4M46A 4BQPA 3KZ1E 4CV3A 1QCYA 2I3AA 2P68A 3BUSA 3I0NA 4OP2A 2OWDA 2CFOA 1L5GB 4Y2PA 4Y9RA 4H16A 3FTCA 3TL6A 1R5NA 1NQXA 3FCXA 5HM6A 1REQA 1DTEA 1XD2B 2BGMA 1QLWA 1VPDA 5E6UB 4RJJA 1AGYA 2Z43A 1L5WA 4IKOA 3A4NA 5ERGB 1Z22A 5DLEA 5HF5A 5UKDA 2CT8A 3SYKA 4K9SA 1W73A 1XNJA 3GUHA 4LHEA 3WMGA 1SO8A 3TKYA 1KTIA 2IHUA 1LBQA 4L0CA 3WJ1A 1EDEA 2EFHB 4TQ9A 4ZVMA 4CTNA 1FFYA 1L4NA 2FUEA 3W4IA 3NTUA 2Y1OA 4QOIA 1KIAA 2B98A 2C88A 3ZWXA 1DCKA 1AHHA 4LC0A 5D51S 4ZEMA 3REQB 2GF2A 3MRXA 4WPGA 4WWHA 4NQRA 3RK0A 2QGZA 3COVA 4FFOA 4HMOA 4ODIA 1O94D 3LT2A 4QQRA 5HUJA 1OTXA 4KSCA 4QPDA 3ZVMA 1WOMA 2IQ5A 1I4WA 5KVQA 4PHTA 4BWYA 4QOFA 2P75A 2AWOA 1KSJA 3HDYA 1G3IA 4QPJC 3UANA 4BMCA 4ZGBA 5L53A 5B6IA 1V47A 1KI4A 2DSTA 2PYDA 1DV1A 3FDZB 3PJFA 4D98A 1CR2A 3HB9A 4K9PA 3ZN2A 4KU4A 3GMIA 5I4BA 4ZMSA 3D8UA 3BJIC 3G2LA 4CV1A 1PVDA 2HREA 4GC9A 4B8ZA 1MG5A 3DULA 4B8YA 2FF7A 5EGNA 2R5NA 4JYCA 5TX7A 2I9KA 3ML1A 3HO6A 1P3JA 5A9RA 3AOEA 2CDNA 5JXIA 1SZDA 1OWMA 2AOTA 2XTNA 3CGWA 2WBLC 4YCSA 2IV3A 3BE6A 2GN1A 1R66A 4D8XA 1MA0A 2GI4A 4NJEA 5AXAA 4QU8A 2YR0A 5A6SB 4N7BA 3UW1A 1AD2A 4XGNA 1NV9A 2VDUE 3E2PA 5BN4A 1F8GA 3LWDA 2OC4A 1TK2A 1FBTA 3H2HA 1HDGO 2OCAA 2FMHA 4PZCA 4TKUA 3RYFB 4HYQA 4D9BA 4AY3A 2WFLA 2J0UA 2VZLA 4U00A 1ZQ1A 4DMLA 5BRAA 2F55A 1V3TA 1WQ4A 4M88A 1ZA2A 1T1IA 1UPUA 3NTOA 2VTBA 1PDOA 2JI4A 2VP2A 2CF6A 2IKSA 3R4VA 1AK1A 1NUQA 1BYIA 1Z88A 3LU1A 1QLHA 4IW3B 1SUIA 2ON6A 2ZPTX 1QG2A 1S01A 2OZEA 1E1YA 2HU8A 2QAGA 3CNNA 1WM1A 1A04A 1N2JA 3M9XA 3O5AA 4JLMA 1AY0A 1OKKA 1RHMA 1UJMA 1K0UA 2GZDA 4CT4B 3H1FA 1HY3A 2BKXA 1XEFA 1DJPA 3QHAA 1XZKA 2EGUA 5KQSA 2O1XA 1N25A 1U1GA 1Y1PA 2YXDA 3B5IA 2H0QA 4RJLA 4Z1OA 1DRKA 4FDMA 3ZKAA 2WMYA 1PS0A 5CBPA 1DL5A 5J2UF 4D97A 4FOLA 1T9KA 3EC7A 4OL0A 2OHHA 4A92A 4X20A 1LK7A 2AI1A 3IKMB 2BFFA 4E21A 4KGXA 2NPIA 1J06A 5F76A 2UZ1B 5IZ4A 3LT0A 5EIBC 5KUTA 3EPPA 1ZRMA 3EN0A 3I2IA 1A77A 2F3UA 3PWZA 4DKXA 4E07A 2GPWA 1XZCA 2Y3IA 3NB0A 4MW9A 3P4XA 3T7JA 5EA2A 4JBHA 5CDGA 2JLSA 3OTQA 2EWVA 4MQUA 1P1JA 2IWHA 4TXHA 3QENA 1FP6A 3UT5B 3OESA 3AIIA 4R81A 1M1UA 4HHEA 4MYCA 4OSOA 1QG6A 2LCFA 1SUSA 3OF2A 2IVFA 2YL2A 4J0FA 3HDVA 1PZNA 1CEYA 4KYTA 4A0RA 2XDWA 4DJFC 4YV7A 4QXRA 3GD5A 5D7BA 1Y81A 2XDQB 3KYCB 4GLBA 4IJMA 2D4AA 2GCNA 1CPYA 1PZHA 2QV7A 4EJMA 5A62A 3ZW8A 4LF6B 1P2SA 4S0ZA 3TJMA 2C0QA 1NL3A 4FC7A 5M5BA 4HGYA 2W6CX 4YCBA 1HYEA 3ACBA 1CUAA 3HXLA 3GAMA 3QTBA 1TJPB 3S2IA 3VYVA 3WMWA 3ZY5A 4D3XA 3AK4A 5JD6A 4J16A 4Q4LA 4DBZA 1XF9A 3NOQA 1SIBE 4FYIA 5KNBD 3J7AC 2JDID 4FJ0A 3AEYA 4HQFA 2WQ6A 3HVJA 3WLAA 3AHEA 4TLCA 2RHLA 1SXJD 4LKRA 1RXEA 4S1OA 2XGMA 3TSZA 3UH1A 3VJLA 1CTQA 1NXTA 2XEDA 2P2SA 5JD4A 1LTKA 3RT9A 2YXBA 3LG2A 3CRW1 5CJJA 2D7DA 4L5JA 1JEYA 1QE0A 1QU2A 2GAJA 1LBEA 1C1HA 1O6CA 2C98A 2YN2A 2XE6A 2O57A 1C41A 2PZGA 1BWRA 3V6MA 2ZRHA 4QODA 3V4RA 5JJKA 3FKJA 1MIOB 1OLOA 5KREA 3GPLA 3WL8A 5K8TA 2ALJA 3LUHA 2O8DA 2JJYA 3HUEA 3K1AB 2J3MA 2H5IA 5EKSA 2JFUA 5DNUA 4GMDA 4IDDA 2G67A 1Z29A 1ONPA 1I4DD 4DSAA 4C3ZA 4EL5A 1RVDA 4QUJA 4AIRA 1RXYA 2Q45A 4ZQIA 4RAOA 3QF4B 5J63A 2X76A 3QVGA 1Y9DA 1F4VA 4L5IA 3H9BA 1KZ9A 1NHGA 3R3JA 5DF1A 1SXPA 3V9PA 4IGEA 3BIJA 1U6KA 1V0JA 4J03A 4BLVA 1WZNA 1N2OA 2HWYA 3CONA 5AHKA 3MTGA 1SCIA 2O50A 2A35A 5EESA 3G9UA 5F7ZA 4DCUA 4OBXA 2FVXA 2F4VB 4EYSA 2DBVO 2AFHE 5LD2B 2VJKA 5D3KA 5JCJA 1NVBA 1II8A 1QGYA 3JYQA 1F14A 4EY4A 1T1EA 1J07A 4FSXA 4RYDA 4PLHA 2FHPA 2SCUA 1L7MA 2WTMA 3F6RA 3JASA 3P5BA 5GONB 1VI5A 3VHRA 1WDWB 4QGAA 4P6VF 3U7EB 4CT0A 3U6BA 1H5QA 1T9DA 1KO8A 2NZYA 3UA3A 2QRGA 5TIIA 3WAKA 4R51A 1JIIA 2F3PA 1U5BB 3K2QA 5JAOA 1JWLA 1PR1A 4NS1A 5EJFA 3S29A 1OX6A 1KNQA 3KOUA 4U2BA 2FW0A 4LV8B 1OXKB 3WQBA 2EFDB 2QYHA 4LGVA 5EHNA 1K6EA 3C1OA 3KV3O 3SIWA 5FEUA 2J7PA 1QRUA 1U7DA 3HPQA 3P9PA 3L41A 4HGQA 5K8UA 2R1ZA 1BAPA 4A5OA 3ROPA 1T9BA 1Z8FA 4LYHA 3VISA 4UTPA 5JJLA 3N3BC 2QLMA 5AP9A 3TCNA 3KKOA 4QDKA 3B36A 1W8DA 3ZZUA 3EASA 3RAGA 2SBTA 3L40A 4XJVA 3G7UA 3GAAA 2O7SA 1TYAE 2PRYA 3J80A 1CNEA 1HTWA 4W5NA 4FEGA 4C2UA 5DNDA 4Z49A 1N92A 2FPOA 5IDQA 1NZFA 5B4VA 4C7KA 2A86A 5T5QA 1TZMA 2X9VA 4ALNA 4KQ2A 5CLJA 2XA9A 5EAIA 1QOPB 2JDIA 3ISTA 5IUJC 3L43A 3KYIB 1EBUA 4ML3A 3TUIC 2XSZD 3PQ6A 3WMFA 3PRKE 4OXQA 1HGXA 1BXRB 4FHZA 2GPNA 2Y77A 3BSYA 3VJKA 1DEXA 4QDXA 3AU9A 4XUGB 3W6UA 1P2TA 4BX9A 1ML3A 4R9SA 1EINA 1Y98A 2XJ4A 1Y3FE 2RIRA 4X90A 5T67A 4FM9A 3EJWA 1K9SA 4C7OA 4XQEA 1T5BA 1A8SA 1OASA 3TYXA 4V2IA 3G59A 1W19A 1CZKA 1NVVQ 1T9HA 4L8LA 2PX5A 1NXOA 4II3A 3WLRA 4Z4HA 2BTQA 3H0EA 2P9CA 5EVJA 5F33A 3RJMA 1E3WA 1GXSA 5BNIA 1XQYA 1OFUX 1THTA 2GCEA 1JFTA 3X0DA 5DX0A 3CZPA 3OLVA 2J07A 4DZTA 2XXAB 1G8GA 1R5OA 1N75A 1F51E 5HKLA 5F2NA 1QFJA 3ZUPA 3UMYA 3MQ2A 4DA4A 2VXOA 3BQMB 4FX2A 3GA7A 4PAOA 3WRYA 3IMFA 4R98A 3LA8A 3QXXA 4F4JA 4JJEA 3IRUA 4YP1A 4RVOA 1MX9A 4CG3A 4CDRA 4BDTA 4JOQA 4X1OA 4RFSB 1SOAA 2HD4A 4QUKA 3WLLA 2WNSA 1YJCA 4P4LA 4B80A 3UMMA 3S7ZA 5DJ5A 1G17A 4PM4A 4JDPA 2B5VA 3FSEA 3CLSC 5BV2P 4LSGA 5JEDA 3MRSA 4DLWA 1FNNA 5D84A 1I6LA 1NQUA 1QG4A 4KYIB 2G06A 3WWYA 4CT5A 5IT4A 3WWZA 4B3XA 1UP6A 3CPHA 4EBBA 1Y63A 3FN4A 4UPDA 3U1TA 2WVAA 5KDOA 1UKAA 5H82A 3X1DA 1MX3A 4HN4B 5TGZA 1UBHS 2CV0A 2JFQA 2G9QA 5JDCA 1C30B 3GUYA 1JL3A 3KXDA 4PZPA 2O8CB 1YQQA 1H85A 1G291 2IHVA 4I6EA 5HRUA 4JLAA 3AUSA 3E5RA 2QTCA 1JFVA 1N7GA 3OLQA 3BT7A 1DO0A 1CRQA 3QLVA 1TM2A 4Q4AB 1TEHA 2VPZA 1F6DA 2ZDGA 2XUGA 4IS2A 3HRHA 3O8OA 4AO8A 1E3QA 5GY7A 2PO7A 5SZHB 5EJ6A 3G7NA 1AXGA 3D4NA 4MKGA 2ONJA 2ID7A 4J0JA 4RD6A 3V4PB 4OJKA 1CF2O 2PGLA 4N3CA 3DLAA 2JEZA 4U9IS 3UMRA 4R2WA 1U2DC 2JRCA 4BO5A 3HYNA 4BFTA 2GILA 5DGDA 2PWAA 1GZ3A 1K98A 3HN2A 3GRRA 3JD4A 2B6NA 2XQVA 1GA4A 1WCYA 2SKDA 3G85A 5B7QA 2YIMA 3ENKA 4X6LA 2JLQA 4PR0A 3ZIAD 4QDUA 8OHMA 3OTOB 3B1XA 2HRCA 3UWPA 2ZZKA 3CH4B 1KEKA 1Y3CE 2O2DA 2X13A 4UTZA 3U61B 1B23P 1UZNA 1E0AA 1QIMA 3PSAA 1J22A 1JNYA 2QYOA 4UDNA 4CQMA 1E6EA 1E59A 3C74A 5BURA 3ITEA 2EBFX 3B3GA 4AJEA 5JRJA 2DX7A 3G8BA 5FNZA 3ZYZA 3OOYA 5BSMA 1ESDA 4G4GA 4GM0A 4WDQA 1TA4A 1C9EA 4LJYA 5LL6P 3DDUA 1NFQA 2ZIAA 4ZOCA 2ZXUA 2IS1A 3PUJA 4WMLA 3WKBA 1FDTA 1GGEA 2OBXA 2PZEA 2MSEB 3MTDA 3O8BA 5FXMA 3VKHA 3P4UA 3BEDA 3NALA 4MYRA 5TLSA 3VSAA 1L5QA 3IIEA 1RRPA 3B1KA 3EMDA 3GPIA 3IQFA 4TLAA 1YVEI 2PHZA 3COWA 3QVTA 5LNK1 5BOVA 1HC7A 3INTA 4TXLA 4B4OA 1KP2A 1PQPA 2VRNA 4UM8B 3AX6A 4YDSA 3CRVA 5DM60 2W71A 4IGFA 1RC1A 3L77A 2PMFA 3R2JA 5F5XA 3S5JA 3KG2A 1P7CA 4C6RA 2ET6A 5TARA 1H8EA 1QNLA 2QW1A 3K0HA 3BF8A 5ARDA 4TN5A 3FYHA 4G0WA 3F6CA 1KI8A 4TROA 1CW2B 1OV6A 1VPVA 5ETJA 4DF3A 8ADHA 5GADl 2HCJB 5KEIA 4BZXA 5HZMA 5K8VA 1OA1A 4LWQA 4Y2UA 4ENQA 1JQ3A 1UQTA 3I30X 3U19A 4BCDA 2PUBA 4JQCA 1Z0FA 1P33A 1EHYA 1QO0A 2Q3LA 1ODLA 3UN1A 3ZTWA 3QOYA 5AOCA 1FP4A 1IRXA 4NP6A 3OU6A 3P9SA 2G8LA 2X8LA 1AS0A 5KC8A 1S6YA 2O2JA 3D6JA 2P90A 2KJQA 3I6IA 4YI3A 2HO4A 4WW0A 421PA 4RD4A 3VHXA 1G0OA 1NQOA 3AY0A 2G7MC 2JLCA 4DGQA 3DZJA 4XVRA 4N03A 5IP5A 2P0AA 3DJYA 3MWYW 4ZCMA 1YB1A 1PNOA 2ZSBA 3V48A 2HUPA 5AVJA 4ZYLA 1DZ3A 5AK6A 3A9RA 3VO2A 1OJ7A 4FMDF 3NATA 2IZZA 3N2KB 2O4UX 1ONBA 1TNDA 1UM9B 3EGDA 1EFTA 1O95D 3AVWA 1Y5LA 2WMOB 3JQRA 3EPLA 1SGWA 5JECA 5KYKA 1IK6A 4D4JA 1SU8A 4U1RA 2H5JA 5JVDB 3PLRA 3ZH9B 1C3VA 2IDMA 3RSZA 5BSRA 2PVCA 4E5VA 9ATCA 5JBIA 3KC2A 3KUCA 1ITZA 2X9LA 3PPIA 4XDZA 1S4QA 3LT5A 2ZM5A 1KKLA 3UPUA 3RADC 1JFFB 3MWJA 5ALSA 2OAQ1 3EULA 4MW4A 1XTIA 3E53A 4BV2A 3DYIA 1T8RA 2EERA 3QE4A 3JWJA 2LNDA 4QGFA 1UQUA 1N2GA 3ANNA 2JHCA 2VQSA 4LYAA 1TKCA 4FWIB 4C1BA 4DCOA 2D06A 1Y8QB 1EX9A 2FFRA 2O3TA 1WP9A 1VLLA 1B0PA 1W0KA 1F5SA 3JVUA 4BNUA 4Q7QA 2R8PA 4IIHA 3H3JA 3PYMA 2OCIA 3FSJX 3ZWQA 1ENZA 3R3WA 2GLXA 2RAVA 4C5CA 3B1JA 3AP2A 5J23A 3KJQA 4PZUA 2O2CA 4QVIA 5FPKA 3RBXA 4YDRA 1J23A 1CT9A 1KF0A 4TXNA 4Y6OA 4JX9A 1E0KA 2H2HA 3CM0A 3CURA 4H3VA 3UK7A 3VOBA 1RVV1 2VNJA 4Q7LA 4RK0A 3T3MB 4GKJB 2J85A 1ZONA 3MYYA 3N8IA 4M9XA 4FMCF 5EERA 1Y1TA 4A7PA 1JN0A 3EEYA 3CF4G 1PT6A 4HNSA 4R2LA 3KSUA 4WZBB 1VG0B 1MJHA 3ABQB 3N2KA 5BW6B 4CF4A 4O6VA 5HDQA 1B2RA 4ZVQA 3M5PA 1AKRA 1I36A 4GPEA 3UJ7A 3HKDB 4BU1A 2RGWA 2EJTA 2VH5R 1EFPB 3GCXA 3GZNA 3HUTA 1ZK3A 3UA4A 3WRXC 2C29D 4C7OB 4KAXA 5AW4A 3DDSA 2FE4A 4KUEA 2VSOA 3PR3A 3RBZA 1CVLA 4XFJA 4X7MA 5CYPA 4B7XA 2WF7A 1BOOA 2W2TA 3R6GA 4DLLA 4P86A 1Q57A 4C01A 4D4KA 5BUCA 4FDUA 1X13A 1GUAA 2X8WA 5ALJA 3DXZA 1BMTA 3WRWA 5CFPA 1IBCA 3LFTA 3ER6A 4MV1A 2CXQA 2AK2A 1L5OA 4K87A 5HMLA 2QTLA 4MVJH 4F3KA 3OT1A 5C8XA 5FLXA 4NJOA 1XZAA 4GPBA 5JNWA 5F9FA 1YRAA 3OIUA 4IV5A 4LNUA 2OHIA 4C30A 4YACA 3G2JA 3ZKWB 2NO9A 3PT5A 1MRZA 2WILA 1T3ZA 3CKLA 1K9VF 2CMGA 1PW5A 4IO1A 4YT8A 6ADHA 2ONKA 4A26A 1KGDA 1MXFA 3TIVA 2D5CA 1DDIA 1TF7A 1QQ7A 4IV8A 4MPDA 3P0RA 2CHFA 4O2AB 4RZ3A 4DJDC 3H3XA 1UEIA 1IHYA 3OG9A 3O4IA 3UPTA 1FFCA 5HA5A 2UXCB 2CDAA 2WU4A 4HAWA 3LVBA 4TT3D 1JR3A 1RWQA 3VQTA 3S5UA 4CLOA 2FWJA 1JDSA 1BS2A 3EIWA 4KPFC 4XFDA 3SDBA 1V8OA 4Y1GA 2GRUA 3GRYA 1HBJA 1NW7A 1V4VA 2QWXA 3IDZA 4LYDA 4OQZA 1CERA 4ARSA 3RYHA 3QELB 4P3XA 3T54A 5E9WA 2POQX 1JQAA 2XTJA 3WJ7A 4Y2HA 1E1RA 5G3YA 2XRMA 1N6IA 1J2TA 4JLNA 1O2DA 1U7WA 2ETXA 1CEEA 3NOXA 1SHKA 1X70A 2G25A 1HYGA 1FVXA 3AHDA 1C3EA 3GUVA 5IBRA 2JFOA 4ND2A 4HH1A 4LY9A 4EECA 1XEAA 2PEYA 1PVOA 2Z5FA 2OXEA 4EB6A 1C29B 2WLSA 4Q4JB 1A88A 1QGAA 5DSXA 3D1JA 5EPOA 4DM4A 1Z5VA 4KV7A 3QK7A 2DP4E 2IHTA 1OSNA 3BTSA 3R75A 4D9GA 4DCGA 1GL3A 1Q74A 3KYBA 1GM5A 2CNWA 3LH5A 1VPLA 4JU8A 5IM5A 3D3JA 5HGXA 4LKOA 1QLJA 3F98A 2B94A 3TZLA 3AI3A 3NC4A 4HDSA 4U8GA 5CX1A 1BVYF 3H0KA 4PQYA 5DASA 1V8ZA 2YXLA 1G9XA 3M81A 4AZ0A 2Y67A 4KI0A 3OM8A 4WBNF 2A58A 1JAIA 4R2HA 2P6RA 3ETGA 4AD8A 3RVKA 1G8JA 1JI3A 4NI5A 3E9YA 4Y7DA 3U4QA 5AKIA 1F2DA 4RTQA 4MKZA 3FTDA 3PKJA 2DUNA 1M0SA 3KL4A 2YYYA 1QHHA 2NTEA 5LD2C 1LUAA 1VJDA 3LC1O 5C2JB 2G82A 4LYFA 4ZV7A 1PLKA 2GUWA 4YV1A 1WVGA 2BN4A 2HIHA 2OSBA 2CGEA 4H18A 2XSZA 4TUYB 2O8BA 5GZ6A 1NG1A 1U4NA 4KIGA 5G1PA 2V4ZA 1IH8A 4TYPA 3OA0A 2R7MA 3OOHA 1ZBDA 3ADBA 2O3UA 2F9FA 1E1CA 2B69A 4IWXA 1UANA 1QTQA 1E5XA 3QBVA 5K0FA 2Z57A 2SNIE 2HJ9A 3U4AA 2KWIA 3HFGA 2CKDA 2IUTA 3UMSA 1J7JA 1Z18A 2WV9A 4TZTA 2WIKA 4FHGA 4CIVA 4OATA 1T8TA 1DRJA 3G49A 3BYZA 1S3FA 1VCMA 1SKYB 2ONCA 2Y4OA 3N0RA 1RU3A 1C50A 1U6JA 3QXHA 4GSYA 4ZU6X 1WA5A 4HSGA 1SVSA 2ZWPA 4GI5A 3F6BX 3ROEA 5YASA 1VE1A 3QTTA 3VYRB 4DG8A 4YUWA 3IXMA 3COJA 5HFNA 1FNMA 2Q0XA 4JJ6A 4DCTA 1JG1A 1IZ9A 1PG2A 3P9YA 5TY0A 3OBIA 3VOAA 1Z16A 5KTSA 4HG2A 3WK4A 2QLFA 1T13A 4UZEA 4L08A 4P1ZA 4D43A 4M36A 4U63A 1W4LA 3RV3A 3GF4A 3R44A 4AUNA 4TL9A 5AD1A 1SCAA 1MC5A 5ER6A 3QYPA 1FLAA 1I7PA 4BMXA 4MGHA 1E60A 4ECAA 1WR8A 1CY6A 5CLQA 2BAGA 1JXAA 4DBVO 5G53C 2HOQA 4P4UA 1HSOA 1GXSB 1XQWA 1WG8A 2X7HA 2QROA 2Y05A 1IUPA 1TQDA 3KLNA 4FI3C 5CPBA 5TGDA 4MO2A 4FZ5A 4DCPA 4FMPA 5ES3A 3NM5A 2HK8A 2JBWA 4MWZA 2JAXA 2AEMA 5BORA 1ZMXA 2TRSB 1EA5A 1UWCA 3PGVA 4MVJM 3SQLA 1ZN2A 5E3JA 1VYTA 3N53A 1TC1A 1AH2A 3L0SA 1OZ0A 1X7ZA 5CLLA 2M6RA 3DVAB 2Y0BA 1E2JA 2ZQ5A 3ERCA 3ANXA 2PH1A 5AQEA 3C7CB 1F6BA 2AEJA 3WO1A 2AD5A 2BHSA 3K1JA 4UOEA 4P4GA 3HBAA 1NUTA 4QOGA 4MZDA 4BNXA 8GPBA 1EYZA 2ODWA 3SLRA 1FC0A 2BFBA 1G6Q1 5KX5B 3C87A 3GI1A 1KE1A 3A28A 5K3DA 3PQ2A 3FSGD 2X0NA 3MQ4A 4UE2A 4C4ZA 5BW8A 3IKJA 4ZPJA 4B6GA 1A4XA 1NHWA 3IHWA 3MJDA 2XWBF 3Q5GA 2H31A 1NKTA 2HU2A 4GQIA 2Q4TA 3BULA 3Q9LA 2OA0A 2M32A 3B2QA 3K9NA 2PZJA 3MGAA 3W5HA 3PA6A 3D8SA 4O3FA 4BJHB 4QHYA 5HS4A 3ZVLA 1RAGA 3PDHA 1JYSA 1IHXA 5JPCA 2E21A 4H2DA 3UT0A 3UV3A 1WDMA 1IHOA 4J2HA 1QK3A 3CHYA 4DV5B 2BYTA 1SG6A 4M6WB 4DA9A 4CM3A 3G0CA 2XUAA 4B6RA 1BJRE 1NVMB 3NYQA 4BQNA 3RSLA 5IYZB 1PR2A 3SP1A 3DO5A 3WNDA 5L40A 4MIKA 2JG3A 1NBHA 3QVLA 3OQPA 4OL9A 5D3MB 4AZTA 5IJ9B 1PTJA 4HT3B 5JMTA 1KIMA 2V7UA 4V1CB 4G01B 4QUIA 4UM7A 4QRDA 4TSRA 3L4KA 1KO1A 4WIAA 3CX4A 2JA2A 4N01A 3EVEA 4CMGA 4F1KA 3WO0A 2WD8A 2CXHA 3AL2A 4BVEA 1N6LA 4F3TA 5DP2A 5DHTA 3I2KA 5K3CA 2PGNA 4Q16A 3X1JA 5I47A 1V41E 2HQSA 3CTMA 1MPXA 2WJ4A 3DLIA 3GJRA 2FMFA 1NQWA 3HCPA 4G1UC 4GPIB 3AHCA 3QX7A 4FS3A 2FPIB 1WS6A 2NV6A 3D0OA 3R3UA 1FCJA 1Y1RA 3IAM6 2QQGA 4NFLA 5F2OA 5KJEA 3Q9SA 4MKFA 4A8JA 5TQ0A 1X1RA 2R66A 3B7PA 3FWNA 3CX8A 1RLMA 2PX3A 4KLCA 4JXXA 4W1RA 1HTTA 5EINA 5CB4B 1F0NA 5JARA 5DMXA 2NU8B 5KKNB 1I13A 3NTXA 3QMWA 2W6ZA 2XD9A 4W99A 3ORSA 3F7NA 1PFKA 1QM5A 4KK3A 2PMCA 4NOJA 4W8GA 3S2FA 5C7OO 3FVVA 2KW5A 1QIGA 3NYWA 1CCWA 3QXSA 5GAJA 3VSBA 1FU8A 3ZCPA 2HWUA 4DARA 1A8IA 3CNBA 5ICMA 3P9QA 2YVQA 1OQAA 1HLFA 1SUDA 1XZBA 4L9SA 4Z1MA 4ESVA 3KOZA 3ILYA 2IH5A 1M5UA 1TUIA 5KSPA 1CIPA 1ENOA 3MS7A 1CLEA 4PFSA 4TS3A 3VAZA 4K6GA 3GLIA 2G40A 4CM1A 3HDTA 1E6CA 4G1MB 3UWSA 2IIQA 2W8ZA 5IAAA 1MOQA 1ZXBA 3L07A 1JDPA 1L4BA 1MO3A 2PJZA 3IOEA 1ZM9A 3PLNA 2YY6A 4XSGA 5M29A 2QTFA 3EVBA 1WNTA 4DDVA 3ZU4A 3B8HA 1M2VB 2WZDA 5MF6A 4WFJA 4B3BA 4LWOA 3A9SA 1E2FA 4PX9A 5I9IA 4J0HA 2UYQA 2C59A 3NYRA 3MOSA 5IFKA 2VTKA 2PX2A 4ZC1A 1DJQA 3ANMA 4S2EA 3GLFE 3EUEA 4LYYA 4DJEC 3S2UA 3S8YA 2C00A 3BWMA 3DE2X 3KLMX 2QJFA 4KX5A 4PU0A 2ZVPX 2ZYAA 3TE7A 3WS7A 4MXDA 4CR7A 2GARA 2B7BA 3KTOA 4MLCA 5J2TA 2OXTA 1XE3A 3V1NA 1P2VA 2VH2A 2W8BB 3DA8A 5BNWA 3WL6A 1ZGHA 4LX8A 5JCXA 1Q77A 1XLVA 4DLRA 3PK0A 2AMLA 3VGPA 2IBTA 4U0JA 2HDNB 3GEDA 4S24A 2VTDA 3B1FA 1DIRA 3IDAA 1IY1A 2OXFA 4ZRMA 3GFGA 2XUFA 3JPYA 3ZWOA 4BX8A 1J5XA 2YW2A 4CXMA 1XA3A 2LDBA 3K4QA 1T8SA 4KXXA 4JI0B 4KAFA 3U1BA 1M0EA 1RZUA 4Z5XA 3SHTA 1WB5A 4ONEA 5TVKA 3VPHA 3DFMA 1BJKA 4LSZA 5CYFA 3SE7A 3Q5EA 2PKQP 2Q1YA 3GJ6A 1NASA 3WNVA 1YNSA 1ZCBA 1IBRA 3MRTA 3QU2A 3ZDFA 3PG5A 4UCWA 1VCHA 2SECE 4FFLA 1QIFA 5JPIA 3WGKA 5BN5A 2OENG 4D74A 4D4HA 4EF5A 3RAPR 2OP0A 3IESA 4KWHA 1YHZA 4MQFB 3VR4D 4XRRA 1N3YA 1E2HA 3FE2A 5C51B 1NLZA 1ISJA 2IYWA 3HJAA 4EGFA 4C89A 2RB4A 4KIWA 1M7GA 2X6TA 1TJ5A 5H70A 3VPDA 2I2XB 1E2UA 4RE5A 4YH1A 1TQ6A 3ICCA 2C5GA 1YIOA 2ZBFA 4H0NA 4OB7A 4HNAB 3SHQA 3ZHCA 4BQRA 4D3YA 5BYBA 3I0ZA 1OXSC 1G41A 1T4DA 3T4XA 2P1RA 1UPAA 2WC1A 1YULA 2WHPA 4MUAA 4QQKA 4YONB 3SEFA 4BQOA 2BJWA 5D5PA 1Z6TA 3M6WA 3NNDA 2Q3MA 2HT6A 2LD4A 3WIUA 3Q3GE 4Q7EA 3D6UA 1AZTA 2GUGA 1D6NA 2ZJ8A 5F78A 4A0GA 4P0QB 3FTPA 4FYMA 1RTTA 1TUBA 3AY7A 6CHYA 3HY6A 1SWVA 1KMHA 2VDMB 3CXUA 4QASA 3KOXA 3O03A 1T10A 1JDBC 3RREA 1W36B 2IXDA 1U2RA 3C6MA 1FE8A 4P4TA 1QRTA 1YF3A 1C9JA 1C7FA 4EAQA 3PZBA 5CTJA 5ALEA 3UAOA 3H84A 4PE5B 1IZ8A 1ISSA 1JR2A 3OFKA 4OYHA 4BO0A 2I91A 4MNTA 1CDDA 2PVPA 1C8KA 1JLRA 5MN6A 2FVYA 1O4VA 5J5CA 4RXTA 4D25A 1SBCA 1IN4A 2II6A 3C1TA 3L0YA 1AQLA 5A7HA 4PIMA 4DQDA 3QPUA 1EAYA 1EFVB 4IVPA 1N5JA 4XD2A 3NANA 4QYMA 1EP3B 2QVGA 3IDQA 4ZI2A 1EB9A 9LDTA 3UJPA 2WTBA 4JVMA 1PT7A 2O0HA 4IIFA 1LC3A 1YACA 4BRZA 4JR2A 1GPUA 2Q3JA 4RA6A 4Z0PA 1BEEA 2AR0A 5GONF 5BRNA 5C37A 1FMFA 4EQ6B 1VLQA 2VIIA 1HRKA 4DIDA 4U3JB 4ZYWA 4K9DA 4OJQA 3ZHOA 5B3JC 4ZT4A 1WXGA 4PO9A 3GLHA 5HCIA 5K4AA 3N0XA 1E92A 1S8NA 2YICA 4PZZA 4RY2A 4E15A 4ES6A 3BD6A 3EISA 3LCVB 4XEHA 1BJTA 1VYVA 4PNZA 2WD7A 2G4VA 3FPGA 1A7UA 1O8BA 2B37A 1QFYA 5IK2D 2ADMA 3IEIA 3GHHA 2FRVA 4Q5IA 3UOAB 1QFZA 3TI7A 4DR1B 2OCXA 4X6XA 2DPMA 2WG0A 1V3VA 2BFEB 2C4NA 3L1IA 3MTIA 3OMWA 3IPAA 4FD2A 2HY7A 4YRDA 2P9FA 2I1VB 3HCCA 2NZ8A 3GJZA 3IT1A 4WVLA 2TMGA 3VFDA 4CLRA 2BMWA 3ITNA 1K4YA 2Y66A 4HFRA 1EP9A 1MA3A 3QA3E 4TXJA 5E6RA 4EF4A 4ZOQI 3OQJA 2ORYA 4E0BA 1EI9A 2IU6A 3HH8A 4C20A 3L8DA 3ZWDA 3H87A 4D45A 2Z6VA 3Q98A 3IO5A 1UAGA 5F7JA 3FPAA 3T7RA 3GJSA 1QV7A 2I3GA 2EHJA 4UVDA 1FSZA 2Z9BA 1W0KD 1P8AA 4G5RA 5ULLA 4CWAA 3PYLA 3AW8A 4YECA 3WHKA 1IXSB 3AU8A 4RQBA 3OX3A 4IGAA 4LNUB 4LVUA 3QLJA 1ZRHA 5BWBA 1GEGA 3BB1A 4YJDA 3DKRA 2YTZA 4Y9UA 3ZEIA 4YP0A 3FCEA 4D9FA 5JROA 1H6AA 4UU1A 4DWJA 2WV7A 3OQBA 2FZ4A 3BKWA 2YOGA 3PXUA 2FPLA 2OFXA 1OH7A 5CFNA 1EQAA 3EDYA 3FUWA 1RT9A 3AERA 4CIXA 3QY0A 1OGYA 3TD6A 1TM1E 1FVFA 3PHIA 2AUTA 4UHJA 1F2TA 3AR5A 3KEFA 4RIIA 5AM0A 1NVEA 4V1CI 4AZ3A 2C2MA 3ONNA 4QDTA 4TUYF 4UARA 4G5QA 1ECBA 1ZH6A 3AUKA 1L7DA 1I2MA 2EZ4A 2X8AA 3AETB 1KEEA 4OLHA 1KO7A 5T4BA 1OT5A 1PK9A 4ZOEA 5LDHA 1HXHA 3AV0B 1V35A 1YR7A 2I33A 1O6ZA 1RMYA 2LIPA 1TF5A 3A36A 4D56A 2WTAA 1RJDA 1PT5A 4G25A 3ABSB 3SMVA 3CF0A 1A27A 1D6JA 1DKMA 2R79A 2IYUA 1IQPA 3DE4X 1EUDA 3CZ5A 4FKMA 1EH5A 5CA0B 4HDQB 4UJ3A 4HH3C 2HQBA 1IB0A 4BY9E 3K9BA 3LQ2A 2W90A 4GBGA 4KQKA 4XGQA 3AFHA 3THXA 4M53A 4DJTA 3P2IA 4M0DA 3DXXA 2PZKA 2YC2C 1EWKA 4AJ4A 2J4FA 2FPPB 1J2UA 1V39A 2LVBA 4JJFA 3KV1A 1EWYA 3EXIA 4N3BA 4Q24A 1GFSA 2IUEA 3I2JA 2I5PO 2WJWA 2Z2IA 4AULA 4BFYA 2YKGA 4EG6A 2QUKA 4EX6A 3IKVA 5HUQA 2F1RA 1TU4A 2P77A 1IZ0A 2YJTD 4QXPA 4DCSA 1WAMA 5IT0A 4BLSA 3NP7A 1A5BB 4KL8S 3JQPA 5CGQB 4YMGA 2V5VA 3R5KA 4Q7JB 1I2AA 2R6JA 5CIYA 1YTUA 1BDMA 4QBIA 1GQRA 3VYSB 3QUQA 4HVLA 5B1IA 3JQFC 5CBKA 1JHZA 4NY1A 4OI4A 2GFHA 1WUYA 2BFDB 2VNHA 5EC8A 821PA 4Z4GA 2DLDA 5EIHA 4EG0A 4CNBA 3AERB 2DU8A 1AZLA 1LBTA 2N1MA 3ABZA 2NU6A 2QTVA 1HDXA 1RZVA 2A9KA 2VDJA 2ZZNA 121PA 3TDNA 1E32A 4ZFNA 3CPSA 3MXTA 5DM1A 2ORIA 4E5DA 1GSHA 1OOEA 2QL7A 1L8XA 2VPWA 4JLDA 1CZOA 3FJYA 1E7QA 3JAWB 3R6TA 2SKEA 1Z6ZA 2JIZA 2XPCA 5FWDA 1ULZA 1WDLA 2C9DA 1OI4A 2VI5A 4E13A 1FQOA 1HQDA 3VR3D 1DKOA 1R18A 4G0XA 4P2GA 5KNDD 1NZDA 4A23A 4HDNB 4YJHA 4EO7A 2FWMX 1YR2A 4RNDB 2W2XA 3NHKA 3PUYA 4I6GA 4XW2A 1RJEA 1ZGAA 2XLBA 4YCDA 1L9XA 1V3QE 3RO7A 4DQLA 3KETA 4ZCQA 2CNWD 3FWKA 3KJGA 2G5CA 3GUUA 3GZJA 3PEEA 4OIMA 4AQYB 1N2CE 4TZ6A 1F0KA 2BONA 2JCXA 5DWVA 4OUKX 2Q5LA 4UE3S 1GGNA 1L5HA 1H9AA 4Z9XA 1QB7A 3BIOA 1Y1QA 3EARA 1IWOA 1SM4A 4URZR 3RIMA 4RTOA 3HXPA 4YB8A 5KOJB 1T34A 3GWZA 3RI3A 4QRHA 4TXMA 5KOYA 1KQFA 4L50A 3S99A 3PBKA 1GDHA 1VM6A 1ZM3A 3VR4H 3I01M 2GCOB 4LZJA 4DILA 3ZXSA 2AH5A 3R9WA 2JIDA 3SHOA 5HUHA 4RL4A 2G0AA 1Y3BE 3O74A 3PUKA 5EY5B 3T9BA 1F4LA 2E85A 3QLTA 3LVQE 2MYTA 3VSEA 1WTAA 2CC2A 4IO0A 3H11B 5FULA 1WSBA 1SKAA 2CLIB 3CIOA 1YK1A 5JI3E 2HAEA 4YRFA 1IEWA 2HFJA 2I54A 3CIFA 1U2ZA 4LISA 1X7HA 5CYOA 4YI5A 3RROA 4YP6A 4D9IA 3THXB 2B35A 5K3OA 1N3IA 5JY1A 2EFEB 5K8LA 4PR3A 5JXHA 3K0BA 4B9EA 1YRWA 1M2HA 4IRUB 1PNTA 5LBUA 1EFHA 2WU3A 3C6XA 1I10A 3ZJ5A 5MFZA 3G6WA 4DXHA 5I7WA 4P81A 4C2TA 3LP5A 4IIYA 2RH9B 5AUPB 3VNAA 3EEIA 4GG1A 2UZAA 2CD7A 3P2KA 2NTJA 2Q4EA 4CLOB 1WE2A 2FMUA 5IF9A 4FZRA 2FHSA 2PVSA 2CUTA 4XQ9A 5FCDA 1J25A 2XZPA 3NW9A 4ZKDA 3GJXC 3OE5A 3GVHA 3R3HA 4NWIA 4ZAGA 1ZHFA 1OZHA 1SFRA 3WBFA 3ZE0B 4AG3A 3SC2A 3K9FC 3UW3A 3FNFA 2XRFA 4P8RA 1QR2A 2WA1A 2Y71A 3NHWA 2P7HA 4N5HX 5JO9A 4GXNA 3WL3A 3AI2A 2A9FA 2YOHA 5HF9A 4D9EA 3C3PA 2ILTA 1CX9B 2MMCA 3UXHA 1ECPA 2BBSA 2P8SA 2Y1FA 3PDIB 5REQA 5E0OA 2P9QA 4F04A 5KB3A 4M6WA 4K2HA 5BVGB 3WICA 5F73A 4KH1A 3CVXA 3OQHA 1DOAA 2ID8A 4RTKA 2GMWA 3HY3A 3OZ7A 4BVBA 3C3BA 1T29A 1AC5A 2J46A 3IBCA 3L0ZA 2O8FA 5CR9A 4PVDA 3CUTA 2F1HA 2GZMA 4DV1B 4GE0A 1PWXA 2P3LA 2XCUA 4FW8A 1IOVA 1D2EA 4IXNA 4JJ4A 1IAVA 1PJAA 1FP1D 2FDRA 2FPRA 3D6AA 3GDFA 3EOAI 3IFSA 1Z8HA 4ZVUA 3TR0A 4PBSA 5HRAA 1N34B 4GQAA 2A5FA 2WDPA 3MIIA 3BF7A 2IEIA 3QNMA 4H4DA 5E7MA 5GJCA 4ADSG 3QRWA 1VKHA 3ZHTA 2W2VA 5HHTA 2KPOA 2VRCA 4IIVA 2Z6AA 3UAYA 1P3DA 2BFEA 4LTMA 1T9CA 2D0OB 2NO4A 1WEKA 4DM3A 2ZRJA 5DCUA 5M7EA 3E22B 1LB1B 1U8UA 3TCXB 1UBOS 4FXPA 1FMTA 2A57A 5KMGB 5IK2A 1XDSA 3PC2A 1P17A 3FPFA 3LA6A 3C5CA 4YCJA 5HGJA 2B34A 2JGMA 2AZMA 3VI3B 1X80A 4N6GA 3E6AA 1PHRA 3EMBA 4FE3A 4BATA 2DECA 5TDHA 5JV5A 3KDSE 1FPMA 4H1TA 2J3JA 4OKSA 7YASA 5IVPA 1YE8A 4C0XA 3V33A 5G41A 3AM1A 1U9ZA 1MORA 3FIJA 5TPZD 4D3DA 3TRIA 1RFLA 3ZE1B 5LQDA 4H6VA 1WQ1R 3F9RA 1IHPA 3IPXA 3WIVA 2E4XA 3LXXA 2A92A 2X5NA 2QSJA 5FH9A 1PYGA 2AFIE 2ERYA 2VYQA 3HP4A 4JENA 1H2WA 4NAVA 1EIZA 3ZZMA 3VX4A 2FTKE 3E61A 4MUEA 3KPJA 2VT2A 4M1EA 1DTSA 4RADA 1T2CA 2C4WA 4GI1A 4EZBA 1WW3A 1D2GA 1NAIA 1NYTA 3V3KA 3UQZA 1UFOA 2O2HA 4OJTA 5DW0A 3KHKA 4QEDA 5DLQC 4WCDA 3EGXB 3WE7A 4AJHA 4J2OA 4RYLA 4FJ2A 4W7SA 2OD9A 2RH4A 2H8KA 2XUQA 5B3JA 5L3ZA 4D1YA 3RC8A 2AN4A 2R6AA 3KEOA 5FWXB 3F4BA 3GJ4A 4N47A 4LA4A 4P7JA 5EG5A 1BDHA 1WPXA 4XB6B 4BWFB 4J0CA 1NULA 3ESBA 4V0MA 4HVCA 4QG3A 2Q5QA 3RV4A 2FEKA 4H59A 3B70A 1W1UA 3HZHA 3JX9A 2ZFUA 4O2RA 3BFVA 4DS3A 5CVTA 1FXWA 4EEKA 4Y9SA 3C6YA 1L3IA 3L1JA 1DO2A 1MX5A 2FDCA 3I62A 1J2YA 1O0CA 1NNLA 1QOZA 2ZSIA 1OAAA 1XKTA 3E18A 2QTRA 4LXIA 4PXAA 3C5WP 1RQGA 3OZAA 1M73E 4TTVA 4NCXA 3W9BA 3E4CA 3AVVA 3ESAA 2PQ0A 1TFRA 1KMIY 3PPYA 1VJGA 4NCBA 1HM5A 2FX2A 1NLMA 3CLUC 3LO5A 4U5QA 3OPNA 5LP6F 1NVDA 4EVSA 1ORRA 4JC4A 1EDZA 4OUDB 3MCTA 4OMCA 4AB1A 4ERXA 3BGSA 4QQ8A 3F5FA 3ETEA 3RAJA 2J3IA 1ZHHA 1CUZA 5AJTA 5P8WA 4DE5A 4OHYA 1ZSNA 4UMEA 4DCCA 4ZTZB 3UMGA 2W2KB 1E9EA 4RTRA 1MT3A 3FOZA 4FCVA 1E1QD 2BF7A 1JR6A 1Q15A 1GNVA 2O0LA 3IBFA 1OYVA 3LDAA 4N8EA 4DFDA 2HDHA 4XLZA 1E2LA 1OXUA 2GXUA 1EM8A 4CF6A 1ZJ5A 3N7TA 2H0AA 4ETNA 1R8QA 5AJHA 2M2IA 3GCZA 3TQCA 1D2HA 4BKOA 5BR7A 2BY4A 2W98A 4GI3A 4GW3A 3LAWA 1HSZA 2ZAIA 3PU6A 3ZXUB 1P80A 2TYSB 3V4FA 5ALOA 2J9RA 2DETA 1TZCA 1ZITA 5LP6A 3GLFB 1VSBA 4US2R 1YVRA 2W0MA 3VU1A 3ZTYA 1ZAYA 3OIWA 7AT1A 4L95C 5D3ZA 3EEFA 1E3DA 1YS9A 1GEEA 1IM5A 1QOQB 1Q91A 5M34A 2CXTA 1AUQA 3AUTA 5CVCA 3VR3A 2DRIA 4BOYA 3VR5H 4E31A 4HWPA 4ID9A 1W9HA 4BB6A 5BR4A 5HQTA 2RDMA 1XQ6A 4MS4A 2PMWB 4BE4A 2PJRA 2ZJFA 1XK6A 1L0BA 1QGOA 3OX2A 4IMRA 3RW9A 1U9CA 4KE8A 4NE2A 1EFCA 2IU0A 4OI2A 4WLVA 3DXFA 5THQA 3OSZA 1GKYA 2WK1A 2IXTA 2KSQA 1LRLA 2ZETA 3DNFA 4WA7A 3VU9A 3KWFA 2YHIA 4XVHA 2WABA 2YMMA 4MYTA 3LRPA 3MINA 1Q1BA 4JOSA 3NWBA 3STVA 1KFCB 1KEZA 4I5IA 3S8EA 1SCDA 5AT1A 3RU7A 1EVEA 1RCTE 1R8YA 3NWOA 2W6NA 4QE3A 3W1WA 1GNPA 4L7VA 3GZ4A 3I09A 3QEJA 4PPGA 5T8KC 3VNSA 5JRZA 3DQQA 3UMJA 2FEMA 4UTRA 1KJIA 1SWWA 2I4NA 3UG6A 3HCAA 4IG9A 4FGLA 5I7UA 4I81A 3HJUA 4XJSA 3KSRA 4G0ZA 1ZS9A 1UZLA 3ZS9A 2VBFA 1PLLA 4C0HA 5HQ3A 1TD1A 2XVZA 1V25A 3CRMA 5JRDS 5ESDA 4CKEA 1LF5A 2P9TA 4PLZA 4BMYA 1MHTA 3QPDA 3V1TC 3BMNA 4B32A 4MWEA 1DPGA 1QIJA 5GIPE 1WV1A 3A32A 1H4SA 1K5DA 1R0SA 3BH7A 3UOGA 221PA 5ARCA 3KKQA 3MT0A 5K3AA 2YXPX 4CF3A 2CLHB 2PZLA 2SHKA 1P0QA 1FFAA 1RLTA 3N74A 1YAHA 3CKMA 3OZBA 1S0UA 2Z5LA 3PEUA 1DO8A 4G0NA 2VDLB 5U4QA 4GM4A 1W9MA 2H00A 1XJQA 3GX1A 4N4AA 4J0EA 3NVDA 4ILKA 4L8VA 1JQBA 4LJ8A 2FSIA 3L4EA 2FPGA 1UMDA 2JIPA 3IBTA 1DSSG 4U4AA 3Q7EA 5EJMA 2Z8YA 1VL8A 1JZQA 3I3SR 3HFRA 4LHSA 3ZUGA 4I1IA 4C2AA 2V8OA 4OFBA 2QTBA 3HACA 3FZGA 4DAEA 1KRXA 1XXLA 2H1VA 2ANBA 5G2OA 3U4GA 1L7NA 1U4OA 2FZCA 2GA9A 5FWAA 5H4GA 3IL2A 3AM3A 5CH3A 4FINA 2BOVA 2B4QA 1B00A 4HK4A 2MMGA 1NLFA 3OZRA 1GTL1 4UE6A 2DFPA 3LY7A 3WYCA 4FDVA 3RSHA 3SZ3A 5ICGA 2FK7A 1RQNA 4UEWA 3CKKA 3DVLA 3HXTA 2P6PA 2P6MA 4X95A 1GRCA 4E2FA 4DB2A 3B3JA 2PZFA 5B2FA 3EPHA 2WWIA 3JR3A 4RULA 4RY9A 2UZ1A 2EBUA 3F8WA 5DT2A 3W3ZB 2VLBA 2YFHA 3NBYC 4KIUA 4PLTA 4BKUA 4C0BA 4YAJA 3M6LA 5JHGB 4ZDIA 4TL8A 1FX0A 2RHOA 2QE6A 3HCNA 4GKAA 4Q3KA 4BNKA 5E9QA 1ZUIA 3PVZA 4PQRA 5CDUA 3D5QA 3TQRA 5KU1A 3O4VA 5LXTF 1KYIA 2PIAA 2PLFA 1Y8RB 3DHYA 2E5LB 3KU1A 4GGMX 4WKOA 1Z45A 2Y92A 4FVTA 1LFAA 3U9TA 4HH0A 3LW7A 1J49A 4EL0A 2R8RA 2WG2A 1CUGA 1H0SA 1KH3A 1P31A 2WAAA 4P08A 5C35A 1E0JA 4E33A 4N82A 5JSZA 1TEVA 2UYGA 3OT5A 1MJNA 3LOQA 1KAMA 1M0WA 3DDOA 3M6UA 3HG7A 3MTEA 3V7WA 2Y0DA 4X91A 3E1GA 1QRSA 3GJ7A 4PONA 3QMVA 2ZUBA 1VFNA 2VDQB 3C6ZA 4L0QA 1XZQA 5AIBA 1M75A 2Y93A 3E48A 2HYDA 3VZRA 3UWMA 3PP8A 4R54A 2O5EA 2M6KA 1PK8A 2XV1A 1AS3A 2M9MA 3ICQB 4RU1A 4Z9AA 2WKRA 4MV0A 4YMTA 5K03A 1WHSB 5JWOA 4J07A 1J2EA 4O2BF 1LKZA 3TQOA 1XRQA 5B58C 2QENA 1OBHA 4RSRA 5DWQA 1M1YB 2J7PD 3OI7A 4WEOA 2PXAA 5TGTA 2C78A 2K2WA 1GQQA 1PZGA 3AFGA 3EXHB 3JYPA 3LO8A 1H93A 5EQJB 3HYSA 2B8JA 3KKMA 3G2IA 3QITA 4OH1A 3NR2A 2AYXA 5C8YB 1MDFA 5EIXA 3JD3A 4QUAA 2IW3A 2P9EA 4J1NA 3HKBB 4MINA 3V42A 3ZWMA 2ZUDA 1U0SY 4RC9A 3AZOA 1JG4A 3G2PA 1L4YA 3N86A 1ZVQA 3QTLA 3N1UA 1QE3A 3O3MB 2J3LA 1OIXA 2WE7A 4FFVA 2EFGA 1D0SA 1BXGA 1YR6A 2WE8A 4JB0A 2GN4A 5D85A 4H6XA 3FMPB 4YRBA 3HJHA 2IODA 3E05A 1XMIA 3G8AA 5T57A 5FUMA 3RS8A 1YZLA 3GROA 2O6HA 2F64A 3PXCX 2J48A 4I1PA 4NBVA 3T3NA 4MWBA 2B5WA 2NXJA 2J6CA 2O48X 3X1WA 3GLQA 2KBFA 3GJ3A 4HN2A 5KTRA 3A6JA 3AR3A 4XYGA 3EQ8A 3CE9A 3WWDA 1GFWA 3HRIA 1EBBA 3L01A 4FBGA 1HFJA 1AF4A 2A6PA 6PFKA 1ECGA 4UM5A 1D4OA 2ADFA 4M1MA 3SZMA 4BJ1A 2CXRA 1TMKA 1JALA 2CL5A 4J4TA 4L5CA 4U7PB 5BV8A 4M8LA 1XVTA 5ELXA 1JP7A 3TIFA 3UCEA 3GFRA 4CTKA 5AVSA 1ZZEA 4RDIA 4OXIA 5DYWA 5IC6A 2DPYA 2X3FA 1I7QB 1PKEA 5KU7A 3PFWO 4LXQA 1N9GA 5FYDA 1EK0A 3RWOA 5A9TA 3WGVA 2DEUA 5TT1A 1A4UA 3KO8A 5LQCA 1RWMA 2BR3A 1CY4A 1W44A 4XR9A 4ZVLA 3SSAA 3W06A 3VPCA 2HWKA 2C03A 2FSHA 1TIPA 2ZIGA 4GKBA 3N0WA 2CUNA 1K08A 1UDXA 1Z38A 3HC7A 1G3RA 2FQ1A 2JCYA 1JEYB 3U7QB 4B0PA 1A96A 2FR0A 2P4SA 3EZFA 2QRVB 2UAGA 3HVUA 4J91A 4RK5A 3RRYA 1TB4A 2ENWA 2P5TB 2KQUA 4CLRB 4WLUA 4IG4A 2GZAA 3KPVA 5IAEA 2GDJA 1T6YA 4F8JA 1ZJ6A 3R5TA 1ZKDA 1F8UA 1ZM4A 2OHVA 3MTAA 1S2OA 1NF3A 4EMSA 1D0VA 2D4HA 3SS8A 1TT5A 4OX9Y 1XTKA 4MAFA 1E9RA 2Q2QA 4Q4AA 5DSTA 3PJDA 4B7UA 1H2HA 1TA9A 3LW8A 3PNQA 3UHPA 2JKYA 1RS0A 3PD1A 2WF5A 2JZOA 2X4DA 4FFSA 4O4IA 4XIGS 1A1SA 2QUHA 2X86A 3T0GA 3WK8A 5AFSA 4B84A 1MOZA 4DUGD 5CXUA 2Q3BA 1QKIA 5CK4A 5LZ4A 2VSFA 3KFXA