1I8PA

Structure determination of the ferrocytochrome c2 from rhodopseudomonas palustris
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
114
structure length
114
Chain Sequence
EDAKAGEAVFKQCMTCHRADKNMVGPALAGVVGRKAGTAAGFTYSPLNHNSGEAGLVWTADNIVPYLADPNAFLKKFLTEKGKADQAVGVTKMTFKLANEQQRKDVVAYLATLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CYTOCHROME C2
publication title Cleavage of the iron-methionine bond in c-type cytochromes: crystal structure of oxidized and reduced cytochrome c(2) from Rhodopseudomonas palustris and its ammonia complex.
pubmed doi rcsb
molecule tags Electron transport
total genus 35
structure length 114
sequence length 114
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2001-03-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00034 Cytochrom_C Cytochrome c
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.760.10 Mainly Alpha Orthogonal Bundle Cytochrome Bc1 Complex; Chain D, domain 2 Cytochrome c-like domain 1i8pA00
1CTJA 2ZZS1 3CXHW 2AIUA 1I54A 1HRCA 4L3GA 1N9CA 3SLEA 4FA5A 1CRYA 3WFCC 5KLVD 3OCDA 1U74B 1GJQA 1EB7A 2YQBA 4EIEA 1J3SA 4WQ9A 1YTCA 1S6VB 3CU4A 1CIEA 1CHIA 2AI5A 1IQCA 1QL4A 3M97X 5DJQB 1CYJA 1DW0A 1KYOD 2GC4D 1H1OA 2YIUB 3RN0A 1LMSA 4WQ8A 1CSUA 1HJ4A 2B10B 2C1UA 2N9JA 5EXQA 4FAVA 5GTIV 1SQXD 5DF5A 1CIGA 3CXHD 1QL3A 4YE1A 4AANA 5B6QA 1FHBA 4AAOA 1IRVA 1H32B 1M6ZA 3L74D 4N0KA 1MZ4A 2BGVX 5DFSA 4O1WA 1CXAA 1CORA 1H9XA 2ZONG 1CRJA 2BH4X 3X39A 1DIIC 4J20A 1CEDA 1C52A 2CE1A 2C2CA 1I55A 1HZUA 1CO6A 3VYMA 1GQ1A 1NTZD 4WQCA 4U3FD 1CHJA 2FWLA 1P84D 4WQAA 1VYDA 2FYNB 4JCGA 3O5CA 3HQ7A 2FYUD 1CTZA 155CA 1H32A 1ZRTD 2VHDA 4AALA 1W2LA 3PH2B 3RN1A 2C1VA 4FANA 1RZ5A 2BCCD 3O0RC 2CE0A 1H33B 2V07A 1LS9A 3RMZA 1CRCA 5KAIV 1CYCA 1NTMD 3MK7C 1FCDC 2N18B 1CSWA 3C2CA 1B7VA 1YCCA 1ETPA 4IL6V 3NWVA 1IRWA 1NMLA 1YIQA 1FI7A 2QJPB 1YNRA 1M60A 1CSVA 3L4MA 2D0SA 5CIBB 1CCRA 2PACA 4FA4A 2GB8B 1CIFA 1C6SA 2D0WA 3JBTB 1HROA 2QJYB 1FOCA 1H33A 3VRDA 5C9MA 2N3YA 1LFMA 1FJ0A 2OZ1B 2LIRA 1CC5A 4Q5PA 1CYIA 4XXLA 4MU8A 1QYZA 1IO3A 1K3GA 1CSXA 3H1KD 3WU2V 1SQQD 3O1YA 1DIQC 5B5EV 1KX2A 1K3HA 4WQEA 4UB6V 3L4OA 1HZVA 1IZL0 3SWSA 1JDLA 5TISV 1I8OA 1BL9A 451CA 1NTKD 1DW1A 1YEBA 1E2RA 3CX5W 2OZ1A 1QN2A 3DR0A 3H1HD 5CYTR 3ZOYA 4PD4D 5CICB 3WFEC 2YK3A 3H1LD 3NBTA 2BPBB 3TYIA 4DY9A 1C2RA 1M70A 1GDVA 1CNOA 1LC2A 2B0ZB 3RLMA 3O20A 1PPJD 2CXBA 5IY51 4WQ7A 4PWAA 4PJ0V 3TGUD 1CTYA 3H1ID 1SQBD 1W5CT 2N3BA 3L72D 2GC7D 2N9IA 1YICA 1PP9D 3A9FA 1SQVD 1COTA 5KKZB 1CXCA 1H31B 4FA1A 4KMGA 3PXSA 2MHMA 3CWBD 1I6EA 3CX5D 2B4ZA 1FI3A 5GTHV 4D6TD 1BGYD 2C1DB 4Y5RA 1AOFA 1F1FA 3L70D 2JQRA 1GIWA 4O1QA 4EIFA 2YCCA 3DMIA 2ZOOA 2BCNB 1H31A 1CRIA 1L0ND 5CIHB 4RSZA 1HJ5A 1MG3D 1C2NA 1BE3D 3L75D 2AXTV 1NIRA 1OCDA 1A56A 1RAPA 3MK7B 2C1DA 1NNOA 3OCDB 4GYDA 3BCCD 1N50A 2QJKB 2JTIB 4WQBA 1DW3A 1L9JC 1OAEA 1HH7A 1YFCA 2ZXYA 2ORLA 3PXTA 1C6OA 3CP5A 2GIWA 1WVEC 2C9XB 1CRHA 1A8CA 2A06D 1MG2D 1CRGA 4WQDA 1DVVA 3SVWA 3L73D 1C6RA 1CHHA 1NU1D 1RAQA 351CA 3WUIA 1I5TA 4P4QB 1DT1A 5DJQC 4UB8V 1KB0A 4V2KA 1GKSA 5B66V 1AYGA 3DP5A 1FI9A 4FA9A 4H0KA 2XTSB 1BCCD 4H0JA 1EZVD 2BLFB 2I8FA 2LITA 1C7MA 3PXWA 3ZBMA 2HV4A 4XYDB 4GEDB 1NMIA 1E8EA 3HQ8A 1DVHA 3OA8B 4L3HA 1CIHA 2CA3B 3H1JD 5CIDB 3WC8A 1HCMA 1WEJF 1AKKA 5E79V 1DW2A 1CCHA 1S5LV 1L0LD 1U75B 3WFDC 3ZOXA 1KIBA 3SXTA 2CA4B 2L4DA 1F1CA 2PCBB 3ZCFA 5C0ZA 2PCCB 1I8PA 2ZBOA 4L1QA 2DVHA 3ZOOA 4LJIA 1RZ6A 2EXVA 5CIEB 3OA8A 5H2FV 4EICA 1A2SA 1H9YA 1GU2A 3ZIYA 4AX3A 1N15A 1N90A 1ZZHA 3L71D 1KV9A 3HQ6A 5AURA 1E29A 4QAOA 3ZOWA 2DGEA 1L9BC 1SQPD 3VNWA 2N18C 2B12B 1QKSA 4K3IA 3SJLA 3WFBC 3A0BV 3NBSA 2C8SA 4FB1A 1C75A 1I6DA 1KX7A 5CIGB 2MTAC 4AAMA 2FRCA 3KZIV 2IBZD 4NFGB 3ORVA 1AOQA 2B11B 1R0QA 1KYOW 1HJ3A 1LC1A 1YEAA 5CIFB 5KAFV 4PW9B 2V08A 4EIDA 3A0HV 3CYTI 2BH5X 1KB9D 3HQ9A 5KLIB
chains in the Genus database with same CATH superfamily
1CTJA 2ZZS1 3CXHW 2AIUA 1I54A 1HRCA 4L3GA 1N9CA 3SLEA 4FA5A 1CRYA 3D0WA 3WFCC 5KLVD 3OCDA 1U74B 1GJQA 1EB7A 2YQBA 4EIEA 1J3SA 4WQ9A 1YTCA 1S6VB 3CU4A 1CIEA 1CHIA 2AI5A 1IQCA 1QL4A 3M97X 5DJQB 1CYJA 1DW0A 1KYOD 2GC4D 1H1OA 2YIUB 3RN0A 1LMSA 4WQ8A 1CSUA 1HJ4A 2B10B 2C1UA 2N9JA 5EXQA 4FAVA 5GTIV 1SQXD 5DF5A 1CIGA 3CXHD 1QL3A 4YE1A 4AANA 5B6QA 1FHBA 4AAOA 1IRVA 1H32B 1M6ZA 3L74D 4N0KA 1MZ4A 2BGVX 5DFSA 4O1WA 1CXAA 1CORA 1H9XA 2ZONG 1CRJA 2BH4X 3X39A 1DIIC 4J20A 1CEDA 1C52A 2CE1A 2C2CA 1I55A 1HZUA 1CO6A 3VYMA 1GQ1A 1NTZD 4WQCA 4U3FD 1CHJA 2FWLA 1P84D 4WQAA 1VYDA 2FYNB 4JCGA 3O5CA 3HQ7A 2FYUD 1CTZA 155CA 1H32A 1ZRTD 2VHDA 4AALA 1W2LA 3PH2B 3RN1A 2C1VA 4FANA 1RZ5A 2BCCD 3O0RC 2CE0A 1H33B 2V07A 1LS9A 3RMZA 1CRCA 5KAIV 1CYCA 1NTMD 3MK7C 1FCDC 2N18B 1CSWA 3C2CA 1B7VA 1YCCA 1ETPA 4IL6V 3NWVA 1IRWA 1NMLA 1YIQA 1FI7A 2QJPB 1YNRA 1M60A 1CSVA 3L4MA 2D0SA 5CIBB 1CCRA 2PACA 4FA4A 2GB8B 1CIFA 1C6SA 2D0WA 3JBTB 1HROA 2QJYB 1FOCA 1H33A 3VRDA 5C9MA 2N3YA 1LFMA 1FJ0A 2OZ1B 2LIRA 1CC5A 4Q5PA 1CYIA 4XXLA 4MU8A 1QYZA 1IO3A 1K3GA 1CSXA 3H1KD 3WU2V 1SQQD 3O1YA 1DIQC 5B5EV 1KX2A 1K3HA 4WQEA 4UB6V 3L4OA 1HZVA 1IZL0 3SWSA 1JDLA 5TISV 1I8OA 1BL9A 451CA 1NTKD 1DW1A 1YEBA 1E2RA 3CX5W 2OZ1A 1QN2A 3DR0A 3H1HD 5CYTR 3ZOYA 4PD4D 5CICB 3WFEC 2YK3A 3H1LD 3NBTA 2BPBB 3TYIA 4DY9A 1C2RA 1M70A 1GDVA 1CNOA 1LC2A 2B0ZB 3RLMA 3O20A 1PPJD 2CXBA 5IY51 4WQ7A 4PWAA 4PJ0V 3TGUD 1CTYA 3H1ID 1SQBD 1W5CT 2N3BA 3L72D 2GC7D 2N9IA 1YICA 1PP9D 3A9FA 1SQVD 1COTA 5KKZB 1CXCA 1H31B 4FA1A 4KMGA 3PXSA 2MHMA 3CWBD 1I6EA 3CX5D 2B4ZA 1FI3A 5GTHV 4D6TD 1BGYD 2C1DB 4Y5RA 1AOFA 1F1FA 3L70D 2JQRA 1GIWA 4O1QA 4EIFA 2YCCA 3DMIA 2ZOOA 2BCNB 1H31A 1CRIA 1L0ND 5CIHB 4RSZA 1HJ5A 1MG3D 1C2NA 1BE3D 3L75D 2AXTV 1NIRA 1OCDA 1A56A 1RAPA 3MK7B 2C1DA 1NNOA 3OCDB 4GYDA 3BCCD 1N50A 2QJKB 2JTIB 4WQBA 1DW3A 1L9JC 1OAEA 1HH7A 1YFCA 2ZXYA 2ORLA 3PXTA 1C6OA 3CP5A 2GIWA 1WVEC 2C9XB 1CRHA 1A8CA 2A06D 1MG2D 1CRGA 4WQDA 1DVVA 3SVWA 3L73D 1C6RA 1CHHA 1NU1D 1RAQA 351CA 3WUIA 1I5TA 4P4QB 1DT1A 5DJQC 4UB8V 1KB0A 4V2KA 1GKSA 5B66V 1AYGA 3DP5A 1FI9A 4FA9A 4H0KA 2XTSB 1BCCD 4H0JA 1EZVD 2BLFB 2I8FA 2LITA 1C7MA 3PXWA 3ZBMA 2HV4A 4XYDB 4GEDB 1NMIA 1E8EA 3HQ8A 1DVHA 3OA8B 4L3HA 1CIHA 2CA3B 3H1JD 5CIDB 3WC8A 1HCMA 1WEJF 1AKKA 5E79V 1DW2A 1CCHA 1S5LV 1L0LD 1U75B 3WFDC 3ZOXA 1KIBA 3SXTA 2CA4B 2L4DA 1F1CA 2PCBB 3ZCFA 5C0ZA 2PCCB 1I8PA 2ZBOA 4L1QA 2DVHA 3ZOOA 4LJIA 1RZ6A 2EXVA 5CIEB 3OA8A 5H2FV 4EICA 1A2SA 1H9YA 1GU2A 3ZIYA 4AX3A 1N15A 1N90A 1ZZHA 3L71D 1KV9A 3HQ6A 5AURA 1E29A 4QAOA 3ZOWA 2DGEA 1L9BC 1SQPD 3VNWA 2N18C 2B12B 1QKSA 4K3IA 3SJLA 3WFBC 3A0BV 3NBSA 2C8SA 4FB1A 1C75A 1I6DA 1KX7A 5CIGB 2MTAC 4AAMA 2FRCA 3KZIV 2IBZD 4NFGB 3ORVA 1AOQA 2B11B 1R0QA 1KYOW 1HJ3A 1LC1A 1YEAA 5CIFB 5KAFV 4PW9B 2V08A 4EIDA 3A0HV 3CYTI 2BH5X 1KB9D 3HQ9A 5KLIB
chains in the Genus database with same CATH topology
1CTJA 2ZZS1 3CXHW 2AIUA 1I54A 1HRCA 4L3GA 1N9CA 3SLEA 4FA5A 1CRYA 3WFCC 5KLVD 3OCDA 1U74B 1GJQA 1EB7A 2YQBA 4EIEA 1J3SA 4WQ9A 1YTCA 1S6VB 3CU4A 1CIEA 1CHIA 2AI5A 1IQCA 1QL4A 3M97X 5DJQB 1CYJA 1DW0A 1KYOD 2GC4D 1H1OA 2YIUB 3RN0A 1LMSA 4WQ8A 1CSUA 1HJ4A 2B10B 2C1UA 2N9JA 5EXQA 4FAVA 5GTIV 1SQXD 5DF5A 1CIGA 3CXHD 1QL3A 4YE1A 4AANA 5B6QA 1FHBA 4AAOA 1IRVA 1H32B 1M6ZA 3L74D 4N0KA 1MZ4A 2BGVX 5DFSA 4O1WA 1CXAA 1CORA 1H9XA 2ZONG 1CRJA 2BH4X 3X39A 1DIIC 4J20A 1CEDA 1C52A 2CE1A 2C2CA 1I55A 1HZUA 1CO6A 3VYMA 1GQ1A 1NTZD 4WQCA 4U3FD 1CHJA 2FWLA 1P84D 4WQAA 1VYDA 2FYNB 4JCGA 3O5CA 3HQ7A 2FYUD 1CTZA 155CA 1H32A 1ZRTD 2VHDA 4AALA 1W2LA 3PH2B 3RN1A 2C1VA 4FANA 1RZ5A 2BCCD 3O0RC 2CE0A 1H33B 2V07A 1LS9A 3RMZA 1CRCA 5KAIV 1CYCA 1NTMD 3MK7C 1FCDC 2N18B 1CSWA 3C2CA 1B7VA 1YCCA 1ETPA 4IL6V 3NWVA 1IRWA 1NMLA 1YIQA 1FI7A 2QJPB 1YNRA 1M60A 1CSVA 3L4MA 2D0SA 5CIBB 1CCRA 2PACA 4FA4A 2GB8B 1CIFA 1C6SA 2D0WA 3JBTB 1HROA 2QJYB 1FOCA 1H33A 3VRDA 5C9MA 2N3YA 1LFMA 1FJ0A 2OZ1B 2LIRA 1CC5A 4Q5PA 1CYIA 4XXLA 4MU8A 1QYZA 1IO3A 1K3GA 1CSXA 3H1KD 3WU2V 1SQQD 3O1YA 1DIQC 5B5EV 1KX2A 1K3HA 4WQEA 4UB6V 3L4OA 1HZVA 1IZL0 3SWSA 1JDLA 5TISV 1I8OA 1BL9A 451CA 1NTKD 1DW1A 1YEBA 1E2RA 3CX5W 2OZ1A 1QN2A 3DR0A 3H1HD 5CYTR 3ZOYA 4PD4D 5CICB 3WFEC 2YK3A 3H1LD 3NBTA 2BPBB 3TYIA 4DY9A 1C2RA 1M70A 1GDVA 1CNOA 1LC2A 2B0ZB 3RLMA 3O20A 1PPJD 2CXBA 5IY51 4WQ7A 4PWAA 4PJ0V 3TGUD 1CTYA 3H1ID 1SQBD 1W5CT 2N3BA 3L72D 2GC7D 2N9IA 1YICA 1PP9D 3A9FA 1SQVD 1COTA 5KKZB 1CXCA 1H31B 4FA1A 4KMGA 3PXSA 2MHMA 3CWBD 1I6EA 3CX5D 2B4ZA 1FI3A 5GTHV 4D6TD 1BGYD 2C1DB 4Y5RA 1AOFA 1F1FA 3L70D 2JQRA 1GIWA 4O1QA 4EIFA 2YCCA 3DMIA 2ZOOA 2BCNB 1H31A 1CRIA 1L0ND 5CIHB 4RSZA 1HJ5A 1MG3D 1C2NA 1BE3D 3L75D 2AXTV 1NIRA 1OCDA 1A56A 1RAPA 3MK7B 2C1DA 1NNOA 3OCDB 4GYDA 3BCCD 1N50A 2QJKB 2JTIB 4WQBA 1DW3A 1L9JC 1OAEA 1HH7A 1YFCA 2ZXYA 2ORLA 3PXTA 1C6OA 3CP5A 2GIWA 1WVEC 2C9XB 1CRHA 1A8CA 2A06D 1MG2D 1CRGA 4WQDA 1DVVA 3SVWA 3L73D 1C6RA 1CHHA 1NU1D 1RAQA 351CA 3WUIA 1I5TA 4P4QB 1DT1A 5DJQC 4UB8V 1KB0A 4V2KA 1GKSA 5B66V 1AYGA 3DP5A 1FI9A 4FA9A 4H0KA 2XTSB 1BCCD 4H0JA 1EZVD 2BLFB 2I8FA 2LITA 1C7MA 3PXWA 3ZBMA 2HV4A 4XYDB 4GEDB 1NMIA 1E8EA 3HQ8A 1DVHA 3OA8B 4L3HA 1CIHA 2CA3B 3H1JD 5CIDB 3WC8A 1HCMA 1WEJF 1AKKA 5E79V 1DW2A 1CCHA 1S5LV 1L0LD 1U75B 3WFDC 3ZOXA 1KIBA 3SXTA 2CA4B 2L4DA 1F1CA 2PCBB 3ZCFA 5C0ZA 2PCCB 1I8PA 2ZBOA 4L1QA 2DVHA 3ZOOA 4LJIA 1RZ6A 2EXVA 5CIEB 3OA8A 5H2FV 4EICA 1A2SA 1H9YA 1GU2A 3ZIYA 4AX3A 1N15A 1N90A 1ZZHA 3L71D 1KV9A 3HQ6A 5AURA 1E29A 4QAOA 3ZOWA 2DGEA 1L9BC 1SQPD 3VNWA 2N18C 2B12B 1QKSA 4K3IA 3SJLA 3WFBC 3A0BV 3NBSA 2C8SA 4FB1A 1C75A 1I6DA 1KX7A 5CIGB 2MTAC 4AAMA 2FRCA 3KZIV 2IBZD 4NFGB 3ORVA 1AOQA 2B11B 1R0QA 1KYOW 1HJ3A 1LC1A 1YEAA 5CIFB 5KAFV 4PW9B 2V08A 4EIDA 3A0HV 3CYTI 2BH5X 1KB9D 3HQ9A 5KLIB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1CTJ A;  2ZZS 1;  3CXH W;  2AIU A;  1I54 A;  1HRC A;  4L3G A;  1N9C A;  3SLE A;  4FA5 A;  1CRY A;  3WFC C;  5KLV D;  3OCD A;  1U74 B;  1GJQ A;  1EB7 A;  2YQB A;  4EIE A;  1J3S A;  4WQ9 A;  1YTC A;  1S6V B;  3CU4 A;  1CIE A;  1CHI A;  2AI5 A;  1IQC A;  1QL4 A;  3M97 X;  5DJQ B;  1CYJ A;  1DW0 A;  1KYO D;  2GC4 D;  1H1O A;  2YIU B;  3RN0 A;  1LMS A;  4WQ8 A;  1CSU A;  1HJ4 A;  2B10 B;  2C1U A;  2N9J A;  5EXQ A;  4FAV A;  5GTI V;  1SQX D;  5DF5 A;  1CIG A;  3CXH D;  1QL3 A;  4YE1 A;  4AAN A;  5B6Q A;  1FHB A;  4AAO A;  1IRV A;  1H32 B;  1M6Z A;  3L74 D;  4N0K A;  1MZ4 A;  2BGV X;  5DFS A;  4O1W A;  1CXA A;  1COR A;  1H9X A;  2ZON G;  1CRJ A;  2BH4 X;  3X39 A;  1DII C;  4J20 A;  1CED A;  1C52 A;  2CE1 A;  2C2C A;  1I55 A;  1HZU A;  1CO6 A;  3VYM A;  1GQ1 A;  1NTZ D;  4WQC A;  4U3F D;  1CHJ A;  2FWL A;  1P84 D;  4WQA A;  1VYD A;  2FYN B;  4JCG A;  3O5C A;  3HQ7 A;  2FYU D;  1CTZ A;  155C A;  1H32 A;  1ZRT D;  2VHD A;  4AAL A;  1W2L A;  3PH2 B;  3RN1 A;  2C1V A;  4FAN A;  1RZ5 A;  2BCC D;  3O0R C;  2CE0 A;  1H33 B;  2V07 A;  1LS9 A;  3RMZ A;  1CRC A;  5KAI V;  1CYC A;  1NTM D;  3MK7 C;  1FCD C;  2N18 B;  1CSW A;  3C2C A;  1B7V A;  1YCC A;  1ETP A;  4IL6 V;  3NWV A;  1IRW A;  1NML A;  1YIQ A;  1FI7 A;  2QJP B;  1YNR A;  1M60 A;  1CSV A;  3L4M A;  2D0S A;  5CIB B;  1CCR A;  2PAC A;  4FA4 A;  2GB8 B;  1CIF A;  1C6S A;  2D0W A;  3JBT B;  1HRO A;  2QJY B;  1FOC A;  1H33 A;  3VRD A;  5C9M A;  2N3Y A;  1LFM A;  1FJ0 A;  2OZ1 B;  2LIR A;  1CC5 A;  4Q5P A;  1CYI A;  4XXL A;  4MU8 A;  1QYZ A;  1IO3 A;  1K3G A;  1CSX A;  3H1K D;  3WU2 V;  1SQQ D;  3O1Y A;  1DIQ C;  5B5E V;  1KX2 A;  1K3H A;  4WQE A;  4UB6 V;  3L4O A;  1HZV A;  1IZL 0;  3SWS A;  1JDL A;  5TIS V;  1I8O A;  1BL9 A;  451C A;  1NTK D;  1DW1 A;  1YEB A;  1E2R A;  3CX5 W;  2OZ1 A;  1QN2 A;  3DR0 A;  3H1H D;  5CYT R;  3ZOY A;  4PD4 D;  5CIC B;  3WFE C;  2YK3 A;  3H1L D;  3NBT A;  2BPB B;  3TYI A;  4DY9 A;  1C2R A;  1M70 A;  1GDV A;  1CNO A;  1LC2 A;  2B0Z B;  3RLM A;  3O20 A;  1PPJ D;  2CXB A;  5IY5 1;  4WQ7 A;  4PWA A;  4PJ0 V;  3TGU D;  1CTY A;  3H1I D;  1SQB D;  1W5C T;  2N3B A;  3L72 D;  2GC7 D;  2N9I A;  1YIC A;  1PP9 D;  3A9F A;  1SQV D;  1COT A;  5KKZ B;  1CXC A;  1H31 B;  4FA1 A;  4KMG A;  3PXS A;  2MHM A;  3CWB D;  1I6E A;  3CX5 D;  2B4Z A;  1FI3 A;  5GTH V;  4D6T D;  1BGY D;  2C1D B;  4Y5R A;  1AOF A;  1F1F A;  3L70 D;  2JQR A;  1GIW A;  4O1Q A;  4EIF A;  2YCC A;  3DMI A;  2ZOO A;  2BCN B;  1H31 A;  1CRI A;  1L0N D;  5CIH B;  4RSZ A;  1HJ5 A;  1MG3 D;  1C2N A;  1BE3 D;  3L75 D;  2AXT V;  1NIR A;  1OCD A;  1A56 A;  1RAP A;  3MK7 B;  2C1D A;  1NNO A;  3OCD B;  4GYD A;  3BCC D;  1N50 A;  2QJK B;  2JTI B;  4WQB A;  1DW3 A;  1L9J C;  1OAE A;  1HH7 A;  1YFC A;  2ZXY A;  2ORL A;  3PXT A;  1C6O A;  3CP5 A;  2GIW A;  1WVE C;  2C9X B;  1CRH A;  1A8C A;  2A06 D;  1MG2 D;  1CRG A;  4WQD A;  1DVV A;  3SVW A;  3L73 D;  1C6R A;  1CHH A;  1NU1 D;  1RAQ A;  351C A;  3WUI A;  1I5T A;  4P4Q B;  1DT1 A;  5DJQ C;  4UB8 V;  1KB0 A;  4V2K A;  1GKS A;  5B66 V;  1AYG A;  3DP5 A;  1FI9 A;  4FA9 A;  4H0K A;  2XTS B;  1BCC D;  4H0J A;  1EZV D;  2BLF B;  2I8F A;  2LIT A;  1C7M A;  3PXW A;  3ZBM A;  2HV4 A;  4XYD B;  4GED B;  1NMI A;  1E8E A;  3HQ8 A;  1DVH A;  3OA8 B;  4L3H A;  1CIH A;  2CA3 B;  3H1J D;  5CID B;  3WC8 A;  1HCM A;  1WEJ F;  1AKK A;  5E79 V;  1DW2 A;  1CCH A;  1S5L V;  1L0L D;  1U75 B;  3WFD C;  3ZOX A;  1KIB A;  3SXT A;  2CA4 B;  2L4D A;  1F1C A;  2PCB B;  3ZCF A;  5C0Z A;  2PCC B;  1I8P A;  2ZBO A;  4L1Q A;  2DVH A;  3ZOO A;  4LJI A;  1RZ6 A;  2EXV A;  5CIE B;  3OA8 A;  5H2F V;  4EIC A;  1A2S A;  1H9Y A;  1GU2 A;  3ZIY A;  4AX3 A;  1N15 A;  1N90 A;  1ZZH A;  3L71 D;  1KV9 A;  3HQ6 A;  5AUR A;  1E29 A;  4QAO A;  3ZOW A;  2DGE A;  1L9B C;  1SQP D;  3VNW A;  2N18 C;  2B12 B;  1QKS A;  4K3I A;  3SJL A;  3WFB C;  3A0B V;  3NBS A;  2C8S A;  4FB1 A;  1C75 A;  1I6D A;  1KX7 A;  5CIG B;  2MTA C;  4AAM A;  2FRC A;  3KZI V;  2IBZ D;  4NFG B;  3ORV A;  1AOQ A;  2B11 B;  1R0Q A;  1KYO W;  1HJ3 A;  1LC1 A;  1YEA A;  5CIF B;  5KAF V;  4PW9 B;  2V08 A;  4EID A;  3A0H V;  3CYT I;  2BH5 X;  1KB9 D;  3HQ9 A;  5KLI B; 
#chains in the Genus database with same CATH topology
 1CTJ A;  2ZZS 1;  3CXH W;  2AIU A;  1I54 A;  1HRC A;  4L3G A;  1N9C A;  3SLE A;  4FA5 A;  1CRY A;  3D0W A;  3WFC C;  5KLV D;  3OCD A;  1U74 B;  1GJQ A;  1EB7 A;  2YQB A;  4EIE A;  1J3S A;  4WQ9 A;  1YTC A;  1S6V B;  3CU4 A;  1CIE A;  1CHI A;  2AI5 A;  1IQC A;  1QL4 A;  3M97 X;  5DJQ B;  1CYJ A;  1DW0 A;  1KYO D;  2GC4 D;  1H1O A;  2YIU B;  3RN0 A;  1LMS A;  4WQ8 A;  1CSU A;  1HJ4 A;  2B10 B;  2C1U A;  2N9J A;  5EXQ A;  4FAV A;  5GTI V;  1SQX D;  5DF5 A;  1CIG A;  3CXH D;  1QL3 A;  4YE1 A;  4AAN A;  5B6Q A;  1FHB A;  4AAO A;  1IRV A;  1H32 B;  1M6Z A;  3L74 D;  4N0K A;  1MZ4 A;  2BGV X;  5DFS A;  4O1W A;  1CXA A;  1COR A;  1H9X A;  2ZON G;  1CRJ A;  2BH4 X;  3X39 A;  1DII C;  4J20 A;  1CED A;  1C52 A;  2CE1 A;  2C2C A;  1I55 A;  1HZU A;  1CO6 A;  3VYM A;  1GQ1 A;  1NTZ D;  4WQC A;  4U3F D;  1CHJ A;  2FWL A;  1P84 D;  4WQA A;  1VYD A;  2FYN B;  4JCG A;  3O5C A;  3HQ7 A;  2FYU D;  1CTZ A;  155C A;  1H32 A;  1ZRT D;  2VHD A;  4AAL A;  1W2L A;  3PH2 B;  3RN1 A;  2C1V A;  4FAN A;  1RZ5 A;  2BCC D;  3O0R C;  2CE0 A;  1H33 B;  2V07 A;  1LS9 A;  3RMZ A;  1CRC A;  5KAI V;  1CYC A;  1NTM D;  3MK7 C;  1FCD C;  2N18 B;  1CSW A;  3C2C A;  1B7V A;  1YCC A;  1ETP A;  4IL6 V;  3NWV A;  1IRW A;  1NML A;  1YIQ A;  1FI7 A;  2QJP B;  1YNR A;  1M60 A;  1CSV A;  3L4M A;  2D0S A;  5CIB B;  1CCR A;  2PAC A;  4FA4 A;  2GB8 B;  1CIF A;  1C6S A;  2D0W A;  3JBT B;  1HRO A;  2QJY B;  1FOC A;  1H33 A;  3VRD A;  5C9M A;  2N3Y A;  1LFM A;  1FJ0 A;  2OZ1 B;  2LIR A;  1CC5 A;  4Q5P A;  1CYI A;  4XXL A;  4MU8 A;  1QYZ A;  1IO3 A;  1K3G A;  1CSX A;  3H1K D;  3WU2 V;  1SQQ D;  3O1Y A;  1DIQ C;  5B5E V;  1KX2 A;  1K3H A;  4WQE A;  4UB6 V;  3L4O A;  1HZV A;  1IZL 0;  3SWS A;  1JDL A;  5TIS V;  1I8O A;  1BL9 A;  451C A;  1NTK D;  1DW1 A;  1YEB A;  1E2R A;  3CX5 W;  2OZ1 A;  1QN2 A;  3DR0 A;  3H1H D;  5CYT R;  3ZOY A;  4PD4 D;  5CIC B;  3WFE C;  2YK3 A;  3H1L D;  3NBT A;  2BPB B;  3TYI A;  4DY9 A;  1C2R A;  1M70 A;  1GDV A;  1CNO A;  1LC2 A;  2B0Z B;  3RLM A;  3O20 A;  1PPJ D;  2CXB A;  5IY5 1;  4WQ7 A;  4PWA A;  4PJ0 V;  3TGU D;  1CTY A;  3H1I D;  1SQB D;  1W5C T;  2N3B A;  3L72 D;  2GC7 D;  2N9I A;  1YIC A;  1PP9 D;  3A9F A;  1SQV D;  1COT A;  5KKZ B;  1CXC A;  1H31 B;  4FA1 A;  4KMG A;  3PXS A;  2MHM A;  3CWB D;  1I6E A;  3CX5 D;  2B4Z A;  1FI3 A;  5GTH V;  4D6T D;  1BGY D;  2C1D B;  4Y5R A;  1AOF A;  1F1F A;  3L70 D;  2JQR A;  1GIW A;  4O1Q A;  4EIF A;  2YCC A;  3DMI A;  2ZOO A;  2BCN B;  1H31 A;  1CRI A;  1L0N D;  5CIH B;  4RSZ A;  1HJ5 A;  1MG3 D;  1C2N A;  1BE3 D;  3L75 D;  2AXT V;  1NIR A;  1OCD A;  1A56 A;  1RAP A;  3MK7 B;  2C1D A;  1NNO A;  3OCD B;  4GYD A;  3BCC D;  1N50 A;  2QJK B;  2JTI B;  4WQB A;  1DW3 A;  1L9J C;  1OAE A;  1HH7 A;  1YFC A;  2ZXY A;  2ORL A;  3PXT A;  1C6O A;  3CP5 A;  2GIW A;  1WVE C;  2C9X B;  1CRH A;  1A8C A;  2A06 D;  1MG2 D;  1CRG A;  4WQD A;  1DVV A;  3SVW A;  3L73 D;  1C6R A;  1CHH A;  1NU1 D;  1RAQ A;  351C A;  3WUI A;  1I5T A;  4P4Q B;  1DT1 A;  5DJQ C;  4UB8 V;  1KB0 A;  4V2K A;  1GKS A;  5B66 V;  1AYG A;  3DP5 A;  1FI9 A;  4FA9 A;  4H0K A;  2XTS B;  1BCC D;  4H0J A;  1EZV D;  2BLF B;  2I8F A;  2LIT A;  1C7M A;  3PXW A;  3ZBM A;  2HV4 A;  4XYD B;  4GED B;  1NMI A;  1E8E A;  3HQ8 A;  1DVH A;  3OA8 B;  4L3H A;  1CIH A;  2CA3 B;  3H1J D;  5CID B;  3WC8 A;  1HCM A;  1WEJ F;  1AKK A;  5E79 V;  1DW2 A;  1CCH A;  1S5L V;  1L0L D;  1U75 B;  3WFD C;  3ZOX A;  1KIB A;  3SXT A;  2CA4 B;  2L4D A;  1F1C A;  2PCB B;  3ZCF A;  5C0Z A;  2PCC B;  1I8P A;  2ZBO A;  4L1Q A;  2DVH A;  3ZOO A;  4LJI A;  1RZ6 A;  2EXV A;  5CIE B;  3OA8 A;  5H2F V;  4EIC A;  1A2S A;  1H9Y A;  1GU2 A;  3ZIY A;  4AX3 A;  1N15 A;  1N90 A;  1ZZH A;  3L71 D;  1KV9 A;  3HQ6 A;  5AUR A;  1E29 A;  4QAO A;  3ZOW A;  2DGE A;  1L9B C;  1SQP D;  3VNW A;  2N18 C;  2B12 B;  1QKS A;  4K3I A;  3SJL A;  3WFB C;  3A0B V;  3NBS A;  2C8S A;  4FB1 A;  1C75 A;  1I6D A;  1KX7 A;  5CIG B;  2MTA C;  4AAM A;  2FRC A;  3KZI V;  2IBZ D;  4NFG B;  3ORV A;  1AOQ A;  2B11 B;  1R0Q A;  1KYO W;  1HJ3 A;  1LC1 A;  1YEA A;  5CIF B;  5KAF V;  4PW9 B;  2V08 A;  4EID A;  3A0H V;  3CYT I;  2BH5 X;  1KB9 D;  3HQ9 A;  5KLI B; 
#chains in the Genus database with same CATH homology
 1CTJ A;  2ZZS 1;  3CXH W;  2AIU A;  1I54 A;  1HRC A;  4L3G A;  1N9C A;  3SLE A;  4FA5 A;  1CRY A;  3WFC C;  5KLV D;  3OCD A;  1U74 B;  1GJQ A;  1EB7 A;  2YQB A;  4EIE A;  1J3S A;  4WQ9 A;  1YTC A;  1S6V B;  3CU4 A;  1CIE A;  1CHI A;  2AI5 A;  1IQC A;  1QL4 A;  3M97 X;  5DJQ B;  1CYJ A;  1DW0 A;  1KYO D;  2GC4 D;  1H1O A;  2YIU B;  3RN0 A;  1LMS A;  4WQ8 A;  1CSU A;  1HJ4 A;  2B10 B;  2C1U A;  2N9J A;  5EXQ A;  4FAV A;  5GTI V;  1SQX D;  5DF5 A;  1CIG A;  3CXH D;  1QL3 A;  4YE1 A;  4AAN A;  5B6Q A;  1FHB A;  4AAO A;  1IRV A;  1H32 B;  1M6Z A;  3L74 D;  4N0K A;  1MZ4 A;  2BGV X;  5DFS A;  4O1W A;  1CXA A;  1COR A;  1H9X A;  2ZON G;  1CRJ A;  2BH4 X;  3X39 A;  1DII C;  4J20 A;  1CED A;  1C52 A;  2CE1 A;  2C2C A;  1I55 A;  1HZU A;  1CO6 A;  3VYM A;  1GQ1 A;  1NTZ D;  4WQC A;  4U3F D;  1CHJ A;  2FWL A;  1P84 D;  4WQA A;  1VYD A;  2FYN B;  4JCG A;  3O5C A;  3HQ7 A;  2FYU D;  1CTZ A;  155C A;  1H32 A;  1ZRT D;  2VHD A;  4AAL A;  1W2L A;  3PH2 B;  3RN1 A;  2C1V A;  4FAN A;  1RZ5 A;  2BCC D;  3O0R C;  2CE0 A;  1H33 B;  2V07 A;  1LS9 A;  3RMZ A;  1CRC A;  5KAI V;  1CYC A;  1NTM D;  3MK7 C;  1FCD C;  2N18 B;  1CSW A;  3C2C A;  1B7V A;  1YCC A;  1ETP A;  4IL6 V;  3NWV A;  1IRW A;  1NML A;  1YIQ A;  1FI7 A;  2QJP B;  1YNR A;  1M60 A;  1CSV A;  3L4M A;  2D0S A;  5CIB B;  1CCR A;  2PAC A;  4FA4 A;  2GB8 B;  1CIF A;  1C6S A;  2D0W A;  3JBT B;  1HRO A;  2QJY B;  1FOC A;  1H33 A;  3VRD A;  5C9M A;  2N3Y A;  1LFM A;  1FJ0 A;  2OZ1 B;  2LIR A;  1CC5 A;  4Q5P A;  1CYI A;  4XXL A;  4MU8 A;  1QYZ A;  1IO3 A;  1K3G A;  1CSX A;  3H1K D;  3WU2 V;  1SQQ D;  3O1Y A;  1DIQ C;  5B5E V;  1KX2 A;  1K3H A;  4WQE A;  4UB6 V;  3L4O A;  1HZV A;  1IZL 0;  3SWS A;  1JDL A;  5TIS V;  1I8O A;  1BL9 A;  451C A;  1NTK D;  1DW1 A;  1YEB A;  1E2R A;  3CX5 W;  2OZ1 A;  1QN2 A;  3DR0 A;  3H1H D;  5CYT R;  3ZOY A;  4PD4 D;  5CIC B;  3WFE C;  2YK3 A;  3H1L D;  3NBT A;  2BPB B;  3TYI A;  4DY9 A;  1C2R A;  1M70 A;  1GDV A;  1CNO A;  1LC2 A;  2B0Z B;  3RLM A;  3O20 A;  1PPJ D;  2CXB A;  5IY5 1;  4WQ7 A;  4PWA A;  4PJ0 V;  3TGU D;  1CTY A;  3H1I D;  1SQB D;  1W5C T;  2N3B A;  3L72 D;  2GC7 D;  2N9I A;  1YIC A;  1PP9 D;  3A9F A;  1SQV D;  1COT A;  5KKZ B;  1CXC A;  1H31 B;  4FA1 A;  4KMG A;  3PXS A;  2MHM A;  3CWB D;  1I6E A;  3CX5 D;  2B4Z A;  1FI3 A;  5GTH V;  4D6T D;  1BGY D;  2C1D B;  4Y5R A;  1AOF A;  1F1F A;  3L70 D;  2JQR A;  1GIW A;  4O1Q A;  4EIF A;  2YCC A;  3DMI A;  2ZOO A;  2BCN B;  1H31 A;  1CRI A;  1L0N D;  5CIH B;  4RSZ A;  1HJ5 A;  1MG3 D;  1C2N A;  1BE3 D;  3L75 D;  2AXT V;  1NIR A;  1OCD A;  1A56 A;  1RAP A;  3MK7 B;  2C1D A;  1NNO A;  3OCD B;  4GYD A;  3BCC D;  1N50 A;  2QJK B;  2JTI B;  4WQB A;  1DW3 A;  1L9J C;  1OAE A;  1HH7 A;  1YFC A;  2ZXY A;  2ORL A;  3PXT A;  1C6O A;  3CP5 A;  2GIW A;  1WVE C;  2C9X B;  1CRH A;  1A8C A;  2A06 D;  1MG2 D;  1CRG A;  4WQD A;  1DVV A;  3SVW A;  3L73 D;  1C6R A;  1CHH A;  1NU1 D;  1RAQ A;  351C A;  3WUI A;  1I5T A;  4P4Q B;  1DT1 A;  5DJQ C;  4UB8 V;  1KB0 A;  4V2K A;  1GKS A;  5B66 V;  1AYG A;  3DP5 A;  1FI9 A;  4FA9 A;  4H0K A;  2XTS B;  1BCC D;  4H0J A;  1EZV D;  2BLF B;  2I8F A;  2LIT A;  1C7M A;  3PXW A;  3ZBM A;  2HV4 A;  4XYD B;  4GED B;  1NMI A;  1E8E A;  3HQ8 A;  1DVH A;  3OA8 B;  4L3H A;  1CIH A;  2CA3 B;  3H1J D;  5CID B;  3WC8 A;  1HCM A;  1WEJ F;  1AKK A;  5E79 V;  1DW2 A;  1CCH A;  1S5L V;  1L0L D;  1U75 B;  3WFD C;  3ZOX A;  1KIB A;  3SXT A;  2CA4 B;  2L4D A;  1F1C A;  2PCB B;  3ZCF A;  5C0Z A;  2PCC B;  1I8P A;  2ZBO A;  4L1Q A;  2DVH A;  3ZOO A;  4LJI A;  1RZ6 A;  2EXV A;  5CIE B;  3OA8 A;  5H2F V;  4EIC A;  1A2S A;  1H9Y A;  1GU2 A;  3ZIY A;  4AX3 A;  1N15 A;  1N90 A;  1ZZH A;  3L71 D;  1KV9 A;  3HQ6 A;  5AUR A;  1E29 A;  4QAO A;  3ZOW A;  2DGE A;  1L9B C;  1SQP D;  3VNW A;  2N18 C;  2B12 B;  1QKS A;  4K3I A;  3SJL A;  3WFB C;  3A0B V;  3NBS A;  2C8S A;  4FB1 A;  1C75 A;  1I6D A;  1KX7 A;  5CIG B;  2MTA C;  4AAM A;  2FRC A;  3KZI V;  2IBZ D;  4NFG B;  3ORV A;  1AOQ A;  2B11 B;  1R0Q A;  1KYO W;  1HJ3 A;  1LC1 A;  1YEA A;  5CIF B;  5KAF V;  4PW9 B;  2V08 A;  4EID A;  3A0H V;  3CYT I;  2BH5 X;  1KB9 D;  3HQ9 A;  5KLI B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...