1I8UA

Family 9 carbohydrate-binding module from thermotoga maritima xylanase 10a
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
189
structure length
189
Chain Sequence
MVATAKYGTPVIDGEIDEIWNTTEEIETKAVAMGSLDKNATAKVRVLWDENYLYVLAIVKDPVLNKDNSNPWEQDSVEIFIDENNHKTGYYEDDDAQFRVNYMNEQTFGTGGSPARFKTAVKLIEGGYIVEAAIKWKTIKPTPNTVIGFNIQVNDANEKGQRVGIISWSDPTNNSWRDPSKFGNLRLIK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structures of the family 9 carbohydrate-binding module from Thermotoga maritima xylanase 10A in native and ligand-bound forms.
pubmed doi rcsb
source organism Thermotoga maritima
molecule tags Hydrolase
molecule keywords ENDO-1,4-BETA-XYLANASE A
total genus 56
structure length 189
sequence length 189
ec nomenclature ec 3.2.1.8: Endo-1,4-beta-xylanase.
pdb deposition date 2001-03-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06452 CBM9_1 Carbohydrate family 9 binding domain-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1190 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 1i8uA00
4JPQA 1I82A 2IVFC 1I8AA 1ULVA 1UG9A 1I8UA
chains in the Genus database with same CATH superfamily
1NCCL 4XWGH 3HUJF 4NQDB 3MV11 4YHNB 1AD0B 5C6PB 5K9QG 5CCHE 3H3BC 1G9ML 1DVFB 3Q8EA 1IL1A 2BP0A 1DQMH 4KPHL 4OZ4B 2V3EA 4KHTH 4LCYA 4M9PA 5BQDA 3EOTL 4H8WC 4UQEA 4DGWC 4FXKC 1FNGA 1HHHA 1Q9KA 3EDKA 5D71H 3VXNB 2VM3A 4F5CA 3MACH 2P8LB 1G43A 4KK9D 4P5MA 5EG6C 4CILA 5AFAA 4FNSA 4RQQB 1KB9K 3H0TA 4XPHL 4JFED 4WWNA 4ZFFA 2JLLA 3P02A 4G7SB 5AB2A 1IBYA 2FECL 3NCBB 1JI2A 3UYPB 4NQUA 3FTXA 3L1GA 5CEYA 4NKMB 2Z93A 3WIFA 3S9DB 2OZNA 5D1QD 4X6CF 3B8SA 3L3DB 2M8XA 4GYBA 4UQ3B 4O02H 2DY2A 4XTRC 4QGTA 5D2LA 4EZJA 2BSEA 2PF6A 1ZVYA 2HKAA 4PJ5D 4IRSC 2DM3A 3CFEA 5HHNA 5IB1A 2W91A 1NEZB 1BYOA 1TF4A 3MOBL 1YYLH 2VDRB 4JDVA 5JPNB 3BI9X 3MV8B 5L7XH 1BA9A 1HCVA 1MN4A 1R3IH 4P5KB 5I2IB 3V0AC 3L4UA 4NQDD 2XYBA 2UXFA 3HLKA 2DQEH 3QI9C 1QASA 4OJEH 4Q56A 4WI7A 4TLUA 1I3RB 3C5XA 2LTQB 5E1GA 3RGVC 5FKPA 3T1WA 1CD1A 2TRYA 3NA9L 5GGSB 4Z7OF 4U4IA 1KBGH 5EBLB 1N5AA 2DQIL 2OP4L 4EJ1C 3WNMA 3RTQB 2HRLA 3QDJB 2QGCA 3WLBA 3A4AA 4RFOL 4BA0A 3VA6A 4AEHH 2XG4B 4FGMA 1FIEA 4BQ8A 3BD5A 3ZDYF 3OXSB 4WSKA 5CO1A 1SJHB 4WUKH 4J39A 3CPLB 3SGJA 3QCUL 3P9MA 2AK1L 2WW8A 4QHKI 4NNYB 3KG5A 2FX7L 4PRPA 1ZHKB 2QVMA 1LTXA 5AAMA 2I9TA 1LHZA 4U2YA 5CP7B 3GHBL 1HESA 5CU9A 1XB3A 3QUMH 2JLPA 4FQHB 4JFTA 1ZV9A 5G4MA 3QHFH 4ZOBA 5INDB 4R8WH 2BNRA 4EN3B 3GMPA 5J1TC 1RI8A 3KPNA 5IOPB 5I1KL 3G5WA 4XNDA 4GNKB 3VW3H 1CT8A 4XVUC 4UQIM 1NMAH 2PPFA 2V5MA 3D3VD 2NZ9C 3BAEH 1DL7H 4HJTA 3JT0A 4UM8B 4AQ8C 4PJDE 4TMPA 5EUKA 4GXVL 4ZZKA 4DETA 1JCVA 2I9LA 3PGDB 3KYKL 2ARWA 5HDWA 5DJ2B 4QCIA 4E9SA 1P1VA 2XTJC 3GRWL 3NUKA 1WDAA 4MXQC 2VKXA 2R23A 3HR5B 3O6LH 3O2VH 3FU7A 4UZUA 3STZB 1A7NH 2A7BA 3DA0A 3WMSA 4DOHB 4KH9A 4DPAX 4KZ0A 2MHAA 5ISZB 4LU5H 1HJBC 3UBXB 4XBPB 4LEOB 3MJ6A 5DRNB 2ITDA 4UDTB 4G5AA 4KQ4L 3UL4A 2RHEA 5IMMB 4F7PB 4Y9EA 5I0WA 1VGEH 2A1WL 3BE1H 3QDME 1RZKC 4YO0A 5DFVC 3ZZLA 4M48L 3PNWB 4NN7B 3S36X 4K73A 1DJGA 4EQ2A 1GGYA 3QORC 4GAJH 1K4CB 5DEGA 3AVEA 4UZSA 4L8CB 2HLFD 4YIQA 3SOBL 1UH3A 2G3ZA 3H1ZA 1QLFA 2N4IA 3QJOA 2NY7H 3FUIA 1IBDA 1BG1A 2WANA 1MRFH 1KJVA 1E5CA 1EQWA 1G7HB 4JQIA 4NO0B 3IDGA 4RGNE 3KPRA 1QLEB 4RISH 3UGXA 1ZGLM 4C4KT 4A55A 4APXA 1NA8A 3SGKC 1UM6H 1CXHA 1D5BB 5GGRY 3W11D 5E6UB 3TYFB 3GSWA 5EU4A 3Q6GH 5DUPL 3VO0A 2R0ZL 5I17A 4XP6H 1JF5A 3KPSB 3CQQA 4GSDH 32C2B 3SGEI 4HOZA 3HTLX 3WN5B 1AMYA 4U05A 4L8DA 1ADWA 3QPXL 5FYJL 2OTWA 15C8L 1UD5A 2EADA 4KXZI 5F7DB 2X12A 3G6JB 1YEEH 4IMKA 1QTYT 1ZSDB 2NY5C 3ATDA 3B9DA 2AQ3A 1SF5A 1H6UA 4DP8X 2KT6A 3F05A 5I8OH 3K1DA 3LN4B 4K3EL 4WTQA 1J7VR 4ORGB 2DDQL 4ELMB 3PL6A 3BH8A 3QJHB 1S2EA 4BFFA 2GTZA 4M5YH 4LDCA 2WXGA 3AZUA 2BW4A 1U6AL 3EG9A 3ECVA 4JN2B 3NJJA 1TZIB 2R0WL 1N4XH 3BGMA 4GS7B 1KJ2B 4KXCA 4HIEA 4UNIA 4PJEF 1TEFA 1HSAB 4XAWH 3O6FC 2N0KA 1SXZA 3D34A 3X11A 3S88L 1T7YA 4WFED 4DO4A 1OAQL 4JFYB 4NLAA 5HHOB 3KCPA 2L7JA 3B4NA 3MX0B 4B9KC 5I5MA 1T3FB 4IBSA 3G6JE 1XIWA 3R4DA 4U6XA 1WT5C 1OHZA 2OYLA 3HMXH 2QDVA 4MBOA 4P57B 2ZKXA 1N0XL 2FIKA 4LHUA 4WW1A 2B2XH 3QZBA 1HL8A 3G6DH 2AQRA 1A6AB 5DZLA 4M7ZC 3T2OA 1NAMH 3ARPA 3BGFB 4NQEB 4P5MB 4EI5A 4JFEA 4JZNA 3BT2H 5D1QC 1ETB1 4FD0A 4JFDE 4KAQH 5KTEL 5D7JD 4GAGH 3DTXB 1Q9WA 4DGIL 4CC4A 3QEUA 4HBCH 1NGXA 3BRGC 3FTWA 3RJOA 1L0YA 1KJMB 5T1KA 2CR3A 2W5PA 4XN4A 1JHLL 2FX9L 2FWOA 1ECZA 3SKOB 2VUYA 3FUEA 3TN0B 4L9DA 5KVMC 2CKBB 5I0XA 3S34L 1S9YA 1IBGL 1KG0B 4G42B 1SZNA 1BD2D 5TGBA 3VMNA 4DKEH 1MRDH 1XF3A 4GRLD 3MBWB 4X5XB 1CZ8H 2BP3A 4JY5H 4C56A 1LO0H 5I16A 2WUCL 3ARRA 2DBLH 3CFDB 3F6IA 4DZBA 3OQ3B 3O3DB 4JDEA 1TJGL 2D3NA 3ARGA 1IAOA 3QIWB 3L16A 3HE6A 3LV3A 4XX1G 4APQD 2FD6L 2P24B 3HRZC 2F7PA 3QJFB 4GMTL 2W95A 4PD4J 4NUJB 5A2IH 1OSPH 5J9PA 2CHNA 1IBFA 2ICWJ 2XIBA 3K6NA 4XX5A 2VDPB 5D7IE 2AZUA 2I24N 4RAHA 3U6RA 4AOFA 3JUZA 3MJ9H 2VJXA 5T1LD 2CG9X 1F11B 4BHUA 4BD4A 4I0KA 1JYXA 4AYEC 4J12A 2IANB 1DFBL 4Y4KB 5SV4A 2EICA 4YDLB 3SO5A 4U1MB 2NZ9D 3NFPB 2UY6A 4WHYH 2IQAA 1NJ9A 3GJFB 5I6OA 1KCUH 3NP4A 3PHQB 5FA3B 1GCFA 2FYYB 4WU7A 4Y4FB 4DERA 1KBKA 1BJMA 1CT8B 5E8EB 1BD2A 3IDMB 4AQAA 1WE5A 4BKLB 2YRLA 1YUKB 4J3BA 3ZE0E 4BH8B 4F7KA 2E7CA 2XNAB 5D7IB 2R27A 4TNFA 3DMMA 3L5IA 3QXDB 4MFHA 4M8QB 3WXWL 5HHVL 3GB7B 3NCEB 3QQ3A 4NC1C 1ZT1A 5DD5L 5IW3A 1KPRB 2PW2B 3PWUB 2ZUSA 2VERN 5GZOD 3JWOC 4UIMA 2H32B 4POZC 3FUDA 3IE4A 4PJCB 3VE0B 3BUYB 4JO3L 1YYMH 1JPGA 1XTLA 3PP3H 4LLQB 5DFVD 4MJ5A 4AJYV 2J72A 2BOLA 4Q74A 4HC1A 3ZMEA 2GI7A 5BZWB 5IIEB 3ATAA 4L8BB 1F0LA 1OTSD 2KKQA 5GS3A 3MLPA 5BRZE 4HZ1A 1AD0A 1FH5L 3NJIA 4FHBD 5CJXC 1I3UA 3Q01A 3IJSA 1JZ5A 1ZV2A 2FSEB 2OYPA 4MKMA 3AS1A 3TWCH 1XH3B 3QDMB 1H6TA 5G55A 3B83A 3HG1D 3SJVA 43C9A 2D03H 1JGVL 1KELL 1TQSA 1ZDQA 3MOQA 4K8RC 1N68A 3KPSD 1I1AD 2W65B 2F58H 1IM9A 5DO2D 1QHQA 4U1KA 2DYRB 1GS6X 1ZSHA 2MH4A 1LK3L 1H8SA 4MA1C 5J13B 4EZLA 4KRNA 1DCEA 5CCKL 2VZUA 2Z4TA 5CJ5A 2H6PA 3VD9A 3UTSA 2IAMA 4IBZA 1AD9B 1UH4A 2X9YA 3MLUH 4ZTOL 3NPZB 2GBUA 3B3IA 3GSNB 5JHDB 5F7EH 3OMAB 1KIRA 1G1KA 3TL5A 4PRAB 4Q6YA 1VJSA 4ZSOB 1W8NA 1E9PB 1DLFH 1QI4A 4HD5A 1RHHB 3ZKMC 3IU4L 3EJZC 4HUWA 4Z3TA 4N9GB 4NZDA 4GINA 1INEL 4FOMA 1EDHA 2AVFA 4FADA 1T4KA 3D2UA 3PL6C 3BKCH 25C8L 1W9XA 2C7UA 1SBSH 3F83A 2ZIDA 3QIUD 1ZSDA 5LG1A 5I1IL 3CXDH 3X17A 4PJAF 2VZVA 3GUTA 4QRSA 5AALA 4R2GD 3UO8B 4I4WA 4MBRA 4W6WB 5IMMA 1OD7A 3D52A 4PJHF 5CD5D 3RTQA 1IM9D 4IIQA 1XGQB 5C0BA 4PLJD 5CBAB 1HKFA 5IY5B 3RJQB 4P99A 2JKNA 1MCCA 1RZGA 4AMKL 1SDDA 2Q5BA 3FKUS 3ENEA 1S5IL 1TNNA 3HC3H 2BVEA 4G6JL 5HHOA 1P4BL 2A6DB 2K4WA 1F3DH 4XPAL 3GTNA 5LDSA 5IMOB 3VQMA 2JKRM 1QA9B 4F7EB 1G6RB 3DJSA 5F0JB 2CIIA 4UTBA 5A43C 1HTYA 1P5UC 1TQUA 2ILLA 5CZXC 4CW1A 2A83B 3BZEB 5DUBB 5CKAA 4N9OB 4EI5D 4TVPD 4PYHA 3RZCC 4W9JC 1ODUA 4GRLB 4YDMA 1RD6A 4Z78A 1MCHA 4GAAA 3KDMA 3WD5L 1Y6KR 3ZE0F 3B9KB 4S1RL 4D0DB 3FN3A 4LGPB 3LZPA 1KXTB 1CIDA 1P7QA 3LIZL 5ALCH 4ZUTB 5LGKA 4QWWD 4YOKA 5I1AB 1OV8A 3R0MA 5DJ2A 1Q8MA 1ODAA 5HDQL 3TN0A 3OD3A 1KFGA 3QAZC 3N6YA 2JCCF 2NYYD 1GJWA 2Y5EA 2RH0A 2NCEA 3HZKB 4AMXA 3LPGA 2EUXA 4ENZA 1JPTH 4DCQB 1DQQA 2C9XA 4G6ML 5D70H 4DNLA 2WKOF 2A74C 1CDIA 5J4MA 2HWZH 3V4PB 3VMOA 1J8HE 2BIHA 5DFAA 5TK2A 5DJ8B 2O26U 3TVMB 2QSQA 5F7YC 5I1GL 3C60A 3RZCA 4LDEB 3V0WH 4AM0B 3JWNG 5MENA 1WYJA 2N7BA 4ABVA 4S0HA 4PG2C 1ACXA 4ZS7H 2FO4A 3MGTB 4GO8A 5F21B 5KYNA 4LCIL 4PG9B 4I0PD 3MX0A 1NFIB 2B4CC 1P6AB 3FQRA 1XIWB 3VWKA 3U2IA 2PXYA 5KYWB 3REVA 4GAYB 3JVGA 3GXNA 3N43F 3Q1EA 1I4FA 2FIKB 4WW1B 5BRZD 1K2DA 4L9LB 1R3HB 3ZDXF 1SMOA 1BF5A 3DI2B 5F96H 2ADFL 2GVYA 4J28A 4JM4H 5E94A 4AC4A 1ZEAL 1Z3GL 1HI6A 4JFEB 1GZPB 4JZNB 1BFTA 1WFMA 1MFDL 4LLWB 3QWNA 3U7AA 2JK5A 5LGJB 1E4JA 1JPST 3PHQA 5FA3A 4LIQL 5EO1A 3IGFA 2YMTA 2F54A 1Z7JA 3OZ9H 4OKDA 3NH7H 2HJKB 5CN2A 1QBML 3SYCA 3OX8A 4K9EC 3U9UA 3V8OA 3IDYC 5GZOC 3IXTB 2CBTA 4EUPG 5I66B 4Y9BA 4MA7L 1Y6MR 2CKBH 5DYFA 4JJHA 4TTDC 4ZNEA 1IZJA 4HJGA 3JV0A 3QUYB 2CD0A 2NRDA 4M02A 1NCOA 3DGCR 4J3OH 4KJPD 4NN5B 2PCXA 4DZBB 3FTSA 1GZHC 4PJCA 2EACA 3QUXC 1X4ZA 3QG6B 3RLSA 3F7RA 4GJTB 4RMQA 3K46A 3WFHA 5LBSA 4CSPA 4EVNB 5I6XB 1NCCH 4LVHC 5ICZB 3OPUA 1HCFX 3V95A 5DRWB 3GK8L 2CO2A 4FLRA 3FRPA 2RCSH 1OT2A 1NKGA 2EDKA 3OXRB 1XH3A 4N2MA 4AI7A 4FQCL 1WH0A 3WEOA 3F58H 5J12C 3JZYA 3MJ9L 3QNXB 5CZVL 1B0IA 2E6PA 1EEUA 3BUDA 4R2GB 3MUGB 3PP3K 2ADYA 4L05A 2H8PB 4MNGA 1ONQA 2ZSVA 5ETUA 4GIAA 1LM8V 5JA8B 3WS3B 4WHCA 1ZPUA 2Y2TA 3RL2B 1VADB 4D2NA 4LXFA 4F7TB 1TZOA 5KANG 4ABQA 1EHXA 1VIWA 3F62A 3UYRH 5D7IA 1TCRB 3S5LB 3O9WA 2NPLX 2OMZB 2HYMA 4JREC 4X6CE 3HC2A 1ORSB 1QRNE 1A4AA 1U3JA 2OX5A 12E8H 2LV4A 3GSXA 4FN0A 4EQ3A 2ZCKL 4WQOA 1RZJL 3BVUA 4OD2B 3MRHB 4GSXA 4KKBD 1YN6B 2J5WA 5C09A 1MCOL 4PJ8A 4NRZB 3EYQD 3HE6B 2BCKB 3LV3B 1ZLWH 4NQCA 4RWYL 2X3BA 1J9TA 3IDIA 1O6SB 2IH1B 3HE7B 1QZNA 2ZOKA 4QHNA 3GSVA 5AVQB 1U8QB 3OMZA 5EUOB 2K7QA 1ULVA 3U0WH 3RAJL 2G30A 1A9BA 2ZONA 4ZUWB 3FC8A 5L2KE 2DJSA 1AHWA 2BP8B 1EO5A 3WXVH 5ADOH 3PJSB 1QRNB 4NAMA 4FAAB 1JVOA 4OCRH 5I1HH 4D9RE 3HI1B 5F9WB 4DKFL 4WFEE 4BV1A 4R4NC 2YD4A 3PHSA 1H3VA 4FTVD 1IGCH 5B3NA 1A6WL 2ZYSA 4PR5B 2VDRH 4HZLB 4L5FE 1S3KH 4KK5C 1LEIA 5C70A 4Y4HC 2X4NA 3HAEH 2KHAA 3I84A 5C0FB 1DBJL 5JOPD 4FKKA 2YQGA 1C1EH 3O6FA 3U7WH 2XT1B 3BPCB 1INQB 2AEIT 3NJHA 3O81A 1N6VA 2Y07L 3PF2A 2VR6A 3P2BA 1U8JB 4LE8A 4U1GC 4NKIL 1B0WA 3RHWK 2Z8SA 1VZGA 4IRJD 3UZQB 4BWWA 3MRIB 1DLFL 1N18A 1OY3B 1RJZA 4OCNC 4Y9FA 4ZDHB 3EOBA 3VI4F 1VESA 1J1XH 4PVNA 1T5XB 3NTCL 1KXTA 4D7BA 3CFBB 4J3XA 2VDKH 1M6OA 2HTLD 3GXUB 1FN4B 2DJMA 4FI8A 4LF3A 3PGCA 2G5RA 4NENA 4YQXL 1IU1A 2ZKHH 1FP5A 1ZVSB 4H1LB 4QNPE 4OBRA 1HX0A 2VB5A 5CP3A 1FFTB 4N8CL 4BRJA 3MUUA 2R83A 1I8KA 4RA0C 4UOZA 2YXMA 1CFTB 5JPMA 3WIHA 1GC1H 3QZWA 4ALAC 3IFNH 3HI6L 5D1XD 4W4OA 3GUTB 1A7OH 4HEMA 4MAYC 2OMNA 7PCYA 3ESVF 4RGND 4QHUB 1QABA 5DJ6B 1NGWA 3ZE2F 1T0PB 4DGVL 4DN4L 1S6NA 1TKWA 2QPEB 1OLLA 3CG8A 4HKXB 4JFXB 1O7VA 1NC4D 3WBDA 43C9B 1UFGA 3MRNB 3QCTH 1NGZA 1P4BH 2W65A 3S2CA 2DYPD 1ZE3H 2W92A 2A5UA 4NQXB 1IBZA 5CCJA 3QDMD 2KERA 4RX4A 2AQQA 4J3TA 3ABKB 2GI0A 2VERA 3D2TA 2N7SA 1GC1L 3NSDA 4J4PD 1XCWA 4X5WB 5IVNA 1L9MA 4YH6A 4WNSA 2DBJA 1DBKL 4Y0GA 2X05A 3QS3A 1M1XB 5J11B 1XEDA 5AKVA 5IM7A 4DP5X 3ZHKA 1E4KA 3BKYL 5TQ2L 4NPJA 3V52L 3UBFA 2W88A 3MRMB 2WYIA 1ANUA 1U8IA 2CK2A 4X6DA 3S35H 3CUPA 3V5DB 2VZSA 5BNXD 1LWRA 3QPXH 3VYOA 5HGBB 4XMUA 4YE4L 1YEDB 3MLRH 3A6CH 2WIIB 2MCAA 2ADIB 3BN9D 2C26A 4M6NH 1EO7A 1CF1A 4LQFL 4MAYA 4ZXBC 5JR1H 3E2HB 4DCQA 4HJGB 2YA0A 1NGYB 3ME0A 3SBPA 5B39G 1OP3K 3WE6B 4MMYB 1OAYH 1EXHA 3LVEA 2R4RH 2PO6B 2PNDA 4KDWA 4P9HH 4K9JA 5DJYA 3TO4C 1ZOXA 3QSKB 5DJXA 3WFHB 5HHOE 1QRND 2QSCH 1JPFA 1BMWA 3TNNA 3EYUL 1AKJD 2W59A 1Q0XL 2F9BT 3FFCB 5C07B 4H20L 1AE6L 3FRPB 3SKNB 3SDCC 4M03A 2YPVH 1QA9A 2AAAA 4FI6A 4FQQB 4OLZL 1RVFH 1BPVA 3CLWA 1XR8B 3Q3GB 2Y5TB 1J86A 3FOLB 4P0DA 1J9RA 4ZZFA 3ZHFA 2BFVL 3Q13A 3PE9A 4RMSA 4QT5B 1QLRB 3MR9B 2YO3A 1VFBB 1H6FA 3QJTB 1JZ3A 1CFSA 2YKKA 1ZS2A 3AY4A 1LLAA 3ARBB 2NY1B 2QSCL 2VIRA 3H9SD 1LDPH 3OZ9L 3H6JA 3MO1A 2OZ4L 4LMQI 4QY8B 3UIZA 4BK5C 2HG0A 1ZPLA 3C6LA 4ZUUB 5IBTH 3ULUC 1SHSA 2DKSA 4KMLB 3KNBB 1QFWL 4H0GA 2BDNH 3QJZA 2QFPA 4YDVA 4KKBC 4ZO6A 2X42A 4HKZA 5IW6B 1YA5A 5ACZA 4GXUN 3DHUA 2GJ6D 3GMLA 5BVPH 1J0IA 2BVQB 3QUYA 5CEZE 3SBWA 4XNBA 5FKPB 3SD5A 3ZXAC 3T4AA 4Q0XL 5FC9A 1PFOA 2J7LA 4PJ8D 5DRZA 3TOPA 2D0GA 3RNKB 2Z31C 1T7XA 2E8ZA 1I1AA 9PCYA 1T4WA 1EJ8A 3KPQB 1W8EA 5C0EA 5CZRA 4HU8A 3OAYH 2CO1A 3SSGA 4AEFA 3KLAB 2KMWA 4LCYB 1JYNA 1OPGH 3S88H 1CGUA 3OXSA 1Y7VA 2EXWC 5FUCE 3MGTA 2Z91B 1TQVA 3P9LB 5DGRA 1X3DA 5ICYA 3JTSA 3OXRA 2AGJL 2PYED 1CFBA 1LD9A 1C16B 3L3IA 4KK6D 3HPJB 3H0TB 1XL4A 1OE2A 3GMNB 5IFJA 3ZN6A 1RUPL 1OPOA 5GGQL 5GRJL 2UXTA 3SDXB 3VXUB 5E94B 1MW1A 2CRZA 2EVIA 2H8PA 5CINH 1N2RB 1LO4L 1YCSA 4OVUA 2EIBA 4KROC 5E4IA 5A6MA 2Y4SA 4XCFH 1SDYA 3BPCA 2OYKA 1RIVL 4FI7A 1PSKL 3FQTB 3IETA 3NCFB 4MNHA 2OR9H 2XA8L 3QHZL 2E7DA 3ISRA 2WLIB 1BZEA 1BQ5A 4JM2C 3EF7A 4WEBL 1IEHA 1G1YA 3S34H 1RQ5A 2BNQE 4YDKL 5E2WL 2JJSC 4MCNA 1L9QA 5J3HC 4PRIA 4PJAE 3JYCA 1T5XA 1CXKA 3P1VA 2J1YA 3I3BA 1U21A 3QIBB 1KUMA 2AJXH 2H1PL 2RALA 1JN6A 1BEYL 1FV1A 5D1XC 2J20A 2WO2B 1LO4H 3PWVB 4P06A 2HB0A 4PJ7B 4FKHA 4M61B 4AKOA 3HI5L 3OF6A 4KUCD 1K6QH 4C4BA 5JYLA 5GZNA 5C09B 1DQJA 3ZDZB 5LO7A 4MXWL 1DQTA 4Z0BL 3EO9L 5AB9A 4P8QA 2J8UB 5D2NB 4PBXA 5FHAH 3ULVL 2YRPA 3QFGA 1FAIH 4TVUA 3C2AL 5DZPA 3T8VA 1K4CA 4N0YL 2EUZA 4KTYA 5DJ6A 2YWYA 5HHVH 5E5RB 3WL9B 4XCNA 2IDUA 1TZHB 3GS0A 4QXGH 2E4FA 5FYKL 4AT6A 4QOKB 1G7PB 4K23L 5I73C 5I9QB 4AE1A 3H2PA 2J4WL 3MNVA 2JIXA 4YLBA 1A5FH 4PR5A 4N2KA 5TE6H 3I6GA 1NCTA 1ONQB 4LPYA 2GC7C 3U6XA 1WUZA 3TC9A 3DARA 3RUGF 4NEHB 3TBTA 1CL7L 1QYGL 4Z3GA 5KBDA 4LPUA 1NCGA 2FCBA 4Q4EA 5F9JB 1DUYB 3K72A 2Q3XA 1J5IA 1MHHA 4XO4A 4F9PA 1C5CH 1USZA 4XB7A 5B3SB 4XMTA 3SGKA 1FFOA 4FEIA 3OGCA 1Q1JL 2G5BA 4B9YA 2ZWYA 1S9VA 3N44F 1MJ8L 3JV6B 3UZQA 3RTQC 1BZ9A 1COBA 2FLBT 2OTWB 3A4EA 3MRIA 4PY8J 5DZJA 5C0RL 4IBQA 4R5XA 5DD1H 3OR7A 5F0MB 5KJ7E 3KBEA 1ORSA 3FU7B 1OP9A 2Z7WA 1JF1B 3QEGH 1ORQB 1XCTA 4YDJB 5L2JB 2WGNB 2XFXB 2P5EA 1TCMA 2O4EA 5C86A 2AJVL 4PJHE 4WI5A 4X80L 4ELMA 2WVVB 5CEXA 1YPZF 1N10A 2K8QA 3F01A 4RGOH 1HL9A 3MRGA 4NIYE 4ZTPL 3SPCA 2E9WA 2FEDC 1D6VL 1UXLA 4R97B 3ESUF 3MUJA 5D8JL 3QDGD 1ZIAA 4HUMB 1HSAA 3O3AA 1S7RB 2R0KL 1NQBA 2DMGA 4LOUC 2RTTA 1A9BB 2W9DL 4W93A 3TWCL 1NGWB 4YHKH 3L17A 4NFDA 4OZFB 1T3FA 1KBVA 1MFBH 1U8CA 2YS4A 1AKJA 2Y36H 5JHLA 4OV5B 3RE0A 2BW5A 4X5PA 3AB0C 1VGKB 2GG1A 5ESVA 3L5WB 3U79A 3LH9A 4AIEA 3FFCE 5C07E 3BQUB 4M1CC 2X1OA 5AW2B 3K6IA 4W1TA 3CFCH 1NWPA 3R06B 5K9JH 4TPRH 1P5UB 3RTLA 1JGDA 1PVHA 2FECI 3WKNA 5MEOA 3CX5J 4XNYH 4OFKA 32C2A 3AQZA 5JW4N 1VA9A 1NM9A 2YAPA 1UWFA 3U7YH 5DUML 2X41A 1IGTA 1RJZB 3H9SA 3BX7C 3VSUA 1Z5HA 1MH5A 1S9XB 4OZGA 4QJ3B 3QZLA 4D0BB 4KVCL 1YUHA 4H26B 2MQGA 5F8RC 4CU7A 4I0PB 5F1SA 4H1LA 5DD6B 1A65A 2KDYA 3DK2A 4Z7QB 3JWNC 5PCYA 1NDMA 4JVUA 2FT7A 3QUYD 3FPYA 1TZIA 4WWOA 4HQQH 3LH8A 4PJBB 1LMKA 2P5WE 3EO0B 5CIPH 5FYJD 1H3TA 4MJ6B 2UWEE 1FFRA 1OE1A 3HBPA 3SGJC 3ZL1A 3SHSA 1DBAH 3NESA 3AM8A 4NUJA 1I1AB 4P9HL 1I1YA 1HNGA 1BECA 1OSPL 3GMOB 2ESVB 4U6XB 3VYNA 4BFIA 5EF3A 5IV2A 1KBPA 4P23D 5AEAA 1IM3D 2Y7LA 1UUNA 4LOVA 4ES9A 4ZMQA 5KVDL 5I0VA 5I1CL 3BRDA 1WHOA 2L0DA 3X12B 2Q3ZA 1HXYA 4XGZB 1K8IB 1TMCB 5GRVK 2GABA 2X40A 4ZMTA 2OPCA 1JPTL 2FZ3B 2UY6B 2C3HA 4A67A 2B1AL 2Q7NA 3ML9A 3QEUB 4JFSA 5CF3A 3F64A 5CMAA 3IFOA 3BSHA 5F44A 2VW4A 3VXUE 2UWEB 3O8XD 4CADB 1P4IH 5IM7B 3QFJE 4UI2A 3QEHB 1VSCA 4FRWA 1U8KA 2QADD 2ESVE 3MV9E 4LLMB 3VU1A 3PHAA 3RVVD 3TH3T 4PWEA 3D0VB 4XAWL 2WYZA 1S9YB 1SXCA 2WZAA 1SHWA 3P73B 5ALCL 4AC2A 5L6YH 4ZQKB 3HG1A 5DC0A 4QHLA 5LXGH 2VZOA 3F6JA 1P53A 4R90L 5D7JB 4CMHB 5FECB 3ALWA 4BCXA 4GI9A 2CGRL 2JH2A 4HJJH 1D7BA 4N0UA 4PJFA 4UB0L 1AZVA 4PS8A 5JQ6H 4LQFH 1YPZE 2KZWA 2QPUA 1NBZB 1QRKA 3GMLB 2ZUXA 5HHMB 1AXTH 4ACTA 3O8XB 2MCMA 4GUPB 3OQRA 5C0GB 1QR4A 3L4VA 2AXHA 2ZXEB 3BUBA 3BESR 3AWGA 5EBWA 1MZYA 4DVRL 1UB6B 5DGQA 3DJTA 1ZTMA 4EXKA 3PLYA 4W9ZA 4NDMA 1CU4H 4N0RA 2FGWH 3UTQA 4PJGF 2QT6A 4U1IA 5DD0H 1Z1WA 1MFCL 4YUEL 2AK4E 1UH2A 4HFUH 1UHVA 3W9DB 1DP0A 1RZIB 3PV6B 3WLWC 1QW8A 4H25A 5J1AB 3GPEA 1ZKAA 3K6SA 5AVWB 2WBKA 4KKCC 4R84A 4UB0H 2XJKA 2F18A 4HK0B 5DVNA 1CJYA 1TJHH 1UB5A 3BOVA 5ANMB 3E8UH 3UAJD 1YEKH 1G7PA 4PHXA 1J05A 2BFVH 2ALWA 3V0FA 3IGKA 1NJ9B 2EDDA 3GJFA 1FGVH 4YSPA 4C83A 1C1EL 4Z7VA 3OKOA 1YEHL 2H6PB 2J43A 4HMEA 5IQOA 3MNDA 1PEWA 3UG3A 3BAIA 5CGYD 3S96B 3LRSA 1VPOL 2DD8L 3ARUA 2VN3A 2C34A 4JFPB 4Z77A 1T03H 4N3TA 3FZUC 4AM0Q 1GPOL 5EBMB 1MEXL 4YHIB 5IVOA 3A4DA 4WHDA 4WFGE 4PCKA 4XMLH 1N0LA 2Q20A 5ENWA 3STLB 3TFKC 4YHPA 4NGHL 4HVBA 1X5ZA 3NPSC 4NZJA 5AOKA 4A68A 4TTGA 4K8RH 2ZYIA 3GMMA 5KYXA 4YDVB 5GRXG 1CLOL 2BVOB 4G72B 4EDXA 4WV1B 2EC9U 3ZSTA 4P4RA 3DV6A 4ICXA 2XPGB 1HN1A 1OTUD 1PZ5B 2Y2WA 5F9AC 1GGCH 4KJYA 1A7BA 1XGZA 4XPFL 4EIGB 4IBLT 3NP3A 3MRCB 1AGEA 4NQED 1YN7B 3UTTE 4JPKL 2ADJB 1HXMB 1JWMA 2PR9A 4QXUH 4AYFB 2W1NA 3GNMH 3I6KB 5DJ0B 5K1NA 3OLEA 4HFWB 4BSWB 3QDMA 3CDFA 1FLRH 4XMLL 4NAQA 1DR9A 2V3FA 3V4VL 3VACA 4P2RB 4JG0H 4O2EA 4F5CE 3L3GB 2VGLM 1ASQA 2OK0L 4K3GA 3TCLA 1C7SA 1HE7A 5KSAC 5JHDD 1VKXA 4JKKA 4OD3L 4WEUD 3HS9A 2YC1A 3TBSA 5ISZD 1AQKL 1JDDA 2ZCKH 3WUZA 3SDXA 3UTSB 4XN9A 2VDRL 1R3KA 2G60L 4R4BA 1FRGL 3ARED 4V1DA 5IKCB 1NBQA 2YBRA 3WJJC 3QZNA 4XN1A 4NZRL 3MFGB 4Z78B 1MCNA 2ERJC 4NIKB 5TQ2H 5MEQA 2R1YB 4HWBH 3HZYA 1RHHA 4YDIH 4JB9L 1UURA 4HH9B 4OQTH 3EGXB 2G5BB 2WTPA 4JHVA 5EZOH 1SBBA 2HT2D 2QSTA 4N0FA 5MEND 1R5WA 1VFAB 2TAAA 1A6VH 3ULSB 1IEAB 1U92B 3CH1A 4JDTL 2AJXL 2EDOA 3BYTA 4M6NL 1P2CA 1UWGH 2CHXA 3IMRA 4HHWA 3RDJA 5KVGL 1HCYA 5DQJA 1GKOA 5A3ID 3OAUL 1S7SA 4K7PY 4RZCB 1QSFA 1MJUL 1BXAA 2QQLL 4OFVA 4X4YA 1EERB 2RQ8A 2BVPB 2P45B 3MNWA 2HWZL 4KI5C 1SJMA 4N90D 3DTUB 3T65A 4EI0A 1QO3B 3V79C 5GGTA 1F3DJ 4KO7A 3M45A 1JERA 3F7PC 3LZFH 1YJDL 3V5KA 2ZX6A 5I18H 2X89D 3O6KH 3WL9A 4ZS7L 3T6WA 1QPPA 3HUJA 4JFHE 1DEDA 1RK0A 2H7WA 3IRPX 4UYQA 3GS4A 5B1CA 4OZ4A 3IKKA 5K69A 4LSTH 1QFWM 2CM6A 3DIVA 1P6FA 2VN4A 1KTKE 1G5AA 1MRDL 1NCBL 2F74A 5IGXL 2BNRE 2V6HA 3T4YB 3Q2CA 1LO0L 1CFVL 4CSTA 1NBCA 3PFUA 4JM4L 3B1UA 5TPWH 3E9UA 3NIFB 2YAOA 2F1BA 4WFHE 1DVUA 1DBKH 2OJEB 4FTVA 2D2CC 2X4SB 3KBPA 3GMQB 4AGQA 4JM2A 1IC7H 3FO0L 1D5IH 3OB8A 1B6DA 2XZCH 5I6KA 4U1HA 4XRCA 5AVSB 1UGNA 4O2FB 1CVSC 5DI8A 4X42A 1HHGB 4I3SH 2FX8L 3T2PA 3MREB 4WW2B 4DW2L 3KR3L 4NQVA 4L4TB 3VFSB 3P0GB 3DIFA 2GJRA 2R2EB 1URLA 2Y06L 3O3EB 4KVNL 1KBBA 3QJRB 1S3RA 1E3ZA 3TBCA 2J71A 4I77H 4X4MA 5E5MA 4RMTA 3B43A 1P9MA 2PP8A 4DVBB 1BGXL 1NEPA 1F02I 4L0ZA 4Z3IA 4YR6A 3NJVA 4PS4H 4O5LH 1QNZL 1EK3A 2FB4H 1QI5A 4ZS6D 3AUWB 1ZK9A 3NVQA 4P3DB 1JWSB 2J88H 4C57C 4N2EA 4NQDE 4TL4A 4DN3H 2NR6D 3DOIA 4KXZH 1J11A 2Z64C 3SDDA 4PEEA 2W81C 1JHLH 1WC7A 2FX9H 4F15B 4JQVA 2VMFA 5C6TL 4PJDF 1KJ2H 1MVYA 4LSVH 4ODWA 4RFNB 3WKMH 2AXJA 5KS9E 1KLFA 3REVB 1BXXA 2XIDA 4A2LA 3DX8B 4KQ3L 5DD5H 4Z7QE 1QACA 4UANA 1V7NL 2VXTH 1LL1A 4R9HA 2P8LA 4DKEL 1N26A 4U1SA 5D1QE 5IP4A 1MAMH 3KW8A 2BWQA 1A6PA 2MKLC 1QNZH 1E4WH 4JPWL 4N8PA 4C83B 2VE6B 4AG4H 1E9QB 3OMNB 2FIRT 4IOSD 4FJYA 5E6YA 2HA1A 4HLZH 4FP8H 5GGRB 3ZL2A 3D39E 4OFYD 3SQOL 3HOGA 3D1MC 1Q0XH 4QRAA 1V7NH 4AZ8B 4JFWA 2PPAA 1UOVA 3D48R 5EUKB 1HYSC 2IVFC 2I60L 3QO1A 2D03L 1Q38A 5D1QB 3A6CL 3ZZSA 1NKRA 3G9VA 5F7FA 1FPTH 3MJGX 2NR6A 1I1CA 3PHOA 1YEFL 4I18C 4FQXD 4PY7B 4PPTA 4MLSA 4ZODA 1MIML 5BUAA 3QRGH 4WV1C 4A7SA 5F0PB 4XPBL 3Q48A 1RUML 2EIEA 5FCSH 1KPVB 1MHCA 1KDJA 2F68X 4OCXH 1E5BA 4YHLH 5ICZA 3C2AH 4L3CA 4LO9A 2R1WA 3HJEA 2ITDB 4TSCH 4LPWA 2OL3B 3I6KA 4YHOL 4WKZA 1IL1B 2BP0B 3WDIA 3W56A 1S7VA 2PWDA 2HN7B 3PJSA 4UT9H 1UWEL 1LO3L 1Q9KB 4P59H 1FVEA 1SNRA 1GZQB 3DGGB 1ML0A 4NHUA 2CPCA 5CJQH 2DWEB 1PNDA 3TCLB 4WUUE 1A7QL 2IFFL 3MXVL 4P4KC 5TE6L 5EU6D 4OIAA 1E6OL 5I8EB 5SX4H 3BKCL 1B3JA 1IIIA 2O30A 2VR3A 4XCCH 1E27B 1FE8H 1FGNH 4KFZC 5BUGA 3VFOB 4RGMC 3TBBA 4A6YH 1P7KA 2BSTB 5IEKB 3C5ZA 3EHBD 2Y07H 5LQBH 3BHBA 4A63A 1JGLH 3TIDB 3K71B 2IAMC 4XVJL 4JFPA 3I02B 3ILPA 2IAAC 4EN3D 2WCGA 2E5EA 2ID5A 3A22A 4M1DL 1AI1H 3DX9A 4BSJA 3MBED 1IC4L 5MP6L 4HH9A 2FLMA 2GHZA 5EEVA 3IMUA 3ABLB 2HFFA 3D5OF 5HPMA 3NIGB 4R90H 1GAFL 1FQ9C 2G75B 2VO5A 3TU6A 1DDHA 3PCYA 2BDNL 1F97A 5KS9F 4R7NA 5C0AD 5JPNC 1DJHA 2VDPH 2VR4A 2HT3D 3LQMA 4G9DA 1PMYA 2HTKC 3F12A 4GIOA 1TETL 3FO9B 4PJAA 4Q58C 3P4NA 4WY7L 4A7GF 3Q7JA 5C09E 3ZDZE 2EVGA 1A4KB 2QQNH 3K80A 2FEEI 4TUKH 5DR5H 2Z6FA 4NJAH 4MXWH 3L54A 3T77A 4F20A 3R7QA 3OVUB 3F7KA 3FT4A 1M71B 2UZYA 4YAQB 1FG9C 1NIBA 3QCVH 4JHWH 2LTQC 5AYUL 2APXA 1Q9OA 2XG4A 4P2RA 1O0VA 4Z95H 1EHNA 2OL3H 2X53A 1JPEA 3V5KB 4GBXA 2PCPB 3MZTA 1MREH 4N2IA 4QXGL 5FYKH 2HJFB 3X13B 5GRYA 4BZ1A 3IPEA 2LFGA 5TDNB 1RUPH 4WLCA 1QSED 5I75C 4PIRF 1TQCC 2GW5A 2VQ4A 1R75A 1ERNA 1WA1X 2WZ0A 4YN3A 3B9AA 3OLGA 3QUZC 3EO9H 3MZGB 3PGFH 5M94B 2ZE0A 5C7XL 3G3LA 3B34A 1I7UB 5KSBE 1H3XA 4ZDHA 4R26H 2FH8A 2F5BH 2WK2A 2O5YH 3EZ8A 3VFWB 3WELA 1YY8A 1N0LB 2DV6A 4NZFA 5EBGA 3S3CB 5LB1A 3I3DA 2XCMC 3GO1L 4RBPH 4X6EA 1AJ7L 4L4VB 1WZ1H 2G0KA 2YD2A 5DJDB 3VFPA 2QZQA 3DX7B 1P0SE 1NBVL 1IEAA 3NJGA 3MREA 2ADIA 1F41A 1YZZA 4AXWA 3SOTA 4LBEB 2V2TB 3GBNL 3QEGL 1W72L 5I82A 1IKFL 1AG0A 1XF3B 2X09A 3E1F1 3DETD 1RKRA 1CD1B 1SHXA 3O3EA 3UBXA 3WTWA 1F6FB 1TNMA 3RFZB 1N7MH 1OGAE 2QSVA 4Y2LA 1HXMA 1JWMB 3H3PL 3BUQA 4AQ8A 5FO8B 4GBXD 4ZYKB 3UACA 1QI3A 2CLVA 4FMKA 1YMMB 2YXVA 4H7VA 1EHLH 3IEAA 3NZUA 1Z5LB 4X7TB 1B2YA 3KYNB 4QRRE 1JI1A 4TSBH 4HCRH 1AJ7H 3U46B 3VXQA 1NOLA 3CD4A 1E7VA 1AZRA 4Z6AT 1YC8A 2F54E 3B2UD 4HV8A 5CXPA 1ZV5A 4M93B 4CU6A 4JGJA 4LSSL 4OB5L 3B3BA 4FQHA 4LL1A 1LXMA 2Y5TA 3AG2B 3MLVH 4YZFF 2VXQL 3B5TA 3GJFK 3IDGB 4LHUB 4ABWA 3DRQB 3GQFA 1J0YA 5F7AA 1BJ1H 1GHFH 4L8SA 1OGAB 2JV6A 3QXUA 2DQCL 1G9EA 4OZHA 4DEPC 2YXFA 1QYGH 2DW5A 1JVLA 2P80A 3CZUB 3ETBF 3T04D 2UZXA 3QEQA 4YSCA 1WZKA 1WTGT 3MRMA 3O9WC 1T2QH 2JIXD 1IGIH 1FZOB 2IPTL 5C0CB 4Y4FA 2CJUH 3WEAA 5L0QB 4ICWA 5DS1A 3S3DB 4AVKA 1ZLDA 1GXEA 3IMBA 1UA3A 2YAMA 2DH2A 2FL5B 2OCFD 1Z0MA 5CFHA 2XRAL 4U1HB 4X5RA 4XRCB 2XXCB 3WN5C 1YJDC 2XNAA 3IT8D 2XWRA 5GGRA 3QCUH 2F5AL 4IDJL 2EEAA 1JZ4A 4DK6A 3ZE2E 5I5JA 3OR6A 4M6MH 5CR1A 4PJIF 2WYHA 2P43B 3MOAL 3ME0B 3GZOA 3QHFL 2ZOOA 3ETTA 1FL3B 5T33L 2J44A 4UDTA 4QJ5B 3O41B 1CLYH 2EEDA 1BV8A 4X6FA 3MODL 3VXOB 5F1NA 2BVPA 2FB4L 2PO6A 4HG4K 3KLDA 1MFDH 4YR6B 3ULVE 1AFVH 4HUVB 4N26A 4HQQL 2R69A 4BK5A 4BKTC 2W9EL 4OGXH 5BV7H 1JPFB 5EA0L 3ATEA 2FO8A 4XP5L 5C0AB 3ZRFC 2GFBA 4P5TB 4M5ZH 3V6FA 3HA0A 5LJYH 3CN3A 3C6EA 4TN9A 4JPSA 2A9MH 5IEHB 4M1GH 1EAOA 4PUBL 1FO0A 2OCJA 1PLCA 3KPRB 5EZIH 4Y19B 2ITCA 3LNFA 3DLQR 4NHUB 5E8OB 4GW4A 1B90A 1A6AA 4XHJD 4DWHA 2D7NA 3T4YA 5GJTH 4JPWH 4NSKB 1MNUH 3LH2L 1AP2A 1DEEA 3VXME 1CL7I 2B1OA 3BN9C 1RIUH 1IGJA 2BY2A 3WIIL 1QBAA 4N0CD 4L3FA 5DMJB 1YO4A 3I6LE 1X5GA 3QWOA 5LLIC 5LWYH 1S4IA 2NY6D 4AIXA 4AQEB 2JTDA 3EF4A 4ZOEA 1JCKA 2YRZA 4XCYA 5DHEA 1UXWA 4PRDB 3DIDA 2WINB 1F45A 1B4RA 1Q4NX 2NT1A 1O5PA 3L48A 3IJ7A 4YHMH 2WLLA 1WIPA 2OMUB 5AQ0A 3TEYA 4ZW7A 5KG9A 3QO1B 4N2DA 1JN6B 1MRFL 5E1AB 1NSNL 3QJHA 1E4XH 5G4OA 5IJVA 2X6MA 4F1ZA 3MLWH 2CRMA 3F12B 3IAPA 4JFDA 1M1SA 5ES4B 2NNRA 3ZDXE 2XWCA 3SKMB 4LLQA 3B5HA 1QQDB 1AOHA 1XGUB 1KPVA 1BXVA 4BZ2A 1FIGH 4ESKA 3H3KA 5EEUA 1DANU 3ZX1A 3CDYA 3JBG7 4N8VA 3FT4B 4F7CA 3LEXA 3U9PH 4BDVA 3RVUD 3FBQA 3BKJH 1U3HA 3JUYA 4NP9A 4OD3H 4KI1A 5ID1A 2JE8A 2D3LA 4JREB 3BZ5A 4AUJA 1ZLVH 4QXWA 1GMIA 4RRPG 1A6TB 1MOEA 1YMMD 2IANA 3QUZD 2A4EA 2YGVA 1S8DB 2X28A 4O00A 2NY6B 2MNUA 2WVUA 4OCSH 1D9KD 4PJXA 2DQMA 5J89A 1ZK5A 1WEJL 2FJGB 4PM1A 3K7UA 3FQTA 3H53A 1AD9A 2IQ9L 2IWGA 4NC1E 2Z3FA 1AGBB 2QFRA 2WGXA 4GLRH 3LKQB 4Z7NB 4PS3A 5D2LF 4BKLA 4ODHL 3AMKA 4L0YA 2EYSA 2Z31D 4HGWA 2YN5A 5I0ZA 3SPJA 3TZVD 4BQCA 3GB7A 3QQ3B 1ZGLP 3H85A 3C5JA 4GI8A 5DD1L 4EDWH 2QGBA 4AIZA 1E5UI 1G0XA 2HFFB 1BVLA 3LJ3A 3V6ZA 5TK4A 4LKXA 2VLRB 4R5TA 1OP5K 3G5YB 3T1FB 2QEJA 2YQ2A 4X8JA 3WJMA 3KXFD 1MVUB 5C0JA 2I07A 3IE9A 1U0QA 4GEJA 4KKRA 2QLYA 3FB5A 3GIZH 3IDXH 2CO7B 2B5IC 5FO9A 4JKNA 1E5YA 1G9HA 2EIMB 1IO4C 1EAJA 4QRSB 2DD8H 4HEPG 1KIQB 4G7YH 3G5ZA 2VC2L 3VSVA 1CFNB 2FSEA 2OP4H 4PJ9D 5E8PA 1AQDB 1WS8A 4YK4C 3PWLA 4NQTA 2HFTA 2DIEA 2ZPKH 3CHOA 3D50A 2BFGA 3Q2VA 3OPZL 5D7SH 2E56A 4JL2A 5I0YA 1MFBL 1F4XH 3DGGA 1OAKL 2IH8A 3THMH 2XN9D 4H1LH 3U46A 1P5VA 1FZMA 2LLLA 4QRTA 3EYFA 1WIUA 1KB5A 1GH7A 4JM2D 4HYTB 4NBYB 1A6UL 2WP3T 2YAFA 4PJXF 4KV5F 3A67L 3SGDH 3CLEH 3MGOB 3ZHDA 5I76A 2Z31A 4Y2OB 4LNVA 4CW1B 2QHRH 1QSFE 4XWOD 3D8MA 4U1NA 4X98A 3GNML 3PV7A 4NX0A 4QKTA 1W6LA 4W9FC 3WYRA 4OM0H 5F9DC 4D9LH 3EOYG 4E9XA 1AGFA 3DX9B 4N8UA 1XAUA 1FWXA 1RZKH 3WJLA 1PG7L 1M7DB 4IK6A 2XN0A 4WW2C 2OK0H 5JOFB 1AXSB 5CD3B 5KBMA 3CFJA 4LVOC 1USQA 1VF5C 3MLZH 4KJWC 2IWFA 3MA7B 3A67H 3MRDB 4XNXH 3CCHA 5DMKB 1T20A 2WCPA 3BO8B 4MSWA 4ERSH 1GGBL 2OSXA 3BUYA 3CXDL 1QWNA 4QF1A 1IKFH 4RAUA 3OR6B 1KN4L 1A4KA 4NHCL 2ED6A 3PG2A 4G8EB 4L8BA 4XPTH 3RFZA 3VA2C 1FL3A 3FYIB 3T3PF 2VL5A 4I4WB 1R4XA 5FK9B 3VDCA 4U1JB 2A1WH 1HOEA 4XP6L 1D5XA 2J12B 1JXFA 1T5WB 2W38A 3LKSB 4X7TA 4WU5A 3V8CA 4BFIB 4W4OC 1JZ7A 4ZOAA 1KXHA 2EO7A 2FO4B 4KGLA 1OALA 4JFFE 2EP6A 4XGZA 2Y7OA 1NFAA 5CZKA 3FT9A 5DYOB 1TOXA 4OCYH 4JVPA 4PGEB 1HHKA 3L5HA 4GAYA 4NHCH 2D7PA 1TZGH 5MEOB 2IIJA 4PSPA 4L37B 4YL4A 1L9TA 3RL1B 4RRPM 4PP1C 4OJFH 2B1HL 5FS5A 5JHDA 4O02B 4X2UA 4QRRB 5FXCH 2IG2L 1QX1A 3WFDL 1R33A 2XBTA 4PBVC 5E6IA 4HPOH 3VFWA 5FF6B 3QNZB 2F54B 4R7LA 2VSMB 3FO0H 4NM8H 3WS6C 35C8H 5A2JH 4X99A 4KK8C 4JE0A 3UFIA 2XTJE 3BISA 1TZAA 5D1XA 3LQAC 2VMEA 2D9QB 3BLBA 4K71C 3L6FA 4H20H 1HZKA 2ODIA 3FJTA 2PPDA 2A77H 1H0DB 2X10A 2XV2A 5GSVB 2XSKA 4CSSA 1KGXA 1NCBH 1P6WA 1XQ4A 4GKSA 4LL9A 2ATPB 2GJ6B 4ZUVB 1U91A 2AJZA 1WBZB 4MJ6A 3UPRB 4BK8A 3MRHA 1PZUB 4R0LB 2G3NA 3TJEH 1M56B 4DGIH 1U6AH 2VSCA 3SE4C 5DFWH 4JX0A 4N87A 3LRMA 3FCUB 4UTAA 4AM0A 4L1LA 5T3ZE 3BJLA 3INUL 4HEME 5E2UH 4AQOA 4PJ5A 1KLGB 2GFBB 4P5TA 3PV6A 3ZYJA 4ZI8A 1FL6B 3ZE1E 3C5ZD 4BWUA 2AHIA 3AT0A 3L3OC 2CRYA 2P8PB 1G6RA 3GYRA 1LEGA 1UB5B 2DQJH 2NQDA 5ANMA 1URZA 2NW2A 4NWUH 1EFXD 2APTA 5TH2A 1HAWA 2P5PA 4AYDC 4CADA 4MNGB 4LPTA 4G1MA 3GI9H 5LGJA 3B37A 1GYUA 3Q1SH 1VLXA 4TULL 2GIXA 4GIPD 3WS3A 2CDFB 3CJJA 1MIEL 8FABA 3RVXD 3FQWB 2YPKB 5TDOA 1P4LA 4K8RD 3U1QA 3W0WE 1UVQB 3RURA 2EO1A 2GIMA 3DSNB 2DQJL 1ZS8B 5KWYC 1TCRA 2C4XA 3FCSB 1A25A 4LLVB 3V5HB 4PCSA 5CP3H 3TEXA 1DN2A 3BVNB 1KEMH 3LX9A 1JUFA 2PTTB 5FW6A 1QSVA 2XQBH 1Y6NR 5E1AA 2VLRE 3NK3A 2MNJB 4K5OA 2WUCH 5KVGE 3T1FA 3WE1A 4F37F 3OKDA 3U0PA 1KCSL 1A3QA 3QG6A 5HHQB 2XIIA 3HHSA 2A73A 4GKZB 2F7IA 4ZPVA 4DN3L 2VT0A 5DJAB 2G0LA 3NFSL 2RFXA 3IGAA 3P9MB 1KB3A 4N3UA 1AMXA 3BAWA 4H25B 1KJ2L 1ZXKA 4K9EH 2WMPB 3GXFA 5CLXA 5CP7A 1QWUA 2XC8A 1PEZA 2FJHA 3CFKA 4OLYH 4Y4KC 5CZVH 4BZ1L 4OKVA 5ID1B 3MRNA 4X4ME 4JRLA 2XQBL 2BZDA 1UT1A 2UZIL 3UTOA 5E8OA 3KPNB 4H8VA 1RV6X 1U3NA 1R3KB 5B1BB 3CDZA 3SDAC 1HI6B 3FK3A 4XC1L 4R2GC 1WAEA 4V1DB 5IKCA 4WCYH 2VDMH 3JWOH 4CJ1A 5C0FA 2AANA 1F1GA 2GTWB 3AFLA 1BM3L 4B9CA 2FUQA 2YMXL 4WWKA 5MEQB 4F2MB 1ADQH 4P49A 2IJ0C 3IKCA 4AEIL 1I9IH 3MBXL 4LSQL 3I3EA 3M1BB 1W6WA 2YKLH 4FFTA 2X1QA 3PJNA 4HF5H 4DPBX 3K8KA 5LDUA 1U93B 1E8XA 5EF0A 1JHTA 3IXTA 4LRNH 5KJRL 2VLJA 3TA3B 4P23B 1BVNT 4Z18A 2WLLB 3M6DA 5CSGA 1MCWM 4IOSA 1X7QB 1OCWH 3WAJA 4KJQC 4PAZA 4BA8A 4EI5C 4FNRA 1BLIA 1QG3A 2OTUB 1RUQL 5A2LH 3VWKC 1YEFH 3W9EA 2AJYL 3RFZC 3R0NA 4MSWB 1S7SB 3MI6A 5IK3A 3L3HB 2F53D 1V3MA 1I8KB 5IHZB 3HRZB 3SE8H 5JPMB 3MLUL 3W39B 2FWUA 3GSVB 2O6EA 4D8OA 3DNKA 4NO0D 5E8NA 1X5JA 2YD0A 2ZPKL 2H4EA 5DF0A 3BSZL 3BT0A 1B3IA 5HY9A 5I1HL 4JRFA 5DT1L 2NY2D 3M7FB 2BVTA 1K5NB 4MZRA 2F8IA 2IPUG 1A6UH 3BLKA 3ESPA 4MQ7A 4Y1AD 3CN4A 2Y6SC 1Z0NA 4A39A 4K94L 1FO0L 4Z7VE 2Y7NA 2IPUK 1G1OA 2E46A 3K2MC 1T66C 1TQCB 2COVD 2J8UE 3D0LA 5KANI 1DQDH 1YEWA 4D8PA 3DO7B 4F2FA 2AABL 2YA2A 2ZXGA 1BEXA 2FYVA 2OJEA 3RL2A 2XWTB 5IB5A 4QT5A 1R5IB 4JPKH 3FO2B 2F0CA 3CBKB 2X1XR 4KK8D 4L8DB 1XGRB 1L7IL 1KDIA 3HMXA 3NAAH 5EN2B 5LGHL 1I7TA 3CVBA 5FFLA 4N2BA 3ULSA 3ES6B 2VDKL 3QARA 4AMKH 3JTTA 4TQEH 1SEQL 4NQVB 4QY8A 3LDBB 1L6PA 2VLRA 1BBJB 4GP8B 2H9GA 4OF5A 3CHXA 5F89A 1QR1A 1Z9LA 3A6OA 4FZ8L 4TVPH 5FYKD 4QXVA 3X14A 1N5YL 1NUDA 2VMCA 1L0QA 3IDXL 2DEXX 2EIZA 4RMRA 5DSCB 3I50H 3IDIB 1UEMA 1Z9SB 4C58B 1H5BC 3EYSH 3MJ8A 3HBZA 4MMYA 2CO6B 4ZW5A 5I6MA 3UPRA 3DHPA 1NFDA 3OKEB 3MTXA 1OAXH 5EORH 4LT7A 3ZBMA 1YNTA 3AUVA 4KKAC 4NT6B 4P5TC 3C5ZC 4DN4H 1GTNA 1QRNA 1FBIL 4HKXA 4JB9H 5D72L 1V7MH 4DGYH 2DAVA 3K6FA 2MEJB 2OXHB 2XUWA 1DE4B 5SWZD 3X3FL 3GBNH 3WKPA 1YEEL 2XKUA 4FA6A 1MCEA 5B21A 3DBSA 1RPUA 5EULV 5LG6A 2VXQH 3ARGD 3SBRA 2EJ1A 2X7LB 3VFGH 4WNJA 5HHMD 2A9CA 1OAXL 2E7LA 3T09A 2LLGA 3H42L 2P5ED 2IG2H 3VGHA 1ZHLB 4LCWB 2AS5M 2WLJA 4NUGH 2UY7A 2R2HB 2VDLL 1S7TA 3Q5YA 2R0WH 3ASWA 5L0QC 4ZMAT 1UXSB 1I1RA 4JY4A 1RZFL 2Y7QB 2EECA 4NENB 3O0RH 4AYMC 5IMLB 4D9QD 1A14H 1RHFA 4KRLB 4GAFB 5JQHC 4OLWL 2Q6WA 5IJDC 1KTLA 2A74B 5IROD 1A1NA 5FYLD 5HVHB 3L1FA 4JFQB 2WUBH 3HAEA 5IQNA 1MI5A 1MG2C 3QWRD 4N2NA 2XQYG 3L81A 5IUSA 2BY3A 1FGVL 1Z3GH 2IBZY 2DQ6A 3FB6A 3CZEA 2VL5B 3NIDB 1PZSA 1G7LA 4X83A 3S8GB 2NNXA 4UT7L 3L3KB 3M86A 1IGIL 2IPTH 1T5WA 3LKSA 2FTAA 1EO8H 2CCVA 1XIWC 3CWGA 4MD5A 1NWOA 1GPOH 1E6JL 3P4LA 1SLXA 3B2VL 1XZWA 2NTFB 3CSFA 4J3SA 5JW4R 1DSFL 1QLEH 1CGVA 3KPRE 5DYOA 4NPYB 1W15A 2ZP0T 5F7LB 2H2PC 5JQ6L 1TZGL 1WWAX 1E6OH 4LIQE 3DPBA 3NJMA 1KT2A 5HVHC 1QFPA 1HEHC 1AXTL 2DMBA 3R19A 4J1UB 5ERWA 3D87B 3BMWA 2YN3A 5DQDH 3W3BA 1MCWW 2DWTA 1AO7A 3I02A 3QZMA 2FHBA 2CDEB 3KLSA 3E6FA 3QR0A 3WKQA 1FDLH 4IS6A 4G9FB 1IRAY 3FQ4A 1G9MC 3G04A 3LS4H 2VISA 1KYFA 3NJNA 4KZCA 4OIIH 3MV7D 2NY1C 2ARJB 3B2VH 5CEZH 4FZEH 4CDHA 5C3LD 2KLRA 3OJ2C 4NNXB 4ZUUA 1QFWH 5KVDE 2MPVA 4UOQA 2WQVA 4P2RD 1Q94A 1UVQA 1BZ9B 4ODTL 1G1CA 5GRUH 1BQHB 3D33A 3QEQD 5IWLC 2ZXWB 3TBYA 4DPRA 4Y4FD 5HPOA 4HETA 3WNLA 4MQTB 5IB2B 2VXTL 1D6EA 3BUIA 4ISVB 1LP9A 1JK9B 1FV1B 4BWTA 5BZWA 5T33H 1T80A 3RWIA 3WFEL 5TE7H 3SQBB 3TWYA 3QFDB 3TFBA 3LZNA 3IJSB 2EDWA 4LIQH 4DP7X 4I13B 1AIFA 1XL6A 5I6NA 2AITA 5HHQA 1OSYA 2K4AA 5EU5B 3DJ9A 3ZYZA 4JG9A 5HYJB 3LZQA 4I5BA 5JZ7D 2W07B 1A7RL 5A7BA 2XZZA 2ZNWA 4AY0A 4MKTA 3QRBA 4QLWA 1BVZA 1DDTA 3KYOA 4XCNB 3GXPA 5EZJA 5C08E 2PETA 3DRTB 2NW2B 5B8CC 2WWMD 4HULB 1D5ZA 2EQDA 5DWPA 4BH7B 1SMDA 3SDYH 1A1MA 1J18A 4PV8B 3ABZA 1U8NB 1XCXA 3VXUA 5AVZB 2IAMB 4I9WE 1O7DE 3UBGA 2GY5A 1TJGH 3ARDD 3UADA 4U3CA 3ILPB 4F3FA 3K72B 2UUDK 1DZ0A 2AC0A 1OKEA 2HUEA 5CLTA 4X4XA 2BLFA 5EEXA 4GO9A 1HYRC 2XWTA 3C8KB 4MNHB 2QMJA 3T2NH 3ULUF 5GS2H 1S9VB 1SVCP 5E8DH 4ONHB 4X6DE 4GFTB 3QYNA 1L7TL 3OZKA 3BWUC 2JJTA 5CHNB 5DVKA 5D2LE 1S9XA 2WVSA 4OZGB 1FORL 1NC2B 3MDJA 4GSQA 3NA4A 3U1PA 2BX5A 5LNDA 1M7UA 1NMCC 2PTTA 3B9EA 2VYRE 2NY3D 4NZUH 5JYMA 1RUQH 3PWVA 2FWLB 1V5JA 4KRMB 5AOZA 1D7DA 1NFKA 1K3ZA 3TBWA 1J8SA 4BZ2L 1IFGA 1VRSA 3VG0L 5BRPA 1PYWA 5KAQF 1FYTE 1NDMB 3UPCA 4PJCE 3NQKA 4RWYH 2P4AB 3QR1A 4TVSa 1PZAA 1XGQA 5C0BB 1Z5LA 4B27A 5BJTB 4PJBA 5C3IA 3QHTC 3QO0B 4IJ3B 4QYOA 4Y5VA 1AAJA 3PU7A 5F9WC 3EHBC 1N8OE 1NANH 5DURB 4HDIB 4XMPL 3EGDA 3QA3A 3QXTA 4K55A 4AJWA 5D7KD 2DLFH 2GKIA 4WEEA 1NTDA 4UQ2A 4E9YA 4RDQF 5ITFA 3MMEA 3QZOA 1ND0A 3ROLB 3SPIA 4WUKL 4H88H 4XNQB 4NNPL 2NSXA 2J2ZB 4IBTA 2AMUA 1FC1A 3ML8A 2Z7UA 2Z7ZA 4GP5B 4QRFA 1FYTB 3MRBB 3MRQB 4KO6A 1J10A 1P5UA 4J6RH 5C8JA 2VXSL 4FG2A 2FZ3A 4J27A 4ZO8A 2D2OA 5C0BE 3BWZA 3LCYA 4JFOB 4XVOA 1KY6A 4P05A 1R5IA 2IAND 2PCFA 2WLIA 4YBQC 3LSOA 3CQPA 3US9A 1RULH 2APFA 3IM1A 4JM2F 3VCLB 3TIEB 2XZAL 2DTSA 3K74B 1M2OA 3H9SB 4L4VA 3EJTA 5HHPA 4XPGH 3KLLA 4AYSA 43CAA 4PFEA 5KUKA 2WWNA 1KELH 3NGBC 2D4DA 4JY4B 4LVOB 4JRYE 3RDTA 1JFQL 5IMLA 3EXJA 4G7RB 1JV5B 5BZDA 5KYYA 4LHQB 4NCC2 2J5LB 5GS0L 2IADA 1DQJB 3MTRA 4MB3A 1UZ6F 4GUOA 4XBEL 2HSIA 5LBVA 4ADIA 3CDCA 1IEBA 2C3XA 1UQSB 3FT0A 4HIXL 1KWKA 4L48A 3QIWD 2D31B 2YBGA 3MYZA 4LCUB 4Y5YC 5F3BA 5I1LB 3L7EA 5KSVA 3O4OB 1HQ4A 3II2A 5GQBA 4P2QE 2JELH 1F13A 2X88A 1JK8A 3DYOA 4HUKB 5DD3L 4FNLH 3QG7L 4U3SA 4IDLA 1A47A 2R51A 2YAQA 4AT6B 5L2KA 5MHSE 3L3OB 2YEVB 5SWSB 4BHUI 2X4OA 4GAJL 2QKSA 5KSBF 1ZAGA 1FNGB 1HHHB 1ZTXE 3KVQA 1FO0B 1FSKC 1G7JA 3D7PA 3OKKA 2OXHA 1A3ZA 3KPLA 2CR6A 4OFIA 1X7SA 4N8CH 4W68A 2JJVA 2O6CA 4PJ8C 4HK0A 2DF3A 4WI4A 3TBTB 4ZFGH 1G7IB 3GUFA 3SEPA 1BFVH 5ILTL 1THAA 3NG5A 3OTTA 2X7LA 1X5XA 3QGVA 2NXZD 1F4HA 2IBGA 4NQSB 4U1GB 1HEZA 5C2BL 4PWIA 2X87A 4WEMB 5FDYA 2VLKB 3UMNA 5EC1B 4LCWA 3ULUE 3QORB 5AW7B 1H8OA 3LHPL 2FQDA 4EIUA 4GG6B 2NY4D 1ZJAA 1PG7X 1WA2X 3UO1H 3L9RB 5EPMA 1M05A 2D7OA 5E51A 5SWSE 4XXDB 3D07A 2ARJA 1QEWB 3CFEB 5HHNB 4G8FB 5IB1B 1BBJA 3ET9F 3KBFA 4LCIH 5IQ9A 4U33A 4XNXL 4TF4A 2WVVA 1NGPH 1RVFL 4P5KA 3ARBD 5CEXB 1SOXA 4PJFB 4PRNB 3B2UC 1JZ8A 4WV1A 1WFOA 2AEPL 3MLSL 3NIFE 4HC1H 1HEJC 2PO6C 1I3RA 1NDGA 3VD7A 1JNLL 4JVWA 2GSMB 2O5NA 3V6BR 2QQKL 3DUUB 1J8RA 3FNKA 4H8PA 1QATA 5AZEH 1BFOB 2F19H 3K5RA 1EH9A 1FCGA 4KKLD 2E7LC 4JRXD 4CBZA 2TSAA 3WTXA 2BNQA 2QZ5A 3BFWA 3SQOH 1JV2A 3O9WD 5C6WH 3D4GA 1A9VA 3DX2A 4S1SH 1EEZA 1SJHA 1VENA 3BSZA 3MV7E 3VRJA 5ECJE 2WN2A 4ZAKD 4QAWA 3F7VA 3H7LA 2FBOJ 1PNCA 1D7CA 2F5AH 4IRZA 5F1KC 1LILA 3TM6A 4B9GA 2BJMH 3FQXA 3REWB 2HVKB 3ERXA 5D7EA 1A1MB 4ZOCA 4M62L 5CMAB 1XT5A 1BQSA 1WA0X 2Z93B 2BZ7A 4DEWA 3KLKA 1ZVNA 4PRBB 4BZYA 1MZZA 4X8GA 4E0RB 1SOQA 4IS6B 5F6HI 2CJ3A 3E3QC 3AY4C 1OPGL 1XZ0A 3J07A 4OLUH 1ZT7A 3EGSA 2FBRA 3EDEA 3DI3B 3POCA 3OKLB 5DK3A 3ZUNC 2QR0B 3V6ZB 4BFJA 1X44A 1WICA 1AYRA 1E4HA 2IFGA 1PF3A 3BZDA 1MREL 1IBGH 1RZJC 3ATBA 5I1JL 2YD1A 4M4RA 2AJSL 2R8SH 1LP9B 1WITA 2ADFH 2ZOKB 1ZEAH 4ALAL 4M29A 1G7LB 1HSBB 1L5GA 1SLVA 3QFDA 3CIQA 3G5ZB 3DX6A 4N2GA 3G5XB 4HFUL 5T1JA 2B9AA 2Q2EB 4WHYG 2X6UA 3CVHB 5AZUA 2F5BL 4NZTL 4YHZH 3EFDH 5D7SL 1CD0A 3EOAA 5KBKA 3CQFA 3LPFA 3PQYE 4NNYA 4J7RA 2I9TB 1INEH 3QA3B 4OCLC 2X9XA 1WUNT 3BJ91 3GSQB 4DO5A 3WN6A 4B0MM 1VKXB 4YWGH 4XNUH 1HILA 3WV0A 1CI5A 3ROLA 1UZ8B 2MQ3A 1KCRL 4PV8A 4K3HA 2NY5L 2AABH 2Z8RA 4PB0L 2HH0L 3VD5A 4U7MA 3LRSB 3N41F 1T03L 4MCMA 1DVSA 3GXTA 2CCWA 3QI9A 1BM3H 2GIYA 4NOFA 1G6VK 4ETQB 1E67A 1TR7A 5DCCA 1MQ8A 3D69B 4UQCA 3P73A 3FSOA 3FCTB 1P4UA 5AYUH 1GJIA 1PZ3A 3LAFA 1BSIA 5GRUL 2VH5H 2NXYB 3GSRB 3CFJB 2NDFA 4EXPX 3GXMA 2AV7B 2CDGA 4N6RB 1KGCD 1MVUA 2BVOA 5FWRA 2QVIA 4JRWA 1NBZA 1DN0A 4I3RL 2V7NB 4FYRA 4QF1B 3CK0H 3VFSA 2LHAA 3D0AA 2BY0A 4H0IA 2ZOTA 3L5XH 3QZWB 4YFLI 3MLYL 5FO9B 3WNPA 1PAMA 1I7RA 4GUCA 2ENJA 3ZKXB 4G8GE 1NAKL 1QSFB 2ZAIA 3VD2A 4PQXA 5ICXA 2WTRA 1O5DT 4NDMB 1I9RL 1UQSA 2H1XA 2R9HD 5E08L 4LSQH 1AZNA 2NY0B 4P5SA 4FLSA 5AVVB 1W91A 5MI0C 2IALB 1PIGA 2FQEA 3AITA 1JK8B 5EUOE 5C0RH 4P48A 3BUPA 4FQIH 4JG1H 4K2UH 4I3GA 4W6YB 2Y24A 1IGYA 1M9SA 3A0OA 1EVUA 4I88A 4M4PA 1KZYA 3DX8A 4EN3A 1F3RB 1F86A 2FR4A 4JFUA 1GMEA 1AGDA 1F4WH 4U1SB 1NCIA 1WBXA 4X98B 2XWJA 3CU7A 4N2HA 1TTUA 1BIHA 2TSBA 3KL0A 4ZK8A 5HYQB 3H7BB 3NRPA 4UM8A 5EBMA 2P8MA 4BRVA 3LZRA 5C71A 1PCXA 1U8IB 4J23A 4ODBD 4RDQG 1EAPA 2R15A 4ATTA 5E8DL 5ELIA 3MYJB 2YFNA 3DPDA 5SX5H 1F58L 4Y5VC 2VLKE 2X6BA 1IM3B 5BPPA 2ITEA 3MRLA 3FU8A 5IWLA 4LRNL 5CHNA 2AEWA 3I9AA 1CFQA 3IDNA 3MRDA 3L6FB 2DJUA 5BXFA 1UOKA 2R23B 2EO9A 3G6JA 3QK0A 3VGDA 2Z4QB 2XKNA 1H0DA 2FX7H 4HCIA 5IHUH 2VMJA 3WNJA 1Q0YL 3APCA 5HYSA 2FATL 3CMOL 3O2WL 1BVNP 4ORGA 2N0MA 4NO3A 2X4RB 5DQJB 2IGFH 2Q2LA 3QVAA 1J0KA 1CO1A 1OZUA 2P44B 1GGTA 2WB1A 3C9NA 4NB7A 4Q6IC 1H8NA 3P69A 5EU3A 4LCUA 5F3BB 5KSVB 1K72A 3CZGA 3VH8G 3MRFB 3ZSSA 3PWPB 4XMKH 5DMGC 3TNNB 2P5WA 4U1LA 3MUHL 5J0BA 3KL5A 2DMKA 3D85A 4ZAKC 1DSFH 2FQFA 3NT0A 4YSOA 1MHPL 2MCPH 4TRPL 1TZ8A 2ISDA 3MMEB 1LEKB 4Y1SA 2CIKB 5HJBA 2F08A 4GFXA 2OFQA 5CILL 4ZMWA 3QQ9D 2QELA 3MV7B 5JIKA 5CJOL 3OLDA 4ZMPA 5FLVA 5IF0B 5E03A 1BAFL 1BOYA 1WHPA 3WDHA 5BS0B 4UTCA 4OGQC 4EUPH 1A21A 4G1MB 1CLYL 3IRZA 3TYFA 2C1PB 4L3EE 2R1YA 3DTXA 1IARB 1U30A 3REWA 5IVZB 1UTDA 4XPTL 5T1LB 2VE6A 5HI3D 3VFOA 5SWZB 3BE1L 1JMXA 1DBAL 2XY1A 3BZ4B 4F57L 2X1WL 4NKMA 1GKEA 2WWOA 3G6JF 1I3VA 4QLRA 1MFAL 1ZHBB 3QXAA 1SOKA 2I32A 4IGBA 4XXDA 1KZQA 3QIUC 1I9EA 3C09C 3RVTD 3UX9B 4MJHA 1YLBB 2WQ8A 2XQYK 3F2LA 1RK7A 4NLHA 3ZKNC 1UCTA 2JKTM 2G2NA 4UV7L 5AB1A 5B39B 2Y7SA 1FCCA 3RWEB 1JTOA 2QBWA 2JI2A 3VE0A 1JWUB 2AJ3A 1MPAH 2L7UA 3QWQB 2P3YA 1JWSA 4Y16D 2H0FA 3FPXA 3RWFA 1J1PL 2Y3NA 3DUUA 3FTUA 4NOBA 4ETYA 4FE9A 2AI0H 3HMWH 2DQGH 2OL3A 5JIPA 4YXKH 4KOBA 1WBYA 2ZSWB 4E5XB 2F7RA 3I74A 3ILDA 3MCLL 4AJ0A 2WMPA 1AHMA 5SWSA 1AG6A 3SJVB 1N59A 3F5WA 3FONA 4LHUG 2YQBA 1KBWA 2CHDA 4BZ1H 2ZNXA 2NZ1A 4OBSA 5B22A 5CZXD 3S97C 5E56A 3FT3A 2YOAA 1A3RH 3AT8A 1YEIL 2DWEA 3KPLB 1I31A 3A6BH 4QRUB 1BZDA 1A3LL 2WUBL 2R56H 2XXMB 1BQUA 4FQ1L 4KNTA 5AG8A 1L3WA 2OQJA 2BERA 3GSOB 3GKZA 4KTEL 1MW3A 3IFLH 5D5MF 2WTOA 4AG4L 4F2MA 5I24A 2X4SA 2YK1L 2YMXH 3MSPA 2A9BA 3GMPB 4XB3A 1P7KB 4FG6D 3UG4A 5IOPA 3BHBB 5CBEA 4WDIB 4Z7UA 4J3WA 4GG6A 1QKZH 4Z9KB 2YSSB 1CGSL 2WAHA 3L9RA 5CJXA 5AW5B 3IBEA 5BV7B 3ZTDC 4HUWB 4U0RC 1TQTA 5KOVC 2G75A 4G83A 1AACA 1KLUB 3HE7D 4LLUA 1N12A 3ROOA 3E8UL 4P07A 4M61A 3V4UH 2A2QT 4HSCX 4XPHH 5GS0D 2AEPH 3MLSH 5BVPL 2B59B 3APNA 2WC7A 3FSAA 5I15H 2HPTA 1VFOA 4PBWD 4AGLA 2J8UA 1EDQA 1UWXH 5B7EA 1UM5L 4X9FA 4TTDD 3US0A 5IJKA 2PW1A 3GIVB 2BMKB 1ZLSL 2R1WB 3HZ3A 3QS2A 3M46A 3Q05A 1W2KT 2AK4B 3CHPA 2BSDA 2JXMB 4ZYKA 3HZVB 1EA9C 1WFIA 3NYKA 5DD0L 4GS7C 5ACMA 2DLFL 1IGMH 3STBA 4BBWA 5CBAA 3FQUB 1Z9MA 5MHSD 1LWJA 2DQHL 3ZYIA 2AEQL 4HALA 4CKQA 4N2CA 3EAKA 3MNVB 1A7QH 2IFFH 4JY6A 1HH6B 4X9IA 4LVHB 1IM9B 5B4MD 4YDKH 1NOAA 4K7FA 4JHUA 5I26A 1HILB 4U3HA 1UJ3A 4U1MA 4Z0XA 3ZQXA 5GGQH 1VFUA 3D0LB 4EUPA 2VXSH 3BZEA 2KQMA 3WSQH 4Z8FH 1PU0A 4JKPL 3GBML 4KITB 2VJ0A 4PRBA 1Z9PA 2R29H 2CUAA 3V9EA 2X9ZA 1BQHG 1O7SA 4HS8H 2XZAH 4YUEH 2AQTA 5JHLH 4ZPTA 1XZ0B 3GS7A 4Y19D 3GSWB 2VLJB 3ILQC 5DWUL 3TA3A 3EJYC 3WIAA 3MYJA 5J12B 2P5EB 3B2MA 1MVFA 3EH4B 3TT3H 2WNXA 2JKSA 3OG4B 2WZPD 4P5RA 2WXOA 4PJCF 2VABA 3VB9A 5BXFB 4TLSA 2XACC 1N67A 2VDQB 3QJSB 1RY7B 4WY7H 1PIFA 4Y4KD 4HUXA 5HYSB 3VX1A 4L1SA 3WO4B 4N6QA 3TVMD 3GBDA 4KC3B 1QSEB 3LN4A 1F5WA 5EOQH 4G6AC 1NMAL 2VDML 4B9PA 1DQVA 2DQDL 4J3OD 1I9RH 3V4PA 4OJFL 5G5DB 1YMMA 5EORL 1TENA 4R4FH 4PU2A 4LOFA 1BP3B 2W9LA 3QG7H 3S5LG 4Z7VF 5F93C 4HUUA 3UTZB 1XD1A 3MVSA 3W37A 1CR9H 2OJ1A 1SDDB 2I26N 2PCPA 1G6RH 1U95A 1WVZA 2YOCA 3SE3A 1W72B 5TDPB 2X4QA 3WY4A 1V54B 3ASNB 2FBJH 5IFHL 2YHGA 2GCYA 4HOMA 4QOKE 1FG2A 5FA4B 4CVZA 2AZAA 1I4FB 1P84K 1UATA 2HFEB 5DHVA 1FYTD 1BEYH 4JZOA 3WTVA 5DUBA 4Y19A 1A8JH 3FQNA 4FQLL 5D5ME 3QWRA 4OZHB 3VWJC 2G9KA 2YFOA 3M8OH 1A9EB 1S7UA 4Z23A 1CICB 2AXFB 4EI5B 1I7TB 5FGBC 4GT7A 4JQVC 4KUZH 4W9GC 3DVGA 3MLXL 5T1LA 1EDYA 2EYRB 5FO2A 1AO7E 3MRPA 2BHZA 4HJUA 3KS0J 1JFHA 3MBEB 4N0YH 1IM3A 1MCQA 4J3UA 2FWOB 5DD6A 2H3KA 5CWSA 4KNQA 2OJZL 2MJWA 3SB3A 3UJTH 3FO9A 3EYQC 1DJZA 4WGWB 4UQ9A 4IHOB 3BQUC 1MW0A 3NEXA 4RRPA 3PFQA 2L7QA 3RWDA 4PJHB 3PREA 3P4MB 3TO4A 2H6UA 5DO8A 3T0XA 3QQNA 2W80C 2UZYB 4OT1H 1Y1DA 2EDYA 1PJ9A 2F15A 3SE9L 1A6ZB 1EZLA 2IO5A 2R0KH 2JELL 3RWFB 1LDSA 1C12A 1G4MA 2W9DH 2K6YA 4LSDA 1O6TA 5I28A 1JIBA 3U7YL 4EE2A 5DRWA 2QVFB 5AZ2H 2FX8H 4N8VB 4YE0A 5IVXF 1K8IA 4WAFA 4J3VA 2YLHA 4H4NA 2Y23A 1U3HB 4MHHI 3FONB 5IHLB 4WENB 4GPVA 4HPYL 1QUNA 3TXAA 3AXLB 2ROYA 3ELQA 1IBBA 1YYML 1RZQA 3WTSA 2EKJA 4Y2DD 5JLZB 1NICA 4HCGA 1BGXH 2MWCA 5F7UA 4MJIE 4IRJC 4N2LA 3HVDA 3NABL 4XTRD 3LZLA 2WJ7A 1X9QA 2B3RA 5C0CA 2OSLB 3D0VA 2DYPB 2V8MA 4IRSD 3UEQA 4EAEA 5CEZL 5JDJA 5IESH 5JTWA 2XWEA 5E8EA 4AQAB 4NYLA 5H94B 3HZMB 3DX7A 3LPOA 2WXHA 3LEVH 3VI3A 2R4SH 3SODB 4UOJA 1NCWH 4H0HB 1ZLEA 3SCMB 1AR2A 2B2XL 3LD8C 4MYPA 3WS6A 2FQGA 3QDJD 1BVLB 5I1CH 2K9FB 4KY1L 2X4RA 4UYPA 4YE4H 2PW2A 3UCQA 1EZSA 3CSYB 5DMIH 1WP6A 2IWEA 3SQBA 3T6VA 3CHSA 3VXOA 1TEGA 1UB6A 2OR8A 2XI9A 3P0VH 1CG9A 1CTOA 4HBCL 4KK9C 5HGDB 5IB4A 4HKBA 5DJ8A 1KGIA 2WQXA 2CO7A 2YUVA 5C7XH 3MRFA 4OD1H 4QHNB 4MJ5B 1XX9C 3T0BA 2XV3A 4CN1A 2P5WB 4U1LB 2N1TE 2KDGA 3ZMNA 5I74C 4FXGB 4QDGA 4X7SL 3V6FB 2WOYA 3QZPA 5J1AA 3VB8A 3LEXB 1HOCA 1ICTA 3MCYA 3OLIA 2GTQA 4KHTL 4DW2H 1BQLL 4QRPB 1GJUA 2ZUWA 4IBWA 3PWPD 1CDYA 2W0KA 4KQ3H 5DTFB 4WTXA 3LNIA 2ZUVA 2WBJB 3FH7A 2FO1A 2QPFA 1X5MA 1KEML 4JY6B 4XC3H 3ZO0A 3N42B 1W0VA 4ELME 3ECWA 4ZFGL 2HKFH 3HG5A 2C1OA 1OAJA 1D7FA 1QFUH 1REIA 4PS4L 2OSWA 4OIFA 1FZJA 4CAGA 4Z77B 5IROC 3RY4A 3K0WA 1YRKA 4OD1L 1KEGL 2PWFA 3N85L 6CGTA 2EXYC 1A7PH 5EDSA 3WOVA 2F19L 2R0ZH 3MJ7A 1VEMA 4X7SH 5CBEB 1SEBB 5E2VH 5H8DA 2H2SC 4XVSH 3TA3D 3UCRA 1KIRB 2J21A 1M2VA 3EOTH 1U58B 1IV8A 1ZLSH 3P54A 4HOXA 5IBLD 1WQVT 4FXLA 1ASPA 1HXKA 4FHKA 3CVCA 4UILL 3B7UX 5K59E 2P5EE 1OEZW 2UZIH 1JGUH 3VTMA 1MDAA 3ZTEA 2CHWA 2OS7A 4G6AD 3E3QE 4ODSH 5IJVB 5C0JB 3V0VB 3KPOB 2H6OA 2WXJA 5GRWA 3PJLA 2EYTA 3IRCA 3HMWL 1R1CA 3UBXI 5EUOA 1OQOA 2VOTA 3MFFB 3OKMB 3EYOB 1DQML 4RBPK 2H5UA 3BKJL 1BAGA 3EDJA 2ZX7A 5HGHB 3ZT7A 1AHWB 4OIIL 4Y8DC 3IDJA 3X3GH 4WUUB 2I60H 3FULA 4FMFA 4NGHH 3J2PA 4PRHA 3HHRB 5TTRA 3R8QA 5LXGL 4QI3A 1LMIA 4DFHA 1U8NA 1SGKA 3ZT5A 3QB7C 2CO3A 3LHAA 3GXDA 2ZSVB 1W16A 3N1PC 5KOMC 4PTTA 4JE4B 4X6DF 4BE6A 4G6KL 4L29A 4MXQD 5C0NC 4Y4FC 5DHVB 5J57B 4YXHL 4UM9A 2DOCA 3I2CL 4XPFH 5BO1L 4H2AA 3GMRA 1CN4A 5EIQA 1DVXA 5AAWA 2ICES 4S1QH 4TSCL 4OZHE 3ZDYB 1DL7L 3HHMA 3MJWA 3O6ML 4Y8AA 3BRFA 1MCFA 5ESQA 5MEPB 3VXSA 4R7DB 1XR9B 1JF6A 2P26A 4IEFB 5SV3A 3TPKA 5F9OL 2APBA 3L2MA 5F8QC 1MW2A 1J9QA 4LSRH 3TJHD 1YEDA 4A7UA 4CC1A 2MFNA 1MLCB 2KBGA 4HZAA 3CK0L 1OOAA 4RAUB 3T65B 2CH8A 4MDIB 1MNUL 3LH2H 5EUOF 4GKSB 2G60H 2JB6A 2IF7A 3GIVA 4NN5C 3ELAT 1IFRA 3FFDB 3FS9A 3NSXA 5FWQA 2D7QA 4AQ1B 3NFNB 4F1SA 1HDMB 1X5KA 3NH7L 5E08H 3ZDWA 2NY0C 5DD3H 2AAVA 3OJVC 5LGHH 1DFXA 4Q9RL 3ZZQA 3QUKB 1TITA 1GAFH 2CHZA 4GRMB 4I48B 2OL3L 4X4ZA 3AXHA 1CXEA 5CUSL 4V2BA 4ECNA 4P2CG 4YK4B 4YC2C 5D93C 1OWRM 3NZ8B 1OGSA 4Y88A 1G4RA 2ODHA 1AKPA 4S0TD 1G5GA 2X4NB 4JRYB 1IZKA 4OLWH 3Q6FA 2DLHA 2ZOLA 3RY6A 1I7ZB 1RZJH 3L5XL 4ZX6A 4JJ5A 1OWWA 2L3BA 2F53E 2Q0ZX 5DR5L 1NPNA 1U9KA 3E0GA 2ENQA 1AGBA 2NNFA 1M1XA 1XEUA 3NRFA 1ZVHA 4XH2B 4YFDB 5JHLL 2EC8A 3HB3D 4E41B 1M57B 4LLWA 1U41A 2OW6A 1UZ6E 3MCKA 2VIRB 2KPWA 1HIMH 4U2ZA 1OW0C 2FLRT 1AXSA 5FYLL 3C6LB 4OI9A 3H2QA 1V3KA 4WFFD 4MB1A 1XGPB 4TS6A 3RILA 5KYYB 2HVJA 5DZAA 3ZTJG 4C56E 4E68A 4KY2A 2NLJA 2LE9A 4TXVB 4B3VA 5D7LA 5EIIG 4CJ0A 4UQDA 2X2HA 3GHPA 2YGPA 4JHBA 3FB5B 3GM8A 5TJWK 4G82A 2V5YA 4APQC 4J5VA 1J0ZA 3CH8A 4ODVL 1DBBL 2XHNA 4WI6A 3FL7A 1J1PH 1R3JB 2V5RA 3AG3B 3OG6B 3BUTA 3U2SB 1UJ3C 2DL9A 1JNHB 3AS3A 3ZQWA 5CJ8A 2VTFA 2J1XA 3VXRD 2E9JA 2VLMD 3H9HB 4Y1AA 5EO9B 2NUTA 3WEXB 5E9DB 5DJXB 3KM2A 5FDWB 2YWZA 2K9UA 3EH1A 2BRRH 4HPHA