1I8UA

Family 9 carbohydrate-binding module from thermotoga maritima xylanase 10a
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
189
structure length
189
Chain Sequence
MVATAKYGTPVIDGEIDEIWNTTEEIETKAVAMGSLDKNATAKVRVLWDENYLYVLAIVKDPVLNKDNSNPWEQDSVEIFIDENNHKTGYYEDDDAQFRVNYMNEQTFGTGGSPARFKTAVKLIEGGYIVEAAIKWKTIKPTPNTVIGFNIQVNDANEKGQRVGIISWSDPTNNSWRDPSKFGNLRLIK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ENDO-1,4-BETA-XYLANASE A
publication title Crystal structures of the family 9 carbohydrate-binding module from Thermotoga maritima xylanase 10A in native and ligand-bound forms.
pubmed doi rcsb
source organism Thermotoga maritima
molecule tags Hydrolase
total genus 56
structure length 189
sequence length 189
ec nomenclature ec 3.2.1.8: Endo-1,4-beta-xylanase.
pdb deposition date 2001-03-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06452 CBM9_1 Carbohydrate family 9 binding domain-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1190 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 1i8uA00
1I82A 1UG9A 1I8AA 1I8UA 2IVFC 4JPQA 1ULVA
chains in the Genus database with same CATH superfamily
1KFGA 3CQQA 4B9IA 4LL1A 4NRZA 1E7UA 4IJ3C 2PYEB 3LEXA 1JWUA 1IBHA 1K4CA 2LAAA 2ZUUA 2D7TH 5INCA 1AANA 3QEQE 1QVOB 1R47A 4IGBA 1GXEA 2DBJA 4TTGA 4PHXA 4KI1A 2V7HA 3O2DA 8FABB 2Z4TA 2N7SA 1FNGB 5C0IB 3MCLL 1MHEA 1SDYA 3NIFE 4JPWL 4YEEA 1F4XL 3CUPB 3SQBB 3TT1H 2VAAA 3L2MA 1F2QA 1LP9E 1EEYA 5I8OL 3U30C 2WTRA 3BWUF 5D7KD 3IJSB 1SLXA 2BOBB 5F1IB 1UA6L 2AJXL 3Q1SH 2UX6A 4ZXBD 3WTXA 2XWBB 4IK7A 4XCEA 4F7CA 3OMZA 3P2TA 5ETUB 5CLWA 3CZEA 3FCGA 1PGRB 4KUZL 3DJ9A 4R4FL 2FWUA 1SDAB 1NBVL 4MASA 4KTDH 4TRPH 3RIFF 1YEIL 1FSKC 4LCWE 2EVFA 1J9SA 2A4EA 4F9PC 5GJTH 2KLRA 3QJSB 4N0UA 3QG7L 4JL2A 4ZX3A 1DQKA 5JHDE 3QPXL 4TTDC 4JG0H 4WU7B 2DM2A 2OTUB 3VB9A 3ES6A 1VAHA 4S1DD 4I48A 5C6TH 3DC0A 2QQLL 5A2IH 1J11A 4HAGA 3LRGA 4OTXL 2EC8A 2Y9RT 4P2OD 3POCA 2BVTA 5DFAA 1UOWA 1QSFB 4I18B 3MRMB 3UJIH 2R27A 1EK3A 4UT7H 4JPQA 5DMKA 2QT6A 4H13C 3G6DL 3LS4L 4R2GB 2FYYA 2J21A 3OF6A 1JTOA 1COBA 1FE8H 4NUGH 4QHUB 1LO2L 1THAA 3LEVH 2GW5A 2CBMA 3KPOA 4HXBL 4I3GA 4OIFA 4QOKD 4WWID 3S36L 5KSVA 1F4YH 3F5WB 1DBML 4NBYB 2EH8H 4K8RL 3OG4B 1TETH 1FVCA 4GKZA 4M6OL 5IBTH 1AGDB 4TNGA 1AGCA 4IGBC 1UB5B 3GB7B 1A1MA 3FRPG 1OPGH 4HGWB 1IAIM 2E46A 4PJHB 1OT1A 4X7CC 2OV0A 2AZAA 1YNTA 3QNFA 4ETQA 2NW2A 1KPRB 4UU9B 2FATH 1DBJH 4XP4L 4X5QA 12E8H 1HH6A 1S7UA 2P5EE 4IMLB 1MI5E 1MIEH 5A16A 1I7TB 5LNEA 4IOFD 3MREA 5I17B 3D52A 2NUPB 4FI8A 4IBUA 5EOCL 1UXMA 5FOBA 3EOBA 4KUCD 4JGJA 1LL1A 1FCGA 1KYFA 1M3JA 1AXTL 1U92B 4DGVL 2IIJA 1EEZA 2R1YB 4Z3HA 3APFA 3A4AA 4KROB 5AAWC 5JNYB 3CHRA 1QBBA 3LNHA 3MCKB 5KVEL 3MR9A 3PP4L 3NQKA 3SY0B 1KEMH 2PWFA 3GO1L 4HUUA 1N7MH 2ODIA 3DDFA 5JPNA 1S4IA 4CN4A 2Q6WB 1UASA 4KJYB 2PCPA 2A6JA 3K46A 3QAZB 4RAHA 2FO8A 4KOBA 2CQVA 2NLJA 3VRIB 3B5GA 2APTA 2YKLH 4GRMA 3F7YA 4RA0C 4HMEA 1XF3A 1FLRH 1C12A 1FLTX 4LSQL 3RB7A 2CGRH 2CH8A 1CDBA 2CM5A 1XFPA 4FI7A 3WIFB 2Y7LA 3UC0L 2YPLE 3D4GA 4MB3A 3OMNB 3K2IA 3KYNB 4JPSA 3GLDA 4N8PA 5TDOA 1OQOA 4BFEA 4CW1B 4Q74A 3T6XA 1S7TA 4I9WE 1INEL 1QI3A 4NFBA 5DRXB 2NY7H 4XN1A 3PPSA 4FLHA 3QJVB 4GAFB 1QSVA 4P2CG 3SBPA 1I75A 1PZDA 3NCWA 3OAZH 4MJIA 4ZOCA 4KZEH 1HHKB 5E8NA 2K4AA 3FDWA 3MV9A 4XMTA 2DWSA 3VGGA 3VXUE 4YHOH 5FGCE 3Q1EA 1QO3B 2C7UA 1FVEA 1LK2B 2HXAA 3NJMA 5T1MB 5L2KE 3FF7A 3RU8L 2Z93B 5ESAA 4NAJA 4JHBA 4N9OB 5I8KH 4OD1L 2CIKB 2J88L 2PTUA 1P2CA 2D3JA 3IGAA 1WD8A 5ECJE 3RI5K 1CFQB 4NZDA 2CCVA 4EXKA 2EEFA 3FQNA 4QY8A 2L3BA 2WLIB 1EUTA 1KEGL 1J05B 2ZUWA 2DKUA 3QJQB 3OMIB 4H8WL 4MNHA 3WS3B 5IT2H 1FNEA 2ADGA 3FTGB 4ADGA 1Q0XH 5L4MA 1IGTB 1PLGL 1TVHA 3WFZA 3X1FA 2X42A 3UX9B 1W72A 3E3QC 1NC4B 1HKLH 5JPNC 2G3NA 3MROB 1GTNA 1I8LC 1V7MH 3ECBA 4NO0B 4XHQA 1H3TA 2H0FA 5DVOA 5AKSA 3FQRA 2HTLD 4HHAB 3VCLB 3J27A 3M8OL 3RGVB 2WNXA 5GS1B 4JG5A 4Y9BA 3NACL 3K71A 1AZCA 2A3TA 2I9LB 4EXPX 1WJ3A 5E5MA 3L3IA 3SE3A 1KULA 1F42A 3KXFE 3RNKA 3CPLB 4X50A 4HH9A 2I24N 3ULUE 4JCLA 4O5LH 3D4ZA 5FM4A 2J6EL 3FCSB 3BGFB 4DZBB 3QR2A 1JPST 3PIQB 5IZ7A 4HJEA 2F8VA 3GLAA 3MRDA 4X80L 3UBXB 1CDUA 4N2LA 1BVNT 2BC4B 2BNQB 5EZLA 1Q9WB 4XI5C 2CDFB 5JO5B 1CQYA 2FBOJ 5JHAA 1NIBA 2IDUA 1TIUA 5ISZA 3ZR5A 3VD1A 4G42B 5AW8B 2HJLB 1DP0A 2QVKA 1CF1A 2E4FA 2FWOA 1BLNA 4WK0B 3GRBA 2A77H 1P1ZA 1QX1A 3HZYA 4WJKB 1RJZA 4UTBL 4ONFL 3EYSH 2N7AA 1MFUA 3L95B 4ZQTA 5INDB 3WJMB 1WBXB 5ADOH 4FFTA 3BE1L 4L0PB 2YXMA 1NGQH 4F92B 3TIDB 4XBEH 5A2CA 5KYWA 1E5AA 5DMGD 4JN2B 3W9DB 1M4KA 1BQSA 2Q3ZA 5I26A 5AOKA 3ZDZF 3BJLA 4PCKA 2ZYRA 4DEPC 4X4XB 1X7TA 1MCOL 4CDHA 3PYCA 4Z3JA 1WS7A 3SKJL 4R6UA 5IVOA 4JRYE 3T3PF 4U31A 1GC1H 3T04D 2VLRD 1I7UB 3GMMB 4OCSL 3PGCB 4GAJH 4M7LT 4RRPM 1C08B 1KWGA 3WTWA 1QR1A 1KMGA 4G5ZL 4JB9H 2GK0A 1UT9A 5J13C 5HBBA 1G7HA 4JPKL 3B2VL 4FXGC 3BSZA 2CA3A 4LGRB 1RJLB 4Q56A 3IKCA 4E9XA 2BOCB 3V4LA 1JNLH 3HVNA 3FRPA 2YA2A 4IHBA 1E5UI 3TYGH 3FU7A 3DWTA 3MLWL 4PWGA 3GM8A 5C7XH 2XQYA 3MV7D 5KVGE 3MBEA 3FQWA 3SE3C 5DD6B 5D72H 3BZDA 2FL5A 2NZIA 5IVZA 4HU2A 2F74A 3BKML 1TDQA 3ULAB 5T3ZL 2XETA 1S2EA 4PJBE 2IH3B 1QLEB 1CURA 3ASNB 1YECH 2G9HA 3KPRD 1BD2D 1MFEL 5C0CD 4P5TD 1LHZA 1EDQA 5C71A 2FSDA 1KIQB 3DX8A 3BJ91 1MEXH 3DGGB 5LWYH 3BP7A 4L37A 1JZ5A 1B2WH 4NI3A 3KW7A 2QV2A 4FMVA 1JL8A 3IJEB 1XBRA 4NN7C 5HJDA 3FN0H 5HHPA 5C70A 1C16B 2EDWA 5F8QC 1GH7A 1SJEA 2R0LH 4L9DA 3ZL4L 5IOPA 4MGXA 1GMIA 1BQHB 2YMOA 3T09A 2Z0UA 5SWZB 2PYED 1PX8A 6FABH 1O9WA 3P2BA 2HVKB 4P57B 3ZKSD 4A2GA 4UT9A 5I74C 3RVVD 3GRWH 3FB5B 4YHNA 3NCJL 3VTTA 1PDKB 2CJSA 1BAFL 2QBWA 3KW8A 3S98A 2RBLA 2YFOA 1XF4A 2ICEC 3I9GL 5TFSL 3VXMA 3T1WA 3MLYH 2NNXA 2R7EB 2QLYA 1DLFH 1DJHA 1Z32X 1GZPB 2Q86A 3DNKA 3G5XB 4L2LA 1T0NB 3EHBD 4JFUA 4KX9A 4L1HA 2WXJA 3PWNB 1G0YR 5CJBA 4P9HH 5JHBA 4Z0XA 3NIGB 2WXMA 4UZUA 2J73A 1XV8A 1MQ8A 4P23A 3JV4B 2E75C 1J7VR 2PN5A 4UQDA 3VGHA 1NMBL 2H41A 5J06A 4PW4A 4MDJB 5C97A 2DMBA 2O5YH 2HTKD 2WUCL 4RMSA 4PM1A 4XPTH 1XH1A 1WF5A 2E9WA 4PMEA 4F57L 3VFTA 4DIXA 1IMHC 2FB4H 3MI6A 1C5CL 4KRLB 4U6VL 1RMFH 3U4BL 3RL1A 2BSSA 2O6CA 5BQ7B 3ARSA 1QW9A 4PGCA 4GI6A 5D70L 2NR6C 3AS3A 1BJMA 1MWAH 1BOGB 2NY1D 3GSXB 5D1QE 5FGRA 5FYLD 2FRGP 1ULVA 4I89A 4K8RC 4NCDA 3WE6A 5CINH 4LCUA 4DJMA 1KGUA 1PVHA 3LKQA 4G43A 4HLZG 3IJHA 3CFDA 2APWA 4OJEH 5DI8B 4QCIA 3C60B 2DLHA 4Z7WE 1C5DA 2MOVA 4PR5B 1HN1A 1CD9B 2VXTL 3OZ9L 5ALBL 1VZGA 4WW2B 3ELAT 5EZJA 1U33A 5F7FA 5CS7A 2XI9A 2C5DC 4WDIA 4DHLA 2CKBH 4U1JB 3SKNB 2WMPB 1NEZB 2BNUA 5FHAL 4YBQC 3HS0B 3HI5L 3SQRA 3FH7A 3PWVB 2AERT 4XPBH 3V7MA 4LCWA 3F7KA 1DO6A 1OGTB 4PY7A 3OWRA 4L4VA 2Z9TA 5ENWA 3L1FA 3VI3A 3AT0A 3O4LE 3V5KB 5JHDA 1QBLL 2J8OA 2OMVA 4R7DB 2P4AB 2VE6B 2D0HA 5F72S 3OHXA 1MOEA 1A0QH 2Z6FA 1U8NB 4POYA 3CSYB 3DVNB 2NSMA 4KROD 2ZKMX 1JNJA 1UKSA 1IM9A 4JCMA 4XVOA 2LR4A 5KJ4A 2R9HD 4P23C 1UM5H 4W9FC 4YHML 1NLDH 4GQ9L 5CCHE 1E4WL 1JDDA 1E2WA 3D4YA 3IFLL 1CO1A 2VXVL 3GSNL 2HFGH 2CBPA 1EJOH 3AS1A 3BFWA 4PRIB 4AKOA 5IJCC 5I82A 5IJKC 1IKFH 1RK7A 5AB2A 3ARYA 4F33A 1SEBB 4WTZA 2W38A 1T66C 4KFMA 3DOSA 1KDJA 1NLBL 4JRXB 15C8L 5B38A 4BHUA 4I7ZC 3MLVL 3I3EA 4N28A 5DJ0B 3W57A 3U36A 3ZZSA 1RK1B 2AXGA 5LCVA 5I19H 5I5RA 2HJFA 2CGZA 2AHIA 1E28B 5IREA 4AT6A 1NKGA 3O3EA 2VERN 3NN8A 3E6HA 3U7YH 3T0EA 1L4IA 3O6KL 5MENE 3UMNA 1AR1B 4ZNCD 1NCCL 3IJ9A 3EGDB 1GS7A 1KENL 5DD5H 4HJJL 1R0AL 4EIUA 1P4IL 1MI5A 4ZMQA 3IFOB 4OLUH 5DHEA 2OMXB 3CVIL 1G7QB 2WXIA 1ND0A 2YPKB 4C83B 3HUJE 3MBWA 4FYRA 4OFQA 2WTPA 3F05A 2NY2C 2IG2H 1MPAL 4HZLB 3QJTB 3DIVA 4KTEL 1LO4H 3FB7B 2AQ1A 3BRGC 2LFGA 2YUVA 5E2TH 2FR4B 2J44A 4JQXA 4R7VA 3J8F7 1JF1B 1MJ7H 3HB3C 3NCXA 2QELA 5JQIB 5J0BA 2R2HB 4H8WC 1OP3H 4ZO8A 1NCGA 1UM6L 5JXAH 1XF2A 4XN7A 5GS0L 5AL0A 2AAVA 1Y18A 1OAQL 4JFXA 3AREC 5AOLA 3K6IA 5AWNH 5AOJA 4XN5A 4MDIB 5FA3A 2OTWA 4JKLA 4CA4A 4APQC 4OGAD 1U42A 4OI7A 5L9DH 2F7RA 2DY2A 4GG6F 1QUNA 2IAMD 1EO7A 3SE6A 4NO0D 4OV5A 3SBQA 3GSUB 4IQHA 3VXSB 3MUHL 4XNYH 2RQ8A 1IBZA 3M1BA 4RNRB 1L0XA 1AQ8A 3TS8A 2CWRA 5G5DB 1DL7H 3VRLE 4NRYA 3L3OC 4NUPA 4HKJB 2JCCE 1K4DB 4GAGH 4IRSB 5D1ZD 3CFBA 1IILE 4N6RA 4RAUB 3HS8A 1AMXA 4P07A 3QUHA 2A9ML 2E7CA 1J0YA 2V2WA 3NA9L 4U4BA 1BWMA 4KY1H 4Z7VE 2QR0A 3SYAA 1PSKL 4YHPA 4HSAC 4RCAA 3KS0J 1CK0L 4M6MH 2BW5A 3F58L 3RILA 3T0EC 3RWIA 5I18H 3ABMB 2XN1A 1CU4L 3PG2A 1KB5L 1OE1A 4PWHA 2BNQD 4AX3A 4DN4L 1EGJL 1CFNB 2OMZA 5CP7B 3MUJA 5ID0B 3B3IB 1SBSH 4G8EB 4A2MA 1F4WH 2ZOUA 4WTQA 3RX5A 1XGPB 4N24A 4AK1A 5IHZB 5DUML 4U1SB 3QGVA 5BZWB 2XVBA 3AU0A 2YIHA 1IGYA 1RSFA 2X3AA 2OR9H 4FLSA 2OZNA 4DUXA 1MCDA 3PV7A 1AGBA 4OGYH 4P5RA 4YDJB 1AQHA 1ADQL 2ZCHL 4PP2A 5EU4A 4ZYKA 5F7MC 1A25A 1MHHA 2C3WA 2ZOOA 4LHUG 4MJ5B 1HOCA 2GHWB 4S0TD 5H37H 1UUSA 4R96A 4YR6A 2V7NA 4JQXC 4POUB 4WWOA 3K2UL 2MFNA 4PTUB 1MVFA 3KLSA 1ZS8B 3LSOA 1HI6B 2XXGA 2RHEA 3UCQA 1KYUA 3KVQA 4RIRB 1FZMB 1VERA 4KKCC 1JGDA 4WU5A 5TK4A 4M7KL 3HC4L 2EXWD 1LK3H 2B7DT 3CBRA 1I53A 3VJ6B 2VYRE 1ZTMA 2VDPB 4G8GB 1G9EA 5ACMA 2DI7A 4JM2F 4HG4J 2Y6TE 2VMCA 5B7EA 3AU1B 5TE4H 1H3GA 2O30A 4F5CE 3QYMA 5F0MB 2XG5B 4FYQA 4P9ML 3BESR 3FOMB 5DA4A 3VXRB 3TBSB 1J8HB 1IE5A 1KLUB 2BP3A 3DGDA 4MJJA 2Q2EB 3QK0A 4QJ3B 4LBEB 5EPMB 3GXMA 4K0OA 4B5ZA 3BAEL 4GMSH 4JDTL 3L3DA 4O51A 1MG2C 1BBJB 1L6XA 5IG7B 2DIJA 5KUMA 5IHLB 4P2AA 5TDPA 4D0BB 3LQZA 1KBGH 1NWPA 5IMKB 1Y0LB 3QNXB 2A0LC 2WB1A 4PRHE 1WT5C 2CHWA 4WTXA 3MFFB 5EG6C 5CJ8A 5J6GA 5DJDA 2BWIA 3MKKA 4PJ7E 5TPWL 1SVCP 1AHWB 1R5VB 2OR8A 3BW9A 4ZBJA 1PU0A 1NDTA 3MXWH 3JXAA 3R1GL 5FGBC 5BVJB 5GRUH 4XXDA 2P80A 2DTML 2X2JA 4D0DB 4P2QE 5FHBL 2FQGA 3GBMH 5D93B 5C0AD 4GRWF 5JHLH 4H8QA 4FD0A 1FGNH 3BT2H 2VN6A 2Z8RA 5IEHA 4ELMB 2FBRA 5SWZD 3WUZA 3N1GC 5E9DB 1EHLH 3ULVF 5FM5M 5A7EA 3E1ZA 3G04A 2DDQL 1PEWA 4F7KA 3OJDB 1A1OB 1E4XH 2EQDA 2DWTA 4L2YA 3C12A 1T03L 3BIKB 3GK8L 3P77A 4UBDD 3RHWK 3FU9A 2IV9A 4Y9CA 3EUDA 4IRZA 5I1DB 1OTUD 3OXRB 3QHFL 3BSHA 1HCFX 5BUPA 5JIDA 2D4DA 3H42H 3PY9A 3R4DA 3P54A 3DUUB 3N1QC 4PWFA 1YPZA 4KKBC 1E6JH 4MA8H 2GIYA 3JT2A 4LF3A 3VFVB 1EEQA 4B9PA 3SPVB 4C54A 3FQUB 5DA0B 2BWDA 4PJBA 1NGXA 1X5YA 4JG1L 4XCNB 3JT0A 1KJMA 3BSGA 2ZG2A 1TJHH 5KUKA 4Z7UA 2X0WA 4NHUA 5ICXB 1I4FA 3LS5L 4X7SL 3HRZB 2VO5A 3BVUA 5DUBB 3UO8B 1XF5B 2ICCA 4UV7H 3T9WA 1H3UA 2RGSA 4MKMA 5E8EB 2FEEI 1S5HB 2Z34A 5LG1A 1JPGA 3QIUD 5CUSL 2XTJB 1CLOH 2DICA 3NH7L 3TA4D 5DS1A 3PPEA 1HEJC 3I6GB 3CC5B 4PJXE 5AVVB 5IJVB 2CE6A 2W0PA 3JYCA 5T1JA 1CFSA 4KVNL 2Y6SC 3CBKB 1IBBA 1P4LA 3AXLB 3CDFA 3VSTA 4X6BB 2W1NA 1OCOB 1KY6A 3BO8B 4PJGF 3MLUH 1YN7A 2P8PB 2DQMA 5TQ0H 3SKOB 2VIRB 3CN4A 3ZYJA 2HG5A 2ZUQB 5K9OA 1BJ8A 3FTVA 1FV1A 3AABA 3FHEA 4TVUA 5DGQA 3LOWA 1CTNA 2YO3A 1DVQA 2A1WL 3G5VA 4EAEA 4JFVA 3Q8CA 2ZF8A 4HG4K 3BEWA 2HT2C 5FCUH 1H6UA 4FQCH 5KSBA 1JUFB 1Q4NX 2O5ZH 4HIQA 2XZAH 2E7LC 4Z78A 3ESOA 4KKNA 4MVBD 1JGUL 3D7PA 4TSCL 5IW1A 1FRGH 4XVJL 5CKGA 4NKOA 4Z0BL 5CBEA 1R1CA 3LNEA 3KYOA 2CRIA 2V17H 4YQXL 1A4JA 3FT2A 4AENB 1FORL 1YZZA 4XNQB 5D96B 1AFVL 4QOKE 3STLB 1S9XB 4ZSOE 4LB8A 2AC0A 5I8CA 4LEXL 1KY7A 1NSNL 2IPKA 4N2HA 3MRQB 2P42B 4YDVB 4YSOA 3CFKB 3T1FB 3KEHA 4NAMA 5IB2B 4PY8J 5I1AB 4WW1B 4I4WA 3BVXA 3FH8A 4S0HA 3UJJL 2FBJH 4M1CD 1XXDC 3H9SB 5I1IH 3N85L 3P40A 3LNDA 5DHVH 4XXWA 5HD8D 3DX4A 3QIBC 5FECB 1QWHA 2WZ0A 3IDNB 1S3RA 2MHAA 2OMWB 4QMEA 4QRQB 4PRID 2XIDA 3NABH 3O2WH 4RBPH 3NZ8A 4N8CL 1DANU 1J0IA 3H54A 1GAFL 5F9JB 4KO7A 3QZMA 4PUBH 3GF8A 4M8QA 3VGBA 1N2RB 1OCWH 2UWEF 1AD9A 1W0WB 1LGVA 3FN3A 1MJ8H 3MGOA 4PJEB 5DZLA 2FJFB 3TJPA 4QRAA 3S35X 3IMBA 3FPXA 5DJZA 1A6ZB 3OKDB 4MS8C 1GGBL 1W0VB 4C56A 4PW3A 3I6KA 3MLXL 4YGAB 1AR1D 2B3RA 3TV8A 3MNVA 2PKDA 3QCTL 1UADC 1ADQA 3QSKB 1TJIH 2ZWKA 4N2EA 1XIWA 4OCRL 5EDXA 4J1UB 4KHXH 3VMPA 2R2EB 3L2NA 4OFKA 2OKMA 4W9EC 5EZOL 5KVDL 3HMWH 3O4LA 1UWFA 3FAXA 4Q6YA 3OR7B 4N0FA 4MNGE 1SZNA 2WWNA 5HTSA 4PGBB 1OB1B 2WYTA 5T1KA 5GS0C 4I3SL 2G0KA 2D03H 3TA3D 1LO0H 3MRCA 3DX9A 2X70A 5DUJA 1T3FA 4QAMB 4AEIH 4UNVA 2APBA 3QIWA 3L9RA 1HINL 1OGAD 1CT8B 4R7LA 1KCVL 2W0FA 4MA3B 5C0DB 2VAJA 1HSAA 2MKWA 5TH2B 1DVTA 2CRYA 3IETA 4JFQA 3PDOA 5HYJA 4N9GA 5GGTA 1A7NL 2EDKA 1JNHB 2BIMA 2CK0L 2P7TB 2QHLA 4M56A 4AH2B 1U91A 4YHKL 1J9TA 5C0JB 4UILH 1HE8A 3S3SA 3WFBH 3WSQL 1VB9A 3ARWA 3FOLA 4ZS6C 1JN6B 2MCG1 3VXSD 2C9PA 1AKJA 4AMKL 4OH2A 4F15C 5LXVA 5IVNA 1GTFA 2OSLA 2BSED 3UTSB 4MJ4A 3T3ME 2WD0A 4PWKA 4DGYL 2J6WA 4IS6A 4JZJA 4EN3B 1QSEA 4FKHA 3RWFB 4UTCA 4UANA 3NSDA 4UTAH 4RAVB 2DQUL 2WWOA 4OZGE 1O7DE 3WDHA 2GJ6A 3MRIA 4XGZA 1MCLA 2NXYB 2YRLA 1UCTA 3VFOB 2YPVL 5D1XD 3NOIA 2EO7A 4J4PC 4WO0A 5CEYB 3JSSA 5FYJD 1XIWC 5SX5H 2XBTA 1REIA 2Y72A 4PJHF 1P7HL 1XR9A 4HBCH 4DO5A 4TPRL 3C08L 3OKLB 5GPRA 4F27A 5CCKL 1D9KB 1FIGL 3KLHC 4HJ1A 2QSCL 5DJ2B 2HAZA 5FB8A 3T77B 1JYWA 2CLVB 4EOWL 3AQZA 3MKGA 4PVNA 2QGCA 1AAJA 4AGMA 1PZCA 5I0XA 4LOUD 3ZZ1A 5EF2A 3QIWC 2FT8A 3QWNA 3MRRB 1X5LA 1I1AB 5LO7A 4JKNA 4U6YB 5ERWA 5JXEC 1JF6A 2K6WA 3ARFA 4YC2C 3SBWA 4X5WA 3U9UA 1JV5B 1UACH 2EJ1A 3P9LA 3QBTB 4EIZC 5I0WA 3PHOA 2EUWA 3CVHA 2VDLB 2DIAA 2CDGA 4G8GD 1SJHB 5D8JL 1EZSA 2JCCA 5GGRY 3UP6A 3QQDB 1PZ3A 4QTHA 5GSRB 5DO2C 5T1DH 3BN9D 4XBGB 1K2DA 1JERA 1ID2A 3C09B 4NKMA 4Y1AA 5EOTA 3QEHB 3NFPB 3DV6A 1S5IH 4OFYA 3VXRD 5ICYA 3TO2A 2ARJQ 3UOAB 5A6MA 4LLYB 5D2NB 3FTWA 2P8MA 2VJXA 2BIOA 4LSVH 4RQQB 4ODBD 3F8UB 4UQ3A 3SOBH 1WUNT 3N91A 4XP9L 3KVDD 2BNRB 5FKAA 2Z7UA 4JZJC 3V2AR 1OVZA 2OK0H 1GY1A 4BZ1A 1NGYA 2X1QA 2IPTL 2VUKA 1YNLH 3DUSB 4XHJD 5GZOA 2AXWA 3JTTB 4KKLC 3DVGB 1KT2A 3ETSA 1H8SA 1JJUA 3B6SA 4XWGL 4YIQA 3NCMA 2XACC 1HCVA 5KJRL 1EWHA 2J2ZB 4WI2A 2EDXA 4C47A 4YK4B 3ARDD 1PTZA 2KI6A 5KBKA 4UDUA 5IKCA 2VLKA 3DX1A 5F0JB 5IF0B 5DGRA 1PNDA 1DQQB 1GY2A 3N2JA 3NJLA 4LCCA 3G7TA 4NUJA 1DJXA 3GJEB 4U3HA 4ONGH 4JVPA 1ZHBB 2WZ5A 3ILEA 3V5DA 3ZE0E 4G83A 4H20H 3MV7E 1U0QA 2VSKB 5IMLB 1SFDA 2E27H 5KYXB 5E00B 2ZAHA 2EH7L 5GRJH 2QTVA 5EU6B 1I1YA 5FYJU 3FT1A 2KT6A 4NP4H 2H3KA 2XKNB 3OB0H 5LXGH 3K4ZA 1MLCB 1U8QA 3KPRE 2P24A 3QWQB 1SVZA 4Q14A 4F5CA 1OB0A 3IGFA 1MKFA 1URZA 4OF3A 2MOQA 1QA9B 1R3HA 3X12A 5HP5A 3FO0L 2Q10A 4NEHB 3SBWC 2AJUL 4L8DA 4FABL 2K7QA 4JRWA 4KXBA 4XP1L 4A04A 3UERA 4L4TB 4HA1A 1Q0YL 3SN6N 5I6XC 3H0TB 2NY4C 3VMOA 4TXVB 4NJAL 1INQA 2XY2A 5ECGA 5GISL 4X98A 1OSYA 2IANA 3CCHA 3FO9B 5FOJA 5I1CL 4IBWA 3U1SH 4XOCA 3EFOB 2ITFA 4G8FA 1RIUH 1DBAH 1KTKE 1UC6A 2C7FA 2NXZC 3D34A 3HC0B 5LN8A 3L9EA 4HW6A 2B9BA 3QUXA 4HK0A 4JLRA 2XRAH 4PS7A 1PZBA 2EDHA 3MLRL 4XODA 1TO4A 4X6DF 2EC9T 4OJCA 4KVCH 5E1AB 2XWTB 3CTTA 4B95C 3PXHA 4G9DB 1NBYB 4UM9A 1QYGL 1XD1A 5MERA 4JFZH 1N0LB 4NI6A 5E2UH 5AW9B 1L9RA 3AACA 2UY7A 2RCSH 1DLHB 3NJVA 3EH1A 3LXUX 3G6AB 4M6AA 1XTLA 1VFAA 5DC4B 4JHWL 5SWSE 2YQBA 1QLFB 2PTTA 4H5SA 2ETWA 2YJLA 4Q58C 1WITA 5E51A 4KI5E 3SGJA 2C9VA 3V4UH 4AY0A 4AKPA 5HDQH 4N3TA 2L7JA 2AI0H 1SBBA 5ALCL 5JOEA 4M1DH 3MJ6A 3PDGA 3W3BA 3W9EB 4KKAC 1A7OH 1QHPA 3NYKA 1AXIB 3QUYD 1VGEH 4P49A 2UXGA 2OMBA 3U4EB 3FUFA 5EBGA 3RZCB 1LD9A 5DMJB 5FO9A 3BUPA 1BIHA 3JWDC 3MV8A 4MD0B 2W07A 3RY4A 4BQ8A 4YDLB 2R4RL 2OXGA 1UJ3B 1TENA 2H2SC 4TLTA 5FYLE 4A7TA 1A2YA 1ITBB 2A74A 2QQQA 2WGXA 3QFJD 4Y4HA 1TZ8A 3ARBC 4Z18A 1DQJA 4JE0A 5H2BB 3AW5A 1KCRH 3FSVA 4J7RA 4JO3L 4ORZC 1TU2A 3M6DA 3MRNB 2ZOWA 2DMKA 3KPSB 1KZQA 3HG1B 3NAAH 1F8TL 1B4JL 4U1HA 3GSNB 1V7NH 3QUXC 4JO2H 4RA3A 3CC1A 2NTSP 1INDL 3P3TA 3OLGA 2G60H 2VQ1B 5E8OB 1L0YA 2B2XH 3TCLA 4PJAB 3I2CH 4BE5A 1KTBA 3Q13A 4OZFB 4PB9L 4P5KA 4RFEB 5DS2A 3GSOB 3OWEA 1MFDH 3FH5A 4MD4A 2JB6B 3FCTA 1RUMH 4S1QH 1N18A 2AEWA 3UAJD 2DYPA 5T33L 1J5OL 5HYEA 4EI0A 4MAUH 5I66B 3CN1A 1WYJA 3TVMD 3PABA 3KJ4B 5K9JL 5I1EL 1IU1A 5IBUG 2P5PA 3CLWA 2H26B 4OQ1A 1SM3H 4R84A 5DR5L 2K6YA 3FFDA 5I6KA 1M53A 2XU9A 3F7RA 1UH2A 4GNKB 2MOGA 1W9XA 3HHSA 3MV11 4JY5H 1H3WM 1LM8V 3WFCL 5FCSH 2HCZX 4MMZA 4M5ZL 3WFDH 1C1EH 3O9WB 2D9QB 4TMPA 2EO9A 2YN5A 4DTGH 3GDCA 4EEEA 2ZPKL 3R06A 5D4HA 4YO0A 3CLFH 4QPEA 4AYDC 3V52L 3PFQA 3BZFB 3X14B 4ZFFB 5SV4A 1JZIA 1QLEH 3CMGA 3BQUB 4UOW1 2CLZA 5IROA 3NJIA 3U0PB 4D0CB 1JHTA 2A74C 1ILSA 1CDGA 3KGUA 3GMOB 3ZKND 3ZUNC 1R5IA 1S7SA 1L9QA 3QJFB 4BZ2L 4CJ1A 3TONA 2WXHA 3CHXA 5MP6H 1RJCA 3B83A 4HSQA 4RFNB 1UGNA 3NJKA 4Y9GA 4WFGD 4DEUA 4MSWA 5EO1B 1WA2X 4K5MA 2EIZA 4I0PA 4P05A 1HL9A 2JKXA 4PI0A 3GHBL 1MJUL 5C8JB 1P7QD 4P4KD 2KQMA 3PAVA 1I9JL 3RZWA 1R4XA 1VFBA 3QG6B 4X6CE 4ABQA 5KS9F 2F58L 5CGYD 3TJEL 3GMNA 3O4OC 4JZOA 4A6YA 4GG8B 4ECNA 1BVLB 3DXAA 3C5XA 4LNVA 2H32A 2NXYD 2BVOB 5D7LB 2FUTA 2R69L 2R0WL 5AYTA 1VGKA 4WWPA 4F2MB 5I76A 3S35L 3F2LA 2VR7A 1E9PA 3LB6C 4OM1L 2YD6A 2BSCA 4WW2F 3H3PL 1QZNA 2VR6A 3MRFB 1A6VL 3IMVA 1BF2A 1EXGA 4MMZC 2B4CL 3T6VA 1A4KB 3AFLA 5IV2B 1FDLH 5EEWA 2BZCA 2JTDA 3U9PH 5JOFB 3H55A 3AVEA 3I3BA 4JN1L 4X7TA 1ZT4B 4AC2A 4CU7A 2VL5B 4OCXH 9CGTA 2JKJA 1Z9MA 4NZRL 3D87B 1DN0A 4E68A 3QFGA 2WBJC 3G3LA 4HX1B 3WTYA 4JDVB 5E6YA 4WI0A 4AIZB 1XD0A 5K59F 3A67H 3CFNA 3K7UA 3KH3A 1VF5C 2Y7QA 4GMTH 3Q6FB 4RVBA 4MNQA 1I1AD 3EOTL 4XXCA 1A5FL 1S78D 5E23A 5F96L 1U6AH 5T3XD 1LQSR 1MAML 4M4PA 1UA3A 1NGWA 2D3NA 3NSCA 1PY9A 5C6PB 4NN5B 3S37H 1JXJA 1YYML 3D9AL 4CADA 1JFQL 4Y0GA 4NOFA 1D5MA 3F64A 4LOFA 4I0PC 2PPCA 1JV2B 4MCZA 3O6MH 1CR9H 3FUEA 2Y22A 1MW0A 2J1KA 1IAOB 5HGBA 3KYKL 4LLMA 5L8JB 3BGMA 4NNXA 1ZPUA 2X44D 3D0LA 3HE7B 5HHXL 4FTVB 5IW3A 4PJCE 3FK3A 3GDBA 3NDZE 1AOZA 2CJTA 1JXKA 1PX4A 4C4UA 2JKTM 3EJZD 2AABH 4U0RB 2BNRD 3P11H 5GZNA 1D5RA 1PKQE 4PD4J 1GPOH 4ZTEA 4UT6A 4LSSL 3JVFC 3VFPA 2GJZB 3VH8G 3QVAA 4H0GA 3S8GB 2ZX7A 4WGKA 3VI4A 4UM8A 4FXLA 1JTTA 2NYYD 3QO0A 4L8CA 1EAOA 2X88A 4QTFA 4ZUSB 1S7VB 1FJ1A 4CNIA 1BZOA 3ILPA 3DMMC 3M45A 3RVTD 1PZ5B 4XC1L 1LWHA 1PAZA 4TUOB 4F80A 3QUML 3NZSA 3FQXB 3K74B 5DRZA 5TF0A 5IVXB 4NENA 2C26A 4H2CA 3RAJL 1A7RL 1OTTC 3QRGL 3WY2A 3P73A 4MAYA 1H0DB 3F01A 5EU5B 3RUGF 4BSWB 2A6KB 3QEGH 5EU6D 1YDPB 5AVYB 1JI2A 5KYYB 4NQCB 3FSAA 3OZLA 4P2RA 4W9JC 3LH2H 4KV5F 4WFFD 5I2IB 4ZOAA 2DM4A 4U6XB 1MVUB 3ARGD 2QSVA 4LNRA 3V4VA 4OZIB 2G75A 1CJYA 1QKZH 5CN2A 4XXCC 2ICWI 4IU2A 3VRJA 1QEWA 1DSFL 4RMVA 1K6QH 1E30A 4TV3A 4PJ8A 1A7BA 1Q90A 2R4SH 3NG5A 3ZVVA 1TPXB 2CBTA 1PCSA 3BAJA 1RLBA 4JCWA 4L8BA 1IKNA 5C0AE 3BZEA 5FDWB 5AW1B 2WQAA 2Z31B 1L9NA 4F37F 5D4IA 3CSGA 2ZWLT 1DQVA 2P44B 3D4CA 5SWZE 4LSUH 4K23H 1XF1A 1I7ZA 5FKPB 5D7SL 4Z7QB 2R2BB 3BKJL 1B0RA 4ILDA 4KNSA 2ZXCA 3PFUA 3RIAK 2A9DA 5GZNC 1KLFB 2B1OA 4FKKA 4K9EL 2CPUA 4G7YH 4IKNA 3MNWB 4HKXB 4Y2DA 5C08D 3T2QA 2C4XA 2OMTB 4JRFA 5BRZD 4JFOB 1BSIA 5TGBB 5E08H 1P84J 3KWVA 4G6JL 4X0KB 1P7KA 1FO0A 3PXJA 1JWMA 3MQIA 1TZOA 4IBYA 3ZPDA 4EBQL 1LNUA 4JANA 1R24A 2NW3A 1BBDH 2R51A 1LWJA 2V3DA 4KX8A 4XPHL 2EVHA 4GI8A 2PPEA 4URTB 4L5FH 2F18A 5EBWB 1BF5A 3IU4H 4MAYC 5E2WH 4WJ5B 4G8IA 4X4ZA 5E7FA 1LO3L 2B1HL 2OBGA 2RTTA 1CGVA 5D2LF 4AZUA 4AYBA 4DZ8B 5DRNA 3TZVB 3ZXAC 1U8CB 4O02A 4ONHB 5EN2A 4OKVA 3PU7A 1L7TH 3EXLA 1KJVA 3QC5X 2YSSA 4AV5A 1RLWA 1T89C 3EO9H 3MX0B 4EDWH 4HOMA 2TSAA 3SE9L 3HAEH 4I2XE 3WXWH 32C2B 3X3GH 1A7QL 4QRRA 4KOCA 1XR8B 4DQAA 3NZUA 3RX7A 1TQVA 4YDZA 5FYJH 4Z5RA 1MQKL 4C55A 1FPTL 3PWUA 1NCWH 4GAYB 3GHEL 1HHJA 3MJ9A 4PD4K 3TBWA 3NRQA 3BPNB 3QQNA 5IB1A 1ROCA 2BLFA 4DP5X 1CBVL 2GUOA 5EOQL 1BREA 5IR1A 5FYKD 3NIDF 3GQFA 4XAKD 1FNLA 4XBPA 4MXWH 5DZOA 3VW3H 1KCLA 2AEPL 1AS6A 3CN2A 3HG1D 3KPSD 4H1LG 2VQ4A 4BGLA 3CAFA 4ACTA 1RKRA 5I8EA 5CXPA 3GLZA 1RUQH 5DD0L 2VXQL 1VDGA 3L17A 3K0YA 3MXVH 4E5XB 4Q9QL 2KBGA 5SWSA 5HI5C 2B15A 3IJ7A 3KPPB 1D5XA 4W93A 4DUVA 2IDSA 5DJCA 2XYCA 1T6BX 3CK0L 3KGRA 5DYOA 5F7EH 2WLYA 1DBBH 3K2KA 5CHNA 1NCJA 2XZCL 3I02B 4GLRH 5T5NG 4ZW6A 2KH2B 2EILB 3C87A 1FL3A 4I0KA 5L4IA 1Q8MA 4P04A 2VDPH 1VFMA 5CZVH 5AW3B 5GSVA 3UAAA 3GJFB 5ANME 3OXSA 4C8XA 3RWDB 1S3KH 1AOHA 3NCCB 2DWEA 4NPKA 3EYOB 3KHQA 1PX3A 4HC1L 4YBLB 3S48A 2VZTA 4TVPE 2DQHL 3T8XB 2XQBH 1DVFB 2X2UA 3CWGA 1KG0B 3BD3A 4LL9A 4K3EH 4ELMF 1EIBA 3LKNA 2GCYA 5KAQF 3FBQA 3SDCA 2VJ0A 2A6IB 2ARJA 2DQDH 3G6JB 1Z3GL 1JPTH 4LT7A 1HHGA 2WGNB 4QXTA 1AO7A 2HKHH 3RB5A 2OCCB 4KDTC 3E0GA 3ZDYB 2E8YA 3O9WD 5E24E 3EJRA 2F5BL 5CLTA 2NNFA 3JTSB 4W9HC 2Z7YA 1MDTA 5AQ0A 1OP3K 1VKXA 1T7VA 5CJ5A 5EUOB 3VXPA 1YUHB 3AJ7A 2CR3A 3HHMA 3TO4A 3V9EA 3VG0H 4DESA 4F7TA 3NRPA 3VH8A 4J6IA 2JMRA 4OQTH 1HHHA 5T5FA 5PAZA 4I77L 4DPCX 4IOIB 1H6EA 2GY5A 3D85A 2D7TL 4ABUA 3L4UA 1G7LB 1WP6A 2Z8SA 3ZX1A 1W6WA 1AMYA 3H9HA 3UTPD 1P84K 2FX8H 3IE4A 5IM7A 3WTUA 1O6VA 1A6PA 4YJZL 1OTSD 3WN5B 2VERA 3BEVB 1CDJA 3RBGA 4GUPA 3VE0A 5KSAB 4HUWB 1KPUA 4W68A 2XFXA 3KL5A 3OJVC 4EPSA 3TT1L 1HWHB 3AT8A 4GSDH 1F11B 1W8EA 4YSAA 5LGJA 5SWQB 2K3HA 1FHNA 1MCQA 3G5ZA 4YSUA 5FYKU 3T5WA 4PSRA 2XWXA 4JPWH 4PN6A 1GW6A 1WVZA 1TITA 1T04A 3LD8C 4R8WH 3T65B 5I8OH 2HMIC 1OGAE 2NPLX 2EE0A 1XEUA 4JZNB 4AQOA 4KJWD 1KNOB 3K1KC 4U6HA 1R5WA 2JIXA 3D08A 5GJTL 1E4JA 2H6OA 2X9WA 2UUDK 4LSRH 3RFRA 1FL6B 4M5TA 1XL6A 4HUKB 1X5XA 4NZJA 3FT4A 3EKCA 2QKIA 3D2UB 1VADA 1VFOA 2J43A 2PLTA 2A99A 4L5FE 1XGQA 3EJSA 3ATFA 3KLDA 3FQ2A 3SCMD 2XWJB 1JOIA 1KF9B 3QPXH 3UJIL 5CF3A 5BS0A 3U0WH 4PG9A 2PYFA 1KJ2A 5HHQA 2QADC 4NUGL 2N4IA 2CA4A 1XXFC 2VDQB 3DJZA 1WZKA 2KDYA 2PXYA 1QFWI 4AGLA 4PSPA 1F4YL 1DE4A 2HRHA 1XSIA 2EH8L 4X0NA 1V3KA 1TETL 3ZTNH 3LS4H 1EX0A 5IBTL 3MOQA 2X4UB 4QRPB 3FUMA 5D1XE 3BVDB 4KU1A 2APXA 2PCXA 4FI6A 4HAFA 4KJPC 4ZMZA 5FYJE 4EUPB 1DBMH 1TZAA 5ACZB 1DBJL 1LLAA 3FN9A 4N1EA 3EJYD 12E8L 4AQEA 1IC0A 3L08A 4ZX4A 4XNZC 1MIEL 4G1EB 4QHNB 3HCVB 4NRZB 4EE2A 4ELDA 1HWWA 2GPZA 1FUNA 1UURA 3PWLA 5I1HH 3MA9L 5HHOA 1E8YA 3KG5A 4TNVF 4OI9A 4LVOC 3HE7D 1P4UA 4FTVD 2V7HB 2YD1A 5D1ZI 3UYRH 4AGPA 3K2MC 4HCGA 5LNDA 1TVBB 3NFSL 2E7DA 2Y07H 5EOCH 1MHEB 4TM9A 4UQ2A 4QHLA 2VAAB 1KEML 2Z4QA 2XG4B 4JHAL 1WUZA 3BLKA 1AXTH 4DGVH 3GS0A 2N1KA 2O5NA 5KVGL 4F7CB 4M61A 3NZHL 2PNDA 1AS8A 1TJXA 2F0CA 3HPJB 1F6FB 1FLRL 5KVEH 3PP4H 2CGRL 1OAYH 2WTOA 3HW7A 3GO1H 2X12A 4JHVA 2HT4D 1G1KA 4IBSA 5CIPB 4TULL 2ESVA 3D18A 1U2CA 4BV1A 2H2PC 4NNYB 1CLCA 2H8PB 1FZOA 4LSQH 1M42A 4BDVA 5BMFL 1ZGLP 4MHHG 1JFHA 4WK2B 4FFZH 2PXYC 5ELIA 1FIEA 2EIJB 2Z92A 5EBMA 3ES6B 1ZY9A 1T21B 3UC0H 3WO4B 1RZFH 1KXVA 4G7RB 4KXCA 5FO2A 2ERJC 2PPDA 4LAQL 3AS2A 4KZEL 1L0PA 1INEH 2ROXA 2WPGA 1OOWA 3T3PE 2FYYB 3OLIA 4HK3N 1HS6A 2WXRA 1SUJA 4RGNB 3V6OA 4LDOB 3VFRB 3SDXA 3OPZL 3KPOB 4YEFA 1MH5B 3ZTJH 5KSVB 5FLVA 1CYGA 1QOKA 3UIZA 5DQJB 1ZV5A 5I8KL 4F8OA 1JZ3A 1AGCB 5EBLA 3GZKA 1A1MB 1E4KC 2HN7A 4K9EC 1OSZA 1ZANH 1YNKL 4GW5A 2D7NA 3PL6D 3U4AA 1YNTB 1DDHA 3ZK0A 4ETQB 3V8OA 2NW2B 5JMOC 4BWTA 3LPWA 2J88H 4CVZA 5K9KB 1Q0XL 3FKUS 3N40F 3S4SA 1S7UB 3O6FD 5E6RB 2X9XA 1HKLL 1EFXD 4GI9A 5E94A 1V7ML 3EOBB 1KEGH 3W11C 4MQ7B 3FSZA 4QWWC 4JKPH 4JFWA 4A1RA 3SE4A 4CVUA 2OMUA 3RKDC 1YQVH 3U2IA 1KCBA 1PLGH 2RFXA 2OQJA 3EYVA 4D9QD 5J4MA 2GAZA 5MEOB 2H5UA 5HDOA 5FW7A 3N43B 2Y3NA 2A9AA 3L3KB 3CZFA 1A47A 1RXLA 3FZUD 3J7HA 3MR9B 4O5LL 1IM3A 4HUUB 4Y4KC 2R83A 1I1CA 3NACH 1UB6B 4HHGA 1A14H 2A6JB 2PCPB 3ZHFA 2LAGB 1U8MA 3PQYB 2QQNH 4UMGA 5GGRA 4A2HA 1XF3B 3F85A 5AVSB 4U3SB 1KXVC 2J6EH 4Y16B 2WQ8A 4K5NA 3AWEA 3L3JA 3IVKA 3JV0A 3UO1H 2EDOA 2VWEC 3B8YA 4X80H 3QXWA 5IGXH 3CVCA 2A77L 3D3VB 2WIIA 4OAWB 4CMMA 1F6AA 4B7IA 1FFNA 1R33A 4Y5XA 3BISA 5D7HA 4WSKA 4V1DA 3EYSL 4LVHB 3SGEH 1S7TB 5JA8B 5IFAL 1BM3H 1XHHA 5ADOL 1KTDA 2DWDA 4BCZA 4MMXA 5EC1A 4GW1A 1B0IA 3MLSL 5EIQA 3MYZA 3GZPA 2H3NB 4ONFH 4RLDA 5F7LB 2D31B 3V0AC 5JPMA 4RDQF 1KSRA 4B53A 4RBPK 4GQZA 3HR6A 4A63A 1G87A 4R7XA 3RVXC 1KPVA 1MXDA 1FI8C 2W65B 5EULV 3CDGB 1X9RA 4BFKA 2J12B 2G2RA 3GM0A 2C7UB 2XPGB 2GEQA 4K2UH 3C5ZB 4JB9L 5ESAB 3DRQB 1CFVH 1P2CB 4XMLL 4U3CA 3QFJE 1A6UL 4OZHF 1JNLL 3SE4C 4OCSH 3WY1A 4G5ZH 1T4KA 2VDLH 4YSRA 4JPKH 5F8RC 5I30L 1FNEB 2ADGB 3DOHA 3L8QA 2BIPA 2L0DA 1TQCB 5KOMC 2YUWA 3N04A 2BVUA 4HIJA 4Y4FC 3V0IA 2HPTA 3MLWH 2YQ2A 4N5UA 4BFFA 3ECBB 4Z7OB 1DUYA 1E3XA 3K4AA 4A39A 5HYQB 2OI9B 1SHMA 1B4TA 4JJ5B 3ZT6A 5E70A 5A3ID 3BKMH 2VOTA 2CXKA 3ILQD 1UT1A 2FJUB 3L3IB 2GC4C 4WEEA 4WWKB 5LWYL 2P5WB 3QUZB 4HH9B 3TYFA 1B2WL 1UATA 1XX9C 2X4PA 2ZKYA 4KO6A 1Q9KA 5BVPH 4NS0A 1NDMB 1ETA1 3FN0L 4Y5XC 4PJEE 4HAKA 2R0LL 3IDXH 4N68A 2B14A 4CN1A 1A64A 2KERA 1PNCA 1FVDA 5E2VH 3REVA 4MHHI 2EDQA 1D2PA 6FABL 1J9CT 5ISZB 1DJSA 4JREB 2NY6B 1WBZB 3OX8A 2ZXEB 4PJDF 5I15L 4HEPA 2DW5A 1HH9A 2PP7A 3VM7A 5JPMC 2EDEA 1P1ZB 3HZYB 3HR5B 4TUJA 2WY3B 4NC0B 3MLYL 3WJJA 1JGIA 1DLFL 2XT1B 4ETYA 3L4CA 5E6IC 1JZ2A 1ZVSA 1NFDB 3ZE1F 1OZTG 4P46C 4BUGA 2YRZA 5KYWB 1BIIA 2OX5A 4K94H 4E9LA 3QI9B 2XIBA 1GZHA 2BSTA 3UCRA 4ODUB 1ID5I 3A6BL 1JE6A 3GSWB 5HYSG 4HKBA 4ZPTB 3AY2A 1BEYL 4Z7NB 1OLZA 2H0EA 1W8NA 2F54D 2Z64C 4AEEA 4D3CH 3KL0A 5SX5K 1QR1B 5JIPA 4MQTB 3TBBA 3LKOA 1S7QA 2GK0B 2O5YL 4FZEL 5C09B 1G7HB 4GXFA 4IIQA 4WFGE 4LARH 1I8KA 2R8SL 2V5SA 2W5PA 4FFYL 4XVUC 1U8HB 4XZUA 2FB4L 3FRPB 1NMBH 1RMFL 1RZIA 2YLHA 2PWEA 5DS8A 3SJVA 1T7WA 3BWUC 3IDIA 5D6CB 3TH3T 2X0VA 4AVKA 3MBEB 4EZKA 2ATAA 5CILL 1MNUH 1YEHH 3SDAA 1NCBL 4H25B 2FL5B 1MWAL 5IVZB 1CIDA 3WBDA 2F1BA 4KVPA 5CINL 2C4FU 1EZVY 1AZUA 4TTDD 1U2YA 1ZEAH 4XB7A 5B1JC 3RKPA 1KACB 5D70H 2BP8A 5BRPA 2E74C 3H9YA 2G9HB 3EZ8A 1BAWA 2X7LA 2W88A 2R1WA 2JJSC 3HHRB 4WIQA 1UCBL 2FJHB 1PD0A 3DX8B 3V0VA 3D25A 1B2YA 1PG7X 3ZDXF 5EU3A 3BP7B 1SYSB 1IFGA 1Z9SA 2Q8BL 4GJTB 4L37B 1PQZA 3BWAA 3NBNA 3PNRB 4NC1C 5HDRA 3VD7A 5J11C 4HSCX 4G71B 3ZYOA 5IQMA 4Z7UF 4XPBL 3SSGA 5IOPB 2OJEA 1OPOA 4GG6E 4PJAF 4NB7A 2PO6A 3QRLA 1X5GA 2AV7B 1S6NA 4L4JA 3U82B 2XZZA 4IGBD 5AW6B 1QNIA 2ZJSH 2UV3A 4CAGA 4QYAA 1A0QL 4YHNB 5ADPH 2J57A 2G0LA 3OJ2C 1YRKA 3GKWL 3REWA 1SDDB 4KITB 2QPEB 3PDDA 4Y2OA 5GGSA 3TEXA 4BK5A 1XF4B 1UM5L 3VXMB 5T3XE 4ODWA 2YD3A 1AZRA 5J89A 3ZYIA 4LIQE 2Q86B 2HFGL 5DQ9B 5I75C 1Z5LB 4TSAH 5FGSA 1HOEA 2EDTA 4IIQC 2MCMA 1NUGA 3WL9B 1IKFL 4KNTA 4H4NA 2YA1A 5FYKH 1KN2H 4A7GA 3ZKXB 3BOVA 4YHMH 4GQ9H 4Z0XB 1HXYA 4RWHA 1PYWA 5AD0A 1U3HC 2VXVH 3GSNH 4WV1A 5EHFA 5D9SB 4P23B 1UH4A 5DEJA 1RP8A 3QDAA 4OBRA 5I19L 2TAAA 5HVFB 3U7YL 3NEOA 5HDBE 4OZFH 3II1A 2X3CA 3B2DC 1LILA 4B60A 4HGKC 3VFTB 2VDOB 4ENEC 4N2OA 5DD5L 1KN4L 4CGUB 3RL1B 2BSSB 3DA0A 5AUMB 2ENSA 2EAEA 3MUGA 4PGCB 2O1AA 4OLUL 5J9PB 3RJQB 4DGIH 4JVUA 2CBQA 3BMWA 3QEQB 4R4NC 3WE6B 1KCUL 2IG2L 3ARRA 1IAIH 3KMDA 1TQTA 3OF6D 4RGND 3GRGA 2VITB 3LRSA 4G43B 3LKQB 4NZ8A 3CSBA 2FO4A 3Q44A 4DPAX 2XIIA 3BP5A 3CFDB 4PREA 5E2TL 3X3FH 4TOYL 3NIFB 1R3LA 1RZ8B 4DEWA 3HBQA 1MPAH 2XJKA 2JKLA 5J12C 5F1NB 5B3NA 2Y7OA 5EU6E 2OW7A 2X28A 4YFLF 3N06B 4KTEH 1JZFA 5JXAL 3HNSL 4Q8BA 4WFFE 1Y6MR 1NCTA 2GKIA 1QRNA 5AWNL 4W9ZA 3ARTA 4LCWB 3BH9A 4LQFL 3LXBA 4BKLA 1UYWL 5CR8A 2VM3A 1XGUA 3OGCA 4PJ9A 4CMHB 5L9DL 4WO4C 5LAPA 1CE6A 2OZ4L 3K6NA 1FL5B 2DLFH 3CFIC 4TKWA 4KJQD 1OAQH 5ENWB 3DX6A 4OLWL 4XNYL 2YGPA 3BAXA 1EZVX 5JHDB 2AF2A 2UX7A 3OHXB 2QMJA 1TYEB 1DL7L 4NGHH 4TYUA 4X8XA 3IB4A 4GRLA 4GAGL 1IM9B 2HRPL 2G5RA 3OKKA 4WV1C 3LAFA 5LDUA 1S9YB 2CBOA 2DLGA 3H6AA 4KY1L 4HVBA 3L3HA 2JLLA 4M6ML 3UG3A 2Y1AA 4CC1A 3FYEB 4UZSA 5JLZA 4ZAKA 1HQRA 1NAMA 4JKKA 3BUIA 5C08E 2A9MH 4F33B 1F0LA 1UGKA 2I07B 3RTQA 5BRZE 1SBSL 4JBSA 3FB8A 3HN5A 4M8VA 1B9ZA 3DOSB 1N6VA 1PZAA 2D7QA 3RDTC 5EA0H 3NK4A 4YUEL 2ZNWA 3V8CA 5I6PA 1CU4H 2ZAGA 3C6LC 1NGZA 2AXGB 2OR9L 4OGYL 1EGJH 2GJRA 2Q3AA 3CG8A 3O3EB 3K5SA 3NN8B 1CI3M 2WVVB 3IBOA 3II2A 1G7JB 5T1LA 3GRWA 4EVNA 3CXFA 1HNFA 4Y5VB 1A65A 2NQDA 3SDDB 1VCBC 4N2CA 1MI5B 4U05A 3RWCA 5I16B 3OG6B 4OFIA 1GC1C 1TF4A 2X2YA 3SDYL 3H3KA 5IEKB 1ND0B 3NFNA 4MJID 4OLVH 4U49A 3E2HC 4PVBA 1Q9OA 1DQDH 3VNYA 1DBKH 1IBFA 3BUTA 3MV9D 3WNMA 3HI6H 3BT0A 3K2UH 1XH3B 1N5YL 2MIZA 2B3IA 5F7AA 4AQ1A 4LRIA 1NMCC 3QORC 5TE4L 4PEEA 4M7KH 4PJ9C 2CUMA 4I1NB 4PJ6A 1XF2B 4NNPH 4FNTA 3KNBA 3M7FB 1OV8A 3R8QA 3D0AA 2JI3A 3IU3B 4MCMA 4YOKA 2XFGB 2KHAA 3WIHH 5F2FA 4P9MH 1N5AA 2Y25A 4FQPA 4PJGE 1X5HA 4XAKE 4N2FA 2KZBA 1HHIB 3HG1E 1AZNA 1KBGL 3EG9A 3X11A 2YPLB 4EQ2A 3BYTA 1QUNB 3WAJA 4OV5B 3RPIA 3BPCA 3PHQB 5DZNA 4WKZA 2D2OA 3FJTA 2WLNA 4J3OD 5I73B 1KTLA 2WKOF 5D6DA 2JKRM 1Q94A 3NP3A 1CDIA 1MF2H 1QNZH 4N6RB 3K0WA 1NJ9A 5GRUL 4LSTH 1N12A 4NIKB 4ZMOA 2WLLA 1U8JA 5ID1A 3T4AC 3GBML 4ZOBA 3LPFA 3F7LA 3MRHA 3RWIB 4NWUL 1T0MB 2EP6A 4FDWA 2C3XA 3R1GH 2CKBA 4ZODA 4ZTPH 4PGJA 5DMYA 4NAQA 3SZ6A 1EXUB 1OIOA 4C4KO 3AGVA 3CPUA 3QZPA 2VM4A 4AYFA 5ISZD 5FHBH 2E56A 1EHLL 1YN6A 3KBHE 2NY6D 2V9RA 3HIZA 3ZKQD 2DQGL 2WV3A 3C8HA 1E4XL 2COQA 3RI5F 2AJYL 4ZYKB 4U1NB 2C1PA 2LU4A 4P9HC 4UQAA 1HOCB 4AQ1C 4F7PA 1TEYA 2CHNA 4R96B 4YR6B 3LKSA 4JO4L 2V7NB 1IQDA 1KDIA 3KLAA 3O3BA 2HZHA 3UADA 3ZOAA 1T03H 5E4IA 4HYTB 4K71C 3TX4A 4WU5B 4Z95H 1J48A 4HIIA 5IFJA 2OR7A 2IALA 3QHFH 3T0BA 3VYOA 2O61A 1TJHL 2UWEE 4ZJ9A 2JQMA 4GBXA 4PCSA 4Y19E 4MRCA 3S5LG 3UTPE 2UZIH 3SKMA 1BG1A 1F1AA 2A9CA 1T1ZB 4YSTA 3D39A 3LNGA 3IDMB 3KXFB 3L6FB 3MPCA 5DFVC 2DTSA 1G1YA 5K5YA 1JGEA 3ESNA 2A4ZA 5B22A 4CBZA 1CLOL 1DZ0A 2Y4SA 4JPIA 1GGYA 1HEZB 3HE6B 4X7SH 1ADWA 2FD6H 2R29L 3MBED 2K9UA 1WEJL 3LIUA 1KGCD 3O41B 3EO0B 5AVRB 1R3KA 3II3A 5CUSH 5TQ0L 1PAMA 3NH7H 1U8PB 1B6UA 1KB9J 2WAHA 3L1EA 4U7MA 3A4DA 4KFZC 1F3JB 4UQ9A 4GSUA 5J6GB 5DJDB 4H8VA 4KRPB 3KCPA 4R0LA 3L5XL 1C7SA 2SODB 1WIPA 1MIMH 3P1VA 2XHNA 3RIFK 5JDJA 4FQCL 1T83C 4TLUA 2GBUA 2HFTA 1DSWA 2O5ZL 3FTXA 4UAOB 1P5UA 4QT5A 4HUMB 1FRGL 3UTOA 1XVSA 5FA4A 5F7DA 5MI0C 4OFDA 2AVGA 3DHJA 4JRYB 3ULSA 2JJTA 4UB0L 2V17L 3W39A 5IEHB 3FULA 3W0WA 1JGUH 4TSCH 1DCLA 1NL0H 2WJ7A 1U8LA 1CTMA 3CZGA 2XNAA 3G04B 3T71A 4ZMLA 4Z0BH 5B3JE 1TLMA 3OR6B 3KDMA 1FC2D 1YY9C 3NJJA 3NUKA 5DJAB 3B1TA 3D30A 1N64H 4GBXC 3P77B 3JYBA 2WQUA 3VXMD 4PV8A 4JFEA 5I1IL 3MBXL 5AYUH 4NKDB 1BX2A 1C7TA 3B9KB 3LJ3A 4NLHA 4EKXA 2FTAA 4WGWB 3VAEA 1MY5A 3NABL 3O2WL 3EBHA 5F1KC 4FQXB 1CL7H 4TQEL 3UG4A 2ATKA 4PJBB 1ET8A 3SGDI 3N85H 2ZKXA 1VEPA 3ATBA 4N22A 1RHHB 4NHUB 4P23D 1OCWL 4ZUWA 5TE7L 1MJ8L 1I4FB 4BYHA 2QDWA 3O8XC 1ZOXA 3IWUA 3PUCA 4F8QA 3BVNA 1B6DA 2HVBA 1IGJA 3P69A 2ADIA 1T22B 5L7XH 3NPSC 2AW2A 1NCHA 5CGTA 5F89B 5CZRA 5J7CC 3GUTA 2FO1A 2YC1A 1TJIL 2BO0A 4ABWA 4NIYE 4ORGA 1JHLL 1H8NA 3GJFH 3IAGC 3UEZA 5IB5B 3B5HA 3MLXH 3TH2T 5KVFH 4DP8X 1P4LB 3IGKA 5H37A 1RVFH 3QEQD 1IEHA 3HMWL 5CWSA 4CL7A 1NANI 1YN7B 2A73B 1P5UC 3CNKA 2BZDA 3QCTH 4XAWL 3WCYA 4XCFL 4LCYA 4WHYG 1D5IL 1PG7L 3CDCA 4M93B 1PLAA 4ADIA 4KK5D 4IKLA 3LDBC 3CH1B 2WBKA 4L1LA 4IRJC 2JJTC 4LLDB 1O5DT 3VFMB 2AKRB 1ZSHA 2PMZA 1A3RH 3BEWB 4R4BB 4YPGA 3RL2A 3KLQA 4BZYA 4ZO7A 1G9NL 2FQDA 3S37X 2NMSA 1FH5H 3GZOA 2X6UA 3VSVA 4M3JA 3DX0A 5E56A 4I3SH 3WHE1 2Z91A 4HDIA 5HPOA 5J3HD 3QWOB 4U7SA 1HINH 1TKWA 4JQIH 2YK1H 4LCWD 2YLKA 5E5RB 3TU6A 4JR9L 4G6FD 5E8PB 1A4JB 4L4VD 2HX9A 4UILL 1A4CA 2NY3B 4N0CC 3WFBL 1ED3B 4U1MB 2ORBH 2YEQA 2O72A 3ZMRA 1NTDA 4U2YA 5JHDD 3BDYH 1KB9K 1FGVH 3KGSA 1A7NH 2BHFA 3U6XA 5I8CB 2IPKB 2MKLC 4ICXA 4XZ4A 4ZXBC 2X4SA 3EGXA 4BKTC 5FFGA 5DZJA 1IM9D 1IARB 2VSCA 3HJ0A 2V9TA 3TF7C 2ATPA 4WEUD 4AIOA 3DETD 5DURB 3J07A 1NBZA 4JFYA 2X1XR 3V0GA 4LHUB 4DVRH 4AMKH 3JTBA 1BVKB 5JYLA 5D1QB 1XH2A 1BM7A 1FYTE 4QRSA 4DGYH 4ZMXA 1AIFB 2ITCA 5GS2D 4IKJA 4JDZA 4MKTA 5JHLA 2IDFA 4MAZA 4NSKA 2GIMA 4Z7WB 2BWQA 3H4FA 1CXFA 3LQAL 4DK6A 2D7MA 1AD9B 4HBCL 3MGOB 1M7DB 3IWVA 4DK3A 2YPVH 1JNNH 2J8UE 1GKOA 5D7IA 5KBPA 3HEIB 1J1XL 3DHUA 5MEPA 1TJMA 3T0ED 3I6KB 1T1XA 2B5IB 1FAIL 1U93A 1E27A 1W8OA 2BSDA 3CFMA 2IJ0C 4Q6IA 4NN6B 5I9QC 3N42B 4TPRH 3L7EB 1MI5D 4NXKA 4O4YL 2F53A 3I50H 3MLTA 3IDGA 1XWVA 5AB9A 5LAXB 5CCKH 1MJJA 4XCYA 3UZVA 4OCNC 1ESOA 2QSCH 3DTDA 1UZ6F 3O4LB 1DO5A 4IDJH 3HFMH 2V3FA 4QRUA 5JW4N 1UACL 2VDQH 2LU5A 1EHAA 5A6IA 2XWCA 1I3UA 2OYKA 5L0QB 1I9IH 3OLDA 1LQBC 1T0OA 1HKFA 3MRCB 3DX9B 2JKIS 4ZO6A 4GSXA 4KNUA 3JWNH 3NA4A 3R0MA 2W9EH 3FQTB 1S5IL 4ZMAT 3WNOA 4JQVA 3QJUB 3PV6A 4RGMC 4S2SA 4ZFOA 3VXTA 4KKCD 5D8JH 4FA7B 2H1PH 4MYWB 1RZGB 3VG9B 3APDA 4EUPH 3NJXA 4JFQB 3SOBL 2XN9A 4WNSA 1HC1A 2OK0L 3QDGA 4N9GB 5FK9B 3N5AA 2DWXA 1QTPA 1YNLL 4FQQA 1U91B 1MW3A 1WAAF 5HHME 1BYOA 3E38A 5HY9A 1A3ZA 5C9JB 3N41B 3QP3A 1OEZW 3O2DH 4HKZA 4A38A 5DJYB 1ZHLB 3UYPA 1NICA 3C8KA 1MCWW 4WVRA 2AQPA 2BZ7A 5BW7C 4IS6B 3VVVA 4IK6A 4PLJC 4X6FB 5D5MF 3T6QC 4WUUE 4ONGL 4AITA 3V6ZA 1ONQB 4NCC1 5EFIA 4H20L 5DJ6A 1XSKA 2AEOA 3HUJB 1BP3B 4L23A 1L7IH 2YZ8A 3COOA 3IRCA 4CJ0A 1OF2A 3NGBB 3F00A 3I75B 3P0VL 4ODXA 3KYAA 3LMJH 5CAYB 2VDMB 4EDXB 4MB1A 5EF0A 5LXGL 5CIPH 5I1LB 3WS6A 5MEQB 4L3AA 1XR9B 4MA1C 2EH7H 3VWKA 2YAEA 3G08A 5EZIL 3PJSA 1J5HA 2X9YA 4MZRA 4Q2ZB 2WNKA 4PRPE 5FB8B 1B3IA 1XCQA 3G5YA 1WZMA 3I9PA 3FO0H 2XTLA 2BPBA 4OD3L 4AGOA 2AJUH 5C0EB 1CICA 1L9OA 4XP1H 2JV6A 4JQVC 5TD4A 2VW7A 1L9PA 2ZWYA 1F90L 5DHVA 2V5MA 1DBAL 1T7YA 3ARFB 5EEYA 4F7MA 3N43F 1DQLL 4HUXB 4LOVA 3VGAB 2BOLA 2KLTA 4HD5A 3CVHB 4Y2NA 2CDGB 4FA8A 1SN0A 1NOLA 1QFWL 2JCCB 1JTPA 4AJVA 1BXVA 5D7EA 3QXDA 4R7NA 4KVCL 5EOTB 3ULUD 2YAPA 4RRPG 4Z7VB 1CGSL 3R7QA 3W56A 1UG9A 1NH6A 2DH2A 7PAZA 5ICYB 4JFZL 1WCBA 5E2UL 3M86A 2UY6B 3GUFA 3HPLA 2VZ1A 5F88B 2Y2WA 5IOKA 4UQ3B 3QXAA 1U8KB 3DTUB 5A1AA 3AAZB 2O93L 1IB5A 1QYGH 3QJHA 1YEJL 3TFKD 1FBIH 3CIQA 3ROOB 4ZD3L 1SY6H 1KT2B 5CEXA 3WLBB 1DR9A 5E4EC 2BCKB 4YIQB 2F54E 3TN0A 3V4UL 5BJTB 5FUOL 2IXQB 5HDQL 2DYRB 2AI0L 5GRZA 1RCYA 5J5EA 1X5KA 5IKCB 2CO6A 2YEZA 4DW2H 1B0WA 2WNGA 4L29A 3QHZL 4LCCB 4L1DA 3WHXA 2Y6SD 1BD2A 1VGEL 3WS6C 4UOZA 4P5TA 4XWOD 1X4YA 4NUJB 4Z77A 3MU3A 3VWKC 2P80D 4BD4A 3LZFH 4I88A 3QUKB 5CU5A 3UIYA 4ALAH 1Z6JT 1E90A 3GSQA 5ESQA 1ZDSA 3FT3A 4UDTB 1IEBA 3SGKA 2UWEA 1GGUA 1N67A 2ZSWA 4K07A 2C1OB 3BZ5A 3IYLW 4Y19A 1UXSB 5B8CB 4JGMA 3EBAA 1ACCA 1NPNA 2VXSH 1KIPB 5E03A 1GHFH 2J4WH 1DQMH 1U8QB 1KCRL 1Z2KA 3Q2VA 1I85A 4RMQA 4XB3A 4NXSA 5E5LA 4NQSA 2JNZA 3MRKA 4DP6X 2PYEA 1R3HB 5DEGB 6TAAA 2E47A 5KS9E 3CZUB 3NAAL 1QVOA 4L8DB 4HPOL 1HYSC 2DJMA 2VQTA 2XA3A 1NA8A 5SV3A 4JO2L 2ZP8A 4BH8B 4B27A 1MUJB 4D9RE 1KIUB 8FABA 3S3PA 5IHHA 1FNGA 3ZKMD 3GSVB 2G60L 2CO4A 3ARQA 3B9KD 3GTVA 2B2XL 3VFSB 3I2CL 2YAOA 3AY4A 1NDGB 3SQBA 3E6FB 1F8TH 1IFHH 1AQMA 2IANB 3CCHB 3US1A 4UTAA 3IJSA 1AQKL 2BOBA 1LO5B 2RQEA 5F1IA 4HULB 1MFDL 4G8FB 1INDH 2XWBA 4NZFA 1GCYA 1OE3A 5EMYA 4GO8A 1WG3A 4S1QL 4PJ7B 4PGEA 1WFMA 1MDAA 4MAUL 4X6EA 4U1IA 5AAMA 4MJ2A 5ITFA 3TN0C 2JWYA 3A3YB 4XN8A 3O3AB 4BK4A 2NYZA 2VW4A 5K59E 3DO7A 2UY7B 2GFBB 4AW7A 4M5YL 1NFIA 1J5OH 3BAKA 3WFDL 2EECA 5I1EH 1C1EL 3T2NH 2MJWA 5KW9L 2NX5E 1VFAB 1ZHKB 2EXYC 3S97C 4DTGL 2PTTB 4H5SB 1GJWA 4P5TC 3ISWA 1HK6A 5E2JA 1T2XA 4MS8D 1QSFA 4I18A 3WFCH 1AD0B 3IEAA 3MRJB 5C0GB 1QLEL 2IWKA 2XWRA 3CDZB 4MD5A 3SGKC 4M5ZH 5DMIH 3E8UH 3WELA 1AZBA 3M17A 4N0UE 1NFDF 4J3OH 3D50A 4HS3B 1EVTC 3RHWF 3GBDA 4Q7DA 4WI7A 4E2OA 1TZIA 1FZKB 1UD5A 2ZQKA 1QFHA 1I85C 1UM4L 2W0LA 4JNXA 1G7MA 1ZLDA 2MPAH 4GS7B 5JW5B 2AJZB 4HQQL 4Z7NF 1GZQB 3IS0X 1LD9B 3H85A 5FO9B 5E9NA 3GB7A 3FL7A 2N7BA 2BJMH 4PJHA 2OXGB 1JD9A 1UA7A 4BZ2H 1BPVA 1CXKA 3B4NA 4Y4HB 4UU9A 4RGNE 2WQVA 3SB3A 3UTZA 1DQJB 5C0BE 3AY4C 3EJJX 4PV9A 3WTVA 4IMLA 1D7CA 3BHBA 4Z3FA 4HCFA 1I7TA 2C9SA 1IO4C 5C3TA 4QGYA 3F3HA 1KV7A 2ZXBA 1OLLA 4G6AD 2ADFL 4U1HB 3VU2A 2NY0B 3GHBH 4DUWA 4MJ6B 1MJUH 2JE8A 4PJXB 5DURD 4ZW3A 1X5FA 3QQ3B 1UZGA 2R1YA 3NEEA 1VJSA 1AXSB 2K6ZA 2GBAA 4YSSA 2HVJA 2DLTA 3RUGE 4L3EA 4ZS6D 3MCKA 4JKWA 3SY0A 4P5KB 1MCJA 2ZD0A 1NGPH 4DERA 5KJ7E 4E41E 2GVYA 1Z66A 2HTKC 3TOPA 1IGIH 4MX7A 1UVQB 3KS0H 1XGYL 1YEKH 3VRIA 2JK5A 2XXCB 1QG3A 2R69H 3ILDA 3MUY1 3U9PL 4K5OA 2UXFA 4M00A 3S35H 4FHBD 3PABB 4OM1H 1H3PH 3CVDA 2MQ3A 4X7DC 3BSZH 4I18C 4P2OB 4C56D 1NC2A 3H3PH 4ZRGA 4FGMA 3EUUA 2BY0A 3FFDB 1KGJA 2B4CH 4EQ3A 1F58L 4R2GC 3C9NA 5KG9B 5EN3A 2YWZA 4JN1H 4CW1A 1XIWD 3NCYS 4GMTL 4M6NL 2ZICA 4QOKB 1QFPA 2K70A 5DEFA 3QFDB 3B9VA 3R06B 3O4LD 4ZSOB 4PYHA 4JFDE 1TUPA 3S37L 4XMPH 1XB3A 1BZQK 4AJ0A 1UWGH 3KLHD 1HHKA 5T1KD 1ZSDB 4DT2A 1A5FH 4ISVB 5F96H 3QIWD 4YHIA 1MAMH 1PCXA 3O6ML 3OC8A 1M9SA 1QO3A 1LK2A 1MFAH 1R5IB 4GY4A 1SMDA 1MREH 3IMUA 5E0QA 1FYTA 4GXUN 5E6ZA 2V5RA 2CIKA 1HE7A 1SVBA 5HGDA 1HQ4B 5HYJD 2AITA 3HMXH 2IH1A 2AABL 2B0SH 4NT6A 3P11L 1CFQA 3B1UA 4MJIE 2YHGA 4EIBA 5BV7B 3FHAA 5DO2D 3B7YA 2WLIA 2PF6A 5HHXH 2EIZB 4PJFF 3MV9E 5FWQA 3RE0A 1ETZB 3P30H 2DB8A 4R97B 3T8MA 4UT9H 5D2LE 3ENEA 4DWHA 1Q1JH 2N56A 3WGUB 5C2BH 1NC4A 5JOPD 1T20A 3QZWA 3EGSB 5HPMB 2HFEA 3B7UX 1XL4A 1VFBB 3QAZC 5EF1A 2JKSA 4HS6A 7CGTA 4HHAA 2WKGA 2QPUA 4ZFGH 3N44F 1D7FA 1MCCA 2BVQA 2VZVA 2ZOTA 3RGVA 1QSED 4B0MM 1GKEA 3GMNB 1CQKA 4LASH 1HIMH 5DLMH 4PVLA 2I9LA 2MNWA 1FG2B 1D2OA 4A6YB 3DXAB 1ITCA 3KAAA 2GJ6D 3V0DA 1P1VA 2FCBA 1FP5A 1E9OB 4MNGB 3QULA 3FCSA 3QEGL 3NIFF 2PUQT 1E9PB 1ZWIA 3KR3H 1LP9F 4X6DA 3PIQA 3TJHC 4F9LA 3LH2L 3UBXA 2WP3O 3O45A 5JO5A 2CDFA 1NIFA 4J3SA 4X7TB 2HJLA 1K6QL 1PFCA 3IK2A 1QWNA 2R4SL 1BXAA 4W4NA 5DUPH 2VDOH 5F9WC 3VGFA 5AG8A 2PW2A 4WI0B 3Q48A 5K93A 3NEXA 1YYLH 5INDA 3L95A 3KJ6H 4XX5A 3K72A 3R7RA 3WJMA 1WBXA 4MNQB 1OQXA 2KZ1B 4W9LC 3LV3A 3VQ1C 4LSUL 2WXOA 5JR1L 1CF8H 3ARFD 1WAEA 3N0PB 4UINH 3HJEA 2BRQA 2ZT9C 3W9DA 1LEGB 2ZAIA 4HFWB 3QA3A 2EDBA 3AQDA 3T3MB 4M7ZB 2OS7A 2LVCA 4G7YL 1D5MB 2WWMC 4WUUA 3P4NA 4NC2B 5KANG 3LIZL 1PMYA 2OM5A 3PS6A 4OFYD 5HGBB 5E08L 3BGMB 1OANA 3FCBA 3PJNA 2NXZD 3K80A 4FULA 1RJLA 1QTSA 1EDHA 2BFVH 4YHZH 1LTXA 1O7VA 3EOAA 5GS1C 3RGVC 5GZOD 4B9YA 4G6JH 3IRZA 4L5FL 3VFPB 3KBFA 3CXDH 4AUYA 3IU4L 4WRLA 5E2WL 4AMWA 5AL8A 4UM8B 5C3LD 1U3NA 2TSBA 1LE5B 4B9CA 1YEFL 3BGFC 4PP1C 4XPHH 1J5CA 4X9GA 2VLKD 2NT0A 4LPTA 4F9LC 3WU1A 4CNIB 2IH3A 4M1GL 1L7TL 2QSQA 3D0VB 4CBPA 3QQ9D 3SYQA 4WHCA 2K9FB 3FO2B 4FEMA 5DRZB 2V2TB 2B1HH 3GMRB 4EDWL 3HZKB 4EI5B 3DGGA 3UPRA 3JWOL 2ZXQA 2PWDA 3X3GL 1KGCE 4V2CB 5CD5C 4M43L 3VD0A 1PY4A 5GS2H 5TQ2H 4PTTB 1WFUA 1C16A 4P2RB 5F3HB 5FYJL 3WEBA 2FWSA 5IB3A 4BQCA 3V4VB 1BQHA 5E5UB 3S2CA 5LCVH 5JW4Q 3HLAB 5E1HB 4MXWL 2KZKA 3BDXA 1QEWB 3VRJB 2HVKA 3I6LE 1HX0A 4PJ8B 3FU8A 4LPUA 3EJQA 5FS5A 2FGZA 5IBUB 3GHEH 1RUQL 4XC3H 2H2SD 3LRKA 4WI3A 1TTGA 2E6JA 4WAFA 1G1CA 4E9QA 2EXWC 3MXVL 5JIHA 1N19A 1M05B 3OQRA 3BZEB 5F7EL 5DC2A 2K0RA 2ICWB 2XPZA 1DBBL 3BKYL 3TNMB 1J0KA 1SGKA 4G80A 4JDEA 2IAND 3SPCA 2F7QA 3C75A 3B34A 3G5XA 1T0NA 5DD0H 1EFQA 3QDMA 2VXQH 5FUCC 1SJMA 2JB5H 1I7ZB 1E5YA 3O11A 3VXOB 4Q9QH 1OWRM 2APFA 2VDPL 1B0RB 3EJUA 5CZVL 4YGVB 2CRZA 3CK0H 5EORH 1S3KL 4HV8B 4JFFA 3WOVA 2XZCH 2CIIA 4Y2DB 4DAGH 3JV4A 1J9RA 2RD0A 1QLRB 2ENJA 4JL1A 2E6QA 4UM9D 5AVUB 3ZE0B 3MV7B 4BEIA 3UBFA 1QHOA 4F9PA 4XPFH 4RWYL 1FO0B 2DQ6A 3Q8BA 3V4PA 3L5IA 2HKHL 5B4MC 1OE2A 4Z76B 2DQHH 4QNPE 2V6HA 3TTSA 5BQ7A 4JM0A 3LYRA 4JAMA 1I8IB 2VUYA 3UMTA 3VG0L 1Z3GH 4QAWA 2BY3A 5HGAA 5KS9A 4MB5A 4JGNA 1BOGA 3GSXA 3LN4A 4X8JA 3AQYA 1SQMA 3EH5B 3VX0A 4IBZA 4NZUH 5EN2B 2E7HA 4OKVB 2Z7ZA 4BK8A 1WGOA 1I1FA 2OMYB 2EVJA 3Q5TA 2RACA 1FFTB 1JZEA 1U3ZA 3C60A 2FX8L 1JIBA 4PR5A 2DH3A 1DQTA 4I77H 4WW2A 4YAQB 43C9B 4A2EA 3MV8D 2X6AA 4KPHL 3CZLA 4U1JA 3SKNA 4B9ZA 2WMPA 4GSDL 5LBGA 1NIAA 4Y4HD 3HS0A 4YFEA 1S46A 4J3OG 4PU2A 4Z5RB 3QWRA 4PH8A 3WMQA 4UBDC 4R5TA 1LEIA 3U1QA 1ACZA 1OTUC 3QJXA 5IB1B 1LE9B 3WLWD 4R8WL 4XBPB 1LDSA 3BXNB 3EHBB 3V5KA 2NY0D 4OGQC 4R7DA 4I9XA 4MBRA 5I8EB 3VSQA 5JQ6L 2EE3A 3CSYA 4KK8C 2NX5A 4YHLL 1ZAGA 4LSRL 1SN2A 5SWSB 1D5XB 1SOQA 4PCYA 5DC0A 4MCYB 5AAWA 1L5GB 1EANA 4BE6A 4GSQA 5CHNB 2I27N 3DSFH 3D5OF 3P3YA 4L4VE 4XTRD 2AFNA 4X5XB 2WLJA 3ARPA 4P4RA 5KANI 3VI3E 1VLXA 4R5XA 2IPUK 3D69A 1JZ6A 4HLZH 3UAEA 2ZWNA 1RPKA 5DZAA 3GBNH 5KEZA 2DYPD 2MMXA 3U0WL 2DWEB 4HU8A 3ULUH 2XUWA 4JRXA 1I7RA 3X13A 1EJFA 2J55A 4G3YH 1EXHA 3U7AA 1MXGA 5DJ0A 3D33A 1UTDA 3UGXA 3ZT7A 3APCA 3DO4A 3C8DA 3LB6D 1FF5A 4BQ9A 1E28A 3SDCB 2XA8H 4GUOA 1UKQA 2ARJB 1AHMA 5LQBL 2NY1B 3ZTNL 3WEXB 3RFZB 1FNSH 3GXPA 4IMKA 3VFGL 3EGDA 4OCMC 3DI3B 3T0WA 3VXQB 5C0BA 3C60C 4LQ1A 4KZ0A 4QLRA 2YAQA 3TTYA 2OL3A 3IFOA 2QADB 3T4YA 3TO4B 4WW2C 1ML0A 1G7QA 2Z1PA 3VH8B 2YPKA 4C83A 3P3UA 2FZ3B 2I7OA 1M71A 5IROD 4KQ3H 4MVBC 1CYXA 4HZLA 4ATWA 3T0EE 3HS0C 2FT6A 4FL4B 2VXUH 5DHYB 3D85B 2C3VB 2XQYG 3FB7A 1CZ8L 4NHCL 5I1HL 4ZW5A 2JJUA 3RUGA 2LGNA 4LOEA 5CCGE 4YDMA 1J1PH 1AGEA 1JF1A 1WFNA 1GYVA 3UYRL 2NDGA 5JORA 1CXHA 2R2HA 3C5JA 4LU5H 4E41A 3THML 4N0RA 5IQNA 1BECA 2Y07L 4QYOB 4GUPB 3VE0B 1KPUB 5CZXD 3MA9H 4R3SB 1YJDH 3QNZA 2I5YH 1QD0A 4I0PD 1Z5HA 5IB4B 3JUYA 4LLQA 1KXQE 4JY6B 4M03A 4U1KB 1JBJA 3IFPA 1XSOA 3NFSH 5FO7B 1G0DA 4RGOH 1AI1L 4HUNB 4YLQT 4HF5L 1OAYL 1XAUA 4HP5A 4ICWA 4JHAH 1NBQA 2O4EA 3GSUA 3VXSA 2K7PA 1EEUA 1KGIA 4U6HB 1I8LA 1R5WB 1G9MH 4IRZH 4Q0XL 4HS8H 5G5DA 5KVGH 1HZLA 3NZHH 1WZ1H 4HKJA 2W91A 1K4DA 4IRSA 2F8XC 3DXAD 5KSUB 5I6NA 2YD9A 4FFZL 5JDSB 4W9KC 1QTYT 1KYOJ 2QKIB 4TULH 4JFDA 4RISL 4KBPA 1RZFL 4LLUA 4ZW7A 2FUQA 3HAEA 2HX8A 1AR1C 2H3XC 4E9SA 4BCYA 2CNYA 3QJOA 4IMKC 5BMFH 1ECZA 1CFNA 4FP8H 1BVZA 2VT0A 5ID0A 3B3IA 2WLHA 4WI6A 3MZTA 4K7PX 5T3ZE 1OTTD 2GSGA 5I0YA 5IHZA 4AVIA 4U1SA 2Y06L 4NQEE 1T1WB 2XBZA 4HWBA 2V3EA 2CZNA 4LAQH 1J88A 3IDYB 4JS7A 4KH9A 4YDJA 2ZCLL 3E1F1 2Q8AH 3LH8A 4OZHE 3RJDA 1J8KA 4MNQD 1NCUA 1S7RA 4PLKC 1ZANL 1C5BH 3OPZH 5B21A 5D2LA 4A7GF 4Z3TA 4PTUA 1HI6A 4RIRA 1E5BA 4U1LB 4AQEB 2ZXAA 4X6CB 4K73A 2Z35A 4KZCA 4TVSa 5AFAA 3PAUA 3SO3B 1YNKH 3DIFA 5GQBA 3O3DB 1WHOA 1F3DH 2FEDD 2VMJA 4JKPL 3ET9F 4X5PA 3AU1A 4ZMVA 4NO3B 5HVWA 1YQVL 4P3WA 2XG5A 1IAMA 2WXKA 4PGZA 2LLGA 3FOMA 3TBSA 4PIBA 4FXGA 2IAMB 1J8HA 5GZND 4UQ2B 4FG2A 1K8IB 4L3CA 2Z4QB 4JFSA 4IRSC 4OVVA 3SYPA 4XNBA 5EPMA 5BXFB 2I9TA 1A14L 2NZ1A 4S1RL 4H26B 5D1ZB 1BBJA 1N8OE 2NNCA 1ZHNB 2PP9A 2QQNL 4M61B 5IG7A 3GLEA 3U2JA 3OKEA 4JY4B 2JVUA 3IJYA 2ZE0A 1MCNA 1Y0LA 3QNXA 1WH0A 2AV1A 1CXLA 4Y9FA 4H1LB 4OQTA 4I87A 4ELKB 3UO1L 3VD4A 1E2VA 1RFDH 3EO1B 4MS6A 3D18B 1ZV9A 4N2MA 5IGXL 3JUZA 1ORSB 4XO8A 1U8OB 4XH2B 1R5VA 5D71L 5LGHH 3X1BA 5AVZB 1R9FA 6PAZA 4L8SB 1T2QL 4YDKL 4EI5D 3TV3L 4Y2LA 4FYTA 1CYWA 4MAYD 4AEFA 5J57B 4KK9D 1RQ5A 2Z92B 1BM3L 5EBMB 2E7MA 4D0DA 2XN2A 2KPNA 2Y1VA 1NQBA 3HNVH 3OKMB 4P2RD 1AVAA 2RA1A 4G5AA 2WCSA 4ELMA 3ECVA 3FQ4A 5IFAH 2CR6A 1MCIA 5AOMA 3W5NA 5E9DA