1I8UA

Family 9 carbohydrate-binding module from thermotoga maritima xylanase 10a
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
189
structure length
189
Chain Sequence
MVATAKYGTPVIDGEIDEIWNTTEEIETKAVAMGSLDKNATAKVRVLWDENYLYVLAIVKDPVLNKDNSNPWEQDSVEIFIDENNHKTGYYEDDDAQFRVNYMNEQTFGTGGSPARFKTAVKLIEGGYIVEAAIKWKTIKPTPNTVIGFNIQVNDANEKGQRVGIISWSDPTNNSWRDPSKFGNLRLIK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structures of the family 9 carbohydrate-binding module from Thermotoga maritima xylanase 10A in native and ligand-bound forms.
pubmed doi rcsb
source organism Thermotoga maritima
molecule tags Hydrolase
molecule keywords ENDO-1,4-BETA-XYLANASE A
total genus 56
structure length 189
sequence length 189
ec nomenclature ec 3.2.1.8: Endo-1,4-beta-xylanase.
pdb deposition date 2001-03-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06452 CBM9_1 Carbohydrate family 9 binding domain-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1190 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 1i8uA00
4JPQA 1I8AA 1ULVA 2IVFC 1I8UA 1UG9A 1I82A
chains in the Genus database with same CATH superfamily
1UD4A 4A2GA 4OLZL 4FULA 3BO8B 3OBAA 2ZICA 5FECB 3E6HB 3DPDA 1ES0A 1JUFB 1CVRA 3CLFH 4LKCA 4OH2A 4S10A 1J1OH 5GRXG 3ME0A 4DWHA 3EOTH 3AREB 3F6IA 4KHTL 3TIDB 4HOZA 1M1SA 3MUY1 1HSAB 2WUCL 2HN7B 1JNLH 2PLTA 1OM3L 1NFDF 4BZ2H 1G1OA 4QOKD 3P3SA 5B39G 4E9SA 2FB4L 5TF1H 1ZY9A 1AI1H 2WXNA 3IU4L 4J4PC 5A2IH 3SGDI 3ABKB 4XO9A 1ZHNA 1LQBC 5TQ0H 1DDHA 4XVUD 2J55A 1GTFA 3LH2L 1Y18B 5ACMA 5CEZL 3FCSA 3MCKA 1H5BA 1W72H 2VISA 1E7UA 1HQRB 4XXDA 4ABWA 5LWYL 3HAEG 5KSVA 4DKEL 1KIQA 4Z5RB 4Z7NF 5I5IA 4JFYA 5D7HA 1T22B 1F1GA 4H25B 2Y4SA 2BWIA 4PJDF 2YPVH 5DUML 5AB2A 5A6IA 1IGMH 2BP8A 2WC7A 2R8SH 4KK8D 2ZXDA 4WJKB 2IPKB 5DT1H 1TNMA 1YSOA 4KNTA 2WO3B 2E76C 1PD6A 4JO2H 4P46A 5FHAH 3T1FB 4F57L 2H3KA 3GLAA 1QFHA 2UY7A 3ESVF 5D7SL 3RY4A 3HG3A 3GMRB 2XWBA 3UMNA 3RIFF 1HNGA 1XF2A 4PGEA 5IW1A 1M3IA 3LKSB 1D5MB 4EQ2A 4K7PX 2BLFA 3LKPB 3B2VL 5TH2B 3NDZE 2NSQA 2X4OB 4PJBA 3V52H 4CAGA 4NPKA 2NDGA 1E28B 3BUBA 3F5WA 2JCCB 2XJKA 4QYOB 5C0EB 4PGJA 4A38A 1FZJB 4WFGE 4P57A 1BZ7B 4XOAA 2NT0A 1TG8A 2NNAB 3IKCA 3V7AG 2VLME 1N7MH 4AQAA 4WW1B 1XBDA 1Z9SA 3DPBB 1BWWA 1KYUA 2Q86B 4PVLA 5KS9A 3B9AA 2GTWB 4QXTA 2OI9C 3P2BA 3IFOB 4XN2A 4XMWA 3PHQB 5L9DH 3UGEA 2R0WL 2R69A 5SWSB 2LOEA 2HT3C 4D7BA 4U1KB 4N0CD 5IWLA 1U3ZA 1Q8MA 3FTWA 3ZE1B 4TL4A 3UG3A 4HUMB 5JIHA 1RJCA 3FQ1A 5CLTA 4LSQL 4KK5C 4WHDA 1A6WL 5T1KB 2FUQA 4QOKB 3BJLA 2CIKB 3WHXA 2BO0A 5FCSH 4HJJL 4GAYB 1AQ8A 3VXPB 1ILUA 2GFBB 1MCDA 3L3HB 5KOMC 2YFOA 1ETA1 4A2LA 1LGVA 5AW8B 1XCTB 5IMOB 4R2GD 1IGFH 2WLNA 4HU2A 4KI5C 2KLTA 4KJYA 1A7OH 3Q2CA 2ICEB 4HQQL 5DD0L 3SBWC 3F3HA 3GXUB 1R17A 4U3SB 3WXWH 4G43A 4LSUL 3BVUA 3VRLE 5M95B 2CCVA 4ANWA 4FA7B 3QQ3A 3MRQA 1FNEB 4KV5F 4JK0D 3MN8A 2O5YL 3OKMA 3AS3A 1WPCA 2V9TA 4HX1B 1RIHL 3A6BH 3UMTA 1UB6A 3D0LA 1M9WA 3V0JA 2VCOA 4WEEA 4Q2ZA 1WISA 2DKSA 3QUHA 5CCJA 3H85A 2KC0A 4MTMA 4Z3EA 1NLBL 1FRGH 3B2UC 1BOGA 3KBHE 4F58L 3ZDWA 1I1AC 3P73B 4KROD 4S1DC 1KOAA 3WO4B 4D9QD 3VCLB 3DXAE 5BUPA 4K94L 3MUUA 4GYBA 5IK3A 4M9PA 5DO2C 1SXNA 1P0SE 2W80C 3PWPB 4HEPG 5EOCL 1LO3H 1VEPA 5ICZA 1OARL 2HT4D 3IPFA 1T0NA 3S3BB 2CUHA 3CAFA 4UOZA 1OAUH 2GTZB 1ZANH 1DVFC 3V0VA 4J6IA 4GLRI 1TTFA 1WEJH 1NOAA 3CPLB 4NC1E 4B9CA 2FTAA 4JQVC 2AJ3A 2Q7YB 2FECI 2R8SL 1FH5L 3MMEB 1H0DA 1TJGL 1PKQA 5DYOB 4F3FB 5TE7H 5I0ZA 4TSAL 2V5SA 4BRVA 4Y16C 5CU9A 2FGWH 5HHVL 5CUSL 2D9CA 3GSNL 4YK4B 4DKEH 4I18C 4QHMB 4EIZC 4U4BA 4DAGL 4X9HA 3BQUA 3KDMA 3K74B 3U1QA 3F7RA 3W9DA 2ADJA 3DGGA 3FUKA 3JVGA 1BVKB 2ZUXA 3H4HA 4LVEA 1DBKL 3OXSB 4M7ZB 3O0RL 2EIZA 3ULUC 4MXVE 4F9LC 1E50A 1FNEA 4NFBA 2C26A 4PJGF 1AOZA 1ILSA 4R2GB 5DJ6A 1IV8A 1PZ5A 3N41B 3SYCA 4U3SA 3HI1A 5F89A 4EI0A 3CK0H 3EHBB 4NHCL 4MJJA 4YHYB 5GS0L 4Y4KA 3QISA 4J3OF 5JHDD 2EE3A 1S5IL 4KRPD 4A6YA 3LEYL 5DQDL 3DRQA 1KY7A 2N4IA 1M3JA 2VR4A 3OZLA 4P2OC 5F7NC 5D7JC 5LAXA 1N5YH 2OJ1A 1GGIH 5CR8A 4ZUTA 4EJ1C 4OZGB 3DHMA 2FD6L 1Z9PA 2P7TB 1BFVH 2J57A 3JV5A 1FO0H 1TQSA 1XIWC 5EU6D 4V2CB 4BK5A 5KSBA 3OGCA 1HHHB 5GS2D 2QVMA 3REVB 1HAWA 2UWEF 4PRHD 3MA9H 4PU2A 1GJUA 3MFGB 1BAGA 4IBQA 3BHBB 5KSBF 2CBQA 4GG8B 1ML0A 1YNTA 3U4AA 3SDAD 4TNWK 5F0MB 4OM0L 4P2RD 1G9MC 1WIPA 1KFGA 4B9KC 1OM9A 1HEZA 2XHNA 1FZJA 4U1GC 1T1YB 1ND0B 3APCA 5KZCD 3ARDC 3TPKA 2JKXA 3A21A 4H20H 2W94A 2Z91B 3QEHA 4GBXD 5AWNL 3UO8B 1QVOB 4CADB 1AAJA 1YUKB 3GINA 3SPIA 4ZFOA 4KDVA 4FTDA 2HJLA 3NIGB 1K4CB 3B7RL 2DQMA 4Y9CA 1O7SA 1JGEA 1MW2A 3C5JB 4V1DB 4F8LA 4XPGH 5SWZE 1IJ9A 1RI8A 4PWHA 2R2HA 4FFYA 4HUUA 3WD5H 4P2QE 4LPXA 4LE8A 1OF2B 1P1ZA 3W2DL 3US1A 5EZJB 3AT8A 2NY2D 1IM9B 1NMCB 1XFPA 2X2YA 3HVDA 5DHVA 3WUWG 3MYJA 3BUDA 1NWPA 4JPIB 35C8L 5JYMA 2AABH 2I7OA 1E90A 1ZTXL 3HBQA 2ENPA 3O81A 1PY9A 4U7KA 1Q9WB 1W6LA 3ARUA 5HGBB 4OFQA 4BFFA 1WWWX 2UXTA 4LO9A 4XPGL 1O9ZA 4P23A 2KT6A 3VI3A 1Y18A 1DLFH 4NI6A 3WJJA 2YXMA 2JVUA 4UM9A 2HAZA 1JHKH 1XEUA 3ECBA 3QW9A 4P99A 5CP7B 4ZS7L 1MREL 3MBEB 1FC1A 3RL2A 2A9CA 5JXEC 2A6IB 1P7KB 5DJCB 2EEXA 4N9GB 1CD9B 3SOTA 2QSCH 3A23A 3HI1B 2VDPB 2MMXA 2XFXA 5F70A 3TBSB 2H7WA 1KGUA 2PR4H 2AJUL 3RA7L 3QNXA 4OCNC 4DO4A 3X1BA 5IESL 5C9JA 2EIZB 3ML9A 3FH8A 3P4LA 5I1DA 1TJHL 5C09E 3KPSD 1OK0A 3D9AL 5DZJA 5CEZH 3MV8D 4L1BA 2P5WD 4X5XB 1JPSL 4U1NA 3IETA 4XO5A 3VWJD 3DIVA 5L0QB 2K6ZA 3JTSB 4EIUA 5TPWL 1JDDA 1A7QH 1Q9OA 1H6TA 3EH3B 2ARJB 3V5HA 5GS0H 3IPBA 4J6RH 1RK1B 5AW7B 4K07A 4FJZA 5FB8B 1BVOA 1A7RL 4PJAE 5A7EA 4PJAF 1ZHBB 4NQCD 2G60L 5DQDH 4BCXA 3WL9A 4NIYE 3NQIA 4QPEA 2WTRA 2FO4B 1MXGA 2MPAL 4I3RL 1E42A 1QACA 2Y9RT 4PJEE 5L8JB 3ZDXE 3QIUA 4ODUB 4NQSB 2FO8A 2O5ZH 5AUMB 4RISH 5G5DB 3WN5A 1JYXA 1AQHA 3IGKA 3B2UD 4J3OH 2CIIB 1GYUA 2UZYA 3M88A 4Y1AE 1NUGA 5LG6A 4JLRB 5SWQB 1FFNA 1S8DB 1NICA 2XCMC 4PRNB 5ALCH 3W82A 3NVQA 4FKEA 4ZMLA 3NEXA 4WU7B 5EZLB 3ULVD 5T5FH 2ESVE 1MQKL 2KZBA 2VB5A 4PP1C 3OHXB 2BM3A 1IO4C 1T20A 3FQUB 4MDJB 2XTJB 2B9AA 1B3JA 1HZHH 5C0CD 3OJDB 1GC1C 3GJEA 5L9DL 2I9LA 4PGBB 3NACL 2VIRA 3CV5A 1NC2B 2HCZX 4GRWF 4QHKI 2WMPB 3MJ7A 1B90A 2DM2A 4MMXA 5DRNA 3EADA 2EYRA 3V95A 4ES9A 1RZJH 2KPWA 3IEAA 4C4KT 5I1HH 2AGJH 1DL7H 1DVSA 2IFFL 3B37A 3OMNB 2ZYRA 5EU6B 4M1DL 2Z93B 3VFGH 4PRHA 3TEZA 4YFLF 5KW9L 4NLAA 5GRJL 1P4IH 1OD7A 3W0WE 2F08A 1NCHA 3ATBA 2Y22A 3VNYA 1AQKL 1U3HA 1KCWA 1YYML 2Y2YA 4YX2H 2FIRT 4AMXA 4KJQD 1UH3A 2QQLL 3SY0A 3JV6B 4EBQL 3VYNA 5E9NA 5B1JC 2CXGA 4BWWA 4PGZA 2VQ4A 4O2EA 4RFOH 4EDWL 1TTUA 3I3DA 2AGJL 5C08B 5DHYA 3KJ4C 4WUKL 3KJ6H 4ZOBA 3SDXB 2UV3A 3AMLA 1UENA 3QORA 1WTGT 1P84J 1OZUA 2CKNA 3QIUD 2B59A 3ROOA 1B3IA 4ODTH 1KNOA 3FSZA 2UX7A 3MRLA 1P1VA 2A83A 4KH2A 4QTIL 4WFHD 3U36A 3MRJB 1KTCA 4NZUL 4DK5A 3GBNL 4H0GA 3SHSA 2AK4B 1CO1A 4KTDH 1ESOA 3SYQA 5JIDA 3K91A 1EWHA 2Z31A 4TULH 3BVNA 2OI9B 4X8JA 4DGYL 1ZSDB 1Z66A 3C2SA 4P0DA 3Q6FA 1QSEA 1XGTA 3R1GL 1TEFA 3UTTD 3DKHA 4NO2B 4MX7B 2JXMA 5ALCL 2FSEA 3SGEI 3B2XA 3KPRB 7CGTA 2C3WA 4FNLL 4PW3A 1PD1A 1LO3L 4P3DA 4CN6A 2DI8A 3N42F 4WFED 1IGIH 4OZFG 4GPVA 4EIBA 1O5PA 4JGJA 1DCEA 2X1XR 4JFZH 1ZLEA 1BQLH 4K3EH 4WEBL 4HV8A 4Y0GA 1CFVH 3RI5K 2GYSA 1RU9H 2WXFA 1CFTB 1QTSA 3IMUA 3VM7A 1NC2D 1S78C 4PJ5B 3P02A 4BSVA 5ABDE 4N0UB 4MAZA 4Q6KA 4OCXL 1RJZA 4R9HA 5DD6B 5JR1H 3WEAA 3E6FA 4HBCL 4WHYH 5IW3A 2YRBA 2FZ3B 2VMFA 1OP5K 1HQRA 2QELA 3ARRA 3DRTA 3LDBC 3D2TA 2PWFA 3G9AB 3QHFL 1QOKA 1E8XA 1AY1H 5BPPA 2UXFA 3K0WA 3D0VA 3IFPB 1KPRA 2BSED 2FEDC 4MKMA 1AG6A 2ZUSA 4JDEA 5C0IB 3CVIH 3D3VE 1NCBH 5B7EA 3BP6A 5ITBH 1EZLA 2F54A 4P23D 5D70H 2WVSA 1E9PA 1G5AA 2O72A 1BEYL 1GW6A 5FKPB 3FU7B 3LJ3A 3L3JB 3O4OC 1EMTH 5LGJB 2HX7A 3FFCD 3ATFA 5EUOF 4AC4A 3ZKMC 4N2CA 2BSCA 4U1JB 1QRNE 3ZT6A 3KPTA 5CEZE 5GRYA 3AACA 4A2DA 5EUOA 4YSSA 2HH0L 4FEMA 2XRAH 4FADA 4NKOB 1VSCA 2Y1VA 3R1GH 2AJSH 4JFFB 5HDWA 4UNIA 1MFDL 4G7VH 4LESA 1RKRA 1QFUL 1WBYB 3MUHL 4JFEA 4AQZA 4OBRA 2QPEB 5J11B 4OGQC 4ANKA 5FYLD 4YR6A 1DJXA 3U30C 5ACZB 3KH4A 4Y16B 3EJCA 2BDNH 1AXTH 1E40A 4FFTA 5JUEH 2YJQA 5C0ND 1ONQB 3UZVB 5AB9A 1WH0A 3HC0B 5EIIA 3SDCA 5D1XE 2JLPA 1IGTA 2AITA 4HGKC 2CJTA 1FAIH 1X5XA 4PRPE 5GRVK 4DVRH 4EDWH 1NAML 4K55A 4S1QH 3GIZL 4G6ML 4HMEA 4OVVA 4LIQE 1MHPH 5JR1L 1JDCA 1LDPL 3VYOA 4M9OA 3NIDF 4YUEL 2QQLH 5JIQA 5L2KE 3PAZA 1HI6B 1WQVT 3GS4A 2PKDA 4NQTA 1XGYH 3B43A 5JQIB 4MNQB 5D6CA 4P2QD 3L9YA 5AB0A 2P44B 1XMEB 5C6TH 4I4WA 3TXAA 3LRLA 4QHNB 4EZLA 1NMBL 1QW8A 3BIKB 4XPHH 2DBJA 3A47A 4YDJB 1I9IH 4X4ME 3TV3H 2VE6A 1J8HB 3IMVA 1NGYB 2VZ3A 5F21B 5F9AC 5BV7B 3Q05A 1J05A 4NERA 1XSJA 5C70A 2ZKYA 2XPZA 3K3QA 2BNQE 3HR5A 4YC2B 1P4LA 4CSZA 1K2DA 3VRJA 5I8CB 1SJEB 1MN4A 3BSZA 3CFMA 3QUYA 2R0LL 4CVWA 4GKZB 5IVXA 3GSUA 1E9OA 4Q74A 5FC9A 3TN0A 5GGSB 5KYXB 5FF6B 3Q13A 1N12A 1SBBA 4IOSA 3ZZ1A 1AGDA 4OLXL 4JO4L 2J12B 3RVTD 1GY1A 2IH9A 1OM3H 4BZ2L 2EIEA 2VDLH 3JTBA 5DJAB 3ARTA 5JDSB 3AUWB 1JFQL 2EYTB 2PXYA 3E3QC 4HS8L 4CJ1A 1JZJA 2HVKA 1AC6A 1AFVH 2ODHA 4O02H 1EXUA 3KPRE 3WFBL 2A0LD 4J8QA 4OZIA 2HWZH 3HZVA 5DVOA 3CZEA 3U9UA 4GY4A 4KY1H 1FVCA 3BP7A 4JFFD 1CFNB 1FGNH 4F5CE 1ZSHA 3BEVB 4WFFE 1HHKA 1E9OB 4QWWD 4X8XA 2YA2A 2CCLA 1I4FB 1XGUB 3QWNA 1W2KT 3GK8H 3H0TB 2EO1A 2EH7L 1RCYA 1T1ZB 4JPKH 4UOJA 5T1KD 1MHPL 4DVRL 3QEGH 3GIZH 4G6MH 3UJTL 1E2WA 2DDQL 2Y7OA 5B8CC 5HI3C 4HH8A 2Y7QA 4K94C 4NPYA 3BPOC 4UB0H 4OCRL 4XPBL 3NQKA 2NQCA 4PGCA 3N42B 4UMGA 1YMHB 3ZR5A 3VD2A 3CIQA 5KAQF 1KB5H 4KQ3L 5IBUG 1J5OL 5GGVL 2KYIA 2DQHL 3LD8C 2W65B 5HDRA 3GTVA 5JHLA 1CFSA 2ZSWB 4XPTH 1KC5L 1GJWA 3V4VH 5E94A 2WIIB 1KLGB 2C1PB 3L5WB 4H2AA 3Q2NA 3H9SE 5CLZA 1DLHA 1UZGA 5A40E 4FQXD 4TNVK 3S88H 3DOHA 4G72B 4CUCA 2BMKA 1NSNL 1GGBH 2F7IA 3WE6B 3H7BB 4FNPA 1QWNA 1TMCB 3MJ6A 3PWLA 4ATWA 4XNMB 3QI9B 1L5GB 2EDLA 1E6JH 2XIDA 3VXTB 3TCLB 1D5RA 3NEEA 3IDXL 1NCAH 4KROB 2XV3A 3VGGA 4A2HA 2CXKA 2WAHA 3BD3A 3FT1A 4N20A 5FYKE 3KGTA 2YSSB 2VWEE 3QQ9D 4XN5A 4OF8A 4M48H 5GSVB 3WEXB 2KS0A 2DEXX 3GS7A 2B1HL 2C7UA 2W38A 3SZKC 2J1KA 3MROA 4TVUA 1E4WL 3B1TA 4IRSC 4N8VG 1L0YA 2KH2B 1NCCL 1NINA 5IEKB 5F6IC 5C0DA 3DXAD 1FUNA 1UA6H 1F45A 2DPKA 3JWDH 4JO5A 1EFXD 2UUDH 4U05A 1SDDA 4NZ8A 1DQQB 3I02A 5HHOD 3EKCA 4HJSA 1MI5B 4NZRL 5HJ3B 2DICA 1H3XA 2D3LA 2V37A 5H8DA 2BY2A 5C2UB 2X44D 5E2WH 1T1XA 2IAMB 5AENA 4ZMTA 1KGCE 2E9BA 3BZ5A 4FX5A 1PX8A 1NIAA 1NOLA 1AH1A 1DTUA 3HI5H 2YMOA 1L0PA 2E27L 2ZCKL 4WHTA 3VGFA 3IFPA 3ILDA 5GGUA 2XI9A 3FUHA 4JPVH 3SDAB 4OFIA 3NZ8B 2LTQB 5IB1A 4CKVX 3LB6C 1KGJA 4G5AA 5DRXB 3EYFB 1NAKL 2X6MA 4C4KO 4R26H 3TO4C 3W5NA 3IAPA 4LKXA 3I2CH 5E2WL 4W9IC 1CT8A 5D1ZI 2YMXL 5GISL 2WN3A 2ZXCA 5DS8B 1CG9A 1Q9KA 2ZAHA 3CZJA 4HMCA 5K1JA 3ZUCA 1EUTA 3LN5A 3VH8B 4C56B 1U91A 4YL9A 2J8UF 3HHSB 1JNJA 4RMVA 2JJSA 4TULL 1R3IH 3T4AC 3WV0A 4WJ5B 4Q9BA 1FO0L 1S7UB 4JFQA 1R5WA 3BH8B 5JW5A 5AYUH 2QPFA 1SJXA 2O4EA 5D1ZC 5GRUL 4L5FL 1JV2B 3I74A 4MZ3A 3C60A 2YJLA 3HZMA 4GUPB 4RMWA 2LU4A 1VENA 4G5ZL 4JPSA 2WBWB 3ARED 1TETL 1F2QA 1TOXA 4AGMA 4LZKA 2EC9T 1OT2A 3GBEA 3BJ91 2AQSA 1EDQA 1T3FB 1HE8A 4LBEB 2Y3AA 4GEJA 1W72B 5JNYB 1MVFA 3UACA 4FLRA 4X7SH 2XWDA 4BINA 4ZFGH 4ODBD 1YYMH 3DV6B 4MMZA 5AL0A 4YX2L 2BZCA 5KTEH 4ZZKA 1NDTA 2XYCA 2DQ6A 3MNVA 2Q76A 2VDML 1E4KA 5IGXH 4RDBA 2ZTBA 2VR5A 3QJOA 2CGRH 3QQNA 3Q3GA 3N85L 3DO7A 3OWEA 4XVTH 4KNSA 2FBOJ 3CDZA 3R06B 5FW8A 2BSRA 3TESA 2UWEA 3TJEH 4N8PA 1KTJA 1X5YA 4PLJD 4XNXL 4RAVB 3WIFB 1CGSL 1XCWA 1F3DH 3AADB 3CQPA 3IXTA 4HDIA 2P52A 2XXCB 5DSCA 4YXLH 4J5VA 3R7QA 4PJFB 3C6LC 2G4EA 2WINA 3V4VA 3T09A 3STZB 5JORB 1YNTF 3MBED 2ZKWA 4JZJB 1ORQA 4UYQA 4QTIH 5D7KD 3C6LD 3TO2B 5E8EB 3VFRB 3LZOA 3OMIB 1FPTH 5F9OL 3QDME 1IM3B 3GXDA 5IGXL 1Q9LA 4U4IA 3H42L 2J8UE 3QJHA 1JP5A 1S7XA 4WUUA 1MHHA 4YXHL 4QRQB 2X4SA 4PJDE 2DQDH 3ZE2E 2R2BB 1QPPA 2B7DT 4HUCA 4JFXA 2PYEA 3MO1B 2OL3L 1TQVA 3CH8A 4NQVB 4P07A 1LWRA 4Y5XA 5J9PA 2ZKHL 1AD0A 5D72H 5HBBA 4HUKB 3AWEA 1HCVA 4P2RA 4FCAA 1U36A 3OJDA 3VXRB 5LHDA 2NY3D 3BEWA 3Q1SH 4Z7QE 4IGBB 4S11A 3HPJA 1ZT7A 4DPAX 4UF7C 2XNAA 2OMVA 2NUTB 3FQNA 2BDNL 4PHZA 3SPVA 1MAML 5I71B 4XX1G 2VDOH 3WS6A 1WZ1L 5HYQB 1NUFA 1NLDH 4PY7A 3C5ZA 1CS6A 1FFNB 2DQGH 1N64L 1QRKA 2DJSA 3QR0A 2J8UA 3AGWA 2OMXA 2CLRA 3N1FC 3MRFB 3D4GA 1C5BL 2VABA 3T3ME 3QG6B 1AHMA 2G5RA 2MNWA 5G5DA 3WN5B 2OMWA 4YO0A 4QXGH 3C6LA 2DWDB 3ISRA 5D2NB 4WY7H 4K5NA 2PN5A 1XCXA 4H8UA 2AI0H 1A1OA 3CVHL 4TSAH 3ZTJH 4WNQB 2CCWA 3ARGC 1I3RB 5C2BL 4Z8FH 4OI7A 2DIEA 5FPIA 5CCGE 4ZNEA 1AYOA 1NFIB 1HXMB 3K6DA 3OAZK 2VDOB 3Q3GB 1L7TL 1FYTD 4G6AD 4KROC 4BUQA 3JT2A 4PVMA 2Q76B 4A37A 4IOIB 3G04B 4NFDA 1Y6KR 5DHDA 1C8PA 3I50L 3V0AC 5DEGB 1T0MB 1YQ2A 4MXQD 4S0HA 1J10A 3DV6A 4MMZB 5IBUB 1O75A 3MRHB 4P4KB 4YE4H 2CBTA 1GGYA 1T80A 3RWJB 1JPGA 4QRUB 2DIAA 1SJHA 3GSVA 3KAAA 1INQB 1RH8A 1J0ZA 1E7VA 3DBXA 3DJZA 4GINA 4QF1B 5CJQH 3MKGA 3UTSB 4AXWB 3JT0A 3UOAB 2APBA 1EJ6A 4JB9L 1VLXA 3S4SB 1H3WM 1U8CB 1UURA 4TLSA 2B14A 1HH9B 5LBSL 4N9GA 2IALA 5D7LE 5JUEL 3ZDZB 3R4DA 1JFQH 3KCWA 4IRSD 2XN9A 4ES8A 5BZDA 3VWJB 5CEZD 3RL2B 3IE4A 1D2PA 4K9JA 2LABA 3BIAX 3DYPA 4MB1A 2JCCF 3ZTNH 1XL4A 4AC2A 3HRZC 1QZ1A 5KN5A 1CG9B 3VI3B 3WKYA 1TKWB 2QSQA 1UM4H 2F5AL 1JIBA 3VAEA 1JPSH 2VXUH 3QDMB 4J7RA 1WZKA 4W6YB 4ORZC 1PQZB 5LNEA 5HGBA 3RURA 4N2OA 3WEOA 1C5DA 2DQEH 4GOSA 4M5SA 4MQ7B 1YJDL 1Q72L 1T0OA 2B0SL 2EDFA 2E3VA 1BMGA 1UYWH 4GO8A 1J8HE 4WV1C 4OGYL 1NMBH 1F6LL 3ZKXC 3WAJA 2JH2A 1QSED 5E8NA 3BFQG 3T6ZA 2QTVA 3UH8A 4NWUL 1ZT1A 5A3ID 1C5CH 1FIGH 1Q90A 1TO5A 2YGNA 3PABA 2CUMA 3PGDA 3NYKA 3QEUB 2DTML 4MXWH 5HJ3A 4NKMA 4D0DA 2VR9A 5GIRA 4PLNC 1OGPA 1S78D 2V8LA 1YZZA 5DWPA 3GI9H 4RQQA 1MCQA 1IGJA 3Q5OA 4RFEB 5K93A 3TBWB 4XOBA 4XP9H 1FFPB 3HS0C 3G6JA 2ZWZA 4XZ4A 1IARB 3IWUA 3LVEA 4ZD3L 4JQVA 1N0XL 4W9KC 2Z9TA 3UBXG 2HKAA 4AGLA 3D51A 2BIMA 3KGRA 4YBHA 5IBLD 3G6JB 1IIKA 4MAUH 3D2UD 1W0YT 4A66A 2VW6A 3EO1B 5IB5A 4D3CH 3GSOA 5T3ZL 2YSSA 4IMKA 5K39A 4BFJA 2J25A 3SGKC 1CTOA 1JGLL 4U1IA 5HHQA 1ZVNA 3KVDD 1VGKA 5KSAA 2F7PA 4PRAB 2GAZA 2AEQH 4XCFH 4PLKD 3MTRA 3PDOB 1JJUA 3I9IA 4N6RB 3THMH 4DQOH 2GC7C 4U1LA 3G08A 3GBLA 1CC3A 4XMPH 1DL7L 2IFFH 3FPYA 1UM4L 5FV1L 4QRRB 1DLHB 2OMBA 1KEGL 1N68A 3VFSA 4X5QA 5I0XA 1F13A 5F9WB 3NG5A 1XB6A 4A6YB 4CGTA 1X6NA 5AOMA 2ZXBA 4S1DD 2QMJA 5E23A 2NY3C 1NCWH 4W9ZA 5ERWB 3T77A 1A7PL 1O6SA 3GSWB 3Q5TA 4J4PA 2V33A 1PQZA 1OGSA 3VQLA 3ZGIA 1PL3A 3C75A 4IGBD 1BD2D 4K3GA 5HD8C 1J5OH 1TSHA 5EMYA 1KJ2H 2ZNWA 4MXVF 2CHZA 5BZZA 1QI4A 5CBEB 1WP6A 4I89A 3SBPA 4W93A 2CM6A 4XMXA 3MUGA 4Y1TA 3PAUA 3WYRA 2P45B 2WIMA 4XHQA 3QPXH 1TLMA 1DVQA 5F93C 3II2A 3RPBA 4EEEA 5AZ2L 4GKNB 5C09A 2WD0A 3HMXL 1NDMB 4U6YB 4B53A 4HCRA 3WNMA 1EAQA 5KSAD 2VERA 1FNGB 2NZIA 3O41B 4KKPA 3ZKQD 3ERXA 2HTLD 1JSYA 1H0DB 2WCGA 3K6FA 1DE4A 1T2JA 3MXWH 4F3FA 3CCHB 4P2QB 4DF9A 3SO3C 2CQVA 1AIFA 1IGIL 5JHDE 1I1YB 2Z31C 3FAWA 3VRLF 2WBJC 1WK0A 2HX8A 5DVLA 3JWOH 3U0WH 4KPHL 5KOVC 3ILPB 1VFBB 2WSPA 1NAMA 5GGSA 5FYLL 1BHGA 5ETUA 2ADIA 1OLLA 1RIUL 1FL5B 5AAMC 2OFQA 5DLMH 2G30A 1NFIA 5CLXA 4OJYA 4Y1AD 5E5MA 4LASL 3UPRB 1T4WA 1CR9L 2HTLC 4X5WA 4A2FA 5F9DC 2FX7L 1FFOA 3MLTB 4MS8D 2FJFB 4K7PL 2LAAA 2MCPL 2L0DA 3HNSL 1QZNA 4P4KC 1KIPA 3C08L 3QUZB 2J8HA 3OAUL 1IGYA 1MCLA 1P69B 5G55A 3FFDA 3ECUA 3SKOA 1DVTA 4YDJA 3MRFA 2HG5B 3WKNA 1ZCRA 4PRPB 4OCLC 3SDAC 3ZY7A 1R6VA 5FA3A 5FFGA 1O9VA 4Q9QL 4I0PA 3IDNB 4UM9D 5HYJA 1M05A 4OKVA 4CVXA 1X9RA 2NSMA 3MRQB 3E2HB 3PDGA 5EOQL 4B96A 4M1DH 1D6VH 1TTRA 4I3RH 2ED9A 1X5LA 4IBLT 4C54A 2XNAB 5K33A 3L4TA 2XBTA 4P59H 3K6NA 2YAFA 3WTVA 5HYJD 4J1UB 5M7QA 1K5WA 4RAUA 3FUEA 1WSST 3VU1A 1KXQE 3H2PA 4TVSa 1THAA 5KANG 4AEFA 1XCTA 3CD4A 3QDJA 4M03A 4PG2C 4WTWA 5D7JD 1HQ4B 5IMOA 3VWJC 3GI9L 1NIFA 2GSMB 2K45A 3MBWB 4F24A 1L9NA 4GAYA 3X13B 1D5ZB 3VXSA 5IJBC 3TA3A 3B7SA 3N9GH 2YPLD 1U0QA 1OO2A 1GZHA 4X6CB 5ACZA 1MIMH 3EOAB 4YR6B 3JVFC 3NCYP 1R3LA 3IDUA 3IYLW 2DKUA 4UUJA 5IVNA 4JUTA 2YUZA 4MCYB 4AGQA 3ZR6A 5BV7H 1IL1B 4HLEA 1KG0A 5T33H 4DGWC 3RFZA 1IQWL 1WJ3A 3F6JA 1NEZG 1C08B 2GIMA 4R97C 3P11L 5AW6B 4Z0XA 5IBLC 4LARL 4APXB 2PCPB 3WTSA 2R0KH 1EEUA 3FU7A 3RPKA 5D71H 2ATKA 2OR9L 1KCSH 2BCKB 1EO5A 2LLNA 2Y23A 4GT7A 4L8BA 2GK0A 4WI9A 4A7GA 4AUYA 3CDZB 4NNPL 2NY6D 5DJ2B 4LFHG 5CGYC 1AANA 5TQ2L 2B4CH 3IM1A 3FTUA 5DQ9B 2DRUA 4GI9A 1D9KB 4EVNB 4ZTOL 3D18B 4PJGE 3ARBB 5BUGA 1QYGH 2YGVA 4JGUA 5HVWA 3D0VB 4U6HA 3O8XA 1M7IB 2I9TA 2Y7SA 5TH2A 4JVPA 1G7HA 2B5IC 2EDEA 1CICB 2CMRL 3VE0B 5CMAB 4PV1C 4Y7OC 4BRJA 2R4RL 1R19A 1Q0EA 3GMRA 4ADGA 4F7KA 1SM3L 3O3UN 2WYHA 3UTPE 5L8LB 4D0BA 1OAQL 4OLYH 2COVD 3KLHC 4P46B 1MFDH 3OKKA 1EGJA 4I48A 3WDHA 1I1AD 3A0OA 1LD9A 3LRHA 2QHRL 4WK2B 4X7FC 1NGQH 3ROLB 1OCRB 1S6NA 3APNA 1TNNA 1F4YH 5HGGS 1JWMA 1E4HA 1SHMA 2RJMA 2XG4B 5D5MF 3TPUA 4A1RA 4U3CA 3FT3A 5A16B 4XR8C 1HCYA 3NN8B 4NHUA 2ID5A 3O9WD 1DDHB 1L9QA 4H44C 5JPMC 4KRMB 1GA2A 1G1KA 2EACA 3UEQA 3BUYA 3ILEA 5FOBA 5TFSH 2Q6WB 1NDGB 2MCPH 3RJQB 3WIHA 5I19L 1VCBC 3OKLB 1MHCB 5FUOH 3PWUB 5F7EL 2LGNA 3T2QA 1CQKA 3B8SA 4H5SA 3GWJA 5CP3A 5CWSB 4NKQB 3QH3B 1OE1A 3PHOB 2EDRA 4HIIB 4RDQG 2ESVA 2VL5A 4ZS6C 1CGTA 3IDGA 4J8RB 4Z78A 2QKIB 1XZ0A 4S0SD 4JPKL 3LEVH 4R4BA 1ACZA 3RFZC 2AHIA 4XRCA 1PLGL 3B7TA 3P3UA 1ED3B 3QORC 5IMMB 3U1PA 4CNIA 4KK5D 3EOBB 1IC5H 2OP4H 4M5ZL 1F18A 5DFWH 3DK0A 1QWHA 1GPOL 5BNXD 1ZS8A 3K8KA 5EEYA 2NXYC 3KVQA 5I0VA 3ZMRA 1I1AA 3OB8A 4U2ZA 5JXAH 4F37K 4LHUB 2E7LC 1A4BA 2WP3T 4MAYD 4RA3A 4RX4D 3IDIA 2XKNB 3SY0B 3RPIB 3GRWH 2I27N 1ZT4B 1OIOA 3BDYL 4PJ8B 1JNHB 1AQMA 3S37X 1OB1A 4MVBC 5C6WH 3KVPA 4X8GA 1UVQB 1XEDA 2VKXA 1OAQH 3QA3A 3P9LB 3CZLA 4UQ9A 4XWGL 2W0FB 2X05A 3MOBH 5LB1A 2N7BA 1IC5L 2OP4L 3AREC 3M8OH 4N1CA 4DN3L 3LYRA 2D03H 3GNMH 3BXNA 1DANT 4NEHB 1JZ4A 2XWCA 2KDGA 1F0LA 3LN4B 4M4RB 4KRLB 3DIFA 1PZSA 3QI9A 4JFDB 2IBZX 2WMPA 1IX2A 3QRGL 3SBWA 3VD7A 2XQBH 4IS6B 4IIQB 1DO5A 2A6DB 3HRPA 4U1SB 3UX9B 3BKMH 4DP0X 1NMAH 3SBRA 1S3RA 3Q8BA 2W0LA 4ZMZA 2MKWA 3FB7A 4PJBE 5E00B 3M1CA 4YH6A 2OR9H 2WQXA 3M8OL 4DN3H 2VDRL 3GNML 1FLRL 1R0AL 5F0LB 5F88B 4H8HA 3HBZA 1OP3K 3HG1E 5EEZA 3MOAL 4HKBA 5F1OB 3VSQA 3ZDYB 5J1AB 5JHMA 2MNUA 2VJXA 2M8XA 1N26A 3K5RA 4DQOL 2X4PA 4U0QB 1D5IL 3VI4E 5KS9E 3JWNH 5E51A 4TQPA 1HESA 4UT7H 2BCMA 2AEOA 2WAQA 3RFRA 4AK2A 2EH8L 4U7SA 3PHSA 3WNIA 4YHMH 4BH7A 4WENB 3WS3B 1WFNA 1BVNP 1XSIA 4UBDC 4YN3A 3S3JA 4F8NA 3TBBA 1KJ3L 3WL9B 2VLLB 5MI0B 1REIA 1A9BB 2JJVA 4FI6A 5DUPH 1A7RH 5HI4D 5TE6H 3IDYB 1IQDB 4GQQA 1KCVL 1SM3H 5DUBB 2X4RB 2ICWB 1IQDA 5A2CA 1A65A 1QA9A 2X6CA 4TNVF 3S35H 3UJJL 2YEZB 3UAJC 4BWTA 4Z3HA 4Z7NE 4EF3A 4MKTA 4FYQA 4E41D 4OZ4B 2BSEA 1MFBL 2BW5A 2OZ4A 1DJHA 2RD0A 3O2DL 4DZ8A 1B2WL 5JZ7C 4XCNA 1VGEL 2AJUH 2C34A 2QFPA 3TJHD 2ZONA 1UXWB 5KBMA 2IBBA 1JFHA 4KHXH 1CTNA 3TOPA 3BKYH 2WXGA 4MMXC 3HZYB 4P46D 1NPUA 1OSZA 2CR6A 3HR5B 3FB6B 4HKBB 1U8KB 4ZW3A 4K7PY 4NO3B 3STLB 2A4EA 2ATPA 2E74C 4Y2OA 3ZLQC 4LLVB 1BPVA 2HG0A 2VE6B 4UQDA 4LEOB 3EJSA 4IKLA 3IT8D 5EO1A 4PB9L 4ILDA 1KBGH 5FA4A 4HULB 3BIKA 3UABA 2C3VB 2G3MA 4FFVD 5EUOE 4XMKH 3TJHC 4LQFL 4P5KA 5CD3B 1AKPA 2VYRE 1FAIL 5D6CB 2CR0A 4UQ3A 4YZWA 2L3BA 1JNLL 1U9KA 5C71A 3D50A 3V8CA 1NBVH 2R51A 3EBIA 4FXKC 5D6DA 1DEDA 1I8LA 3MLUH 2W88A 1UEYA 4WFEE 4GUQA 5CJOL 4BE5A 2V7NA 1DCLA 1E5YA 4BD4A 2WZPA 2W0FA 2XQYA 4FCHA 4F9LA 5DI8B 1PKQE 1D7FA 3RZCB 3WCYA 2DH3A 2UVEA 4JPWL 1BXUA 4G7YH 4ELME 1UWXH 2NRDA 3Q1EA 4EPSA 1BQ5A 4Z7WB 5BW7A 1JTPA 4R7DB 2G5BA 4UBDD 2ZUQB 4IBSA 4CADA 2J1WA 1DBBH 3P0YL 4ZSOE 2IADA 3RJDA 2J5WA 2ZX7A 2KL6A 4J3TA 4FS0A 2BOBA 4MBOA 1T1YA 4RBPH 5B38G 1Z9LA 5IW6B 4NRXB 4X9FA 1AZBA 2NW2A 3C12A 4CVUA 2SODB 2XQBL 1XZ0B 1A2YB 3LHPH 2N56A 4N22A 5DURB 2DYRB 2CLZA 1F1AA 4BELD 4R8WH 5K9JL 3HZKB 3VQ1C 3FT4A 4XXCC 5DHVH 2XQ0A 2D0GA 3I85A 4YSTA 5FYLH 2ISDA 5G2NA 3OGCB 4OAWA 3PWUA 4YK4C 3P2DA 1G7LB 1MLBB 3DVGA 3RWFB 5CJQL 1KY6A 1NLDL 4ELMA 2PUQT 3WIIH 2WUCH 2H1XA 3OQRA 1RZPA 4S1SL 2XLLA 3VRIB 4BUGA 4P5TA 3DRQB 4JJ5A 5IF0A 3IU3B 4IDJH 3HW7A 3PLYA 1RU9L 4ATTA 2CUIA 3DSFH 1VZIA 4XCCL 4F7MA 3BZEA 4FHBD 2ROXA 1UWYA 1MFAH 1J12A 3RL1A 1R1CA 2XICA 4WRLA 4Y9BA 3E2HC 2NXYD 3NIFE 3MRGB 4MS8C 2ITEA 2PPDA 4GSDL 4DEWA 3UC0L 1DHKA 4EUPH 1ZMYA 2CKBA 1N8OE 1QW9A 1AGEA 2Z7WA 4MJIA 1M42A 1J1XH 4GIAA 2CKBL 4I5BA 4FMVA 5CS7A 3R7RA 5KYYA 5D4JA 2HVJA 4JDVA 4Z3IA 3L2MA 5C08E 2VXQA 4NO0A 4OJFH 3K6OA 1A7OL 2GHZA 2WQVA 2VXTH 5E6UB 4DETA 4QRRD 2IBZY 1HZLA 4YS4A 2ALAA 2ZWSA 3K8LA 3TC9A 2JSFA 1CGSH 1O7DE 5KYNA 1CD8A 4DSYA 1UB5B 3CDGA 4FQ2L 1D5BB 4AV4A 1TTCA 1RZ7H 3GRGA 4PS7A 2P8PB 2AJ3B 2ZKMX 3HC3H 3LH2H 3REWA 3QFJE 3QK0A 4IHBA 4N0FB 2PCPA 2ZSVA 2GTZA 3V0VB 4RGNB 5T3ZH 4C56D 3HB3C 2OK0H 1CURA 5I1JL 3H9SA 4DOHE 1C08A 5DTFB 3IXAB 3WMPA 5I17A 3IJ8A 4FQXB 2ZCLL 5E2UH 5B7FA 1I7ZA 4FP8H 2DLTA 1OWRM 1ECZA 2R1XB 3P73A 5JTWA 2DJ4A 2PPCA 5C7XL 2A5UA 4D3CL 4HXAL 4JKPL 5E9DA 3BP4B 4YHOH 4IW4C 5GS2H 5K1NA 2YAHA 3ARBC 3FUMA 3MSPA 3V4UL 3C60C 4BSWA 3D85D 4MMYA 5L7XL 4G71B 1QHQA 5L88H 5AD0B 4E2OA 3L48A 5DA4A 2BIHA 4BA8A 4I3SL 3MNZB 2MQ3A 4GH7B 1K5NA 2P4AB 4HD5A 2HFGL 3DMMA 1UM6L 2V5RA 4I87A 3VD3A 4F7PA 2Z65C 3TLRA 4GP8B 1T89A 5GGTA 5IQ9B 4KJPD 3UP6A 2XV2A 1KN2H 3F05A 3OKEA 1SMDA 3EF4A 2CU9A 3OX8B 2NXZD 3AC0A 2C8NA 4MMXB 3V9EA 1HJCA 3C8KB 5TDNA 5I23A 5SV4A 2IQ9L 1GH7A 4CC4A 3IDNA 5E70A 4LCIH 5TDOB 2VMCA 2HT4C 3FOMB 3ULSA 4PRPA 2X0VA 1XQ4A 3DNKA 4Z7VB 5EEXA 1F3DJ 1RUKL 2AI0L 3ZTNL 2V8MA 1U8IA 5GGRY 4OF0A 4HS6A 2J6EA 2DQHH 3GMPA 4GKSB 1LE5A 3H55A 2NXZC 4H2CA 1Z1WA 1PAMA 1BJ1H 1X5MA 3LV3B 5SWSA 2EVGA 2NMSA 4MCZA 1LQSR 3LQZB 3LPGA 5A2AA 4Z7WF 1IGCH 5EB9A 1G4RA 5IT2H 4D8PA 5AUMA 1JXDA 3VXMD 3GXNA 2X89D 3DI2B 3MHZA 4ONFL 1W0VB 4ODXA 5IKCA 3Q43A 1BZEA 2NNAA 4OCMC 2HJKB 3ARDD 1SMAA 2JV6A 5IIEA 1IKFH 1D3CA 3MX0B 4K5OA 5EU3B 1SEBB 3FFCA 5I8KH 1Z0MA 5DURD 5EBGA 4E9LA 2YAMA 2BOLA 5GJSL 1H8SA 3AABA 3UBXI 4JKLA 3DOSA 4CC0A 3QQ4A 2AV7B 2ZUUA 4M48L 2F1EA 2QFRA 4BHUI 5I75C 5IT2L 2P1YA 2W8CA 3PIQA 3X3GH 2FEEI 5F8QC 1WHOA 4QI3A 5J56B 1H3PL 3WNNA 2VERN 3K0YA 4YXHH 1OK8A 2DY2A 3I84A 1CBVL 5B1AB 3WEMA 1T2QH 2Q3ZA 4PTUB 1HHJB 2BSBA 5DUMH 1KN2L 2EICA 4QAMB 5C1MB 5JHLH 2Q2LA 2IQAB 3QIBD 4GSQA 2W9LA 4N2NA 4OIIL 2D7MA 4PLJC 3I3BA 3HI5L 4JRYB 3HC4H 4R5TA 3DJRA 5CP7A 1A25A 4NZFA 4E9QA 2BRRH 3PGCA 1LLAA 4LQ1A 2A1WH 3S48A 3CBKB 1OTSC 4W9GC 9CGTA 2ICCA 2EEAA 2OZNA 3PWPE 4Y4KC 5CSBA 4Q9RL 2FX9L 3KS0H 3LIZL 1IT9H 3HNTL 4OLUH 4ZTPL 4YIQA 1UGNA 3HVNA 3PDOA 3BAWA 2JIXD 4JG0H 1D9KD 1FZOB 1H3UA 2AJXH 2FLBT 1JDAA 4KGJA 4JY4A 1WGVA 3CFKA 5DHVB 1U58A 1ZLSH 3O0RH 1ES0B 1JUFA 2FX7H 3V2AR 4HUUB 1DBML 3ELQA 2XIBA 2GJZB 4HLZG 2FNBA 4L29B 5AW2B 3M17B 4KKAD 2ZJSH 1V55B 3CQFA 3H3PL 1KC5H 2P5EA 4ZBJA 1NOFA 3D87B 2P42B 3DROB 2VQUA 3ZTCC 3SPHA 3U6XS 1FVEB 4O5LH 4NENA 5MEPB 4FYSA 5DD1L 1BF2A 1S7TA 5BW7C 3VQ2C 1ND0A 2YGQA 2F74B 2AQ2A 2FK9A 3AROA 4WI3A 4YL4A 4DEUA 3S88L 4UIKL 2Z8SA 3QVAA 4B3VA 3P69A 4D9QE 2V5TA 3IAQA 3CHSA 4FFYH 1BXVA 4H88L 4KXAA 2EECA 4L23A 1Q0YL 1C1EH 4BFEA 4R5VA 5I2IB 4X50A 4AW7A 1JD7A 4MCZB 4WTQA 3RYMA 3SE4C 4NRZB 1HIML 3QIWD 1WAAF 12E8L 3LEYH 4QRPE 1YECL 4XVTL 4F15C 5ANHA 4YSAA 3GT6A 2OS7A 4FABH 1NEUA 4PJ7A 3ATAA 5D2LF 4DUWA 1TF4A 4QNPF 3KXFA 4EZMA 1KV7A 3A3YB 3MPCA 4WK0B 1WA2X 3QUGA 3MJ8A 2AEPH 3GSRA 4QUOA 3ABZA 3CDCA 3DECA 2WKGA 3O3EA 1EAJA 4HPYH 4Y19A 1J48A 4YVNA 4XOCA 3TVMD 1DQMH 1G0DA 1J9QA 4WZ9A 3T3MB 4ZTPH 1A6TA 1S7RA 2F5BL 2ZOTA 1JVOA 3QUKA 1TZIB 4IRJC 5DJZB 5IJVB 4RESB 4DZBA 3W9EA 4LSVH 5AVUB 3BGFB 4KTEH 1BBDH 2WKOA 4NOBA 1QNIA 5AVWB 5TFSL 4IMKC 1UWGL 3OXSA 1INQA 4NJ9L 5JW4R 3KW7A 3CSFA 2HJFA 2JJTC 3HCVB 4I88A 4Y5VB 4LXFA 5E9AA 2JMRA 3U0TA 1A6VH 3ETBF 4KVNL 3CSGA 1FZMA 2F53E 4JFPA 3S7GA 3P4MA 1KYOK 5CSZA 1LHZA 3MRHA 4AQEB 3SDDC 4F1SA 2VR7A 4P4RB 4BQBA 2G4GA 4XCYB 3U6RA 4JHAH 4PJXE 4EN3A 3VXUB 1MDAA 4L37A 2GJJA 4J28A 1OL0A 3T04D 1BF8A 2JCCE 1MWAB 4Y9GA 3K2MC 4KX9A 1I7ZB 3BCDA 2A9AA 4YUEH 1G87A 5L2JB 4X4YB 4M5TA 5DTFA 4XBEL 1FF5A 2FJHB 1UJ3B 5F7FA 4OJDH 3DX2A 3RNKB 3TYFA 5HYFA 1UOKA 4H0HB 2WCSA 4Z7UA 3GZOA 2XV0A 1IBYA 3S36L 4ZD3H 4W6XB 1BAWA 3GJFB 1J9TA 2A1WL 4HK0B 3CDGB 4HWZA 3GSNA 3V9CA 5J11C 4ANUA 2B39A 5CCKH 2BW4A 4MQTB 4NNXA 4CVZA 2EEFA 3QIWC 4G11A 3PQYE 4BQ9A 4EN3C 1EVUA 2FX9H 3LIZH 2OX5B 4B50A 4D8OA 3IMSA 3FQNB 3HPJB 3GM8A 4WSGA 3ZE0B 1EDHA 3MRCB 5H94B 2VUKA 4JRYD 5TJWK 2FWSA 2OCFD 2Y0SA 3WFHA 5BO1L 3MBXL 3FPXA 3K1KC 3G6AA 3WXVL 2X1WL 3TVMB 1IBGH 1AD0B 4P2YA 1MH5A 3UCQA 5I1HL 4NUGH 3K2UL 3KYOA 1HILA 4GQ9L 1UD5A 1AGBA 1YMMA 3VA2C 4NQVA 4DGVH 3MO1A 2DQCH 2VDPL 1KELL 5GXBB 1CFQA 4LB8A 1BZ8A 5CEYA 4FXGA 3QUXA 4XP6H 3V10A 1UA7A 4L8DB 4KKLC 4K3DL 1Z5LB 2JQAA 3CFBB 3LH8A 5F1KC 4ZFQA 2XG5B 2P43B 5CHNA 3TX4A 2KDYA 4OZHB 5DQJB 1VZHA 3S2AA 1ZGLB 2GFBA 1Q9LB 4PIRF 1A6UL 2C4FU 2ZOWA 1QAWA 3VB9A 4LNVA 2D9QB 2XUWA 4IK6A 4R90L 2VLKA 3FB5B 3GUFA 1GRWA 3VRIA 1NGZA 2P5WB 1UCTA 5DJYB 1VB9A 3LNHA 3LPOA 4ELMF 3BQUD 3O2VH 4LCWD 3O3BA 5DMIH 4KDTA 4ODTL 3T2LA 4OAWB 2AXGA 2EKSB 3A22A 4JRXE 5TDPB 3SO5A 3QQ9C 4M8RA 2GSGB 4N86A 2ZUVA 4LRNL 3L3KA 5F2FA 4X6EB 4IKKA 5JHAA 2CLZB 5HPMA 1SNRA 3B9KA 5EC1B 4DPCX 1FN4B 3MNVB 4JAMA 2GW5A 2A38A 3KYKH 3QIUC 5EO9A 4HHGA 1CYWA 3MA7B 3VG0L 2ZKHH 4E9VA 2VAAA 3FONB 5I1GH 3RRQA 3SEPA 4GMSH 1P9MA 2QKSA 3ZRSA 2X0UA 3RGVC 5BOZG 3QDHA 3RHWF 1H3GA 2NY0D 2I7SA 1A9EA 3H2WA 3B6SA 2C9PA 4G2AA 5KSUA 1AZUA 4TLKA 1BD2E 2IF7A 2ZCLH 5E2UL 1SOSA 1FL3B 2B4CC 3L2NA 2IADB 1NSNH 5GRJH 4YDKH 5FO9B 4IU3A 1MF2L 3LS5H 4FXGC 3DK2A 4TQEH 4ZMPA 1FLRH 1HH6B 5IOPB 3MKKA 4PJ7E 1KYDA 4K8RC 5FGRA 3FOLB 1PEZA 2EXYD 2F68X 4PJIF 4KVNH 4LLWA 3AXLA 4FQHB 1RP9A 4L1SA 4I0KA 4ZDHB 5CILL 3RKDC 4KAQL 2UY7B 3QZPA 5CJ5A 3SQBB 2NX5D 5J6HB 3TZVA 2Y2TA 4MA8L 5CIPB 1NUDA 2Y5EA 5JHDA 1I8MB 1T5XA 4KITB 2IPKA 2C7FA 4TNWF 5H37H 2PYFA 2YD7A 2ZG1A 1KB5A 3CSPA 3QO0B 1ZLVH 1X4ZA 2JF1A 4IJ3C 4HOXA 2D03L 4H25A 3VTMA 4L8SC 3RG1C 1SPDA 1KIQB 4Z5RA 5T5FA 4RFOL 3Q0HA 1BGXL 1V10A 5EDSA 1RUPL 3FCSB 1KCBA 2HT2D 3IGFA 3MCKB 3NRFA 2IWGA 2G5UA 3RUGA 2XVLA 4JN1H 1N70A 4LEOA 3SDCD 1SVZA 3QULA 3S3SA 4N68A 2HRPL 1YEEL 2WLJA 1I7UB 4Z0BL 4Z7AA 2CM5A 2OYMA 3D0AA 4B5EA 4OR1A 3P9MB 4X4MA 3FB6A 1ICTA 4W4NA 1VFMA 4IRJB 2OSLB 2WZ0A 4Y8AA 3V0FA 3VFOA 2VLMD 1HEHC 1SLWA 4NKDA 2G60H 3V4PA 5DZAA 1GZQA 1R3JB 1YAIA 4FQLL 4EQ3A 1BGXH 3JZ7A 4ZW7A 5SWZB 2WVVB 3V4PL 4NQEB 4HIHB 3NIDE 5E4AA 4ZMOA 5MEQA 5IVXE 5FECA 3MLZL 3BLBA 4KRNA 1HL4A 4ODWB 1OQOA 1UT1A 3QPQC 1LJMA 4N8VA 2BH0A 1X5GA 4NWTL 5DRWB 5INDA 5IB4A 3LRKA 4PBVC 1CU4H 4Y1SA 5DJDB 4EI5A 1WC7A 3QG7L 4OSUL 3RUGE 1K4DB 1FDLL 3O6LL 4XCFL 4X2UA 2Z92A 3BP5B 1J5DA 3OQ3B 3ZDYE 4LF3A 2WWMD 3ML8A 4I0PD 1U3NA 1I8KB 1AMYA 2O5XH 1JXJA 1TZHB 3R0MA 1CJYA 4F2MB 3CFJB 2BMKB 2XN2A 4UINH 4QRRE 4UDTA 1HCZA 1G7IA 4Y8DC 1I7TB 1R3HB 1HKFA 2Y06H 4EDXB 2BVPA 5FGSA 3FC8A 3UC0H 1XGPA 4PJFE 2H1PH 5TGBA 3ABLB 2K8MA 5E94B 5A3IC 4XMZA 2X4QA 4PUBL 3EGSB 5CLYA 2JELH 3I6GA 3NIFB 1P4IL 2XJLA 2W65A 2B3IA 2HB0A 3O6KL 2A77H 4OI8A 1SMOA 1TJIL 3ISYA 2OTWB 4WO4B 5IV2B 1G7QA 1LWJA 3HG1A 5EPMA 3B2PA 2K1MA 2HTKC 2ZZUT 2H2SC 3OZKA 2A9NH 3SDYL 3RIKA 1R3IL 1XTMA 4N6QA 5D1ZB 4YE0A 3CLWA 1FYTE 4B41A 1AKJB 3M07A 2F61A 4UT6H 4R3SA 3BW9B 1EAPA 1U92B 5F7AA 4EUPB 4R96B 4TYUA 1KXVA 3BN9D 5FYKU 1S9VA 2R1YA 3BXNB 5IROC 5LQBH 3M1BA 1F11A 4R8WL 2X1OA 1MQKH 3P3TA 2AQNA 1XF1A 2J20A 3BAKA 1G1CA 4I8DA 5SWZD 2MCMA 3WG7B 2Y5TB 1XGRB 3S8WA 1ZVHA 3SKNB 3WJLC 4PJ8A 3ZDXF 3CHXA 2DIBA 2IBGA 5L4IA 2ILLA 3FQTA 3MV9A 4PJDA 4YDVA 1LEIB 3VSUA 4OTXL 1FP5A 1GTNA 4W70A 5I66B 4YSEA 1YLBB 2C9UA 2WVVA 2VSCA 3IJYA 4UQAA 3TN0B 3N50A 3SDDD 1X6LA 2MPAH 5L7XH 4OCWL 1AZRA 3OZ9H 2JNZA 1MCOH 1KXVC 5T1DH 2YKLH 3EJZD 4MJ6A 3GKZA 1MCJA 4LNRB 5HJBA 3NZHL 3DETC 1RY7B 2JI1A 2PWDA 4Z7VE 2QKIA 3TT3L 1CGUA 3FUDA 2IMMA 1BLIA 1H3VA 4PJBF 1D6EA 3GK8L 4O2FA 1S7VB 3RIAF 4XPFH 2HMIC 1MRDH 4FQ1L 2WYZA 3MRPB 4ZX3A 4PREA 3ZOAA 5LCVA 4HAFA 2DI9A 1A5FH 1EEYA 2C9XA 2D4DA 4TQ8A 1PG7L 2DWEB 4DKFL 1NLBH 5JPNC 2EINB 3SCMC 5BQ7B 1TQBC 1BBJA 1KTLA 3QDMD 3HJEA 3IBOA 2V2WB 3BZFB 3FRPG 5DJ8A 3TEYA 1NFKA 1AHKA 1B9KA 1XF3A 4QMEA 3LNDA 2XG4A 3ULVE 5D5MA 3CXHJ 1R5VA 4GG6E 4NSKB 2W95A 1GCFA 3SDCB 4JHZA 3AXLB 3ZYJA 2WY3B 4JREC 5BVPH 3BWZA 4LGRB 4LHJB 1RJYB 5FK9B 1QUPA 4NDMB 2PP8A 4JM2A 5BZWB 2ADGA 3V9FA 4Y16A 3RWDB 5JPNA 2NTFA 4D0BB 3AM8A 1JI2A 1WICA 2VOTA 3IMWA 1DBAH 2I5YL 3RWEA 3SB3A 1NCNA 1RVFH 3B6SB 3QDJE 2X6AA 4IRSB 2OYLA 1F00I 4DTGL 3O8XB 2Q8BH 2UY6B 1XD1A 3D18A 4R0LA 4WUKH 5E1AB 5FGCE 1NGWB 1DQLH 4Q6IB 2CO3A 1G94A 3KEDA 2BNRD 3OPZL 3ARGB 3D2UB 4HIJA 4NJAH 2VO8A 3QS3A 4IHOA 2F8OA 4ZMWA 1GSMA 3IGAB 5T5NF 3QFJD 2X4TB 3VFPA 1OGTA 1FV1B 5F7MC 4BK5C 4UAOC 1GKOA 1UASA 1MCKA 1NGWA 2WLKA 1WITA 2CMRH 4LSPH 4RNRA 2VKWA 5D7IF 4FQQB 4WEMB 4NM8L 5C0BE 2ZOUA 1QEWB 3I75A 3PV6B 1FBIH 1YEGL 5IHHA 4H13C 5JIKA 4QXWA 3WD5L 3U4EB 3CFBA 3FDWA 3EJUA 3KM2A 4L8DA 1PSKH 1S5HB 4E5XA 4XVJL 3OXRB 1CFQB 2R0ZH 3QEQA 4AYGA 1LO4H 3RGHA 4N0UA 4XPHL 4FAAB 5BJTA 4YFLI 4XNUL 2BOCA 3MRRA 3KPLA 5HHOE 2YSTA 1RZGA 4DH2A 4E41A 3WE1A 1A6ZB 5JXEA 4TXVB 2QADB 3WTYA 3F7PC 4O2CA 4XBPB 4Y5XC 1HXYB 4GS7B 3TVMC 1SXAA 4GRWE 2WOYA 3QZBA 1RIVL 3E8VA 4M1CC 3QNZA 4R2GC 5JIPA 5KANI 3ARFB 2DMKA 2F54E 2H5UA 4GQ9H 2XWRA 4KH9A 5D1ZD 4CN1A 2KPNA 4U6XB 2XTJE 3UBHA 3FU9A 4NNXB 3AQXA 3WKMH 3FH7A 3NRPA 2X6BA 4NO2A 2X4NB 4G59C 4K7FB 2JFCA 3DSFL 1E5CA 1QRNA 3NGBB 7FABH 2PO6A 4QJ4B 4PI0A 3QUZA 1NFDE 3F83A 5ANMA 1PZAA 4X8CA 4LRIA 3O6MH 4P2OD 2EE0A 3KPMB 2E7BA 3L3DB 1BIIB 1NIEA 3TYGL 3TL5A 3LZLA 2FEDD 3SD2A 2IDSA 5D9SB 1A22B 4KHTH 4YHNB 3KLHD 1BA9A 1HHIA 4CU7A 5ETUB 1WUZA 3AITA 2LVCA 2VJ8A 3GXPA 1IBFA 3HE6B 1FORL 3FTXA 4YAQA 2BP0A 2Y3NA 1K6QL 1SOKA 2HPOA 4IKJA 4DKDC 5I15H 2O93L 5D96B 4PGDA 3L4VA 4JZJC 5E6IA 3V0IA 4DVBA 5I28A 1I9EA 3H9HB 3ESPA 3RY5A 1ODAA 2MJWA 4NQXA 4RFNB 5E9DE 1QBBA 3GMMA 4G8EA 5GGRA 3HPLB 2R4SL 3GFUA 3A67H 1OSPH 1BQUA 3P9WB 5FUOL 2PYED 5JQHC 3JWNG 1A6WH 3TEXA 2Z93A 2PPFA 4K2UL 4ELKB 2JKTM 3QGVA 2DLIA 3TN0C 1Z2KA 2CLVA 4OLWH 2R1YB 4HISA 2OXHB 3PP3H 4WGVB 1XIWA 4WI7A 5DRNB 2QJDA 2WXQA 5IQ7L 3CGTA 2EDBA 4M7KL 3PHAA 2D31A 4HIXL 4MLIA 5C07D 1BF5A 4HJUA 1ZA6A 4R7VA 3WNLA 1TJGH 4RGND 3B7YA 1M2VB 5HP5A 1FCGA 4TPRH 4MCNA 4KXCA 1C12A 1IEBA 2DJUA 1PDKB 3G6JF 1Y1UA 3QORD 3RBSA 3EJZC 3QZWA 4GW5A 5A1AA 4ZUSB 2VQ1B 4AGNA 1YO4A 1P6WA 1WF5A 3G3LA 4URTB 5IQ7H 3QIBC 1J0KA 3CC5A 5I1LB 5IB2B 2AK4D 1TIUA 4KMQA 4J2XA 5IBTL 5AEAA 3NSJA 4UDTB 4NKIH 1KEMH 4URKA 3OWRA 4F7EA 2R23B 1FZKA 2YAOA 3D6GA 5K9OB 2XSKA 3SDCC 1E3XA 5D4HA 3O8XD 4AYID 2Z1PA 5K69A 2EYSB 5KSAB 2QLYA 5J6GB 4RWYL 3O11B 1P7HL 3BKML 1Q72H 1N0LA 3CVHH 3W56A 2YRZA 4DHLA 1J8SA 1P2CA 3BN9C 2VN5A 5IROD 2WO4A 3C8HA 1HNYA 4O51B 4UIMB 1JWUB 5ICYB 2OV0A 4WI5A 4CW1B 2PW2B 3APDA 3R4RA 3U83A 5CIPH 4AJ0A 3ES6A 3OKYA 1LO4L 4L4VA 3FS9A 1MJ7H 5C0CA 2GJZA 1FYHB 5IJKC 2E7LA 2PXYC 2A6KA 4UT6L 4W81A 1XF4B 3SY6A 3E1ZA 1FNHA 1FJ1B 4AENA 1AXSB 5FO8B 4NAMA 4V11A 2C1OB 2Z0BA 1KGXA 1G6RA 2I85A 1L7IH 4HH9B 3QNXB 1QPKA 5L6YL 3S3DB 3U48A 2FVNA 5D6DC 3T2OA 5INCA 2G9HA 3T4YB 4UB0L 3QEQE 5I76A 3EYVB 1CF1A 4ICXA 3TBYB 3VXME 5C7XH 2A6IA 2NUPA 4DP2X 2PP7A 4AQ8C 4B3EA 3ECBB 2P24A 4M62L 5DZNA 5LUMA 4RETB 3B8YA 4E42A 1NWOA 3VWKB 1T7XA 4JVUA 1J5CA 1WZMA 1LO2H 2K9UA 1RK7A 2D7QA 3NPZB 5EDXA 2QT6A 2AXFA 3GGWB 4GSRA 2VLJE 1JVLA 3OJMB 2L7UA 3KG5A 4PJHA 4OKDA 1EFXA 4XMUA 1KB5B 1JZIA 1KJMA 4MD0B 1QFWL 4XOEA 4Y16D 4DP6X 2OL3H 3OHXC 2C9SA 3VX1A 1OGAA 3CE1A 4PJAA 1WZAA 5CSGA 4LMQI 3TZVB 4XMLL 5KBDA 2QADC 4HXBL 2AMGA 2WWNA 3DX6B 1NGPH 3AY4A 2BNUA 5BRZA 2OR8A 4GS7C 1MFBH 1CF8H 3BWSA 4KJWC 1ROCA 1N6VA 3X3FL 3H6AA 4NGHL 3FQWB 5C0GA 3TJEL 3HS9A 3GMNB 2COQA 4JM2D 3NA4A 1YC8A 1AXSA 1RZIA 3T6WA 5C8JA 4QF1A 3DOSB 3UDWC 3I6LE 5FO9A 2X12A 4GRLD 3R19A 1ACXA 4AJWA 1QBML 1SEBA 4RA0C 3NZSA 1G7PB 2B1AL 3BE1L 2HJKA 4JEGB 5DK2A 2Z8RA 1MFEH 1JWUA 2R69H 3BWAA 3FU0A 5DEGA 2BVOB 3DARA 1V7NL 2VZ1A 4JMXA 1BMWA 3B9KC 1OT4A 1L6XA 4MAUL 3RUGF 4GT0A 1A6AB 3PXJA 4ZSOA 1TQTA 2C9VA 3IK2A 1ZLVK 3WEBA 3WIIL 1A1OB 1CGVA 3HE6C 3Q8AA 2XXMB 5HHME 1ANUA 1NA8A 3DJ9A 1LE5B 2P7TA 1E27A 3NJMA 1MLCA 4LPVA 1GOHA 4OZGA 3RA7H 4B9FA 3NZHH 2HYMA 1AZVA 2QZ5A 4NZTL 4QD2E 4ZUUB 2WLZA 5BXFA 4R90H 5JA8B 2I32A 4J3VA 5J06A 3D9AH 4P23C 1C16B 3IAGC 3SZ6A 1T7ZA 2XBZA 3NCFB 3QZWB 4Z7OF 5BVJB 2HMID 5CUSH 5TDNB 3VFNB 3QXDB 3BYYA 4YXLL 4HFUL 4PHXA 4UTCA 3PU7A 1TQBB 5IY5B 5AOIA 1WZLA 3ECQA 3LKNB 5JOPE 1OCZB 5E8OB 2NLJB 4MZRA 2YK1L 2H9GA 4YHKH 5HHNB 3T4AA 1EXHA 2E6QA 4V1DD 4NOFA 1F8TH 2H6OA 4LOUC 1URZA 3MNZA 2OMYA 5T33L 2F1BA 3NH7H 1XGQB 3WTXA 3AG1B 3UGUA 3K72A 4HUWA 4JBSA 4MMYB 3KPSA 3H3KA 5DRZB 5DWUH 5IQMA 2NZ1A 4LCUA 4CJ0A 4OZGF 2E47A 1AS6A 3RWCB 1BFOB 4JKWA 2FE0A 3D85B 4Q0XH 3P40A 4WUUB 3VXSE 4CVZB 1TMQA 2CRYA 5K9QI 2HKFH 3HPLA 1VERA 3WBDA 1BIHA 3TO2A 1WWBX 1QYGL 1SLVA 5E6IB 4DVBB 3UAJD 1OP3H 2NTSP 1GY2A 3O8XC 1E67A 5JORA 2YA0A 1PFCA 5JOFA 2AKRA 2ZSVB 2G3NA 2PP9A 4WUUE 1IAKB 5D1XD 5J8OA 1HHIB 4OQTL 1R33A 2P8PA 2UWEB 3REWB 2WXJA 2MOQA 4MXWL 1BFSA 4NQQA 3RVVD 1GIGH 1UACH 4OQTA 2JLLA 4DKAA 1EA9C 1QP1A 3IPEA 2OQJB 2Z64C 4WDIA 1I1RA 4X98A 3CX5J 4H26A 4XZUA 1A4CA 3VXMA 2DS4A 3HJ0A 1A4JB 1HXKA 2K6WA 4PS4H 2X28A 4ZAKD 3U0TB 5DZPA 4K7FA 5D1XC 2F7OA 2X41A 4AYFB 3U1SH 2RH0A 4Y4FD 4YHPB 1FHGA 4QO1B 3IN2A 3TFKC 3VI4A 3U46A 4D0CB 5ILTH 4L3AA 3CJJA 2OTUB 2GJ6A 4XH2B 1BQSA 3QQ3B 4NQCA 2CKBB 1T5WA 1GYCA 5C0AD 4GAFB 4BCYA 5C07B 4QHLB 2DM4A 3I9AA 1IEAB 1TYEB 3D05A 1HXYA 4EN2A 1ITCA 4JQIH 2Q3AA 5I30H 5LXVA 3CN1A 1MRFH 1R5WB 3BH8A 4I0PC 2GITB 2EEBA 4A2MA 2H0JA 3FKUS 4JFHE 2P8LA 5ICXA 5EORH 2D4FA 5KZCB 5F3BB 3VXUE 4U7MA 4XGZA 2ADFL 3BN3B 2C5DC 1UXMA 3L5XL 4E5XB 3U82B 4NRYB 4KXBA 5A2FA 3D3VD 3IFNL 4C83B 4M5ZH 1SEQL 2ITFA 1CLOL 2VRAA 5IEHA 4JFEE 4HU8A 5FUZL 3PV6A 3PRZA 2J5LB 4KFZC 4M8QA 2EDXA 3D39B 2O6PA 1H9DA 4MAYC 1I85A 5C2BH 2WSKA 1A2YA 1LMIA 5BV7C 5GZOD 4Q9RH 4Y19E 3QCVH 1KENH 4CSPA 4G8GE 1F4WL 3AXIA 4XP5H 1MCOL 1T7VA 2H3NA 4JR9L 1YYLL 5EN2B 3ZMEA 4B7LA 5E24E 1WLHA 1MI5A 4LT7A 2BOBB 2X1QA 4IHOB 3I02B 2DWYA 3NTCH 1MG2C 4L4TB 4UOW1 5F7LB 1E28A 43CAA 1INDL 3DROA 2G5BB 3PJSB 4WW2A 3U7AA 3BKCH 3DX7B 1E5UI 5T3ZE 4PV8B 1U8OA 3U7WL 5FW6A 3C9NA 1GS8A 1H3TA 3CUPA 3RZCA 5FO2A 3RWEB 1NKRA 2C7UB 4KRPC 2E7DA 4MRBA 2WNXA 3STBA 3PUCA 4N2DA 2P46B 5K5YA 1CE1H 5T3XL 3P4OA 4TNEA 2CDGB 4JG5A 3PE9A 4YGVA 4WFHE 5HDBB 2ICES 3CFKB 4CRPA 4MSWB 5D2LE 1JRHH 3QDGD 4X6DA 1LDSA 5DK3A 1RUPH 2ZOLB 2J4WL 1R4XA 3FCUB 2VM3A 3WKQA 3S96B 3ZRFC 3IMBA 4L4VD 4P5KB 1XHHA 2IEPA 3KPQB 2UX6A 1AJ7H 4ZXBC 2VISB 4M1GH 3L5XH 3FTSA 4RBPK 2UYLB 4KVPA 3UO1L 2F7RA 2Y7NA 5EZIL 1JNNH 4LOEA 1YECH 2EDQA 5MEOA 1ETB1 1E3ZA 1YEIL 4Z7UE 4POZD 3N91A 1BJMA 1QG3A 4FQIH 3WHE1 3MRBA 1B4TA 4YLQT 3T0XA 3LD8B 3EUDA 3VW3L 5CAYB 1QI5A 3QJFA 5E4EC 1N8ZA 1F58H 2BP5M 4PRHE 5CXPA 2ZD0A 1YMHA 3L7EA 4LCWA 1BYNA 3U2IA 5LJYH 4KMLB 4AM0Q 4PTUA 4NPYB 4LSRL 1CI5A 5I19H 3QRFM 3G6JE 4DZ8B 4G7QB 4Z76B 1UQSB 2ZXWB 2ZOOA 5D2LA 5B3NA 1CXFA 1X4YA 1QLEB 3BPLC 3LN9A 2J6EH 3AZUA 4DT2A 5CR1A 5KVDE 4PJEF 1HFUA 2ZUQC 1HHKB 1I9JH 4E9YA 1FE8H 3GSQB 5IMLB 4JGMA 5ABZA 4JHUA 3BEVA 2CHWA 3EJJX 3FN3A 1ADQH 2EDNA 2NXYB 3CVIL 2OSWA 2FX8L 1PEWA 5KVFH 3EF7A 5I6KA 1JXKA 3ARDA 3M46A 5EU3A 2CRIA 4LRNH 3EDFA 4A2EA 4MZ2A 2VR3A 4HWEL 1KTRL 3BT2L 4FNUA 1X5FA 4H1LB 4AV0A 4GW4A 5LGHL 3KCPA 5FF6A 4Y4HC 3SOBH 5DYFA 3KPNB 2RALA 1F11B 4JHWH 1KDJA 1AZCA 2AJYL 1S9VB 3C87A 5I8CA 4IBUA 4G5ZH 4X6CE 4XNZB 3EHBC 1DZBA 4YNYB 1EJOL 4JFED 4N26A 4OFDA 4UM8A 3SYAA 3QDGB 2IFGA 2Q7NA 4LRIC 2WLIB 4LLUB 4CMMA 3JUYA 5FHBH 4QXUL 2GG1A 3SJVD 2VXSL 3I6SA 1CDGA 3QXVA 1Q1JL 4Y5YC 2BK8A 5DMKA 2KERA 2IGFH 3O6LH 2NNXA 4K5LA 4JPVL 4PRDB 2XFGB 4BM7A 4AEIL 3DV4A 1QLRA 3IJEB 3L9RB 3O9WB 2BS9A 2JKIS 2GTQA 4QTHA 4ZPTA 1F2XK 3AG2B 3ET9F 1AXIB 2VDRH 5I6XB 2R2EB 5E2VL 4JG9A 3RB7A 4MWFB 5EU4B 4ZUWA 2VLRD 3ZRCC 1I7TA 1R3HA 2KMWA 5GS0D 5F7DB 1UT9A 1JZGA 2GUOA 4HWBL 2NY0C 4AUUA 1OCOB 5D55A 5EU5B 1UD2A 2B3RA 1INDH 2E59A 3MBXH 3TZVC 2WUBH 4TSCH 1V5JA 2FHBA 2V17H 1CL7L 3D39D 4LLMB 1ZT4A 2CGYA 2LQRA 4G9FE 3RIAK 2FWOB 3ARDB 5JZ7D 1X5HA 5GRUH 2Z92B 3BP5A 3UJJH 1TJIH 3J8F7 2ZPKL 3WENA 2WVUA 3DGCR 4M43H 3CH1B 1WC7B 3TCXA 1WBYA 1FYTB 2D7TL 3MRIA 1XCQB 1Z3GL 1JNNL 1BFTA 4JQXC 5ID1A 2BIQA 1BCIA 5ECGA 4RGNC 5EUOB 1UWEH 2EDYA 4MAYB 3RWGB 4X0KA 1OEZW 1YCSA 4LHUD 1RUMH 1UG9A 2G2RA 4PJ5D 4CBZA 4U2YA 5HI4C 1S5IH 2ESVB 2VL5B 1NAKH 1MFEL 3E80A 4HIIA 3L3OC 4OUUA 5E8DL 5FFOA 1AFVL 1HL8A 3PWJB 4ZRGA 3NESA 4GAAA 3OKLA 2FT7A 5F1IB 3VMPA 4GKOA 1B0RA 2WXMA 1MCRA 4LL1A 1ZE3H 4HG4K 2VUOA 2YRPA 2C3HA 1NPNA 4X6DE 5DD3H 4Z7QB 4IOFC 4QRSB 1CQYA 3F7VB 5FDWA 3RTQA 8PAZA 1GAFL 5DJ0B 3G9VA 4W1TA 4IEFB 2WZPD 3HRZA 4NS0A 4GUOA 1B6UA 5C86A 4Y4FB 5TF0A 2ZAIA 4XBGB 1DQDH 4AVHA 3ZIMA 3WY2A 3GSXA 3TPUB 2VLRA 4IMLB 2IOMA 2PTTA 1Y7VA 1AGEB 1MCPH 5DD6A 4L18A 4WFGD 1F42A 2G75A 3IDMB 3MRGA 5D7IA 5E99H 2QLVB 3P30L 5L4JA 2J3SA 2ATAA 5EU7E 1I1FB 2JIXA 3V6ZB 4N5EC 4LCWE 4NN5C 5GSRB 5G4NA 2LV4A 1HSBB 1U3HD 4H8VA 3SKJH 2E9IA 4MJ4A 5L0QC 4HS3B 3NIDB 1NIDA 2ORBL 4DGUA 3OAWA 1MUJB 1M7IA 3K4ZA 1DQJB 4IRZH 2MRYA 3OSVA 4NBXB 1DVFD 4U0RB 4KX7A 2D7TH 3PJSA 1RURH 3A4AA 5DQ9A 1EDYA 3HBPA 4M43L 1DUZB 1G7LA 1P7QB 2EIDA 4QKTA 5DCCA 1E9QA 3LKOB 1A1MA 3P30H 3DTXB 5KSUB 1XGTB 1KGWA 4L8BB 4OLVL 1HOEA 2HKFL 3OKOB 2CBMA 1TQWA 3X1EA 4APXA 4ZMYA 4A39A 4OIIH 1LE9A 4U3XA 5EO9B 1OB0A 3BUTA 2F0CA 1CN4A 4G7VL 1RAMA 3JV4A 3MRLB 3KYMA 3UAEA 2LLLA 3FT2A 5DU7A 5ISZD 5HPMB 5HGDB 2ADYA 3OLIA 1XCQA 2DQIH 5KVGH 1ZLDA 2GSGA 3CN3A 4UUJB 4NUGL 5TDPA 1FYTA 1MXDA 1B0GB 1PJWA 5F7EH 2N0MA 4AEIH 4KKZA 4X6CA 3PPEA 4X7SL 2QQNH 2LFEA 3MCG1 3UJIH 4QJ3B 1GVIA 1PZDA 2XTJC 2IOOA 3VXSB 2VLKB 1KB9J 3FB5A 4G7YL 3RDTD 1JMXA 1W0WA 5AYQA 5JPMA 2EC9U 2ODIA 4LCIL 4BK8A 3ALPA 2RGSA 2P8LB 4X99B 1DBMH 1RMFH 3QRBA 3QQXA 3O45A 1J0YA 1IEAA 3QUXB 4ISVB 1NGQL 2EUZA 1FIEA 1XF5B 4FQ1H 4KNQA 1ORSB 2A74B 2F19H 35C8H 3NFPA 4KQ4L 1XIWD 4TVPD 4B9PA 4P05A 4LCCC 3ZO9A 2E75C 1Y07A 3VGBA 3SQRA 3T2NH 4MB5A 5SX5H 1QFUH 2AK4E 1OE2A 2RQ8A 3F00A 1XXFC 2AZAA 1W8EA 3LNGA 4JM4L 4NQDD 1X7QB 4Y5YB 3OR6B 5EBWA 1AXTL 3K81A 1MJ8L 3L17A 4PRPD 5JIIA 2EDOA 5KBLA 2XWXA 2J56A 3SCMA 1M1XA 1U8KA 3CSYB 3NIFF 4P9HH 3KJ4B 1XBRA 3HZYA 4ZQKB 3EJYD 4G9DA 4Y2DB 1KGCD 3MLRL 3CZNA 1P7QD 12E8H 3MVSA 2UZYB 5HYEA 4L3ED 1YY8A 3BE1H 3M1OA 2RBLA 4FKHA 4Z7UB 1NAMB 3KCPB 3RNKA 5C07E 4WI0A 1OPGH 3TS8A 1N2RA 3K71B 3FYIB 1UJ3A 3GLZA 3S5YA 3HA0A 1JF5A 2FO4A 1Q38A 1JL8A 3W0WB 5KVGL 4XI5C 5KVEH 3LRMA 1KN4L 2DD8L 3CC1A 3JWNE 1S7SB 4JPWH 5AAWA 2Y1ZA 3G6DL 3GMLB 3KPOA 5F1NB 2AC0A 3VSTA 5IOKA 3D85A 2FB4H 1GS7A 5TF1L 4RWHA 5HYSA 4H8WH 1MY7A 5AVXB 3K6SA 4P4RA 4FRWA 3DETD 1KJ2A 2L7JA 3P4MB 1JTTA 2DTSA 3FBQA 4X83A 3U6XA 1YA5A 4XAWH 1EEZB 2DM3A 3DMMD 3IETB 1AGCB 2OL3A 2AAVA 4Y5VA 3G7TA 5CZKA 3B34A 4W4OC 4DFIA 5D1QE 5C9JB 1YEEH 5MERB 3TJPA 3NEOA 1M7DB 4UNUA 1HIMH 4EBQH 1R47A 4XNQA 2XFXB 1BVZA 2I60L 2X4PB 4N0RA 2IANB 5IJVA 2VDLL 5I8OL 5J1AA 3R8BB 4N28A 4L1LA 4TUOB 3C60D 4TUKL 5AB1A 5FM4A 3DUUA 5IM7B 4FJYA 1L7TH 4NAJA 4A7QA 4LVHB 4PS3A 2G2NA 4N90D 4XP1L 4HAGA 1RZ7L 2FQEA 3IJ7A 3ZHDA 2NNRA 4LHUG 2MTAA 1O5DT 1FDLH 4LAJH 2C9RA 1RHHB 4U1SA 1GMIA 2DMBA 2A6DA 2OJEB 4PJFF 3GQFA 1GHFH 1A14L 3BYTA 3TBTB 3F65A 1NCWL 5DR5H 4JFDA 1X7SA 1KXQA 2DWTA 1ZJAA 3EO9L 3MR9A 4ZFZB 3VFMB 3BGFC 3KL0A 3UPAA 3MV7A 1YNLH 1F6AB 4M7JH 1O6VA 3JXAA 3WN6A 5IHLB 4PCKA 2ICWJ 5I2IA 2N7SA 4Z95H 3FW6A 2AJZB 4AE0A 3PY9A 3LQAH 5TE6L 4NN7C 2VQTA 3C9NB 5BS0D 3D12B 1QSFA 2K78A 2XKNA 2HJLB 5AVYB 5D8JL 1XV8A 3NSFA 4N87A 4LBAA 4AYDC 3WUWB 1ZHLB 1FVEA 3SBQA 1VA9A 1I1AB 2RCSH 4AK1A 4F58H 4PRIA 3GM0A 2CDEB 5IBTH 4JDTL 3GIVB 2P5EE 3ARQA 3LMJL 5C0GB 1G0XA 3HC3L 1HEZB 1ZT1B 4WVRA 4XO4A 3TCTA 4GRMB 2WUBL 1OAKH 1GOFA 3QBTB 4JFDE 4O02A 2XV6B 2XYBA 1GZPB 1YNTB 2Q10A 1E8WA 5KWYC 2D8KA 4UQ2B 3PHOA 2W59A 3J7HA 1BZ9A 3CFNA 5CWSA 5IFAL 3LHAA 3D06A 3X11A 4POYA 3B1UA 3HN8A 4G83A 3HC4L 3TA3D 3AUVA 1C5DB 3DJSA 5LNGA 1YN6A 2BFVH 1NC4A 1O6TA 2EP6A 2IANE 1OPGL 2WZAA 3F2LA 2MWCA 3N1PC 2OJEA 2WXIA 1QUNB 1F3RB 1G9EA 4KKCC 1JZ5A 5E6ID 3GHPA 3F58L 4OW6A 2QL1A 4PJIA 4H0LC 2XRAL 4GP4B 3FXIC 5HGAB 2NSXA 4JFVA 4EKJA 1FH2A 2WGXA 4DP5X 3NN8A 4K5PA 3O2WH 4DP4X 5ESQA 2LAGB 2PNDA 2YWZA 4Y4KB 2K6YA 3S37H 1U8JA 2MQ0A 2APVA 3BX7C 1JWMB 4KI5E 1QX1A 1UD6A 1FNFA 4JFOB 2AV1A 2PPAA 4ZS7H 3CZSA 1OTUD 2P5ED 2GBAA 1RJLA 2DAVA 4A7VA 2DM7A 4PTTB 2XWTA 3EH1A 5EA0H 5MERA 5AAMA 2I07B 2TRYA 4IU2A 2KHAA 1BVKA 1NUNB 1QFOA 1ID2A 4QGTA 3ZT7A 2WKOF 5LNDA 5LXGH 4KK9D 2C9AA 1PG7H 1SJHB 2YQ3A 3CN2A 4C8XA 3KDMB 4L4VB 2C9QA 4R4FH 3RWJA 4OVUA 1RUQL 2LU5A 3MV9D 4N2EA 4XPFL 3EYQC 4QHMA 1Y6MR 5ICYA 2OQJA 2DYPD 3L4UA 4KO9A 3RLSA 2ZG3A 4QHKJ 2DBLH 3QSKB 5C0RL 5AKVA 2XWJA 4N1EA 4UV7H 2XXFA 4MA7H 1NC4D 1MJ7L 2DTMH 5B38A 3I9GL 7FABL 2LE9A 1LO0L 4Z7UF 2VC2H 3NRQA 4UANA 2IXQA 2NY7H 4W9DC 1BREA 5JOFB 4MA3A 4B6ZA 1DBKH 5IKCB 4YO0B 2AK1L 2OMWB 2M2DA 5DUJA 25C8H 4U1GB 1JPTH 4AIZA 4M6AA 4NAQA 4P48A 2O6DA 5IK3B 3CC5B 5IB2A 4ZQKA 1KACB 4K71C 4G8GD 1MRCH 1M1XB 3GMQA 5GJSH 5G4OA 4LSSL 1HWGB 2VDNH 3RWCA 4PWGA 5EEWA 3S5ZA 4IYKA 4GRLB 1D5ZA 2EIMB 3X13A 2J6WA 1H15A 1MVUA 3CPUA 3B5GA 2YWYA 3S35X 1YPZB 1RIUH 2OMYB 3CLEH 5CCHE 3SGJA 1CICC 1WO2A 2J4WH 2DQJH 1NAMH 4S1QL 4X6BB 3RNQA 1NMCC 4HPYL 1C9SA 3AWGA 3LKRA 4WWKB 5T1LD 4I2XE 4EXPX 2GJRA 3F01A 3VM5A 4A67A 1WBXA 2ZP0T 2FIKA 4HBQA 2CLVB 5IQ9A 3FO9B 3LKRB 4WWKA 5LXGL 2X4SB 4I9WD 1LO2L 1TYRA 3MV7E 4F7CA 1HCFX 4BDVB 4BFBD 5FV2A 2HTKD 4FNRA 2JB5L 4PV9B 7PAZA 5D7LD 5M94B 1D5IH 2X89A 4K9EH 5CJXA 2E4FA 5E8EA 2GC4C 3VFRA 5B3JF 4XHJC 2AJVL 5DZVA 3BKCL 4ZUUA 4BSWB 3F84A 5EORL 4DUXA 1XH3A 1JERA 1ROWA 5T1KA 3C08H 3G5VA 4G6KH 5B39B 5H4ZA 2BY0A 1SY6H 3DXAB 1A1NA 3WO4C 3EGDB 2YK1H 4HETA 4KU1A 3VWKD 1CL7I 4L3EE 3ZDXB 4I9XA 3COOA 5E5MB 3R06A 1EO8L 4IBYA 4AIZB 4NGHH 3SD5A 4F2EA 2R15A 3SGKA 3TT1H 4XWOD 4M6OL 3KYMB 5EHFA 2GCYA 4KY2A 3R0NA 3BUQA