1I94T

Crystal structures of the small ribosomal subunit with tetracycline, edeine and if3
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
99
structure length
99
Chain Sequence
RNLSALKRHRQSLKRRLRNKAKKSAIKTLSKKAIQLAQEGKAEEALKIMRKAESLIDKAAKGSTLHKNAAARRKSRLMRKVRQLLEAAGAPLIGGGLSA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structures of complexes of the small ribosomal subunit with tetracycline, edeine and IF3.
pubmed doi rcsb
molecule tags Ribosome
molecule keywords 16S RRNA
total genus 27
structure length 99
sequence length 99
ec nomenclature
pdb deposition date 2001-03-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
T PF01649 Ribosomal_S20p Ribosomal protein S20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.110 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Ribosomal protein S20 1i94T00
4B3ST 1J5ET 4LF5T 2UUCT 4LFBT 4LF6T 4DV5T 1IBLT 4X65T 2E5LT 3OTOT 1N34T 4LF4T 1HNZT 1N33T 4DV1T 4B3TT 2F4VT 4KHPT 4DR6T 4JI1T 1XNRT 4JI5T 4DR3T 4DR7T 4GKKT 4K0KT 4DV4T 2HHHT 4JI0T 4DR2T 4DUYT 4DV6T 4JI6T 1FJGT 4JYAT 2UU9T 1HNWT 4DR1T 1IBMT 1IBKT 4DR4T 4NXMT 4LF7T 4B3MT 4LF8T 2UXDT 4JV5T 3T1YT 5BR8T 4DV7T 4X64T 4LF9T 4AQYT 1HR0T 4X66T 4DV0T 4YHHT 4DV3T 3T1HT 1N36T 4DUZT 2UUAT 1N32T 5LMUT 1XNQT 4B3RT 2UUBT 4DV2T 2UXBT 4JI3T 2UXCT 5IWAT 2ZM6T 4YY3T 4LFCT 4GKJT 4JI7T 5LMNT 2VQFT 4JI2T 4JI8T 4LFAT 4X62T 4DR5T 1XMQT 4OX9T 2VQET 4JI4T 1XMOT 1HNXT 1I94T 4NXNT
chains in the Genus database with same CATH superfamily
4CI3B 5DABA 2R6GF 4EYUA 2IC9A 4ZS2A 4EGWA 1HG5A 2W67A 1W09A 2XHEB 2CCQA 1VCTA 2H89A 4DBRA 2W4XA 3FHNA 1WLXA 3SOLA 4ILUA 2BKPA 3CPZA 4NIQA 1GQEA 3F31A 4TNVA 2I0MA 5AQRB 2IAKA 3OYXA 1D1BA 5LNKA 3MKDA 2NW8A 2E5LT 3LK3B 3LDQB 2YKSA 3MZKB 1E1HB 4QWNB 1U5PA 2LRLA 2XJ7A 1FMVA 3FZFB 1KFYA 4LF4T 1HNZT 2IDOB 4ZZCA 4ZI7E 1VRBA 4KUMB 2VL0A 3L09A 4QX7B 3AECA 3B57A 3IF8B 3ONXA 4JUYA 1T8BA 3KINB 3ZSSA 2H3RA 4XAXB 2LM9A 2X0LB 4P0BA 2LM2A 3AA6B 4AKLA 5LYJE 2XSBA 2PBIA 2VWAA 3AEBA 3N2KE 3U3IA 4KHPT 4CXWA 1SE7A 3N9PA 3NKZA 4JEHB 3NZQA 4HFHA 4I50E 1D0YA 2LHNA 4DR3T 2XQ6A 3AE5A 4O4JE 5LBQB 4U31A 4DIDB 3JAEA 4GYRA 3ZMUB 3NRXA 4DR7T 4AI6A 2VURA 3P7IA 3LK42 3AB3B 2E9XA 4HWDA 3RRWA 3EI0A 2NTYA 4L9IA 3C4ZA 4H9RC 4DR2T 5JR9A 2Q9QA 4YHJA 2CMRA 5KX5E 2CPTA 4X1IE 2CWOA 2J4GA 2VVSA 4KHZF 5HEGA 3UFEA 2LSGA 5IUXA 4DMVA 1MNDA 1M7KA 3CK6A 1ZOYA 5M4YA 2W63A 2WDRA 3HKBE 2DWGA 5AQGB 4HWFA 2X9YA 2X68A 5JQGE 2XAQB 3ZEFB 4LMJA 3J9X1 5LGTB 1HF8A 2KWIB 4L0RA 2NP9A 2CM0A 2YK0A 4NXMT 4DR4T 3ZMSB 3VR8A 3WAJA 5LXTE 2RPAA 4LF8T 1J1JA 2UXDT 3H3AA 5F8PA 4ILCA 1QUUA 2AXDS 2CEAA 2EHOD 2RA1A 5DQWA 4OFZA 5J0ZA 4JV5T 3AEEA 3AE9A 4MALA 3DTOA 3KV5A 2CBJA 4HTEA 3T1YT 4QX8B 2EHOA 1FIOA 2BDEA 2DCFA 5C2TA 4H9NC 2L9QA 4AQYT 2V1DB 3PUAA 3AEAA 3LK2B 3HA4A 4HFIA 4YSZA 3OJAA 1YKHB 3C50A 5LGNB 1UURA 4IT4A 2HH7A 4O8SA 5JDGA 1FEWA 4E7ZA 4U2ZA 1BR0A 3M65A 2CRBA 1HTJF 4MHCA 3CKDA 3UQ4A 1XDOA 4IE5A 4PW8A 4ZZBA 1HFAA 5TAOA 3FZLB 4CXXA 2LOSA 3FBLA 1BR2A 1SHZC 2LEHA 2WM9A 4H9PC 3ZYLA 5HXSA 1ZEEA 3MACA 4IIJE 3ZCIA 4HWIB 2X9XA 3RIFA 2N2NA 3P50A 3ZLIA 5ABHA 2UXBT 2FJAA 2D0UA 3Q5XA 4GK5E 2UXNB 4HWCA 3RPUA 4B3ST 2H88A 3QC9A 2J47A 5L4HA 3RHWA 3NRYA 2VKOA 1OXZA 2WMOA 3JAFA 4HWHA 1OEDC 4L5GA 5C3JA 2NWBA 4LFCT 4HKAA 4XBFB 3ANWA 4JI7T 5HXCA 2NW7A 4YJ2E 1OEDE 4PK5A 2X51A 2GK9A 1JNZA 4JI8T 3KV4A 4TX5A 4I0UA 4U74A 1KNZA 4UEMA 4DR5T 5ABFA 5JDQA 2WB5A 5AQUB 5IYZE 3VRBA 2JQHA 3KDSE 4AKRB 1XMQT 1FMWA 3CX8B 1YW0A 2BKOA 3T8OA 1LVKA 3ZC1A 2Z6EA 3C64A 3ZJ1A 1NENA 2A3DA 4I4TE 2HPJA 3ZMVB 5ABFB 2LRKA 4PAGA 3AA7B 3W15B 5LGUB 4WNKA 1I94T 2OV9A 2YN6A 2G0UA 4K0UA 2V6XA 5HAXA 2WY2A 1MNEA 3RH3A 2VB6A 2ODVA 1B7TA 4EZHA 1MIYA 2XQAA 2PJQA 4YSXA 3RRCA 3I9WA 3RGLA 4IE0A 2VKDA 4MFRA 4PJNA 5JDMA 2ZM6T 2E9XD 2LKHA 3AE6A 4PK6A 4JLEA 2K5BB 2DWKA 2LSYA 1ZP0A 1QLBA 1HG2A 3BK9A 2MBGA 2V8SV 3EDUA 2J62A 2LHRA 4BAYB 4CI2B 4X65T 4O2AE 1XWMA 3OTOT 3O4XE 4ISTA 3PJAA 5HEOA 5FY0A 5HCJA 3H37A 5JRCB 2OA5A 4J2CA 3MA9A 2QVAA 4AQFC 4CZZB 3O1IA 5L4EA 3ZCJA 3AAIA 3CQXC 2V6YA 2F4VT 4YFSA 2A9UA 3TLTA 5F3JA 2M6IA 5LG4A 4ZI3D 4DR6T 4IREA 1CUNA 1KNPA 3KV9A 2XQ7A 3PE0A 3FXEB 3P4RA 1UCUA 3H3MA 3P8CD 4ZI2C 2XQ4A 4F6RC 4KBMB 3KBTA 3K8PC 4ZEYA 4Q25A 3RIUA 4K0KT 4KMCA 5LJNA 4YJ3E 1HNWT 3GWHA 3QNUA 4A97A 5H6QB 4DV4T 2HHHT 4JI0T 3ONLC 2DNXA 5LHHB 3RC3A 1W0BA 3VKGA 4O4HE 2VASA 3AXJB 4DV6T 3PUQA 1KK7A 4EEBA 5EK4A 1WFDA 1OEDB 2IHR1 5FXZA 1FJGT 3E08A 4NPPA 4EV6A 2E2AA 4TWHA 4TV9E 1YXRA 3EUHA 3AEGA 5GONE 4ZI2D 2ACZA 4AISA 5L3FB 4UVBB 5CA0E 4MBQA 2ACXA 3PUGA 5AQIB 4DR1T 4ASKA 2BVLA 4H63V 2V7JA 3I9YA 2YDQA 3L3PA 1T72A 1ZKEA 4FJOA 1E7PA 5FXVA 5JVDE 2VL8A 1NWMX 1IAPA 5AQJB 3UUMA 4HN9A 5AQNB 3PJAJ 3PUXF 3UUBA 2XSAA 4UELA 1LKXA 2WDQA 4U2YA 3NWIA 4GYSA 1HS7A 3FZHB 2CXLA 3N9OA 3BQLA 3E22E 3CX6B 4X20E 3AEDA 1OEDA 2YU2A 2Q9QD 4DV3T 3OBVE 5AQKB 5JR9B 3T1HT 2Q9QB 1N36T 2Y48B 2D5UA 2XY8B 3Q9DA 4WBOA 2UUAT 2IIUA 1VOMA 3RIUC 3MJXA 3ZSTA 5JRCA 5LCYA 4I43B 4AKGA 3RX6A 3S4UA 4DBQA 5LMUT 3UTKA 3JC6C 3FBZA 1LVFA 4HE8A 4IGUA 5FXWA 4B3RT 1WCRA 2XTLA 3Q2MA 4NUUA 4QXHB 2KINB 3ONJA 5FMNA 3ZYKA 2HN2A 1D0ZA 1D1CA 2WBLA 4QH5A 3E0ZA 5ADXL 2ES0A 2WMNA 5AQLB 3RYCE 3HKDE 4JI3T 3RC8A 4HFEA 4X1YE 2B1EA 3QB5A 4TUYE 3CVRA 5FNVE 5CB4E 1UX4A 3LBXA 2NOXA 3UU3A 2X67A 3AE2A 3SFDA 2ZM2A 5CA1E 3RYIE 5L2LA 1S35A 2XQ3A 2JMKA 2XAJB 5FY7A 5HXRA 2VQFT 4JI2T 4BA9A 5FL1A 4LFAT 3EDVA 3GN5B 3V5UA 4X62T 1OWAA 2KZ7B 4IE6A 4GIWA 4UF0B 2C5JA 2NW9A 4DO0A 2IMLA 3SRZA 2D0TA 5EK2A 3LG7A 4EOZB 5FXXA 3ZMZB 4DVDA 1MMGA 1XMOT 3N9LA 2BBJA 2KWHA 2L3LA 5AQMB 5FL0A 4EEDA 3PUVF 3J7Yq 2QYWA 4EZ4A 1T7SA 5AFUL 1D0XA 4TWDA 1H7CA 1D1AA 2E8IA 4PJMA 2EHOB 2LOPA 4PFPA 5ABGA 4NXNT 4TZ4C 1J5ET 5FYMA 2ZLYA 3LBXB 3C4WA 3OPCA 5KMGP 2BZBA 4OYJA 4A5XA 5BMVE 2JIWA 4HFCA 2Q9QC 4IHJE 1KNRA 4ZS3A 5AQVB 3ZT7A 4BJMA 2QA7A 3AXJA 5CGMA 3KV6A 3UU8A 3AE4A 5AQPB 1G73A 2N1GA 2WU5A 3JADA 1EZ3A 4QH1A 3CX7B 4UF0A 4AQGA 4E7SA 1N34T 3JC6D 4QXCB 1WRDA 3ZJ2A 2D2SA 2KMFA 2Y8DA 2BG9E 2RP4A 2C5KT 1W0AA 4KX6A 3AA0B 5JDLA 3F2EA 4DV1T 1KF6A 2XQ9A 2X0HA 4QHOA 3N9QA 3R84B 4KP3C 1BR1A 1X9BA 5JDFA 2ODUA 3L8RA 3QK6A 5IHYA 3CMLA 3CWZB 3B13A 3PDYA 4QH4A 4DMWA 4IL9A 1XNRT 2WZIA 4JI5T 1Y64B 2KXPB 5L3BB 2LE8A 3SWHA 4NUVA 3O1JA 3ZN1B 5ABEA 3RYFE 2CLYB 2XZEA 3FZMB 4GKKT 3UFGA 2WAUA 4G2AA 4WBNE 2HPLA 3OKQA 3UUNA 5LP6E 2UXXB 4ISSA 4P0AA 1MMNA 2N9DA 3N9NA 5JDNA 2JJ9A 3UUXB 1DU2A 4OX9T 4IDNA 5LHGB 4H9SE 4TN7B 3UULA 4DUYT 3MXZA 4H63H 2LKGA 2XM1A 2JRKA 3ABVA 4PFOA 2JQQA 4WZXA 4DNDA 4LMLA 1X79A 3AVRA 1S94A 1SUMB 2LLYA 2UU9T 3PTRB 1SA0E 3F57A 3C98B 2CE7A 3I1AA 2JPFA 2V5DA 3R6NA 3TKLB 5HXEA 4ZOLE 5JREA 2H7OA 2XQ8A 2V7LA 3PUWF 1IBMT 3HL6A 1Y01A 2YDRA 2LT3A 4LF7T 1HX8A 5FVKA 2ZM8A 4B3MT 2MPKA 2CBIA 5FP3A 1M62A 3PU8A 5FY1A 4CN4A 5J2UE 4GOUA 3LFMA 3GMIA 1US7B 3TLSA 5BR8T 2H7VC 4ZXLA 2IUBA 2MOZA 4DV7T 2YINA 3KVBA 1CHUA 2M6BA 2PTFA 2K48A 3Q5EA 4OHFA 3UU5A 3ZT5A 4F8HA 2C0SA 2VKHA 3G06A 3K1SA 5AQTB 3UU4A 4X66T 2XQ5A 3RYHE 4YHHT 2V7KA 4UIGA 4DV0T 2V6YB 4OYKA 5CJ5A 3O9XA 3Q5DA 4DUZT 4H9QC 1N32T 2B76A 2BVMA 2W66A 3ETUA 2XASB 3ZKRA 1WR0A 1IBLT 2WQYA 4UV9B 3HKEE 1XNQT 2BG9B 2MYSA 4EIWA 1MIVA 2ZM0A 2WS3A 3PURA 4YTPA 1YQ4A 2YU1A 4IDOA 5EK3A 4DV2T 5CFBA 1NAFA 5J2TE 1MIWA 3FZKB 4X5TA 5L3GB 3K3QC 2IC6A 5AQQB 5H6RB 5HWXA 3QUJA 1XZYA 5C8YE 2UXCT 4AQFA 4YTNA 2C5IT 5DQVA 2JMHA 2AE9A 3A8YC 2HN1A 2MTQA 4U33A 4YY3T 5IWAT 5E0OA 2A72A 3IA3A 4CN6A 2VKJA 3RKOA 4AKIA 2BS2A 2K24A 4U3CA 2CHOA 2W0GA 3HR0A 2OLTA 1XDPA 3PUZF 2VVNA 2MAWA 3FB2A 3KVAA 3JCFA 4FI5A 4O2BE 4JEUB 4O4LE 4QKNA 1QSDA 4U7IA 4UVCB 2WWVA 4PK4A 4ADZA 5L47A 4HGAA 5JTGA 2BG9A 3AE8A 1ZV4X 3AAAB 1G8XA 2KNDA 5KXJA 3VKHA 3SS1A 4JI4T 2WP9A 3C4XA 4QXBB 3Q5WA 3DJBA 5HEJA 3B5MA 2W61A 3X1DA 3EHZA 2QGSA 3PUSA 1ZHCA 2K9AA 5F5WA 5LOVE 3PU3A 3ZC0A 3PUYF 3AEFA 4UV8B 2X9WA 2X0YA 3RQWA 4IDPA 2YEVC 2VK9A 2E9XC 5JH7E 3UQ7A 4LF5T 2XPKA 2UUCT 3ZT6A 2XAGB 4B6XA 4PJJA 4COFA 2DL1A 4LFBT 5LJMA 4UVAB 4LF6T 4TNWA 4DV5T 2XM2A 4EAHA 1NEKA 3LJCA 3LSVA 3M3ZB 5AQHB 5HXHA 3D0TA 4N78D 2XQYA 3N9MA 4IE4A 2YDSA 5LG3A 2BG9C 2DHRA 1JNRA 2XUEA 4C91A 1UGOA 3IEEA 4YTMA 4CXYA 2BS4A 3BQKA 2FJDA 2XAFB 2CWYA 2J1DG 3BQIA 3HKCE 4CQIA 2JQKA 3AAEB 4ILBA 4XZCA 3MK7C 3P4PA 4JBWF 3RKGA 4C90A 1N33T 4WW0A 4U7YA 4AKHA 4PJLA 2NR4A 4B3TT 5LA6E 3OVUA 4HFDA 4X1KE 1IJ6A 2A2FX 3SFEA 4CI1B 3I0OA 5JR9C 4JI1T 2WZHA 2NTXA 3TLWA 2V5CA 1E2AA 4LMKA 5KDMC 5JDHA 3CQGB 4TWFA 2W2UA 4IDZA 2X9HA 1Z0PA 2DLRA 2KT9A 1HX1B 3OYZA 4Z8XA 4HEAA 4ZHQE 2LSKA 3UT5E 3I0QA 4EYYR 4P09A 3N2OA 4G63A 2P9BA 2M67A 2FUPA 1T98A 1R8IA 3NBXX 3GA8A 3PV0F 4KI0F 1O3XA 1WYCA 4JI6T 1UK5A 2CXDA 2EHOC 2V7MA 2E5VA 5HWYA 5HEHA 3AVSA 4JYAT 1WYBA 4M1PA 3RI5A 5L3EB 3UU6A 3WI3A 5HYAA 1MMAA 5LHIB 3ETVA 2I6HA 4I55E 4PNIA 3ZPOA 4U72A 1IBKT 4IE7A 2QRXA 2K3WA 3A5XA 3C51A 3P4WA 3RQUA 2FBWA 1UX5A 4Z91A 5EZYE 4BJNA 3VRAA 4YT0A 1Z8UA 3AA1B 1U4QA 3CQCB 5ETWA 5L3DB 3AE7A 3ANWB 1YD8G 3A7MA 1HCIA 5DJQC 5HEUA 2WU2A 4X64T 2LSJA 3ZYMA 4LF9T 4IL4A 3K3NA 2XAHB 1IZNB 2W62A 5FKYA 1HR0T 2FJBA 3RF1A 3QOFA 2YOEA 3ESLA 2E9XB 3VR9A 4A98A 1WR6A 2BS3A 1I6ZA 4UXNB 3TLVA 3O1HA 1J5WA 2FJEA 5HCMA 2PFVA 3CIRA 2D9DA 3TLUA 2CLYC 3GN5A 3EAMA 4O4IE 1MMDA 1LRZA 4IDQA 4YLHA 3IBPA 2UUBT 5AQSB 1BR4A 1YQ3A 4Z90A 2WDVA 2WSSV 5AQFB 3N2GE 2X66A 5J1GA 3FXDB 5L3CB 3VU7H 3NVOA 4ILAA 2I59A 1VCSA 3IHRA 5LBMA 2L8KA 3V5SA 4TV8E 4AIUA 5LB7B 1AJ3A 2LJLA 2PG8A 3NZPA 4AXPA 4YSYA 4MLKA 2CHNA 3P4QA 2IW5B 5A1LA 4GK0E 3U78A 1UUSA 4HFBA 4A56A 4EXTA 4GKJT 2V7IA 3VHLA 4ZI3C 4UR9A 2KSRA 2LSIA 3EABA 4EB6E 2SPCA 5LMNT 2WCAA 4OK0A 4P1NA 2JQ9A 3DP7A 4H9OC 3RLFF 3KFWX 2CXFA 3P4SA 2ZMAA 3AE3A 2Y6XA 3KBUA 3N5LA 4ERRA 2WWUA 1W9RA 3AE1A 2CA5A 4ANJA 5FVLA 2BKNA 1YKEB 3QB5K 3ZN0B 1IJ5A 4WYVA 4CN1A 2VQET 1KEYA 2V26A 3EVYA 3WAKA 4YXDA 3L39A 1HNXT 4HFVA 1L0VA 3ZMTB 2DI4A 1V9DA 2BBHA 3RIAA 5AQOB 3HI2A 2W00A 3K3OA 4V1Av 2KLQA
chains in the Genus database with same CATH topology
4B3ST 1J5ET 4LF5T 2UUCT 4LFBT 4LF6T 4DV5T 1IBLT 4X65T 2E5LT 3OTOT 1N34T 4LF4T 1HNZT 1N33T 4DV1T 4B3TT 2F4VT 4KHPT 4DR6T 4JI1T 1XNRT 4JI5T 4DR3T 4DR7T 4GKKT 4K0KT 4DV4T 2HHHT 4JI0T 4DR2T 4DUYT 4DV6T 4JI6T 1FJGT 4JYAT 2UU9T 1HNWT 4DR1T 1IBMT 1IBKT 4DR4T 4NXMT 4LF7T 4B3MT 4LF8T 2UXDT 4JV5T 3T1YT 5BR8T 4DV7T 4X64T 4LF9T 4AQYT 1HR0T 4X66T 4DV0T 4YHHT 4DV3T 3T1HT 1N36T 4DUZT 2UUAT 1N32T 5LMUT 1XNQT 4B3RT 2UUBT 4DV2T 2UXBT 4JI3T 2UXCT 5IWAT 2ZM6T 4YY3T 4LFCT 4GKJT 4JI7T 5LMNT 2VQFT 4JI2T 4JI8T 4LFAT 4X62T 4DR5T 1XMQT 4OX9T 2VQET 4JI4T 1XMOT 1HNXT 1I94T 4NXNT
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4B3S T;  1J5E T;  4LF5 T;  2UUC T;  4LFB T;  4LF6 T;  4DV5 T;  1IBL T;  4X65 T;  2E5L T;  3OTO T;  1N34 T;  4LF4 T;  1HNZ T;  1N33 T;  4DV1 T;  4B3T T;  2F4V T;  4KHP T;  4DR6 T;  4JI1 T;  1XNR T;  4JI5 T;  4DR3 T;  4DR7 T;  4GKK T;  4K0K T;  4DV4 T;  2HHH T;  4JI0 T;  4DR2 T;  4DUY T;  4DV6 T;  4JI6 T;  1FJG T;  4JYA T;  2UU9 T;  1HNW T;  4DR1 T;  1IBM T;  1IBK T;  4DR4 T;  4NXM T;  4LF7 T;  4B3M T;  4LF8 T;  2UXD T;  4JV5 T;  3T1Y T;  5BR8 T;  4DV7 T;  4X64 T;  4LF9 T;  4AQY T;  1HR0 T;  4X66 T;  4DV0 T;  4YHH T;  4DV3 T;  3T1H T;  1N36 T;  4DUZ T;  2UUA T;  1N32 T;  5LMU T;  1XNQ T;  4B3R T;  2UUB T;  4DV2 T;  2UXB T;  4JI3 T;  2UXC T;  5IWA T;  2ZM6 T;  4YY3 T;  4LFC T;  4GKJ T;  4JI7 T;  5LMN T;  2VQF T;  4JI2 T;  4JI8 T;  4LFA T;  4X62 T;  4DR5 T;  1XMQ T;  4OX9 T;  2VQE T;  4JI4 T;  1XMO T;  1HNX T;  1I94 T;  4NXN T; 
#chains in the Genus database with same CATH topology
 4CI3 B;  5DAB A;  2R6G F;  4EYU A;  2IC9 A;  4ZS2 A;  4EGW A;  1HG5 A;  2W67 A;  1W09 A;  2XHE B;  2CCQ A;  1VCT A;  2H89 A;  4DBR A;  2W4X A;  3FHN A;  1WLX A;  3SOL A;  4ILU A;  2BKP A;  3CPZ A;  4NIQ A;  1GQE A;  3F31 A;  4TNV A;  2I0M A;  5AQR B;  2IAK A;  3OYX A;  1D1B A;  5LNK A;  3MKD A;  2NW8 A;  2E5L T;  3LK3 B;  3LDQ B;  2YKS A;  3MZK B;  1E1H B;  4QWN B;  1U5P A;  2LRL A;  2XJ7 A;  1FMV A;  3FZF B;  1KFY A;  4LF4 T;  1HNZ T;  2IDO B;  4ZZC A;  4ZI7 E;  1VRB A;  4KUM B;  2VL0 A;  3L09 A;  4QX7 B;  3AEC A;  3B57 A;  3IF8 B;  3ONX A;  4JUY A;  1T8B A;  3KIN B;  3ZSS A;  2H3R A;  4XAX B;  2LM9 A;  2X0L B;  4P0B A;  2LM2 A;  3AA6 B;  4AKL A;  5LYJ E;  2XSB A;  2PBI A;  2VWA A;  3AEB A;  3N2K E;  3U3I A;  4KHP T;  4CXW A;  1SE7 A;  3N9P A;  3NKZ A;  4JEH B;  3NZQ A;  4HFH A;  4I50 E;  1D0Y A;  2LHN A;  4DR3 T;  2XQ6 A;  3AE5 A;  4O4J E;  5LBQ B;  4U31 A;  4DID B;  3JAE A;  4GYR A;  3ZMU B;  3NRX A;  4DR7 T;  4AI6 A;  2VUR A;  3P7I A;  3LK4 2;  3AB3 B;  2E9X A;  4HWD A;  3RRW A;  3EI0 A;  2NTY A;  4L9I A;  3C4Z A;  4H9R C;  4DR2 T;  5JR9 A;  2Q9Q A;  4YHJ A;  2CMR A;  5KX5 E;  2CPT A;  4X1I E;  2CWO A;  2J4G A;  2VVS A;  4KHZ F;  5HEG A;  3UFE A;  2LSG A;  5IUX A;  4DMV A;  1MND A;  1M7K A;  3CK6 A;  1ZOY A;  5M4Y A;  2W63 A;  2WDR A;  3HKB E;  2DWG A;  5AQG B;  4HWF A;  2X9Y A;  2X68 A;  5JQG E;  2XAQ B;  3ZEF B;  4LMJ A;  3J9X 1;  5LGT B;  1HF8 A;  2KWI B;  4L0R A;  2NP9 A;  2CM0 A;  2YK0 A;  4NXM T;  4DR4 T;  3ZMS B;  3VR8 A;  3WAJ A;  5LXT E;  2RPA A;  4LF8 T;  1J1J A;  2UXD T;  3H3A A;  5F8P A;  4ILC A;  1QUU A;  2AXD S;  2CEA A;  2EHO D;  2RA1 A;  5DQW A;  4OFZ A;  5J0Z A;  4JV5 T;  3AEE A;  3AE9 A;  4MAL A;  3DTO A;  3KV5 A;  2CBJ A;  4HTE A;  3T1Y T;  4QX8 B;  2EHO A;  1FIO A;  2BDE A;  2DCF A;  5C2T A;  4H9N C;  2L9Q A;  4AQY T;  2V1D B;  3PUA A;  3AEA A;  3LK2 B;  3HA4 A;  4HFI A;  4YSZ A;  3OJA A;  1YKH B;  3C50 A;  5LGN B;  1UUR A;  4IT4 A;  2HH7 A;  4O8S A;  5JDG A;  1FEW A;  4E7Z A;  4U2Z A;  1BR0 A;  3M65 A;  2CRB A;  1HTJ F;  4MHC A;  3CKD A;  3UQ4 A;  1XDO A;  4IE5 A;  4PW8 A;  4ZZB A;  1HFA A;  5TAO A;  3FZL B;  4CXX A;  2LOS A;  3FBL A;  1BR2 A;  1SHZ C;  2LEH A;  2WM9 A;  4H9P C;  3ZYL A;  5HXS A;  1ZEE A;  3MAC A;  4IIJ E;  3ZCI A;  4HWI B;  2X9X A;  3RIF A;  2N2N A;  3P50 A;  3ZLI A;  5ABH A;  2UXB T;  2FJA A;  2D0U A;  3Q5X A;  4GK5 E;  2UXN B;  4HWC A;  3RPU A;  4B3S T;  2H88 A;  3QC9 A;  2J47 A;  5L4H A;  3RHW A;  3NRY A;  2VKO A;  1OXZ A;  2WMO A;  3JAF A;  4HWH A;  1OED C;  4L5G A;  5C3J A;  2NWB A;  4LFC T;  4HKA A;  4XBF B;  3ANW A;  4JI7 T;  5HXC A;  2NW7 A;  4YJ2 E;  1OED E;  4PK5 A;  2X51 A;  2GK9 A;  1JNZ A;  4JI8 T;  3KV4 A;  4TX5 A;  4I0U A;  4U74 A;  1KNZ A;  4UEM A;  4DR5 T;  5ABF A;  5JDQ A;  2WB5 A;  5AQU B;  5IYZ E;  3VRB A;  2JQH A;  3KDS E;  4AKR B;  1XMQ T;  1FMW A;  3CX8 B;  1YW0 A;  2BKO A;  3T8O A;  1LVK A;  3ZC1 A;  2Z6E A;  3C64 A;  3ZJ1 A;  1NEN A;  2A3D A;  4I4T E;  2HPJ A;  3ZMV B;  5ABF B;  2LRK A;  4PAG A;  3AA7 B;  3W15 B;  5LGU B;  4WNK A;  1I94 T;  2OV9 A;  2YN6 A;  2G0U A;  4K0U A;  2V6X A;  5HAX A;  2WY2 A;  1MNE A;  3RH3 A;  2VB6 A;  2ODV A;  1B7T A;  4EZH A;  1MIY A;  2XQA A;  2PJQ A;  4YSX A;  3RRC A;  3I9W A;  3RGL A;  4IE0 A;  2VKD A;  4MFR A;  4PJN A;  5JDM A;  2ZM6 T;  2E9X D;  2LKH A;  3AE6 A;  4PK6 A;  4JLE A;  2K5B B;  2DWK A;  2LSY A;  1ZP0 A;  1QLB A;  1HG2 A;  3BK9 A;  2MBG A;  2V8S V;  3EDU A;  2J62 A;  2LHR A;  4BAY B;  4CI2 B;  4X65 T;  4O2A E;  1XWM A;  3OTO T;  3O4X E;  4IST A;  3PJA A;  5HEO A;  5FY0 A;  5HCJ A;  3H37 A;  5JRC B;  2OA5 A;  4J2C A;  3MA9 A;  2QVA A;  4AQF C;  4CZZ B;  3O1I A;  5L4E A;  3ZCJ A;  3AAI A;  3CQX C;  2V6Y A;  2F4V T;  4YFS A;  2A9U A;  3TLT A;  5F3J A;  2M6I A;  5LG4 A;  4ZI3 D;  4DR6 T;  4IRE A;  1CUN A;  1KNP A;  3KV9 A;  2XQ7 A;  3PE0 A;  3FXE B;  3P4R A;  1UCU A;  3H3M A;  3P8C D;  4ZI2 C;  2XQ4 A;  4F6R C;  4KBM B;  3KBT A;  3K8P C;  4ZEY A;  4Q25 A;  3RIU A;  4K0K T;  4KMC A;  5LJN A;  4YJ3 E;  1HNW T;  3GWH A;  3QNU A;  4A97 A;  5H6Q B;  4DV4 T;  2HHH T;  4JI0 T;  3ONL C;  2DNX A;  5LHH B;  3RC3 A;  1W0B A;  3VKG A;  4O4H E;  2VAS A;  3AXJ B;  4DV6 T;  3PUQ A;  1KK7 A;  4EEB A;  5EK4 A;  1WFD A;  1OED B;  2IHR 1;  5FXZ A;  1FJG T;  3E08 A;  4NPP A;  4EV6 A;  2E2A A;  4TWH A;  4TV9 E;  1YXR A;  3EUH A;  3AEG A;  5GON E;  4ZI2 D;  2ACZ A;  4AIS A;  5L3F B;  4UVB B;  5CA0 E;  4MBQ A;  2ACX A;  3PUG A;  5AQI B;  4DR1 T;  4ASK A;  2BVL A;  4H63 V;  2V7J A;  3I9Y A;  2YDQ A;  3L3P A;  1T72 A;  1ZKE A;  4FJO A;  1E7P A;  5FXV A;  5JVD E;  2VL8 A;  1NWM X;  1IAP A;  5AQJ B;  3UUM A;  4HN9 A;  5AQN B;  3PJA J;  3PUX F;  3UUB A;  2XSA A;  4UEL A;  1LKX A;  2WDQ A;  4U2Y A;  3NWI A;  4GYS A;  1HS7 A;  3FZH B;  2CXL A;  3N9O A;  3BQL A;  3E22 E;  3CX6 B;  4X20 E;  3AED A;  1OED A;  2YU2 A;  2Q9Q D;  4DV3 T;  3OBV E;  5AQK B;  5JR9 B;  3T1H T;  2Q9Q B;  1N36 T;  2Y48 B;  2D5U A;  2XY8 B;  3Q9D A;  4WBO A;  2UUA T;  2IIU A;  1VOM A;  3RIU C;  3MJX A;  3ZST A;  5JRC A;  5LCY A;  4I43 B;  4AKG A;  3RX6 A;  3S4U A;  4DBQ A;  5LMU T;  3UTK A;  3JC6 C;  3FBZ A;  1LVF A;  4HE8 A;  4IGU A;  5FXW A;  4B3R T;  1WCR A;  2XTL A;  3Q2M A;  4NUU A;  4QXH B;  2KIN B;  3ONJ A;  5FMN A;  3ZYK A;  2HN2 A;  1D0Z A;  1D1C A;  2WBL A;  4QH5 A;  3E0Z A;  5ADX L;  2ES0 A;  2WMN A;  5AQL B;  3RYC E;  3HKD E;  4JI3 T;  3RC8 A;  4HFE A;  4X1Y E;  2B1E A;  3QB5 A;  4TUY E;  3CVR A;  5FNV E;  5CB4 E;  1UX4 A;  3LBX A;  2NOX A;  3UU3 A;  2X67 A;  3AE2 A;  3SFD A;  2ZM2 A;  5CA1 E;  3RYI E;  5L2L A;  1S35 A;  2XQ3 A;  2JMK A;  2XAJ B;  5FY7 A;  5HXR A;  2VQF T;  4JI2 T;  4BA9 A;  5FL1 A;  4LFA T;  3EDV A;  3GN5 B;  3V5U A;  4X62 T;  1OWA A;  2KZ7 B;  4IE6 A;  4GIW A;  4UF0 B;  2C5J A;  2NW9 A;  4DO0 A;  2IML A;  3SRZ A;  2D0T A;  5EK2 A;  3LG7 A;  4EOZ B;  5FXX A;  3ZMZ B;  4DVD A;  1MMG A;  1XMO T;  3N9L A;  2BBJ A;  2KWH A;  2L3L A;  5AQM B;  5FL0 A;  4EED A;  3PUV F;  3J7Y q;  2QYW A;  4EZ4 A;  1T7S A;  5AFU L;  1D0X A;  4TWD A;  1H7C A;  1D1A A;  2E8I A;  4PJM A;  2EHO B;  2LOP A;  4PFP A;  5ABG A;  4NXN T;  4TZ4 C;  1J5E T;  5FYM A;  2ZLY A;  3LBX B;  3C4W A;  3OPC A;  5KMG P;  2BZB A;  4OYJ A;  4A5X A;  5BMV E;  2JIW A;  4HFC A;  2Q9Q C;  4IHJ E;  1KNR A;  4ZS3 A;  5AQV B;  3ZT7 A;  4BJM A;  2QA7 A;  3AXJ A;  5CGM A;  3KV6 A;  3UU8 A;  3AE4 A;  5AQP B;  1G73 A;  2N1G A;  2WU5 A;  3JAD A;  1EZ3 A;  4QH1 A;  3CX7 B;  4UF0 A;  4AQG A;  4E7S A;  1N34 T;  3JC6 D;  4QXC B;  1WRD A;  3ZJ2 A;  2D2S A;  2KMF A;  2Y8D A;  2BG9 E;  2RP4 A;  2C5K T;  1W0A A;  4KX6 A;  3AA0 B;  5JDL A;  3F2E A;  4DV1 T;  1KF6 A;  2XQ9 A;  2X0H A;  4QHO A;  3N9Q A;  3R84 B;  4KP3 C;  1BR1 A;  1X9B A;  5JDF A;  2ODU A;  3L8R A;  3QK6 A;  5IHY A;  3CML A;  3CWZ B;  3B13 A;  3PDY A;  4QH4 A;  4DMW A;  4IL9 A;  1XNR T;  2WZI A;  4JI5 T;  1Y64 B;  2KXP B;  5L3B B;  2LE8 A;  3SWH A;  4NUV A;  3O1J A;  3ZN1 B;  5ABE A;  3RYF E;  2CLY B;  2XZE A;  3FZM B;  4GKK T;  3UFG A;  2WAU A;  4G2A A;  4WBN E;  2HPL A;  3OKQ A;  3UUN A;  5LP6 E;  2UXX B;  4ISS A;  4P0A A;  1MMN A;  2N9D A;  3N9N A;  5JDN A;  2JJ9 A;  3UUX B;  1DU2 A;  4OX9 T;  4IDN A;  5LHG B;  4H9S E;  4TN7 B;  3UUL A;  4DUY T;  3MXZ A;  4H63 H;  2LKG A;  2XM1 A;  2JRK A;  3ABV A;  4PFO A;  2JQQ A;  4WZX A;  4DND A;  4LML A;  1X79 A;  3AVR A;  1S94 A;  1SUM B;  2LLY A;  2UU9 T;  3PTR B;  1SA0 E;  3F57 A;  3C98 B;  2CE7 A;  3I1A A;  2JPF A;  2V5D A;  3R6N A;  3TKL B;  5HXE A;  4ZOL E;  5JRE A;  2H7O A;  2XQ8 A;  2V7L A;  3PUW F;  1IBM T;  3HL6 A;  1Y01 A;  2YDR A;  2LT3 A;  4LF7 T;  1HX8 A;  5FVK A;  2ZM8 A;  4B3M T;  2MPK A;  2CBI A;  5FP3 A;  1M62 A;  3PU8 A;  5FY1 A;  4CN4 A;  5J2U E;  4GOU A;  3LFM A;  3GMI A;  1US7 B;  3TLS A;  5BR8 T;  2H7V C;  4ZXL A;  2IUB A;  2MOZ A;  4DV7 T;  2YIN A;  3KVB A;  1CHU A;  2M6B A;  2PTF A;  2K48 A;  3Q5E A;  4OHF A;  3UU5 A;  3ZT5 A;  4F8H A;  2C0S A;  2VKH A;  3G06 A;  3K1S A;  5AQT B;  3UU4 A;  4X66 T;  2XQ5 A;  3RYH E;  4YHH T;  2V7K A;  4UIG A;  4DV0 T;  2V6Y B;  4OYK A;  5CJ5 A;  3O9X A;  3Q5D A;  4DUZ T;  4H9Q C;  1N32 T;  2B76 A;  2BVM A;  2W66 A;  3ETU A;  2XAS B;  3ZKR A;  1WR0 A;  1IBL T;  2WQY A;  4UV9 B;  3HKE E;  1XNQ T;  2BG9 B;  2MYS A;  4EIW A;  1MIV A;  2ZM0 A;  2WS3 A;  3PUR A;  4YTP A;  1YQ4 A;  2YU1 A;  4IDO A;  5EK3 A;  4DV2 T;  5CFB A;  1NAF A;  5J2T E;  1MIW A;  3FZK B;  4X5T A;  5L3G B;  3K3Q C;  2IC6 A;  5AQQ B;  5H6R B;  5HWX A;  3QUJ A;  1XZY A;  5C8Y E;  2UXC T;  4AQF A;  4YTN A;  2C5I T;  5DQV A;  2JMH A;  2AE9 A;  3A8Y C;  2HN1 A;  2MTQ A;  4U33 A;  4YY3 T;  5IWA T;  5E0O A;  2A72 A;  3IA3 A;  4CN6 A;  2VKJ A;  3RKO A;  4AKI A;  2BS2 A;  2K24 A;  4U3C A;  2CHO A;  2W0G A;  3HR0 A;  2OLT A;  1XDP A;  3PUZ F;  2VVN A;  2MAW A;  3FB2 A;  3KVA A;  3JCF A;  4FI5 A;  4O2B E;  4JEU B;  4O4L E;  4QKN A;  1QSD A;  4U7I A;  4UVC B;  2WWV A;  4PK4 A;  4ADZ A;  5L47 A;  4HGA A;  5JTG A;  2BG9 A;  3AE8 A;  1ZV4 X;  3AAA B;  1G8X A;  2KND A;  5KXJ A;  3VKH A;  3SS1 A;  4JI4 T;  2WP9 A;  3C4X A;  4QXB B;  3Q5W A;  3DJB A;  5HEJ A;  3B5M A;  2W61 A;  3X1D A;  3EHZ A;  2QGS A;  3PUS A;  1ZHC A;  2K9A A;  5F5W A;  5LOV E;  3PU3 A;  3ZC0 A;  3PUY F;  3AEF A;  4UV8 B;  2X9W A;  2X0Y A;  3RQW A;  4IDP A;  2YEV C;  2VK9 A;  2E9X C;  5JH7 E;  3UQ7 A;  4LF5 T;  2XPK A;  2UUC T;  3ZT6 A;  2XAG B;  4B6X A;  4PJJ A;  4COF A;  2DL1 A;  4LFB T;  5LJM A;  4UVA B;  4LF6 T;  4TNW A;  4DV5 T;  2XM2 A;  4EAH A;  1NEK A;  3LJC A;  3LSV A;  3M3Z B;  5AQH B;  5HXH A;  3D0T A;  4N78 D;  2XQY A;  3N9M A;  4IE4 A;  2YDS A;  5LG3 A;  2BG9 C;  2DHR A;  1JNR A;  2XUE A;  4C91 A;  1UGO A;  3IEE A;  4YTM A;  4CXY A;  2BS4 A;  3BQK A;  2FJD A;  2XAF B;  2CWY A;  2J1D G;  3BQI A;  3HKC E;  4CQI A;  2JQK A;  3AAE B;  4ILB A;  4XZC A;  3MK7 C;  3P4P A;  4JBW F;  3RKG A;  4C90 A;  1N33 T;  4WW0 A;  4U7Y A;  4AKH A;  4PJL A;  2NR4 A;  4B3T T;  5LA6 E;  3OVU A;  4HFD A;  4X1K E;  1IJ6 A;  2A2F X;  3SFE A;  4CI1 B;  3I0O A;  5JR9 C;  4JI1 T;  2WZH A;  2NTX A;  3TLW A;  2V5C A;  1E2A A;  4LMK A;  5KDM C;  5JDH A;  3CQG B;  4TWF A;  2W2U A;  4IDZ A;  2X9H A;  1Z0P A;  2DLR A;  2KT9 A;  1HX1 B;  3OYZ A;  4Z8X A;  4HEA A;  4ZHQ E;  2LSK A;  3UT5 E;  3I0Q A;  4EYY R;  4P09 A;  3N2O A;  4G63 A;  2P9B A;  2M67 A;  2FUP A;  1T98 A;  1R8I A;  3NBX X;  3GA8 A;  3PV0 F;  4KI0 F;  1O3X A;  1WYC A;  4JI6 T;  1UK5 A;  2CXD A;  2EHO C;  2V7M A;  2E5V A;  5HWY A;  5HEH A;  3AVS A;  4JYA T;  1WYB A;  4M1P A;  3RI5 A;  5L3E B;  3UU6 A;  3WI3 A;  5HYA A;  1MMA A;  5LHI B;  3ETV A;  2I6H A;  4I55 E;  4PNI A;  3ZPO A;  4U72 A;  1IBK T;  4IE7 A;  2QRX A;  2K3W A;  3A5X A;  3C51 A;  3P4W A;  3RQU A;  2FBW A;  1UX5 A;  4Z91 A;  5EZY E;  4BJN A;  3VRA A;  4YT0 A;  1Z8U A;  3AA1 B;  1U4Q A;  3CQC B;  5ETW A;  5L3D B;  3AE7 A;  3ANW B;  1YD8 G;  3A7M A;  1HCI A;  5DJQ C;  5HEU A;  2WU2 A;  4X64 T;  2LSJ A;  3ZYM A;  4LF9 T;  4IL4 A;  3K3N A;  2XAH B;  1IZN B;  2W62 A;  5FKY A;  1HR0 T;  2FJB A;  3RF1 A;  3QOF A;  2YOE A;  3ESL A;  2E9X B;  3VR9 A;  4A98 A;  1WR6 A;  2BS3 A;  1I6Z A;  4UXN B;  3TLV A;  3O1H A;  1J5W A;  2FJE A;  5HCM A;  2PFV A;  3CIR A;  2D9D A;  3TLU A;  2CLY C;  3GN5 A;  3EAM A;  4O4I E;  1MMD A;  1LRZ A;  4IDQ A;  4YLH A;  3IBP A;  2UUB T;  5AQS B;  1BR4 A;  1YQ3 A;  4Z90 A;  2WDV A;  2WSS V;  5AQF B;  3N2G E;  2X66 A;  5J1G A;  3FXD B;  5L3C B;  3VU7 H;  3NVO A;  4ILA A;  2I59 A;  1VCS A;  3IHR A;  5LBM A;  2L8K A;  3V5S A;  4TV8 E;  4AIU A;  5LB7 B;  1AJ3 A;  2LJL A;  2PG8 A;  3NZP A;  4AXP A;  4YSY A;  4MLK A;  2CHN A;  3P4Q A;  2IW5 B;  5A1L A;  4GK0 E;  3U78 A;  1UUS A;  4HFB A;  4A56 A;  4EXT A;  4GKJ T;  2V7I A;  3VHL A;  4ZI3 C;  4UR9 A;  2KSR A;  2LSI A;  3EAB A;  4EB6 E;  2SPC A;  5LMN T;  2WCA A;  4OK0 A;  4P1N A;  2JQ9 A;  3DP7 A;  4H9O C;  3RLF F;  3KFW X;  2CXF A;  3P4S A;  2ZMA A;  3AE3 A;  2Y6X A;  3KBU A;  3N5L A;  4ERR A;  2WWU A;  1W9R A;  3AE1 A;  2CA5 A;  4ANJ A;  5FVL A;  2BKN A;  1YKE B;  3QB5 K;  3ZN0 B;  1IJ5 A;  4WYV A;  4CN1 A;  2VQE T;  1KEY A;  2V26 A;  3EVY A;  3WAK A;  4YXD A;  3L39 A;  1HNX T;  4HFV A;  1L0V A;  3ZMT B;  2DI4 A;  1V9D A;  2BBH A;  3RIA A;  5AQO B;  3HI2 A;  2W00 A;  3K3O A;  4V1A v;  2KLQ A; 
#chains in the Genus database with same CATH homology
 4B3S T;  1J5E T;  4LF5 T;  2UUC T;  4LFB T;  4LF6 T;  4DV5 T;  1IBL T;  4X65 T;  2E5L T;  3OTO T;  1N34 T;  4LF4 T;  1HNZ T;  1N33 T;  4DV1 T;  4B3T T;  2F4V T;  4KHP T;  4DR6 T;  4JI1 T;  1XNR T;  4JI5 T;  4DR3 T;  4DR7 T;  4GKK T;  4K0K T;  4DV4 T;  2HHH T;  4JI0 T;  4DR2 T;  4DUY T;  4DV6 T;  4JI6 T;  1FJG T;  4JYA T;  2UU9 T;  1HNW T;  4DR1 T;  1IBM T;  1IBK T;  4DR4 T;  4NXM T;  4LF7 T;  4B3M T;  4LF8 T;  2UXD T;  4JV5 T;  3T1Y T;  5BR8 T;  4DV7 T;  4X64 T;  4LF9 T;  4AQY T;  1HR0 T;  4X66 T;  4DV0 T;  4YHH T;  4DV3 T;  3T1H T;  1N36 T;  4DUZ T;  2UUA T;  1N32 T;  5LMU T;  1XNQ T;  4B3R T;  2UUB T;  4DV2 T;  2UXB T;  4JI3 T;  2UXC T;  5IWA T;  2ZM6 T;  4YY3 T;  4LFC T;  4GKJ T;  4JI7 T;  5LMN T;  2VQF T;  4JI2 T;  4JI8 T;  4LFA T;  4X62 T;  4DR5 T;  1XMQ T;  4OX9 T;  2VQE T;  4JI4 T;  1XMO T;  1HNX T;  1I94 T;  4NXN T; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...