1I94T

Crystal structures of the small ribosomal subunit with tetracycline, edeine and if3
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
99
structure length
99
Chain Sequence
b'RNLSALKRHRQSLKRRLRNKAKKSAIKTLSKKAIQLAQEGKAEEALKIMRKAESLIDKAAKGSTLHKNAAARRKSRLMRKVRQLLEAAGAPLIGGGLSA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S RRNA
publication title Crystal structures of complexes of the small ribosomal subunit with tetracycline, edeine and IF3.
pubmed doi rcsb
molecule tags Ribosome
total genus 27
structure length 99
sequence length 99
ec nomenclature
pdb deposition date 2001-03-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
T PF01649 Ribosomal_S20p Ribosomal protein S20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.110 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Ribosomal protein S20 1i94T00
4LF8T 4JI0T 1XNRT 4JYAT 4LF4T 2HHHT 4B3MT 4LF6T 4OX9T 4JI5T 1HNWT 2UXCT 4X64T 4GKJT 2E5LT 4DV1T 1FJGT 2UXBT 4DR4T 4JI4T 4DR5T 4JI2T 1N34T 1J5ET 4DR3T 4DUYT 4DV5T 2UUAT 1HNZT 5BR8T 4LF9T 4DV0T 4DV7T 2VQET 4JI7T 4DV2T 5IWAT 1IBMT 4DV3T 4DV4T 4JV5T 4JI6T 4DUZT 2F4VT 4NXMT 4X66T 1N33T 4B3ST 1XMQT 4JI1T 1XMOT 4LFCT 4DR7T 1IBLT 1HNXT 4JI3T 4K0KT 2UUBT 3T1YT 3T1HT 4X62T 4GKKT 4LFBT 1IBKT 1XNQT 2ZM6T 2UU9T 1N36T 4DV6T 4LFAT 3OTOT 2UXDT 4DR1T 4JI8T 1I94T 2UUCT 4LF5T 5LMNT 4X65T 4KHPT 4YY3T 1HR0T 5LMUT 1N32T 4DR2T 4LF7T 4AQYT 4NXNT 4DR6T 4B3TT 4B3RT 2VQFT 4YHHT
chains in the Genus database with same CATH superfamily
5L4EA 3RIUC 4IDZA 2NTYA 1VCSA 4O4HE 4P1NA 4ZI2D 4H63V 1ZV4X 2V7JA 1IAPA 2XQ3A 2VVSA 4DR5T 1I6ZA 2VKHA 4O4JE 3U3IA 5IYZE 1HF8A 5AQTB 4DV0T 1OWAA 5CA0E 5IWAT 1JNZA 5JDQA 5AQUB 3ONXA 2WU2A 3W15B 2F4VT 2LRKA 3SFDA 3C50A 1XMQT 1Z8UA 3G06A 4U2YA 4AXPA 4ZS2A 2D0UA 4BAYB 4A5XA 2V7LA 3UU5A 1WR6A 4QKNA 2JQKA 4ANJA 2V8SV 2MOZA 4L0RA 4XZCA 2IW5B 3OVUA 2DNXA 4ILUA 4H9OC 3B5MA 2E5VA 3H37A 4PNIA 1QLBA 3VRBA 1VOMA 4ZS3A 2CXLA 4OYJA 3RYCE 3ZSTA 4IE0A 2ZLYA 4IL9A 4WBOA 1KFYA 2PBIA 3TLVA 3QUJA 5BMVE 4UF0A 3QC9A 4CI1B 4WW0A 1T72A 5HXSA 1CUNA 1KK7A 3E08A 2K48A 4PK6A 2E5LT 4ILAA 1GQEA 3BQLA 4PJLA 1N34T 4B6XA 3VKHA 4UVCB 4UF0B 4JI7T 1IBMT 2VL0A 3H3MA 5L3FB 3EVYA 2CWOA 5M4YA 5J1GA 3PUQA 4IREA 4QXCB 2DWGA 3A5XA 1ZEEA 2A2FX 3N9OA 4P09A 1D1AA 3P4QA 2CMRA 3ESLA 5JR9A 3T1YT 3P4SA 4PJJA 3HKCE 4MHCA 3LDQB 2OV9A 1MMNA 2M6IA 1NWMX 4AQGA 3ZLIA 3ZJ1A 3AEBA 3CX7B 1B7TA 1LRZA 2FJDA 2ZMAA 5JDLA 3IHRA 4IE6A 3SFEA 3JAFA 5L3DB 3PTRB 4JBWF 2D2SA 4UELA 5FKYA 5AQFB 5JR9B 3O1HA 2HPLA 5KMGP 2NW7A 4K0UA 4HFEA 1DU2A 4AIUA 4HWCA 3KBTA 3QB5K 4DV1T 3P7IA 3RC3A 1LVKA 2WS3A 5HWYA 2X0YA 4UV8B 5FL0A 2UUAT 3SS1A 3N2KE 4U74A 1HTJF 3AE9A 3L09A 1WRDA 1LKXA 3ZEFB 3T8OA 3CX6B 3CK6A 5ABHA 3FZHB 3RQUA 4DUZT 2LKGA 4G2AA 3J9X1 3K8PC 2BBJA 2FJEA 2IAKA 4O2AE 2IC6A 2A3DA 1WYBA 1VRBA 5LB7B 1H7CA 4NUUA 4GKKT 3K3NA 3O1JA 2Q9QD 2EHOC 4DV6T 4LFAT 1KNRA 5AQVB 2LM9A 2NP9A 2IC9A 4UEMA 2XY8B 3KBUA 4WBNE 3RHWA 5CB4E 4IT4A 2VK9A 1SHZC 1WYCA 3P4WA 3CIRA 2VASA 4LF4T 3DJBA 3RF1A 3MXZA 3TLSA 2HHHT 4HWDA 3I0QA 1BR2A 4JI4T 1HX1B 4DBRA 5LG4A 4DV5T 3AAEB 3ETVA 2ZM2A 2XQYA 5FY7A 5L2LA 5ABFA 2Z6EA 4DNDA 5LHIB 4PK5A 4JI6T 4HE8A 1KNZA 1UCUA 4I4TE 4YXDA 3FBLA 5FXVA 1HG2A 4EZ4A 4E7SA 4KI0F 3ZN1B 3AB3B 3KV6A 3U78A 5JTGA 3VHLA 2LSKA 5ABFB 1N36T 2A72A 3NVOA 1KEYA 2CE7A 2XQ7A 1Y01A 4ZI2C 3E22E 4JI8T 3Q5WA 5ABEA 2E2AA 4I43B 2YK0A 4ILBA 2WMNA 2V5DA 2LM2A 2K5BB 2NW8A 1BR0A 3UQ4A 2FUPA 2IDOB 4JI0T 3WI3A 2YDQA 1WFDA 3N9QA 4DMWA 2NW9A 2LSGA 3VRAA 3ANWA 2JJ9A 2XAGB 2V1DB 3PE0A 4IDNA 3AE7A 4PW8A 4DUYT 2WY2A 3UT5E 2E9XD 2FJAA 3VKGA 3VU7H 2WU5A 5FY0A 2DL1A 2QA7A 4EEBA 3X1DA 5AFUL 4KX6A 2G0UA 3V5SA 2D9DA 3C4WA 2ACZA 2RPAA 3O4XE 5L3CB 2HN1A 3PJAJ 2XAQB 4A97A 5LGTB 4PJNA 4FI5A 4UV9B 2CLYB 4IE5A 3ZC1A 4C90A 2CHNA 2MTQA 4NUVA 3RIUA 4X65T 2FBWA 5ABGA 1OEDB 5LBQB 4U31A 3MKDA 2I0MA 5HXCA 5C8YE 4BA9A 1UK5A 2V7MA 4TZ4C 2YKSA 4AQYT 2LRLA 4DR6T 5LBMA 3LFMA 1OEDC 2DI4A 5IUXA 2A9UA 5EK4A 3RIFA 4GOUA 3PUGA 3UU3A 2CBIA 1XWMA 1X79A 3CQGB 4OK0A 3TLUA 2XQ4A 1IJ6A 3AE6A 4AI6A 2KWIB 4B3ST 4CXXA 3L39A 4JI1T 2NOXA 5FXWA 1IBLT 3VR9A 4YSYA 2LSYA 1HNXT 3ZMSB 3EI0A 2JQ9A 4LFBT 2XAFB 4MALA 4MLKA 1FIOA 5AQHB 3LK2B 3MACA 2UXDT 3TLTA 4LMJA 5LGUB 1U5PA 5GONE 3AE4A 1HR0T 5FP3A 2KT9A 2ODUA 1UX4A 3I9WA 2KINB 2XQ5A 4ZXLA 2KMFA 3UU4A 4DR2T 3K1SA 3LJCA 1MIYA 2QGSA 4PJMA 4CI2B 2L8KA 2DLRA 3ZJ2A 2MPKA 2Q9QB 3UU6A 2N9DA 5JREA 2H88A 4X64T 5F8PA 3OYXA 1UGOA 3Q9DA 2VVNA 4J2CA 4LF9T 2Q9QC 3Q5EA 2B1EA 3HR0A 3UULA 1KNPA 1UURA 3EUHA 4UVBB 5LYJE 4COFA 2PJQA 2IUBA 1MMAA 3RQWA 2BVLA 1AJ3A 1MIWA 2X51A 3RRCA 5J2UE 1ZOYA 1O3XA 2Y8DA 3KV9A 4QXHB 2W66A 4XBFB 4EAHA 2IIUA 2V6YB 2JMKA 2XSAA 3B57A 4OFZA 4X5TA 3CX8B 2XASB 5HEHA 4E7ZA 1EZ3A 3RGLA 3F31A 3OBVE 2XSBA 4CN6A 4X1IE 3AA6B 2L9QA 3RRWA 3SWHA 4HFBA 3AEGA 5AQJB 4XAXB 5L47A 4YHHT 4I0UA 5DABA 5J0ZA 2WZHA 3C98B 4CN1A 1D0XA 3FZLB 2CXDA 5HEOA 3HL6A 4ZI3C 1X9BA 5AQGB 1HG5A 2K9AA 3OJAA 2CA5A 2WQYA 5HXHA 2BKNA 3BK9A 2VQET 4AQFC 4IIJE 3E0ZA 2AE9A 1US7B 2CEAA 1E1HB 2I59A 3LK3B 4QHOA 3I0OA 2EHOA 2BKOA 3MJXA 3NKZA 3IBPA 5ETWA 3JAEA 4O4LE 2B76A 2CXFA 4AISA 3ONLC 3CKDA 4X62T 4JLEA 4YSXA 1NENA 3RIAA 4ERRA 3OTOT 2EHOB 1MNEA 1XDPA 2R6GF 3PUSA 3N9NA 4IHJE 4LF5T 2V7IA 3FHNA 3VR8A 2BG9C 2JIWA 4QWNB 2PTFA 3PUWF 4HFHA 1WR0A 1M7KA 2E9XC 5J2TE 2W4XA 4ISSA 2X68A 1NEKA 4HGAA 1L0VA 3GN5A 5LCYA 3RH3A 4DIDB 3ZPOA 2HH7A 3B13A 3GMIA 4U7YA 4G63A 2C0SA 2J4GA 3KVBA 5KXJA 2WWUA 3R6NA 3N9LA 2YOEA 4BJMA 4ZOLE 2XZEA 3ZCIA 2P9BA 2BS3A 5L3EB 4DR4T 2CHOA 2LOPA 4UXNB 2GK9A 2K24A 4CXWA 4EB6E 3GN5B 5LXTE 2WSSV 5FXXA 5JVDE 3JC6D 4GYRA 2D0TA 3MZKB 4QX8B 5KDMC 2XQ6A 3P4PA 1S94A 1XZYA 3ZMTB 3RI5A 5HXRA 3NZQA 5AQIB 4TWDA 3PUXF 1ZKEA 2UXXB 2LSJA 3WAKA 3ZYKA 2WZIA 3P8CD 5L3BB 4F6RC 3CPZA 1OEDE 3RX6A 4YTMA 4HWHA 5LGNB 3F57A 1M62A 3F2EA 3V5UA 2JPFA 4HFCA 1MNDA 3KDSE 3FXEB 2WP9A 3AECA 3MK7C 4B3RT 5AQKB 2LT3A 2X9XA 1WCRA 4LF6T 4V1Av 3CMLA 3FBZA 4H9NC 2W2UA 3RKGA 1ZP0A 3PU8A 5FY1A 1BR1A 3AXJA 2BDEA 3LSVA 1J5ET 1V9DA 2J47A 5EK3A 2YEVC 4CXYA 2WMOA 3CQXC 4GK0E 3ZT6A 4TNWA 5H6QB 3RKOA 4O2BE 1FMVA 2RP4A 4H9QC 2QYWA 4ZEYA 2ACXA 3CQCB 4IGUA 2XQ8A 5TAOA 5HCJA 4LFCT 5CA1E 3AXJB 4DR7T 5FYMA 4AKLA 3HI2A 4UVAB 4EYUA 1YKHB 4I55E 4N78D 2UUBT 4YFSA 2BKPA 3C4ZA 4M1PA 4U7IA 5KX5E 1OEDA 2X0LB 3LK42 3PUYF 2OA5A 3NRYA 2W67A 5HEUA 5JRCA 2WAUA 5LMUT 3AAIA 3KINB 5LJMA 2ZM0A 2MBGA 5JH7E 4NXNT 3ZYLA 4U72A 3OYZA 3RPUA 1W0AA 1SE7A 4ZHQE 5CGMA 5AQLB 2HN2A 3TLWA 1OXZA 3ZT5A 1HS7A 3AA0B 5JRCB 3UUXB 1FJGT 2M6BA 3Q2MA 4X1KE 1XDOA 4TX5A 5L4HA 5AQRB 4DR3T 2DCFA 2H7OA 3IF8B 1D0ZA 4CN4A 1FEWA 4GK5E 4QXBB 4O4IE 4L9IA 4AKGA 1FMWA 3N2OA 5AQNB 5LJNA 1W09A 2V6XA 1MIVA 2V26A 3QNUA 2CCQA 5HEGA 1T8BA 4AKHA 2UXNB 4JI3T 2X0HA 4YJ2E 3BQIA 3AVRA 5FVLA 5FNVE 4HFDA 2LSIA 3O1IA 3L3PA 4GIWA 3OPCA 5JDFA 4DR1T 1MMDA 1S35A 2HPJA 4TV8E 4DO0A 3SRZA 3PUZF 2W62A 3L8RA 1CHUA 4AKIA 2VWAA 1D1BA 4PFOA 3N5LA 4IE7A 1T98A 3GWHA 2LEHA 1G73A 4IDOA 2Y48B 3BQKA 4B3TT 2VQFT 2LKHA 5ADXL 2Q9QA 5EZYE 3IEEA 2KNDA 2KSRA 5FL1A 3S4UA 4JI5T 2UXCT 1ZHCA 1SUMB 1Z0PA 3Q5XA 3ZC0A 2D5UA 4ZZBA 2VKOA 4JI2T 2LE8A 2XPKA 4ZZCA 1Y64B 1KF6A 3HKDE 3H3AA 3JCFA 4F8HA 2E8IA 3ZSSA 4DV7T 3MA9A 4EZHA 4DV2T 3QOFA 2N1GA 4DV4T 4HFIA 5CJ5A 2N2NA 2YDRA 1N33T 4H63H 1WLXA 3J7Yq 3RLFF 2NWBA 3N2GE 5LOVE 3M65A 1D0YA 4QH1A 2MAWA 2BBHA 2V6YA 2BG9E 4EIWA 1XNQT 2ZM6T 2XJ7A 4OHFA 4ILCA 2WDRA 4P0AA 4YJ3E 5LG3A 3PURA 3C64A 4IDPA 4PK4A 3KV4A 4TV9E 3K3QC 4BJNA 4YY3T 1IJ5A 2WM9A 4KBMB 3ZCJA 2YU2A 1N32T 3PUAA 4KP3C 3O9XA 1UX5A 2M67A 4HWFA 5AQQB 3EHZA 2X9YA 5HYAA 5LNKA 3JC6C 2XHEB 1R8IA 4AQFA 5LP6E 4OYKA 4B3MT 2ZM8A 4OX9T 1VCTA 4NIQA 3D0TA 4GKJT 2W63A 2XQAA 2VKJA 4YHJA 3ZMVB 2H89A 2VKDA 2UXBT 2WCAA 3EDUA 1YW0A 2X67A 3HKEE 5AQOB 3A8YC 3CWZB 5HXEA 3QK6A 2ODVA 5LHHB 2WDQA 4DVDA 4YT0A 3UQ7A 4L5GA 4DV3T 3UFGA 2OLTA 3PU3A 2FJBA 5FVKA 4QH5A 5JQGE 2CBJA 2BVMA 3I9YA 5DQVA 1XMOT 5DQWA 3IA3A 3QB5A 2YN6A 2VL8A 3KFWX 2BG9A 4TNVA 4HN9A 3JADA 2E9XA 3ETUA 1HX8A 5JDMA 2QRXA 5HWXA 4HTEA 3EABA 4LMLA 4KHPT 4ZI7E 2BS2A 2BS4A 2X66A 4KMCA 4TN7B 3RYHE 3UFEA 3FB2A 2BG9B 5JR9C 4Q25A 5HAXA 4Z91A 4EGWA 2W0GA 2E9XB 4CZZB 4I50E 4KUMB 3K3OA 2H3RA 3KV5A 4JYAT 2K3WA 1YKEB 5LA6E 4LMKA 4Z90A 4CQIA 4MBQA 5L3GB 2JQHA 5F3JA 2XAHB 3A7MA 4JEHB 3NBXX 1YD8G 3FZFB 3NZPA 3TKLB 1W0BA 2I6HA 3ZYMA 1HNZT 4O8SA 3SOLA 5BR8T 2Y6XA 3EDVA 2WB5A 2LOSA 2WDVA 4JUYA 4MFRA 2L3LA 4GYSA 4X20E 3DP7A 4JEUB 4YTNA 2WWVA 1YQ3A 1QUUA 5FMNA 1E7PA 2JQQA 4U3CA 3P4RA 3I1AA 1UUSA 4EV6A 2PFVA 3N9MA 3WAJA 3RC8A 4A98A 3DTOA 1IBKT 5JDHA 1J5WA 2CPTA 4EYYR 4IDQA 2CRBA 4WZXA 2BZBA 2LHNA 3AVSA 3M3ZB 1I94T 4HEAA 5EK2A 3ZMZB 3ABVA 5H6RB 2AXDS 1YXRA 2WBLA 5JDNA 3C4XA 4EXTA 4HKAA 5HCMA 2X9HA 3AA1B 3ZT7A 4FJOA 1E2AA 2SPCA 4ASKA 4NPPA 3EAMA 1IZNB 3R84B 2J1DG 4A56A 4EOZB 2J62A 4IE4A 3UUBA 4AKRB 1MMGA 5A1LA 3CVRA 4ZI3D 3RYFE 5E0OA 3N9PA 2C5JA 2KWHA 1W9RA 2X9WA 4JV5T 2W61A 2H7VC 3AEEA 2C5IT 4QX7B 4NXMT 1QSDA 4X66T 4HWIB 5LHGB 3AE8A 4YSZA 2LLYA 4PAGA 1HFAA 2LHRA 3AA7B 2KLQA 4QH4A 4IL4A 2XAJB 2V7KA 3UUMA 2DWKA 4CI3B 2IMLA 4DBQA 2UU9T 3UU8A 3C51A 4EEDA 3Q5DA 4WNKA 2DHRA 4C91A 4UR9A 2UUCT 2CM0A 3UUNA 5CFBA 2KZ7B 5DJQC 2JRKA 4TWHA 4YLHA 4LF7T 1T7SA 3UTKA 3AAAB 1BR4A 4LF8T 2EHOD 1XNRT 3AE2A 2LJLA 4H9SE 1D1CA 4HFVA 3RYIE 3ONJA 5AQMB 3LBXA 2XM1A 1HNWT 2PG8A 2C5KT 2XTLA 3AEFA 1SA0E 1LVFA 3ANWB 2YDSA 4KHZF 1HCIA 5IHYA 2MYSA 4X1YE 3LG7A 4TWFA 4WYVA 3ZKRA 3NRXA 3ZN0B 3HKBE 2JMHA 2YU1A 4U2ZA 3KVAA 3LBXB 3PDYA 3PUVF 5C2TA 5FXZA 4Z8XA 3FXDB 2XQ9A 4YTPA 4U33A 1NAFA 3PJAA 3AE3A 4H9PC 5C3JA 2XUEA 4TUYE 3FZKB 2CLYC 4K0KT 3GA8A 1JNRA 4ADZA 3T1HT 5AQPB 2KXPB 3AE5A 3P50A 4UIGA 1U4QA 3HA4A 4P0BA 2YINA 2QVAA 5JDGA 3NWIA 5HEJA 2W00A 5LMNT 5F5WA 3OKQA 3AE1A 4DMVA 3AEAA 2VURA 3FZMB 4ISTA 2NTXA 3ZMUB 4H9RC 4PFPA 2XM2A 1G8XA 5AQSB 2CWYA 2V5CA 2NR4A 2ES0A 3PV0F 1J1JA 3AEDA 2VB6A 2RA1A 1YQ4A 2IHR1
chains in the Genus database with same CATH topology
4LF8T 4JI0T 1XNRT 4JYAT 4LF4T 2HHHT 4B3MT 4LF6T 4OX9T 4JI5T 1HNWT 2UXCT 4X64T 4GKJT 2E5LT 4DV1T 1FJGT 2UXBT 4DR4T 4JI4T 4DR5T 4JI2T 1N34T 1J5ET 4DR3T 4DUYT 4DV5T 2UUAT 1HNZT 5BR8T 4LF9T 4DV0T 4DV7T 2VQET 4JI7T 4DV2T 5IWAT 1IBMT 4DV3T 4DV4T 4JV5T 4JI6T 4DUZT 2F4VT 4NXMT 4X66T 1N33T 4B3ST 1XMQT 4JI1T 1XMOT 4LFCT 4DR7T 1IBLT 1HNXT 4JI3T 4K0KT 2UUBT 3T1YT 3T1HT 4X62T 4GKKT 4LFBT 1IBKT 1XNQT 2ZM6T 2UU9T 1N36T 4DV6T 4LFAT 3OTOT 2UXDT 4DR1T 4JI8T 1I94T 2UUCT 4LF5T 5LMNT 4X65T 4KHPT 4YY3T 1HR0T 5LMUT 1N32T 4DR2T 4LF7T 4AQYT 4NXNT 4DR6T 4B3TT 4B3RT 2VQFT 4YHHT
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4LF8 T;  4JI0 T;  1XNR T;  4JYA T;  4LF4 T;  2HHH T;  4B3M T;  4LF6 T;  4OX9 T;  4JI5 T;  1HNW T;  2UXC T;  4X64 T;  4GKJ T;  2E5L T;  4DV1 T;  1FJG T;  2UXB T;  4DR4 T;  4JI4 T;  4DR5 T;  4JI2 T;  1N34 T;  1J5E T;  4DR3 T;  4DUY T;  4DV5 T;  2UUA T;  1HNZ T;  5BR8 T;  4LF9 T;  4DV0 T;  4DV7 T;  2VQE T;  4JI7 T;  4DV2 T;  5IWA T;  1IBM T;  4DV3 T;  4DV4 T;  4JV5 T;  4JI6 T;  4DUZ T;  2F4V T;  4NXM T;  4X66 T;  1N33 T;  4B3S T;  1XMQ T;  4JI1 T;  1XMO T;  4LFC T;  4DR7 T;  1IBL T;  1HNX T;  4JI3 T;  4K0K T;  2UUB T;  3T1Y T;  3T1H T;  4X62 T;  4GKK T;  4LFB T;  1IBK T;  1XNQ T;  2ZM6 T;  2UU9 T;  1N36 T;  4DV6 T;  4LFA T;  3OTO T;  2UXD T;  4DR1 T;  4JI8 T;  1I94 T;  2UUC T;  4LF5 T;  5LMN T;  4X65 T;  4KHP T;  4YY3 T;  1HR0 T;  5LMU T;  1N32 T;  4DR2 T;  4LF7 T;  4AQY T;  4NXN T;  4DR6 T;  4B3T T;  4B3R T;  2VQF T;  4YHH T; 
#chains in the Genus database with same CATH topology
 5L4E A;  3RIU C;  4IDZ A;  2NTY A;  1VCS A;  4O4H E;  4P1N A;  4ZI2 D;  4H63 V;  1ZV4 X;  2V7J A;  1IAP A;  2XQ3 A;  2VVS A;  4DR5 T;  1I6Z A;  2VKH A;  4O4J E;  3U3I A;  5IYZ E;  1HF8 A;  5AQT B;  4DV0 T;  1OWA A;  5CA0 E;  5IWA T;  1JNZ A;  5JDQ A;  5AQU B;  3ONX A;  2WU2 A;  3W15 B;  2F4V T;  2LRK A;  3SFD A;  3C50 A;  1XMQ T;  1Z8U A;  3G06 A;  4U2Y A;  4AXP A;  4ZS2 A;  2D0U A;  4BAY B;  4A5X A;  2V7L A;  3UU5 A;  1WR6 A;  4QKN A;  2JQK A;  4ANJ A;  2V8S V;  2MOZ A;  4L0R A;  4XZC A;  2IW5 B;  3OVU A;  2DNX A;  4ILU A;  4H9O C;  3B5M A;  2E5V A;  3H37 A;  4PNI A;  1QLB A;  3VRB A;  1VOM A;  4ZS3 A;  2CXL A;  4OYJ A;  3RYC E;  3ZST A;  4IE0 A;  2ZLY A;  4IL9 A;  4WBO A;  1KFY A;  2PBI A;  3TLV A;  3QUJ A;  5BMV E;  4UF0 A;  3QC9 A;  4CI1 B;  4WW0 A;  1T72 A;  5HXS A;  1CUN A;  1KK7 A;  3E08 A;  2K48 A;  4PK6 A;  2E5L T;  4ILA A;  1GQE A;  3BQL A;  4PJL A;  1N34 T;  4B6X A;  3VKH A;  4UVC B;  4UF0 B;  4JI7 T;  1IBM T;  2VL0 A;  3H3M A;  5L3F B;  3EVY A;  2CWO A;  5M4Y A;  5J1G A;  3PUQ A;  4IRE A;  4QXC B;  2DWG A;  3A5X A;  1ZEE A;  2A2F X;  3N9O A;  4P09 A;  1D1A A;  3P4Q A;  2CMR A;  3ESL A;  5JR9 A;  3T1Y T;  3P4S A;  4PJJ A;  3HKC E;  4MHC A;  3LDQ B;  2OV9 A;  1MMN A;  2M6I A;  1NWM X;  4AQG A;  3ZLI A;  3ZJ1 A;  3AEB A;  3CX7 B;  1B7T A;  1LRZ A;  2FJD A;  2ZMA A;  5JDL A;  3IHR A;  4IE6 A;  3SFE A;  3JAF A;  5L3D B;  3PTR B;  4JBW F;  2D2S A;  4UEL A;  5FKY A;  5AQF B;  5JR9 B;  3O1H A;  2HPL A;  5KMG P;  2NW7 A;  4K0U A;  4HFE A;  1DU2 A;  4AIU A;  4HWC A;  3KBT A;  3QB5 K;  4DV1 T;  3P7I A;  3RC3 A;  1LVK A;  2WS3 A;  5HWY A;  2X0Y A;  4UV8 B;  5FL0 A;  2UUA T;  3SS1 A;  3N2K E;  4U74 A;  1HTJ F;  3AE9 A;  3L09 A;  1WRD A;  1LKX A;  3ZEF B;  3T8O A;  3CX6 B;  3CK6 A;  5ABH A;  3FZH B;  3RQU A;  4DUZ T;  2LKG A;  4G2A A;  3J9X 1;  3K8P C;  2BBJ A;  2FJE A;  2IAK A;  4O2A E;  2IC6 A;  2A3D A;  1WYB A;  1VRB A;  5LB7 B;  1H7C A;  4NUU A;  4GKK T;  3K3N A;  3O1J A;  2Q9Q D;  2EHO C;  4DV6 T;  4LFA T;  1KNR A;  5AQV B;  2LM9 A;  2NP9 A;  2IC9 A;  4UEM A;  2XY8 B;  3KBU A;  4WBN E;  3RHW A;  5CB4 E;  4IT4 A;  2VK9 A;  1SHZ C;  1WYC A;  3P4W A;  3CIR A;  2VAS A;  4LF4 T;  3DJB A;  3RF1 A;  3MXZ A;  3TLS A;  2HHH T;  4HWD A;  3I0Q A;  1BR2 A;  4JI4 T;  1HX1 B;  4DBR A;  5LG4 A;  4DV5 T;  3AAE B;  3ETV A;  2ZM2 A;  2XQY A;  5FY7 A;  5L2L A;  5ABF A;  2Z6E A;  4DND A;  5LHI B;  4PK5 A;  4JI6 T;  4HE8 A;  1KNZ A;  1UCU A;  4I4T E;  4YXD A;  3FBL A;  5FXV A;  1HG2 A;  4EZ4 A;  4E7S A;  4KI0 F;  3ZN1 B;  3AB3 B;  3KV6 A;  3U78 A;  5JTG A;  3VHL A;  2LSK A;  5ABF B;  1N36 T;  2A72 A;  3NVO A;  1KEY A;  2CE7 A;  2XQ7 A;  1Y01 A;  4ZI2 C;  3E22 E;  4JI8 T;  3Q5W A;  5ABE A;  2E2A A;  4I43 B;  2YK0 A;  4ILB A;  2WMN A;  2V5D A;  2LM2 A;  2K5B B;  2NW8 A;  1BR0 A;  3UQ4 A;  2FUP A;  2IDO B;  4JI0 T;  3WI3 A;  2YDQ A;  1WFD A;  3N9Q A;  4DMW A;  2NW9 A;  2LSG A;  3VRA A;  3ANW A;  2JJ9 A;  2XAG B;  2V1D B;  3PE0 A;  4IDN A;  3AE7 A;  4PW8 A;  4DUY T;  2WY2 A;  3UT5 E;  2E9X D;  2FJA A;  3VKG A;  3VU7 H;  2WU5 A;  5FY0 A;  2DL1 A;  2QA7 A;  4EEB A;  3X1D A;  5AFU L;  4KX6 A;  2G0U A;  3V5S A;  2D9D A;  3C4W A;  2ACZ A;  2RPA A;  3O4X E;  5L3C B;  2HN1 A;  3PJA J;  2XAQ B;  4A97 A;  5LGT B;  4PJN A;  4FI5 A;  4UV9 B;  2CLY B;  4IE5 A;  3ZC1 A;  4C90 A;  2CHN A;  2MTQ A;  4NUV A;  3RIU A;  4X65 T;  2FBW A;  5ABG A;  1OED B;  5LBQ B;  4U31 A;  3MKD A;  2I0M A;  5HXC A;  5C8Y E;  4BA9 A;  1UK5 A;  2V7M A;  4TZ4 C;  2YKS A;  4AQY T;  2LRL A;  4DR6 T;  5LBM A;  3LFM A;  1OED C;  2DI4 A;  5IUX A;  2A9U A;  5EK4 A;  3RIF A;  4GOU A;  3PUG A;  3UU3 A;  2CBI A;  1XWM A;  1X79 A;  3CQG B;  4OK0 A;  3TLU A;  2XQ4 A;  1IJ6 A;  3AE6 A;  4AI6 A;  2KWI B;  4B3S T;  4CXX A;  3L39 A;  4JI1 T;  2NOX A;  5FXW A;  1IBL T;  3VR9 A;  4YSY A;  2LSY A;  1HNX T;  3ZMS B;  3EI0 A;  2JQ9 A;  4LFB T;  2XAF B;  4MAL A;  4MLK A;  1FIO A;  5AQH B;  3LK2 B;  3MAC A;  2UXD T;  3TLT A;  4LMJ A;  5LGU B;  1U5P A;  5GON E;  3AE4 A;  1HR0 T;  5FP3 A;  2KT9 A;  2ODU A;  1UX4 A;  3I9W A;  2KIN B;  2XQ5 A;  4ZXL A;  2KMF A;  3UU4 A;  4DR2 T;  3K1S A;  3LJC A;  1MIY A;  2QGS A;  4PJM A;  4CI2 B;  2L8K A;  2DLR A;  3ZJ2 A;  2MPK A;  2Q9Q B;  3UU6 A;  2N9D A;  5JRE A;  2H88 A;  4X64 T;  5F8P A;  3OYX A;  1UGO A;  3Q9D A;  2VVN A;  4J2C A;  4LF9 T;  2Q9Q C;  3Q5E A;  2B1E A;  3HR0 A;  3UUL A;  1KNP A;  1UUR A;  3EUH A;  4UVB B;  5LYJ E;  4COF A;  2PJQ A;  2IUB A;  1MMA A;  3RQW A;  2BVL A;  1AJ3 A;  1MIW A;  2X51 A;  3RRC A;  5J2U E;  1ZOY A;  1O3X A;  2Y8D A;  3KV9 A;  4QXH B;  2W66 A;  4XBF B;  4EAH A;  2IIU A;  2V6Y B;  2JMK A;  2XSA A;  3B57 A;  4OFZ A;  4X5T A;  3CX8 B;  2XAS B;  5HEH A;  4E7Z A;  1EZ3 A;  3RGL A;  3F31 A;  3OBV E;  2XSB A;  4CN6 A;  4X1I E;  3AA6 B;  2L9Q A;  3RRW A;  3SWH A;  4HFB A;  3AEG A;  5AQJ B;  4XAX B;  5L47 A;  4YHH T;  4I0U A;  5DAB A;  5J0Z A;  2WZH A;  3C98 B;  4CN1 A;  1D0X A;  3FZL B;  2CXD A;  5HEO A;  3HL6 A;  4ZI3 C;  1X9B A;  5AQG B;  1HG5 A;  2K9A A;  3OJA A;  2CA5 A;  2WQY A;  5HXH A;  2BKN A;  3BK9 A;  2VQE T;  4AQF C;  4IIJ E;  3E0Z A;  2AE9 A;  1US7 B;  2CEA A;  1E1H B;  2I59 A;  3LK3 B;  4QHO A;  3I0O A;  2EHO A;  2BKO A;  3MJX A;  3NKZ A;  3IBP A;  5ETW A;  3JAE A;  4O4L E;  2B76 A;  2CXF A;  4AIS A;  3ONL C;  3CKD A;  4X62 T;  4JLE A;  4YSX A;  1NEN A;  3RIA A;  4ERR A;  3OTO T;  2EHO B;  1MNE A;  1XDP A;  2R6G F;  3PUS A;  3N9N A;  4IHJ E;  4LF5 T;  2V7I A;  3FHN A;  3VR8 A;  2BG9 C;  2JIW A;  4QWN B;  2PTF A;  3PUW F;  4HFH A;  1WR0 A;  1M7K A;  2E9X C;  5J2T E;  2W4X A;  4ISS A;  2X68 A;  1NEK A;  4HGA A;  1L0V A;  3GN5 A;  5LCY A;  3RH3 A;  4DID B;  3ZPO A;  2HH7 A;  3B13 A;  3GMI A;  4U7Y A;  4G63 A;  2C0S A;  2J4G A;  3KVB A;  5KXJ A;  2WWU A;  3R6N A;  3N9L A;  2YOE A;  4BJM A;  4ZOL E;  2XZE A;  3ZCI A;  2P9B A;  2BS3 A;  5L3E B;  4DR4 T;  2CHO A;  2LOP A;  4UXN B;  2GK9 A;  2K24 A;  4CXW A;  4EB6 E;  3GN5 B;  5LXT E;  2WSS V;  5FXX A;  5JVD E;  3JC6 D;  4GYR A;  2D0T A;  3MZK B;  4QX8 B;  5KDM C;  2XQ6 A;  3P4P A;  1S94 A;  1XZY A;  3ZMT B;  3RI5 A;  5HXR A;  3NZQ A;  5AQI B;  4TWD A;  3PUX F;  1ZKE A;  2UXX B;  2LSJ A;  3WAK A;  3ZYK A;  2WZI A;  3P8C D;  5L3B B;  4F6R C;  3CPZ A;  1OED E;  3RX6 A;  4YTM A;  4HWH A;  5LGN B;  3F57 A;  1M62 A;  3F2E A;  3V5U A;  2JPF A;  4HFC A;  1MND A;  3KDS E;  3FXE B;  2WP9 A;  3AEC A;  3MK7 C;  4B3R T;  5AQK B;  2LT3 A;  2X9X A;  1WCR A;  4LF6 T;  4V1A v;  3CML A;  3FBZ A;  4H9N C;  2W2U A;  3RKG A;  1ZP0 A;  3PU8 A;  5FY1 A;  1BR1 A;  3AXJ A;  2BDE A;  3LSV A;  1J5E T;  1V9D A;  2J47 A;  5EK3 A;  2YEV C;  4CXY A;  2WMO A;  3CQX C;  4GK0 E;  3ZT6 A;  4TNW A;  5H6Q B;  3RKO A;  4O2B E;  1FMV A;  2RP4 A;  4H9Q C;  2QYW A;  4ZEY A;  2ACX A;  3CQC B;  4IGU A;  2XQ8 A;  5TAO A;  5HCJ A;  4LFC T;  5CA1 E;  3AXJ B;  4DR7 T;  5FYM A;  4AKL A;  3HI2 A;  4UVA B;  4EYU A;  1YKH B;  4I55 E;  4N78 D;  2UUB T;  4YFS A;  2BKP A;  3C4Z A;  4M1P A;  4U7I A;  5KX5 E;  1OED A;  2X0L B;  3LK4 2;  3PUY F;  2OA5 A;  3NRY A;  2W67 A;  5HEU A;  5JRC A;  2WAU A;  5LMU T;  3AAI A;  3KIN B;  5LJM A;  2ZM0 A;  2MBG A;  5JH7 E;  4NXN T;  3ZYL A;  4U72 A;  3OYZ A;  3RPU A;  1W0A A;  1SE7 A;  4ZHQ E;  5CGM A;  5AQL B;  2HN2 A;  3TLW A;  1OXZ A;  3ZT5 A;  1HS7 A;  3AA0 B;  5JRC B;  3UUX B;  1FJG T;  2M6B A;  3Q2M A;  4X1K E;  1XDO A;  4TX5 A;  5L4H A;  5AQR B;  4DR3 T;  2DCF A;  2H7O A;  3IF8 B;  1D0Z A;  4CN4 A;  1FEW A;  4GK5 E;  4QXB B;  4O4I E;  4L9I A;  4AKG A;  1FMW A;  3N2O A;  5AQN B;  5LJN A;  1W09 A;  2V6X A;  1MIV A;  2V26 A;  3QNU A;  2CCQ A;  5HEG A;  1T8B A;  4AKH A;  2UXN B;  4JI3 T;  2X0H A;  4YJ2 E;  3BQI A;  3AVR A;  5FVL A;  5FNV E;  4HFD A;  2LSI A;  3O1I A;  3L3P A;  4GIW A;  3OPC A;  5JDF A;  4DR1 T;  1MMD A;  1S35 A;  2HPJ A;  4TV8 E;  4DO0 A;  3SRZ A;  3PUZ F;  2W62 A;  3L8R A;  1CHU A;  4AKI A;  2VWA A;  1D1B A;  4PFO A;  3N5L A;  4IE7 A;  1T98 A;  3GWH A;  2LEH A;  1G73 A;  4IDO A;  2Y48 B;  3BQK A;  4B3T T;  2VQF T;  2LKH A;  5ADX L;  2Q9Q A;  5EZY E;  3IEE A;  2KND A;  2KSR A;  5FL1 A;  3S4U A;  4JI5 T;  2UXC T;  1ZHC A;  1SUM B;  1Z0P A;  3Q5X A;  3ZC0 A;  2D5U A;  4ZZB A;  2VKO A;  4JI2 T;  2LE8 A;  2XPK A;  4ZZC A;  1Y64 B;  1KF6 A;  3HKD E;  3H3A A;  3JCF A;  4F8H A;  2E8I A;  3ZSS A;  4DV7 T;  3MA9 A;  4EZH A;  4DV2 T;  3QOF A;  2N1G A;  4DV4 T;  4HFI A;  5CJ5 A;  2N2N A;  2YDR A;  1N33 T;  4H63 H;  1WLX A;  3J7Y q;  3RLF F;  2NWB A;  3N2G E;  5LOV E;  3M65 A;  1D0Y A;  4QH1 A;  2MAW A;  2BBH A;  2V6Y A;  2BG9 E;  4EIW A;  1XNQ T;  2ZM6 T;  2XJ7 A;  4OHF A;  4ILC A;  2WDR A;  4P0A A;  4YJ3 E;  5LG3 A;  3PUR A;  3C64 A;  4IDP A;  4PK4 A;  3KV4 A;  4TV9 E;  3K3Q C;  4BJN A;  4YY3 T;  1IJ5 A;  2WM9 A;  4KBM B;  3ZCJ A;  2YU2 A;  1N32 T;  3PUA A;  4KP3 C;  3O9X A;  1UX5 A;  2M67 A;  4HWF A;  5AQQ B;  3EHZ A;  2X9Y A;  5HYA A;  5LNK A;  3JC6 C;  2XHE B;  1R8I A;  4AQF A;  5LP6 E;  4OYK A;  4B3M T;  2ZM8 A;  4OX9 T;  1VCT A;  4NIQ A;  3D0T A;  4GKJ T;  2W63 A;  2XQA A;  2VKJ A;  4YHJ A;  3ZMV B;  2H89 A;  2VKD A;  2UXB T;  2WCA A;  3EDU A;  1YW0 A;  2X67 A;  3HKE E;  5AQO B;  3A8Y C;  3CWZ B;  5HXE A;  3QK6 A;  2ODV A;  5LHH B;  2WDQ A;  4DVD A;  4YT0 A;  3UQ7 A;  4L5G A;  4DV3 T;  3UFG A;  2OLT A;  3PU3 A;  2FJB A;  5FVK A;  4QH5 A;  5JQG E;  2CBJ A;  2BVM A;  3I9Y A;  5DQV A;  1XMO T;  5DQW A;  3IA3 A;  3QB5 A;  2YN6 A;  2VL8 A;  3KFW X;  2BG9 A;  4TNV A;  4HN9 A;  3JAD A;  2E9X A;  3ETU A;  1HX8 A;  5JDM A;  2QRX A;  5HWX A;  4HTE A;  3EAB A;  4LML A;  4KHP T;  4ZI7 E;  2BS2 A;  2BS4 A;  2X66 A;  4KMC A;  4TN7 B;  3RYH E;  3UFE A;  3FB2 A;  2BG9 B;  5JR9 C;  4Q25 A;  5HAX A;  4Z91 A;  4EGW A;  2W0G A;  2E9X B;  4CZZ B;  4I50 E;  4KUM B;  3K3O A;  2H3R A;  3KV5 A;  4JYA T;  2K3W A;  1YKE B;  5LA6 E;  4LMK A;  4Z90 A;  4CQI A;  4MBQ A;  5L3G B;  2JQH A;  5F3J A;  2XAH B;  3A7M A;  4JEH B;  3NBX X;  1YD8 G;  3FZF B;  3NZP A;  3TKL B;  1W0B A;  2I6H A;  3ZYM A;  1HNZ T;  4O8S A;  3SOL A;  5BR8 T;  2Y6X A;  3EDV A;  2WB5 A;  2LOS A;  2WDV A;  4JUY A;  4MFR A;  2L3L A;  4GYS A;  4X20 E;  3DP7 A;  4JEU B;  4YTN A;  2WWV A;  1YQ3 A;  1QUU A;  5FMN A;  1E7P A;  2JQQ A;  4U3C A;  3P4R A;  3I1A A;  1UUS A;  4EV6 A;  2PFV A;  3N9M A;  3WAJ A;  3RC8 A;  4A98 A;  3DTO A;  1IBK T;  5JDH A;  1J5W A;  2CPT A;  4EYY R;  4IDQ A;  2CRB A;  4WZX A;  2BZB A;  2LHN A;  3AVS A;  3M3Z B;  1I94 T;  4HEA A;  5EK2 A;  3ZMZ B;  3ABV A;  5H6R B;  2AXD S;  1YXR A;  2WBL A;  5JDN A;  3C4X A;  4EXT A;  4HKA A;  5HCM A;  2X9H A;  3AA1 B;  3ZT7 A;  4FJO A;  1E2A A;  2SPC A;  4ASK A;  4NPP A;  3EAM A;  1IZN B;  3R84 B;  2J1D G;  4A56 A;  4EOZ B;  2J62 A;  4IE4 A;  3UUB A;  4AKR B;  1MMG A;  5A1L A;  3CVR A;  4ZI3 D;  3RYF E;  5E0O A;  3N9P A;  2C5J A;  2KWH A;  1W9R A;  2X9W A;  4JV5 T;  2W61 A;  2H7V C;  3AEE A;  2C5I T;  4QX7 B;  4NXM T;  1QSD A;  4X66 T;  4HWI B;  5LHG B;  3AE8 A;  4YSZ A;  2LLY A;  4PAG A;  1HFA A;  2LHR A;  3AA7 B;  2KLQ A;  4QH4 A;  4IL4 A;  2XAJ B;  2V7K A;  3UUM A;  2DWK A;  4CI3 B;  2IML A;  4DBQ A;  2UU9 T;  3UU8 A;  3C51 A;  4EED A;  3Q5D A;  4WNK A;  2DHR A;  4C91 A;  4UR9 A;  2UUC T;  2CM0 A;  3UUN A;  5CFB A;  2KZ7 B;  5DJQ C;  2JRK A;  4TWH A;  4YLH A;  4LF7 T;  1T7S A;  3UTK A;  3AAA B;  1BR4 A;  4LF8 T;  2EHO D;  1XNR T;  3AE2 A;  2LJL A;  4H9S E;  1D1C A;  4HFV A;  3RYI E;  3ONJ A;  5AQM B;  3LBX A;  2XM1 A;  1HNW T;  2PG8 A;  2C5K T;  2XTL A;  3AEF A;  1SA0 E;  1LVF A;  3ANW B;  2YDS A;  4KHZ F;  1HCI A;  5IHY A;  2MYS A;  4X1Y E;  3LG7 A;  4TWF A;  4WYV A;  3ZKR A;  3NRX A;  3ZN0 B;  3HKB E;  2JMH A;  2YU1 A;  4U2Z A;  3KVA A;  3LBX B;  3PDY A;  3PUV F;  5C2T A;  5FXZ A;  4Z8X A;  3FXD B;  2XQ9 A;  4YTP A;  4U33 A;  1NAF A;  3PJA A;  3AE3 A;  4H9P C;  5C3J A;  2XUE A;  4TUY E;  3FZK B;  2CLY C;  4K0K T;  3GA8 A;  1JNR A;  4ADZ A;  3T1H T;  5AQP B;  2KXP B;  3AE5 A;  3P50 A;  4UIG A;  1U4Q A;  3HA4 A;  4P0B A;  2YIN A;  2QVA A;  5JDG A;  3NWI A;  5HEJ A;  2W00 A;  5LMN T;  5F5W A;  3OKQ A;  3AE1 A;  4DMV A;  3AEA A;  2VUR A;  3FZM B;  4IST A;  2NTX A;  3ZMU B;  4H9R C;  4PFP A;  2XM2 A;  1G8X A;  5AQS B;  2CWY A;  2V5C A;  2NR4 A;  2ES0 A;  3PV0 F;  1J1J A;  3AED A;  2VB6 A;  2RA1 A;  1YQ4 A;  2IHR 1; 
#chains in the Genus database with same CATH homology
 4LF8 T;  4JI0 T;  1XNR T;  4JYA T;  4LF4 T;  2HHH T;  4B3M T;  4LF6 T;  4OX9 T;  4JI5 T;  1HNW T;  2UXC T;  4X64 T;  4GKJ T;  2E5L T;  4DV1 T;  1FJG T;  2UXB T;  4DR4 T;  4JI4 T;  4DR5 T;  4JI2 T;  1N34 T;  1J5E T;  4DR3 T;  4DUY T;  4DV5 T;  2UUA T;  1HNZ T;  5BR8 T;  4LF9 T;  4DV0 T;  4DV7 T;  2VQE T;  4JI7 T;  4DV2 T;  5IWA T;  1IBM T;  4DV3 T;  4DV4 T;  4JV5 T;  4JI6 T;  4DUZ T;  2F4V T;  4NXM T;  4X66 T;  1N33 T;  4B3S T;  1XMQ T;  4JI1 T;  1XMO T;  4LFC T;  4DR7 T;  1IBL T;  1HNX T;  4JI3 T;  4K0K T;  2UUB T;  3T1Y T;  3T1H T;  4X62 T;  4GKK T;  4LFB T;  1IBK T;  1XNQ T;  2ZM6 T;  2UU9 T;  1N36 T;  4DV6 T;  4LFA T;  3OTO T;  2UXD T;  4DR1 T;  4JI8 T;  1I94 T;  2UUC T;  4LF5 T;  5LMN T;  4X65 T;  4KHP T;  4YY3 T;  1HR0 T;  5LMU T;  1N32 T;  4DR2 T;  4LF7 T;  4AQY T;  4NXN T;  4DR6 T;  4B3T T;  4B3R T;  2VQF T;  4YHH T; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...