1I9CB

Glutamate mutase from clostridium cochlearium: complex with adenosylcobalamin and substrate
Total Genus 200
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
200
sequence length
483
structure length
483
Chain Sequence
b'MELKNKKWTDEEFHKQREEVLQQWPTGKEVDLQEAVDYLKKIPAEKNFAEKLVLAKKKGITMAQPRAGVALLDEHIELLRYLQDEGGADFLPSTIDAYTRQNRYDECENGIKESEKAGRSLLNGFPGVNFGVKGCRKVLEAVNLPLQARHGTPDSRLLAEIIHAGGWTSNEGGGISYNVPYAKNVTIEKSLLDWQYCDRLVGFYEEQGVHINREPFGPLTGTLVPPSMSNAVGITEALLAAEQGVKNITVGYGECGNMIQDIAALRCLEEQTNEYLKAYGYNDVFVTTVFHQWMGGFPQDESKAFGVIVTATTIAALAGATKVIVKTPHEAIGIPTKEANAAGIKATKMALNMLEGQRMPMSKELETEMAVIKAETKCILDKMFELGKGDLAIGTVKAFETGVMDIPFGPSKYNAGKMMPVRDNLGCVRYLEFGNVPFTEEIKNYNRERLQERAKFEGRDVSFQMVIDDIFAVGKGRLIGRPE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords GLUTAMATE MUTASE
publication title Radical Shuttling in a Protein: Ribose Pseudorotation Controls Alkyl-Radical Transfer in the Coenzyme B(12) Dependent Enzyme Glutamate Mutase
pubmed doi rcsb
source organism Clostridium cochlearium
molecule tags Isomerase
total genus 200
structure length 483
sequence length 483
chains with identical sequence D
ec nomenclature ec 5.4.99.1: Methylaspartate mutase.
pdb deposition date 2001-03-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF06368 Met_asp_mut_E Methylaspartate mutase E chain (MutE)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.240 Alpha Beta Alpha-Beta Barrel TIM Barrel TIM Barrel 1i9cB01
3.90.970.10 Alpha Beta Alpha-Beta Complex Glutamate mutase, C-terminal domain Glutamate mutase, C-terminal domain 1i9cB02
4REQB 2REQB 4R3UA 1REQB 1E1CB 1I9CB 7REQA 3REQB 4REQA 3BICA 1CB7B 2REQA 2XIQA 1REQA 6REQB 1E1CA 3REQA 1CCWB 5REQB 6REQA 5REQA 7REQB 2XIJA
chains in the Genus database with same CATH superfamily
1SU5A 3RCNA 1ME9A 4GCAA 3B9DA 4O28A 2QPUA 2VEGA 3U48A 3S46A 4ACZB 2BHYA 4HP5A 4KWUA 5H8UA 3UZXA 3LBCA 3UU0A 1E40A 3SGGA 3NURA 1L9WA 1S5WA 2C18A 2XFRA 4LUSA 3UERA 2C91A 2OB3A 2GUBA 5IM51 2YLAA 3V36A 3CZGA 3PAOA 1PWLA 2CBUA 1VRDA 3G1DA 1AA1B 2FZ8A 2OFJA 4MYXA 3HTWA 2WANA 1YPXA 3F4VA 4H83A 4HA3A 3WLLA 3LXBA 2FQIA 4C6KA 1VFHA 2ZRZA 1GVYA 4RZ5A 3WQFA 1UWIA 3EX2A 4JTQA 5K2ZA 1CGXA 4JL1A 3S6TA 4ZFCA 4HK6A 3PBMA 3MJMA 1UQYA 2EXOA 4FAMA 1TWDA 4MPKA 2IPJA 4Q32A 5AB3A 1ENUA 4IIDA 4GI6A 2Z26A 1RSCA 3MSRA 3BL3A 4PUWA 4PYSA 3APTA 3NWRA 1IXPA 3S5SA 2WKGA 4IXXA 2G3JA 4G7EB 3EWYA 1V3JA 1O5RA 4UXDA 2W27A 1E4MM 1QATA 3GDLA 3RLUA 1IR1A 5C9XA 1GYNA 4U2ZA 4BEUA 3GE7A 3MMUA 2P76A 3SUVA 2CXGA 5DELA 2IQTA 2FPYA 1EJ7L 2DZVA 5HPOA 3T0TA 1A50A 1WNOA 4PB4A 3F1QA 1WXJA 2WM1A 2BXYA 3GU9A 3BAIA 1FWJC 1ONXA 2GQ3A 3H2OA 3B05A 3EX3A 3U0HA 4GUJA 2GUUA 3FFSA 3I6EA 1UUQA 1XLCA 3KVKA 2BSLA 5JH1A 3TYZA 1PIFA 4JDYA 1UOKA 1CLXA 1C91A 1FWIC 1QFEA 3SSJA 2GVGA 3G77A 5A6KA 3VFLA 2PDQA 3UYCA 3ECQA 2ZUWA 2O9TA 4K6AA 3ZOAA 1XG3A 4LQ1A 1M53A 3WLKX 3PBWA 1X1ZA 1QOPA 4ZQMA 4A3RA 5HQMA 3W7KA 4CQBA 3ZSSA 2YDSA 4GI8A 4E2OA 3NGFA 3DXIA 2F61A 1UMYA 2CW6A 4GLEA 2E8ZA 5HWJA 4K37A 5A6AA 1YW1A 1G9HA 1DTNA 1A47A 4HSHA 2Q3RA 3IWPA 4PC8A 3QZ6A 4JICA 1JDCA 1J4EA 5I02A 3H22A 1QI3A 1WPCA 4IG2B 3B9OA 1QI4A 3VGHA 3GB6A 3G0UA 1B90A 1TUXA 1JPIA 3SY8A 4C7GA 2AMGA 4DO7A 1BF2A 3POHA 2YLLA 3VZXA 2ZICA 1S2UA 3WJSA 3QTPA 4FIRA 1BVNP 5C70A 4I6VA 5AVHA 3EWDA 2BODX 1YTKA 1XSJA 2VYOA 5LA0A 4Q8VA 5FSEC 2ACRA 4OQVA 1PKYA 4WY0A 1IHIA 3VOIA 5M5DA 3Q37A 2FIQA 2FB3A 1AW5A 3UWQA 1CI1A 1PX3A 4DNHA 1AJ2A 1A5LC 2XINA 1JYNA 4AHOA 5ABFA 4HJWA 1YEYA 4MWAA 2W63A 2Y8VA 2BNJA 3RR4A 4X60A 1Q63A 3P84A 2FZNA 1ECEA 3KW3A 4JIQA 4MKNA 3AO0A 4HOWA 1GTEA 1LWJA 1V6TA 3F5LA 4HBKA 5CPMA 4QITA 1XLKA 5XINA 1W5MA 4M6VA 5D32A 3M6YA 5JXQA 3SIZA 2WNQA 4K8GA 4TQTA 3VU2A 2DZUA 1LRTA 2DUAA 4OOUA 1Q85A 1VYPX 1AQFA 3ITOA 3USBA 1O5KA 4F0LA 3VCRA 2P50A 1NAL1 4L7ZA 1EFZA 3C0SA 1OADA 1AMKA 4WSJA 5DRIA 4WSKA 5HMEA 2PS2A 3MMWA 1AUSL 4BWLA 1HW6A 3LQGA 3FKRA 3C8NA 2X0HA 3L0GA 1PDYA 2Z25A 3MKVA 4KS0A 1KRCC 3T8LA 2ZC1A 2AL1A 3VABA 5KZDA 3H7UA 2PGEA 4MB5A 3BV7A 3R1ZA 5AHMA 1FWHC 3ABSA 3I4EA 2DQXA 3WD3A 1SM9A 4P8WA 1XHGA 5HQEA 4RDYA 2VEMA 4LPCA 1CXHA 1EWDA 1N8FA 4C6IA 2Z1KA 1XLEA 2WBKA 2C0AA 4EKJA 1LBMA 4QSHA 4UUIA 4XKMA 3TFXA 2YYUA 3WMLA 4RW3A 1XLAA 4JOMA 3CUIA 3NQVA 4M6PA 4MWAE 4LT9A 1KR1A 3MJYA 3IAPA 3PWIA 1DIEA 1LQ0A 4GRSA 4O11A 6CGTA 3OVQA 1IZCA 4Y9AA 3FKKA 2I9UA 3NOEA 1C29A 4P8VA 4AUBA 1EGMA 2QMKA 2Z2AA 5D30A 3TNOA 1X39A 3N2MA 3MUZ1 2CZFA 2BP1A 1YNQA 4BI5A 2O4MA 3NQBA 3VGGA 4AD5A 1IEWA 1M6JA 5LGZA 5G1MA 1X6NA 3NO3A 1CZ1A 3HO8A 3QW3A 2PDYA 4KEVA 5JU6A 4XZMX 3RLGA 4QG6A 2DP3A 1WYIA 5F1UA 1TREA 4GX8A 2D0FA 1R3YA 3N2BA 4YPJA 4Z0SA 6REQB 3E0IA 4UTJA 5HNNA 3JRKA 4L80A 3W26A 4KGJA 2VR2A 1IEVA 3SJ3A 3AS2A 1QPKA 3HPZA 4W93A 2RJGA 2NWRA 5AN7A 2H9AB 1TPC1 4BS0A 4XZIA 5F7UA 3PZNA 2VHLA 4UMAA 2PCQA 3NSMA 4JBRA 1TVNA 5MKGA 4RNFA 1J6OA 1UKPA 3FYPA 3CUZA 3TYEA 2WKLA 5HAOA 1QU4A 4KESA 4PTNA 3GVWA 1B3ZA 1XDMA 1WBJA 4M81A 3QV6A 1DE6A 1PS9A 4I7VA 3W87A 3WY1A 5BMXA 4RXFA 4UCFA 3HURA 4UOQA 2WLYA 3TK7A 1WQ5A 1PTDA 1ZBWA 4RDZA 1JCXA 3NQFA 1F8IA 4AG0A 2XFFA 1F7BA 4XSLA 5JIWA 4IP4A 2NSOA 4IFKA 4TOQA 4DBWA 1KBKA 1E6SM 3PY2A 2RAGA 1K9TA 2D2OA 2X16A 4MSSA 3UVAA 3DESA 3BUVA 4Q8MA 3N18A 3FJNA 3I7QA 4PMVA 1LZOA 5I3GA 1S2CA 3AJ7A 3V75A 2NXIA 3CHVA 5EMLA 1D7FA 2CBVA 2QJGA 3MUY1 5F4SA 4H6QA 3LCLA 3OU8A 3WLRA 1AH3A 4GK8A 4A22A 2I7GA 2NLIA 2GDQA 4RZ4A 3QPEA 5D02A 3WMSA 1GQIA 3NNTA 1XLFA 3RN6A 1EJWC 1E9IA 3NSNA 1B9BA 3VD7A 2O56A 4MWAC 3OGVA 3ABOA 3M0YA 2A3BA 1MDRA 2CKRA 4WK9A 1UA7A 1O12A 3GNDA 2V81A 1O4UA 4HMCA 4FLOA 5D04C 3KWSA 4PMYA 1EA0A 3GYCA 5KZ6A 1A0DA 2XGIA 3IJ6A 1PTGA 3LBMA 4AX7A 2OKTA 2Y7DA 1TA3A 3W7PA 4DQWA 2D0HA 4KT2A 4DUOA 4YYCA 3CZLA 4ZVJA 2PDWA 3ZJ6A 1OFRA 5EMYA 1V6WA 4HN8A 3FSUA 3LHWA 1UH4A 4FR1A 3QMRA 3VMPA 2Z00A 3L68A 1QPNA 3WH6A 4YCPA 3PUDA 1Q6QA 1V0LA 3KP1A 3DHPA 3W70A 3GR7A 4FHAA 3NDYA 4ZQCA 3EX4A 5EYWA 2BVYA 2W5FA 1YPIA 2A1YA 3MHUA 5AOUA 4JN7A 3BCFA 3B8SA 3DFTA 2VDHA 5LKYA 3HJZA 3KDOA 4NZJA 2VWSA 1Q4WA 1TIWA 5HJXA 5I6SA 3P2VA 3SAZA 1WB0A 3WSUA 1G6CA 2ZBTA 1XCXA 1L6SA 3RRAA 4BA0A 4XUYA 1FHUA 1XPYA 2V5JA 1YTEA 3AAMA 4JY9A 2FZMA 5E9AA 3BTNA 4O52A 5I09A 5K9CA 2CZEA 3SDOA 4KH2A 3KP0A 3QR3A 2VMFA 5E0KA 3W7RA 3SADA 1VCFA 4PBEA 2VRKA 4O12A 1YRRA 3UCQA 5AECA 4YWIA 4PMOA 4LGXA 1P0KA 3C61A 5M03A 4LUJA 1QHZA 2VX4A 4YHEA 3L12A 4CD8A 3B8IA 2QIWA 4IGSA 3DAQA 3WLSA 1SMDA 5FKYA 4GVIA 1F5ZA 2E9MA 2YGYA 2QCDA 2W67A 1XYFA 1ISWA 3UJEA 3URAA 4RDWA 1JG9A 3R8GA 5A8QA 4JY8A 1SQ7A 2VWTA 2Z1XA 1MDLA 4HB7A 4BZYA 4CQCA 3L2LA 4FLRA 1W3LA 3IVSA 1K1DA 1HQTA 3BZJA 2ZTJA 1R3VA 1KM1A 3UY8A 4IMCA 3EPMA 4KPLA 1S2VA 4XB3A 1D8WA 3S2CA 3BG9A 3W7OA 2XYLA 4QJ5B 1W32A 3GRIA 1XC6A 3KFTA 1A0EA 4GVFA 4FPSA 1K02A 2PZ0A 5G1YA 5K4ZA 3OODA 4H9ZA 3PBGA 2WZTA 3TLQA 4JNYA 1UR8A 1V7YA 5D2WA 3DI1A 3C2YA 3GHTA 2DSUA 3H12A 1VEMA 3W1AA 3W73A 2QEZA 1ALDA 3OW1A 1VPXA 2X8RA 3W7IA 3QQ0A 1F6YA 1EP2A 1B3YA 1TPEA 4LY8A 4PMDA 4LRSA 1XQLA 4V1XA 3GU1A 3PWAA 3AWOA 8A3HA 3B4YA 3A21A 1DKWA 3CQJA 3S5NA 2X1RA 2PDGA 4A2RA 4NX0A 1FRBA 3BPWA 3NM3A 1RVGA 2A3AA 4B90A 1SW0A 3MI6A 2P8CA 4I9MA 4MUPA 1VKFA 5GPRA 4MHBA 3UPWA 4ERGA 1V3MA 1JYXA 3TV8A 3AIWA 4DWSD 2Q6ZA 2EJ1A 3GNXA 3KL5A 2PU1A 4NQ1A 3UXDA 2Y62A 4GACA 3GDTA 2NV1A 1MVYA 2WJZA 3V5CA 4H6RA 1VFSA 1K7FA 1XBZA 4LXFA 3GHUA 1K9EA 4X22A 2WVSA 3T09A 2V67A 3ZVHB 4TIMA 3NOYA 5I3KA 1E73M 1BF6A 4FR6A 1Z89A 1CIUA 4HU4A 4KFNA 3PBVA 4K38A 1PEZA 3GDMA 4WXYA 1CXKA 3SN1A 2IKIA 2QW5A 1RZMA 4DVOA 4ERIA 5EGRA 3CHCA 2VD8A 1QDSA 3AXHA 3HPSA 3UWVA 4YNGA 3IJDA 2J9YA 2V2HA 3D3FA 4N6EA 2ZZ3A 2PDJA 3DUGA 4JTJA 3GG0A 4AIUA 4ADSA 1WZKA 1UP3A 3WG6A 3BICA 5DQPA 4GO8A 4KEUA 4JX4A 4PUKA 2FHFA 5AHLA 2E40A 3G6MA 2O92A 2WSRA 2GOKA 1P4CA 1ZSXA 3VNZA 2Y5EA 3MVTA 5IBXC 2W91A 1OGSA 3G8RA 1SR9A 4JNZA 5LNUA 3OLDA 3VKAA 2DV0A 2PU0A 3B8VA 1KGUA 3OG2A 3EGJA 2BVDA 1FWRA 3FIGA 2XUCA 3PHAA 3H2MA 3WNKA 1VFMA 1XICA 2YFOA 4J3ZA 2ISVA 3WDJA 3QSRA 2NLYA 3QV7A 4IQDA 4MF4A 4N4PA 4HSOA 5TD4A 5ABHA 2QUUA 3FN9A 3LRLA 3V1HA 4QISA 2X40A 3QRHA 4C6EA 3VKJA 1FWWA 1LJYA 4W8BA 1QNQA 4I9TA 4F9JA 1RBLA 3VX0A 4B91A 4IPNB 1AZ1A 4QM1A 2EHHA 2Y7GA 1V3KA 4B5UA 3Q4DA 3BQ5A 1TKKA 3N6QA 3OLEA 4A8NA 3ZWTA 2OEJA 2CFFA 3N4AA 2Q8XA 1VHNA 3WIJA 1YQ2A 3U5UA 1KFEA 1Q3NA 5CQ1A 1W8SA 4AWTA 4CUCA 4V2XA 1XRFA 4IISA 1YNYA 2C14A 3A9IA 3UW6A 1SJBA 1W3NA 3IS4A 1MEIA 2XFYA 3QHNA 4GI9A 1E5NA 3O2LA 4Y96A 2DT0A 4N7QA 5HUOA 4AWEA 4G1KA 5IFPA 2ASHA 5GQBA 1TV3A 3VZZA 1SUXA 4HMNA 1I2NA 4MOZA 1V6UA 3GW3A 4W8LA 1JF6A 4XD4A 1DVJA 3GXPA 3RG6A 2AAAA 1P7TB 4F9DA 4DBSA 4YL2A 3SB0A 1RCXB 2NXHA 3DHFA 2DT1A 4NHVA 4E2DA 1ZJIA 2VUNA 2VZUA 3GTIA 3W2JA 1LT7A 2DVTA 3OVPA 3AHZA 3VOCA 1W5PA 1UKQA 2PI6A 4R85A 3BH4A 3W1LA 3UYIA 3S8HA 3IIZA 3BLIA 3CIWA 1F07A 3AZTA 1HJVA 2WK2A 3E2QA 2ZZ4A 3N73A 2UY5A 4GFIA 3MWAA 1GOQA 3UEQA 4S3EA 3SZ8A 1X96A 2HV5A 2DQWA 3O7UA 1FBAA 3TW7A 2INZA 3O16A 5DF0A 3CV1A 5EBAA 4LH8A 3A12A 3CH9A 2E6AA 1JZ8A 2VDGA 1O1HA 4AZGA 1G4SA 2A4AA 3ARTA 3QSTA 4B5VA 4QLKA 4LJ3A 2J7EA 3EB4A 3U2EA 1C3FA 4S3JA 3E1F1 3E9AA 1OBAA 3EOLA 3G18A 1R86A 2QPXA 1TRIA 1ZENA 2YA2A 1R46A 3LHUA 2DW7A 3ICJA 3MANA 1I45A 1OF6A 1D7KA 1M41A 2CESA 4RZ6A 4FXFA 1KGXA 3ABRA 1RPXA 1HP4A 5CG7A 3S2MA 4WKFA 1MUWA 4CQDA 5LXEA 1A3WA 2FYMA 4ENLA 3AXMA 1TX2A 1CECA 1G94A 4EVZA 9CGTA 2NV2A 2QV4A 1F3WA 2CLEA 4PTVA 4EXQA 1A5UA 3MS8A 1O60A 2GSEA 1K6AA 3NPWA 1NARA 5M1TA 1E71M 2P0IA 1KBJA 3UG8A 2JIEA 3P61A 4XD3A 1US3A 3W82A 3L4XA 3W74A 3LMYA 5C6MA 1SR0A 1EX1A 4FOJA 3O6AA 2GVJA 1GOMA 4DJEC 1W56A 1Q2SA 1UASA 3TKFA 1W37A 4TV6A 4L56A 3HGSA 1GVEA 1YE6A 1PTAA 5ECUA 3STEA 2OKOA 4NZ1A 3N3TA 4X9YA 4KIRA 3GXIA 3BCJA 4Q8PA 4A29A 2PRHA 3W1RA 1OFDA 4US5D 1AW2A 1FWCC 2TRSA 3IK2A 3LX9A 3UG5A 1W2PA 3BMXA 3MI2A 4JFVA 4Q8TA 6XIAA 2PDUA 1PZ0A 1PZ2A 3TJ4A 3SQLA 1B3WA 1KFKA 3H53A 2WSPA 2G3IA 1JI2A 3HG4A 4M1BA 4NAEB 1NF0A 1ZALA 4JTFA 3WLMA 3M5ZA 3NYZA 3GKAA 4IQEA 2EJAA 3LGDA 4GQ0A 2Y8UA 2A79A 3F5JA 5BCAA 5C2XA 3BK0A 3KXQA 1V6VA 1QPQA 5AZ1A 1JFHA 4JTUA 1H51A 4NZ5A 5E09A 3CZJA 3TEVA 3VOFA 1Q7QA 3BW3A 4CQAA 3NL5A 3W86A 4L4LA 4HNOA 5C9UA 3QV9A 3TTEA 3O6YX 1TRDA 1A4MA 2VTFA 3K1DA 2Z1SA 1Y8BA 4MY9A 4XTIA 4A05A 3S4TA 1GVIA 2EPLX 2PP3A 4DLMA 5JBFA 5E6ZA 3ENLA 3N1AA 4JFTA 5M17A 2OSYA 1QW7A 4XVEA 2CNCA 4WJ8A 1OFEA 4XWUA 1ODUA 4JFSA 4L65A 1JD7A 4FF5A 3GFZA 3WQGA 1XP3A 4F0MA 1UWRA 1H63A 3S1UA 4B5TA 3LD5A 2WWDA 1XLIA 4YJ5A 2R1NA 3NJ3A 4JD4A 1VHCA 2WZIA 4CNPA 3HGJA 3AYRA 5CZKA 3HA1A 3R4IA 2H8ZA 2QR6A 3WLJA 2J88A 1HGYA 1VLWA 1WDWA 4KWOA 2VQTA 3CV6A 4E2BA 2WPBA 2ZE0A 1V02A 5FESA 1EDTA 4PTDA 4DWDA 4J1OA 3UR2A 4QCFA 3SCUA 3CHEA 3WH8A 3W7QA 2FKPA 1BRLB 3Q45A 3C6CA 4FXSA 4I5RA 1UR3M 4LOCA 3WLNA 5H8MA 3OGSA 5C9ZA 1DJXA 4GVHA 2DJLA 1OB0A 3CLWA 3IUIA 3A4AA 3UXLA 2JALA 3DU0A 5J04A 4C1NA 4XD5A 1W9UA 2HK0A 4YLWA 1ICSA 1QMLA 3M0IA 1LLWA 2VO5A 2GQ8A 3IJ9A 1W9DM 1LOLA 1O7AA 3T55A 2PDIA 2YL6A 2VM8A 3B8WA 4B5XA 3VOGA 1J2BA 3LK6A 1OT1A 2J25A 4U3CA 1QJWA 1J11A 2VI0A 3BAJA 1S5VA 3U9IA 6PTDA 4C6QA 4BEQA 2F2HA 1V4YA 1IF2A 1H3GA 3EMZA 2QPSA 4PCPA 3UD6A 1ZFJA 3SN0A 2VP8A 1U33A 3NEVA 4NZ4A 4CN6A 4W85A 1NFBA 1S1RA 1RVKA 2FGBA 3A4XA 3ME3A 4P2VA 3TZNA 3ZVIA 1ZUAX 1EBHA 4DYKA 8RUCA 3L65A 4H6EA 1UBSA 4JTEA 3AMDA 4NI3A 2Q01A 5FI8A 4B9ZA 3WQEA 3M4HA 1PKMA 2PTDA 3AHTA 2Y2WA 2YBTA 3SGUA 3NL6A 2PDFA 3W53A 4HPNA 1XYAA 1WZMA 5FF0A 4IPJA 2W66A 3UJSA 1HX0A 3W24A 3H4XA 1A3HA 2X05A 3PVFA 4REQA 1Q2RA 3FNDA 3M16A 1QNSA 4U10A 5L6UA 4MM1A 5H8PA 3OOQA 3WQ5A 3T2PA 4O53A 4YS1A 2WM0A 4Q8UA 2E7FA 3R10A 2TSYA 2V3GA 3C3NA 3RX4A 2VFHA 3MHGA 2FHCA 3JZEA 1Z69A 3B8TA 3EPNA 4LEQA 4HNLA 2Q3OA 2R1LA 5I0DA 4JFUA 3NDZA 3RU8X 1R47A 3OG3A 4M6QA 4H00A 1GQNA 2OELA 3AALA 3UXIA 3RK8A 5BMWA 4H8VA 4Y7EA 3UF9A 4MZYA 1ME7A 4CU7A 4FLQA 3M7WA 1CXLA 3SRFA 4F2UA 2E4TA 4NKCA 1ONRA 2OO6A 1O5XA 3QN3A 4HPHA 5KINA 4Z1DA 2XZ9A 3P81A 3CS2A 1DORA 1XIIA 3KAOA 1HO4A 3KOFA 1IYXA 1CGWA 3VINA 1OSEA 3ANVA 1TYGA 3NO1A 5A2BA 3QGVA 4B92A 4Q8WA 2CLIA 4WX2A 4ZZ9A 1W3IA 3WJZA 4PFHA 4IWWA 1SZGA 3W1NA 2YPIA 1E9ZB 4WOZA 1F8MA 2XSAA 1B9ZA 1XYBA 2QS8A 1UP0A 1DJQA 2V3FA 1KM3A 1NOWA 5EPDA 4F0RA 3UPBA 1ISYA 1I1XA 3E2SA 5BROA 3M44A 1TPB1 3LPFA 1XLBA 2IQDA 4AVNA 2ZIDA 1TV2A 3AMLA 4EP8C 3GWQA 2WNNA 4BI6A 1UHVA 2A6NA 2JGQA 4IIFA 5B7YA 1LYXA 1UH2A 1BTCA 4IMEA 1UUOA 1R87A 3GNNA 3E74A 5L9FA 4Y9MA 1SFLA 1B3VA 1KV5A 3AWNA 4PMUA 1KD0A 2JE8A 3NM1A 1DXEA 2BY2A 5CSRA 3W76A 4JX6A 4LYRA 4O18A 1Z3NA 1TPWA 1QPOA 4G5DA 1CX9A 1UKSA 1Z7AA 4RNHA 3OBAA 3BGGA 1PPIA 3AI0A 1RBOB 3OZOA 2GVYA 1KFCA 3CAQA 2C3ZA 3W7CA 1KRBC 3TMQA 3I10A 1YBQB 1D2KA 3W07A 4WUIA 3HMCA 2IQ0A 4UTLA 1NU5A 4GZEA 2AKZA 4GNKB 4QJ3B 4IQJA 5C7VA 1OC7A 1E51A 4M7SA 1B31A 4CLMA 2FVLA 4J3UA 3SCTA 1GOWA 2YOCA 1UD5A 5C8BB 1ZU8A 1CGYA 5FJIA 2ZFAA 2WMIA 5LIXX 1VFUA 1AK5A 4CVWA 4YVXA 4AW7A 4HT3A 5D9NA 3MKKA 2V69A 4FALA 2PDNA 1GQLA 3VYLA 2QGHA 3FGCA 3PR2A 5LZLA 3VAVA 1R38A 3KBWA 3R7MA 1I2OA 4UTTC 1K4GA 1QUMA 3CXOA 1PL9A 3TX9A 3S1GA 1NQKA 3OYZA 1JCMP 2MUCA 2J7GA 2XISA 3KWXA 4PBFA 2VC7A 3TXZA 4C7DA 1KNWA 1VFOA 2Y7FA 2XHYA 4PMQA 3PG9A 1DEDA 2A7PA 4CGTA 3C86A 2NQ5A 3LCGA 3GXFA 4GC4A 2VT0A 4LUSB 1GKQA 3FV9A 3M0HA 4GHRA 5A95A 5DMMA 2E5BA 3A3WA 4MWAD 3MYPA 5HMSA 4GQGA 1X1OA 3MUCA 4GCXA 1VEOA 2BY3A 3W75A 5AYIA 4Q6JA 2YSWA 2EG8A 5AHEA 2AQWA 1W3HA 1XPGA 4ZTYA 1LTDA 3EYPA 2XSBA 4YMZA 1BPLB 1RPKA 3G5EA 1G0CA 2PWEA 3FXYA 5DXYA 3GC4A 3PTDA 1FDJA 3QTGA 3S5OA 3EDEA 4NJJA 3QPYA 4GXWA 1YXYA 2ZA1A 5CPNA 3A22A 2QGYA 3HV8A 2HISA 4QG8A 1J01A 3BC9A 3CMFA 4HYRA 4E5TA 1A5BA 1IEQA 2A6LA 4IP5A 4B3KA 1HIZA 3IGSA 2WKJA 3G1YA 4RNIA 3E2RA 4ZA0A 2DFAA 3IEBA 4O10A 3ITXA 1KGWA 3VA8A 1QWGA 3MUIA 1UD4A 1H7OA 3UGRA 4Z1YA 5AYBA 1ZB5A 3STCA 4HD5A 3AIUA 3GC2A 4RX0A 1JFXA 1OFAA 1BTMA 2J7FA 3QYSA 2W3ZA 1S5TA 4DHGA 3IGXA 3WELA 5KEZA 2JEPA 1HO1A 4KRUA 4S1FA 1GKRA 1RK5A 1ZAHA 1O66A 1TO3A 3UR5A 3BAWA 3JU2A 2JKAA 3SO7A 3WNLA 1BKHA 4S38A 1M5WA 1DBTA 4OV4A 5IDIA 1QBAA 3HQ1A 3L4VA 2JKEA 3DECA 1XD1A 4K1WA 3M1ZA 3N4FA 3UETA 3W37A 4JN8A 4CD6A 1PUDA 1BXNA 1H60A 3VPLA 2IS7A 1U5JA 2YL5A 3FA5A 1V77A 5A8MA 4X0NA 1AFSA 4U4MA 4IMDA 2IPFA 5TIMA 5I5RA 3THQA 1W8GA 1VYSX 4JN6A 4MNJA 1ZBVA 4DB7A 1H2JA 3S9IA 4BR1A 3MCMA 3L66A 1OX5A 1GK8A 1V51A 2E1DA 3TP4A 5T9CE 3KTXA 4AXKA 1H11A 1LG1A 4M6UA 4ML9A 3CL8A 4Q8OA 5AKQA 4EPKA 5BNKA 3KZPA 3AHYA 4WDWA 3K4AA 3KBNA 4O13A 1DTUA 4OT7A 1QASA 3GDBA 1ZL1A 1OX4A 2QCCA 4M19A 2WSQA 2FTPA 1WXZA 3KHDA 2GWGA 1UG6A 1ZP4A 3M0JA 3W6LA 3VD4A 4M24A 4NVTA 1FHDA 4X2PA 3O8AA 4I3GA 1GQJA 1SW3A 5GJMA 5I00A 2B7PA 3AXXA 2UY3A 3MCNA 1NP0A 3WK3A 2CC0A 1PKLA 3DC0A 1JAKA 3SY1A 1FP8A 2KAUC 2WHMA 1FWAC 1QT1A 2VC6A 2WAGA 3URNA 1WV2A 3K1GA 3H23A 4J3WA 2G8ZA 1JQVA 2PP1A 1PDZA 4L64A 4NG3A 1FQ0A 4Q4KA 3AC0A 2REQB 2J7BA 3THUA 4IPIA 3VTRA 3AS1A 2HE5A 1EDGA 4KBXA 4W5UA 1QWKA 4JEQA 5GVJA 4J3VA 2P3EA 1S2AA 2BXVA 3LERA 5DXXA 3R8HA 3RCYA 1IEXA 4HU0A 3KCOA 3W1TA 3E02A 3KBMA 6TAAA 5SWUA 1JXJA 4DPPA 3U2ZA 2W61A 4ZTXA 1Q7MA 4Q7NA 3DBPA 2R6OA 4RK8A 2QJHA 1LUCB 2VVSA 4QXIA 3L5MA 4DAIA 4HZMA 7CGTA 2YW3A 1H7RA 5REQA 1W1PA 3VC5A 2C13A 4RLIA 1Q6FA 4C5YA 1NDVA 1LROA 4XZ9A 4MAZA 4LS2A 4POCA 2PWHA 3UQNA 1MEHA 1US0A 3QOMA 1QNRA 2O55A 2WCAA 4ML4A 2ZDRA 2WV8A 3GTNA 5HJLA 1V93A 4GNJA 1IV8A 3MI3A 1OFBA 4A3HA 3IJ8A 4ZQOA 2FMOA 2YFNA 2Z4GA 3GYEA 3QXBA 4LTSA 4QCEA 2ALRA 3PZIA 4GYFA 4XIMA 1M04A 2QYGA 2ZRUA 3TAOA 2XM2A 1XRVA 1TPH1 4IF2A 2VFDA 5DN1A 5FA5A 4L1GA 5CZJA 3U3HA 4K7VA 4F3HA 4KETA 1CXFA 5F2LA 2JF7A 3N12A 1ADDA 1B1YA 4ACZA 4DO4A 3EWXA 3CHDA 1I1WA 4O8RA 3IACA 3RO8A 2YJQA 3ALFA 3RRXA 5JBEA 5G1TA 1DJNA 1UR4A 1KBIA 3A47A 2PRMA 2DSZA 1TV7A 3WUEA 2R1KA 2ODOA 3O07A 4BY3A 2G4JA 5HOSA 3AICA 2YXXA 4TVCA 2OVLA 2XTKA 3MKCA 5KETA 3E2VA 1JRBA 4OKDA 3KRUA 3RFAA 4UC5A 3VNKA 2GSHA 2B7NA 5CJMA 1E3ZA 5MF5A 4R7OA 3RM8A 1W9BM 3W3OA 4JKMA 4XBKA 2JF6A 3USZA 2GGHA 5HMFA 3UA3A 1TB3A 1YHTA 2EPNA 2ISWA 4ATDA 5LA2A 3GXDA 3QR0A 1PSCA 1E1CB 3B0XA 1FP9A 3P3BA 1EJSC 4JNMA 2YB1A 1NOUA 1SFSA 3WUBA 3VIFA 3BLOA 5G4EA 3ID7A 5LIYX 3VO0A 3MP4A 1H7WA 1ZY9A 1YIXA 1HVXA 1DXIA 4ZSTA 4UFJA 3FA3A 1THFD 4DJFC 4B4HA 3TUUA 3GXTA 1QW8A 2EPKX 4AY8A 5E5CA 1F4AA 4G7EA 1JCNA 4DUWA 4HK7A 1AG1O 4FNUA 3G1AA 1SSDA 3BJTA 4JKKA 2Z1WA 1WOBA 5TAOA 1OGBA 4DM2A 3IJLA 2VURA 2O7SA 2TODA 2NT0A 4W84A 3URQA 1Q6GA 4QE5A 3WLHA 3H2NA 4R88A 3CWOX 3OJGA 2QMJA 4F0KA 2ALDA 4DYEA 2O7QA 4MFEA 4I8YA 2E28A 1UKOA 3CT2A 4FNRA 3DHDA 2HNHA 3CIXA 5FL1A 2QDGA 1P6BA 5D03A 3GO2A 2PC4A 3VKDA 3LCIA 1YXDA 3GS6A 1R30A 4DJDA 4RPQA 1W3KA 2YXOA 4QS5A 5DLCA 1DWHM 1VS1A 4AH7A 2ZZ5A 1PVNA 2OZ3A 4G56A 1KC7A 1VP5A 1WZLA 1YE4A 3KM8A 5DT5A 3U8GA 1E6QM 2OG9A 1H41A 3N29A 3UT0A 1KCXA 4HYWA 1E1FA 4JQAA 3UZWA 3LUTA 3ZR6A 2QCHA 2HTMA 3NIYA 1PZ1A 2QDEA 3H6OA 3G2GA 3CK5A 4AZBA 4P7QA 3E38A 1W31A 4N6FA 4MG4A 3SCNA 3TA9A 1OCBA 3CIVA 2NSXA 4IG2A 1ZP3A 3TU9A 2B0MA 1JNEA 3GK0A 1BXBA 1ZCOA 3TCSA 5A6LA 1J96A 4QSFA 4LNCA 4QRNA 3ABQA 1JNDA 2YIHA 2CLPA 1BVZA 4XQ6A 4F2BA 4A2SA 2X1UA 2XM1A 1OF8A 4R7JA 5CG0A 5CBIA 4DZHA 1EC7A 2DEPA 5IHSA 3IJ7A 4A21A 2WYSA 3BGJA 4BK9A 3ABZA 2PTYA 1EJUC 1Z41A 5CBBA 4ZCWA 2QVNA 2IXVA 4TO8A 1EOKA 3CT7A 3MC5A 3H8AA 1V6YA 5I78A 4PE8A 1R9YA 1NTHA 1V79A 1PE1A 3CL6A 1GT8A 3QHOA 4ZO7A 1E0XA 3I65A 2ZUSA 2IPWA 2HVOA 3THAA 3GXNA 3EMQA 2E1WA 3RPTA 2PP0A 1YADA 1VR6A 2BV9A 3OZMA 3NA8A 3QJAA 4RV3A 3L23A 2VX5A 5D2YA 2PLJA 2EKCA 5A6TC 2GSJA 5LIKX 3DEQA 4N9EA 2Q02A 2XIOA 3V0TA 4QE4A 1QBBA 3B0UX 1CB7B 1VIZA 1EEPA 3VD9A 4ZMGA 1C8XA 3W22A 1BYAA 1WUEA 2XIBA 3ORWA 3GDRA 4KCVA 1E5JA 3FCPA 4GIRA 5I7GA 2CIPA 3GY1A 1D3CA 3BSHA 4LAZA 1E43A 2DDXA 4TX9A 2PAJA 1B30A 2OSXA 4CN1A 1JCJA 1W1VA 3TC6A 2IXUA 3HOJA 1KBLA 5E6YA 3ARSA 1MI3A 3PANA 4YTUA 1JULA 1Y65A 1L6FA 1EIBA 3VIHA 3GIPA 4N42A 2Z1VA 4B2DA 3C2OA 2QUNA 1XIGA 1EZ2A 1OHLA 1TQJA 3POCA 4E8GA 3CNYA 3WF4A 1GVQA 1MW2A 5C2GA 1U5HA 1QR7A 2DGAA 1DJYA 2WCSA 3EMCA 4Z2HA 4JTRA 4X9SA 4OIFA 2ZZ1A 3QV8A 2OYMA 2QULA 3EWZA 4UFIA 1T6MA 5FEPA 3MTWA 2FVMA 3CAKA 3DG3A 1P1XA 4GYKA 3FYOA 4JS3A 4ZB0A 2QT3A 1OK6A 4FI4A 2VX6A 1MW3A 4NUWA 2HXTA 2QJJA 4O8AA 5EFDA 4JQ4A 1GYMA 1W17A 1ZJBA 3L5AA 2G97A 1SVDA 4Y9PA 1U83A 2FH6A 4LVGA 4Z1AA 4BJHA 5EMMA 1DWGM 4NASA 3ANUA 4J7RA 4QDPA 1SGJA 4GKTA 3TYDA 1DJIA 3DFOA 2V0TA 3P7YA 1H0IA 3M0MA 3LHTA 4O16A 3T0DA 1TSIA 5CPTA 4GZIA 1ZJAA 2EPHA 3UGVA 2QZRA 3ZWSA 3WFZA 5KZMA 4H9MA 3P67A 2H9AA 4FOKA 3BLLA 1JIBA 3WK2A 3H4GA 1WO2A 3MVIA 5CGMA 4O50A 1PJ9A 2WC3A 3T9PA 1DWFM 3EWUA 3OB8A 2ZZ6A 3GR4A 1C93A 1LQAA 3WDQA 4AZCB 3W38A 4Q8QA 4G6CA 3TROA 3C5QA 2I9EA 4ROQA 3XINA 3N19B 3QPZA 3U7BA 2Z2UA 4GYJA 3V1PA 6ENLA 1U1HA 3W7DA 3PAJA 1B3OA 1OG0A 1KQZA 3P8JA 3N6JA 1GGOA 3PF3A 4G8TA 3LSCA 4DIAA 3KOYA 2HDJA 1J5TA 5GNYA 2D3NA 3AZSA 4LX4A 1JZ6A 3MU7A 2WHKA 1CT5A 2EO7A 5FEZA 3WQOA 4C6FA 4L1XA 3EDDA 4HU3A 1YDVA 3RILA 1KFBA 1KKOA 2I57A 1VF8A 3W28A 3SR7A 1TFVA 4ZE5A 5DMNA 4H2CA 1KA9F 2RDWA 3GH7A 4GJJA 2I1OA 4BQ2A 1OC6A 2WCGA 5ENLA 3LXAA 1XUZA 4ADUA 3HG3A 2VGFA 3GVVA 3OTRA 2QUTA 2J9ZA 2WJFA 2XN1A 1JF5A 2Y5SA 3LHVA 2VC5A 4TVUA 1XH2A 4FXJA 1L6GA 1K70A 3E3HA 3ZJ8A 3HB9A 4PA8A 3KCLA 2QAPA 3R6IA 3TTQA 3MZNA 4GABA 5AHFA 2F2KA 2NQLA 1C9DA 2XWEA 1JZ2A 3MV11 3WJWA 3LENA 3WQPA 4PN2A 3I4KA 1TTQA 1EDQA 1NP2A 4C6JA 2HS8A 1B57A 3L2IA 3T44A 3UR8A 4NSBA 4PUNA 4ADTA 3H54A 1MEWA 4AZIA 4Z1CA 1UW9A 1HP5A 3VIOA 4UQCA 3KZSA 3NZPA 3TC3A 1NIUA 1JVNA 3BLKA 1M03A 4DXXA 2O9OA 1P1MA 4JYEA 1NF7A 4PRRA 1XCWA 4YXGA 2CBJA 3R79A 1LM1A 5B80A 2NUYA 3L2MA 4P5UA 3GG7A 4W8AA 3A4JA 4GY1A 5LYRA 2WOQA 3WBXA 2VOTA 3IV3A 3RMEA 1KWKA 2WSKA 3N2XA 1V3IA 4JHZA 3CLMA 4FF7A 3ATZA 5G5IA 2CETA 2FPVA 5AYZA 4QLLA 1GOOA 3FVDA 1EJTC 4DO5A 4US6A 1BYCA 1B4EA 4S39A 4PTWA 2J6XA 4KIEA 1PCWA 3WYZA 3TIMA 4J3TA 4BCEA 4O1DA 5E9XA 3KHJA 4UQ9A 2QQ6A 2WMKA 3PG8A 1X6UA 3KRSA 2J7HA 2NX3A 3TC7A 3WD0A 4MDOA 1LOQA 1QXLA 5LIUX 3V3WA 1B4KA 5K9XA 4KFPA 3NQEA 1GZ1A 1PHWA 1VD6A 2GYIA 4LAOA 4Q4OA 3VDBA 4L4PA 3NXLA 4IL2A 4DI8A 4XBJA 2G96A 2GGGA 5ABGA 2PD9A 4C1LA 1UD2A 4PODA 2QJNA 1HZYA 4HGXA 4X61A 1VCVA 1XINA 1T96A 2QLYA 1YDOA 4GQRA 2CLLA 3UWWA 1KFJA 4GUHA 1FWGC 1L6YA 1E55A 1KXQA 4ZGYA 1GHSA 2GFTA 3VMNA 3TQPA 4BQ3A 1NDWA 2ZC8A 3LPPA 3EPOA 2VEPA 1A49A 4MADA 3I3BA 4S23A 4S3CA 5TQLA 1S2TA 1V3HA 1SZRA 2FH8A 3WQ8A 4RV8A 2UY2A 1J6PA 4PULA 3MP3A 3A5VA 4ILSA 2EG7A 5E70A 2CCRA 2VUYA 4X2RA 4O0KA 4PCNA 4GYPC 2J13A 2G3MA 3A23A 3CZKA 1PB0A 4XAFA 3PM6A 2YB4A 4LBRA 2KZHA 1J0KA 3ZFHA 4L9YA 5LNRA 2XPKA 3GAYA 4FNPA 3WUFA 2VCCA 1TJRA 1XKYA 1ZLPA 3K30A 3TJXA 4HMDA 4U28A 2ZXAA 1GUVA 4P7LA 4KW2A 1LL6A 3LU2A 4XKYB 3EEGA 3SQSA 2OCZA 1GVFA 1E0UA 1EGZA 3SI9A 3W27A 1BWKA 1CBGA 3EZ4A 3G22A 3QQWA 3C8FA 3ITGA 4C7FA 1EBGA 3OZYA 1DE5A 2CU0A 4AD1A 4EPBC 2BX7A 4D1JA 5KITA 1SJCA 1Z8AA 2WVUA 3PNUA 3MO7A 2XH0A 5CAHA 1TWWA 1GKPA 3BOXA 3T42A 2PGWA 2GJXB 3C0LA 4WDXA 4FX7A 3TA6A 2V38A 3FK4A 5AC8A 2GUYA 2HJPA 5CSYA 1XRTA 3ZVHA 4WRHA 1S46A 2B7QA 1KWGA 1BG9A 1EO7A 4QAWA 4RE2A 5BXTA 2A2IA 3VK5A 2EG6A 3EWWA 1QTWA 2ONEA 1TV4A 1FFRA 3ZR4A 5IFTA 1F2JA 1WA3A 2JFEX 1UPMB 4OV9A 4V28A 4D6HA 1JCLA 4IUGA 3N9RA 2E68A 4IMAA 2W6RA 4IIGA 3Q67A 3CHFA 4GBUA 3NQDA 3BWWA 1M3UA 4XVDA 4OU1A 3BAYA 2V5LA 2XG9A 3DGRA 1LLOA 3RF9A 1OD8A 3E12A 1J5SA 1EP1A 3NYDA 3AHXA 1CW2A 3L4ZA 4EACA 2Y70A 4W5ZA 4KKXA 4GXMA 4LBSA 3EKZA 4AIOA 4XO7A 1GTHA 1CTNA 1KV8A 3VMOA 5F2MA 4AB4A 3BLDA 3W4RA 2GDUA 3NG3A 4Q7BA 1UA3A 5CPQA 1HGWA 4BF9A 3W2NA 3DFYA 5ECVA 3TYBA 4HU8A 3MA8A 4JCMA 1UJQA 3B06A 4YTSA 1WAUA 3FJLA 3FXGA 4GUGA 4H3DA 4ORIA 3LZ3A 2ZRYA 3FVMA 2HPIA 7A3HA 1XBVA 3LI1A 2Y5JA 3HV9A 5A8NA 3O15A 1MRQA 4K1GA 2AL2A 2DUXA 5E0FA 3CEPA 4RKAA 3L4WA 2W0UA 4GUIA 4UMBA 5HDRA 4GE8A 3RXZA 3GNPA 4S2CA 3SFWA 2FHBA 4XK2A 3CWNA 2OLAA 1OYBA 3UESA 5BRPA 3QEZA 4MGGA 3ITTA 5CJ5A 1ELSA 1UOZA 3QMSA 2ZUNA 3HJEA 4H9VA 1MNSA 1H5YA 3UBPC 1KFLA 2Y88A 2VGIA 1VBJA 2ZWYA 1C7TA 2G50A 1K8XA 2CHOA 1P48A 1A80A 1W9PA 1H49A 4HOXA 1OVDA 2FFCA 1HKVA 4PCFA 4H2HA 2E6DA 4Y9OA 1G1YA 1DL3A 3SRDA 1P7TA 3RR1A 4M80A 1X1NA 1WDSA 1I8JA 2DJXA 3P14A 4NAFB 3CYVA 2YCJA 3GUGA 4PEEA 5FEWA 3PB0A 3H2CA 2GGEA 4ZQRA 3TONA 5H1WA 4LUIA 2J74A 4MJMA 1I2RA 5BYWA 5A8PA 2ON3A 3W1UA 1P43A 1AODA 3VM5A 1VBUA 4B16A 2NQZA 4UR7A 1JGIA 3ARWA 4DBEA 4XO6A 4WGXA 2VR4A 3VDAA 2D1ZA 4ERAA 5CC6A 3CUGA 3R8RA 3R5EA 5EA9A 4HTYA 4DPQA 1R2SA 2P5NA 3C3UA 4CCEA 4ONVA 2P8BA 2BBFA 3TW6A 2BHUA 3GUWA 2C1IA 2R14A 2BLEA 3QC3A 3WF3A 1W1A1 1GONA 5IOBA 4M5PA 5G2IA 4GPNA 2C79A 1I4NA 1EQPA 1Q5MA 5JIPA 1VPYA 1K7XA 1CENA 4PUJA 3AXKA 1XM3A 3RITA 1YDNA 1OCJA 4O0ZA 1DJHA 1K9FA 3W02A 1CYGA 4DBDA 3HIJA 3VZYA 3GU2A 5AHNA 1SFJA 4BHYA 4QTGA 2X1SA 4HPJA 1OM0A 2IKJA 4BFAA 3HPFA 1VCGA 3WEOA 2Q71A 5TNVA 5U4NA 5BWFA 3NQGA 1JPKA 2VCAA 3ES7A 2CYGA 5HR6A 1UBPC 3T4CA 5I07A 4LC6A 2V2DA 3MPGA 2OEKA 4UNLA 2R94A 3VCNA 3BARA 1R3WA 1E6XM 1JR1A 4NP7A 4PMXA 4E8CA 2YCLB 4IM4A 4E4UA 1E56A 3LPOA 1RA5A 1C7SA 1KRMA 4S3KA 1BWLA 3TR2A 2DH3A 1FKXA 3LBOA 2EF9A 3CZEA 3EA1A 3PZOA 2A7NA 5FOOA 3B9EA 2EQDA 2E25A 1TV5A 1SSGA 3TSMA 4TUFA 4EOUA 3FW6A 2WVVB 1XKJA 4PEKA 1E70M 2XH7A 4QNWA 5AC6A 4XAZA 1RP9A 2WZHA 5FF4A 1WKDA 1JDEA 1E9LA 2VR5A 4LVBA 3SUSA 2PZNA 2XVNA 4UTWA 1CWYA 1IT7A 2DH2A 2BVWA 2E8YA 3O3RA 2VFGA 1H1ZA 3VNYA 3H2FA 3VKBA 1YNPA 3CPGA 1UKTA 1J0HA 3ARVA 1TZZA 1S5MA 3OVGA 3W1QA 1KB3A 2DZWA 1F4HA 3PJTA 4FZIA 1T7LA 2PB1A 4O1CA 2BFGA 1HJSA 1X7FA 4V1YA 1J0JA 4UR9A 3IUDA 2NVAA 4HZ8A 3P6LA 2HXUA 3LYEA 1X8FA 3CQHA 1EF2A 4I5XA 4FSAA 3U2CA 2CXEA 1XBXA 2YA0A 3FYYA 4NXKA 4DF2A 4NAEA 1S1PA 5A6SA 3N34A 4LSBA 3IRSA 1O5QA 5C5YA 2CZDA 1XC4A 4ICCX 4IIEA 1TZ9A 3S6DA 3E0LA 2RUSA 3VCCA 3PJWA 1X97A 1DP0A 4UFMA 1GOIA 1R3SA 4JCLA 3VIPA 2DIEA 4IGMA 1V0KA 1KM6A 2DORA 4LBUA 3W2LA 2WO5A 4GUFA 4W86A 2QCFA 3MUAA 1TTIA 3OBEA 4ZOAA 1Y7VA 4GZ7A 5IBXA 3N25A 3BW2A 4XX6A 2PWVA 1JEZA 2Y6ZA 1U5VA 3WD4A 1ZBKA 4J2PA 1W54A 1SO4A 2WB5A 4RDVA 1PHQA 4N9DA 4J27A 1E6PA 1AL7A 4LANA 1FH9A 4C6OA 3TWAA 3BV4A 4PB3A 1QK2A 3CB3A 1OY0A 4ZQPA 3GR8A 4LUYA 3KBVA 3VFCA 1K77A 4NU7A 1UIOA 3VIIA 5K3VA 5CLTA 1VZWA 2ZDSA 1A5KC 2POTA 4GNVA 3B8DA 2WVTA 2R91A 2VEIA 2HQAA 1W9VA 3CU2A 3M5VA 3E49A 3V16A 2VFIA 2WJDA 3A3HA 2WMIB 3SJNA 1ITQA 5FCZA 4W7WA 8CGTA 4GY0A 3F4CA 4KCTA 4TTUA 2IUZA 4O4VA 4DWSC 2HNEA 2XWDA 3CH0A 2RDTA 4FLSA 3WBAA 3LHYA 2DZBA 1HXJA 4WD0A 3TW9A 4KRZA 2QCLA 4EAMA 4ZO8A 4F66A 1QHOA 2UWFA 1XYLA 3SW6A 3WH7A 2E6FA 1KTNA 4ATLA 3ALGA 2F7FA 4JTAA 4GI4A 1LBLA 4I6KA 3G1VA 1BRLA 2GJLA 3FEQA 4N2YA 3BAXA 2V5KA 3RLHA 1WKEA 3G1SA 4EXBA 2YBVA 3NQ7A 4MY8A 4UCGA 1WOAA 1H5VA 4K8HA 1BYBA 1FDYA 2HSAA 1US2A 2TAAA 4IJCA 4D8AA 5IXEA 5LA1A 4FB7A 3R43A 3VNJA 2CERA 1KTCA 8TIMA 4XAGA 3PK7A 1RLDA 1SZEA 4IT1A 3ZSTA 4NNAA 5BU6A 1BFNA 1MMFA 3VIGA 5K4XA 3D46A 2A3EA 4XAPA 3T78A 5BOEA 2G3NA 1CLVA 4JFWA 1JD9A 1TUFA 4DUXA 1U2YA 3ARPA 3K13A 1AQMA 1WDDA 1Q6OA 2PC8A 3CTLA 4Z42C 2DSWA 3IRDA 3FAXA 4WLCA 3GNRA 4NX5A 4ACYA 5EMKA 5LHFA 5I24A 1FCUA 4UTIA 2QKFA 2CLFA 1BYDA 2IMRA 3W85A 2E0PA 3NQ6A 3AIRA 4ZSUA 1E0VA 1UIPA 5AZ0A 3BJSA 4A3UA 4WSHA 3DFQA 1Q6RA 3T40A 3KLKA 1EIXA 3WLOA 3ARQA 4OZOA 4NJIA 3EWCA 2D20A 3LTSA 1Q6CA 2OQHA 4HHPA 4TU1A 2GK1B 4HCDA 1Q45A 2OYKA 1XH0A 1Q66A 2FDSA 4H19A 4AMCA 2OLHA 1KM4A 4UTWC 2A3CA 2HE8A 4XV0A 4AD3A 1RCQA 4PTXA 3LM7A 3SURA 3K5XA 3NTYA 1W3TA 1H7PA 1KRAC 1PYMA 1TPUA 3HQOA 3NL3A 4HOZA 2G5WA 4UB9A 2YDAA 3QLLA 4YVVA 2E3ZA 3OVRA 3BSMA 1PO9A 1F6PA 1UR1A 1KXVA 4AZHA 4H9XA 4GISA 3MYOA 1Q6LA 1P6WA 2OQLA 4ZQNA 4UTMA 1C90A 3NQAA 1I2PA 3ZM8A 1DWAM 2ZRXA 4YTQA 2NUXA 1Y0EA 3O1NA 4R53A 2GGIA 4O1EA 4B5NA 2OPJA 1XYMA 1ZPTA 2W9MA 4QQUA 3UWYA 1DJWA 4L4OA 2GDVA 4CNUA 1PX4A 2YZRA 3VD5A 2PEVA 4FX6M 1FWDC 1Y5WA 4DJEA 3M9YA 1R3TA 3I7RA 3AYVA 3KVMA 1AQ0A 3IVTA 1EUAA 4F0SA 1CEOA 4JTSA 1WKYA 1QAPA 3WLIA 1AJZA 4LVAA 2OR2A 4QDWA 1UD3A 2QIIA 3TZFA 3FHQA 4NYUA 1VPQA 4GIAA 4QQ3A 3TH6A 4NZFA 1FUYA 5D9MA 3SRHA 3VGEA 3LXCA 4IPPA 4G7FA 3PTKA 1KM0A 4A8IA 1HKKA 4TV5A 3W7LA 4EF9A 4D9PA 1JJKA 1NELA 2FZ9A 1UZ1A 4Q8NA 1TR1A 4HK5A 3O05A 8XIMA 3L0KA 3OA3A 1XLDA 1M1BA 4GFSA 4HNVA 1XIHA 2QNEA 3TSDA 4Y9NA 4QEHA 4QLJA 4IPLA 4U2YA 3GVRA 1ME8A 3C52A 1QPRA 5HANA 3QH2A 3P62A 1QK0A 1UWSA 3L9CA 2XH2A 3RPDA 1EYEA 4D8LA 3WH5A 5D38A 3WDHA 1OCNA 3OYXA 4Z2GA 3NQ8A 3MO4A 1P0NA 3N2CA 2AAMA 4FO4A 1ODZA 3UZZA 3SFKA 3ZLFA 1I2QA 1AL8A 1Z44A 2BGNE 1XX1A 2BOGX 1HJUA 3PPGA 1XGDA 3T0CA 2P1FA 2OT1A 3F7JA 2YKKA 4M51A 4MPQA 2FFIA 4I9JA 4PMJA 4A8RA 4Z2KA 3HFYA 3NZRA 1GHRA 1T41A 5DBUA 5AC5A 3C2RA 4PUEA 1KBBA 3LSBA 4QJ1A 4PL1A 3S83A 5TBOA 4MNKA 5JBDA 3UCCA 4A8LA 2BGQA 3IJIA 5E0CA 4L6HA 2W62A 2VX7A 5AC4A 1FFQA 2PWDA 3IIPA 5C54A 3GX9A 3E0FA 4B4FA 4YYFA 2HPMA 3VE9A 2GJPA 1WDPA 1TJ2A 4XAYA 3S5ZA 2V9DA 2ZA3A 1V08A 1E9YB 1RJQA 3ZLHA 1HKJA 3H24A 3B9AA 2HEJA 1UCWA 3ONCA 1E72M 4QIUA 4DWSB 1V5XA 1YBQA 3WK0A 4DJDD 4D6CA 1ICQA 2VFEA 4MTVA 2FDMA 3IVUA 1VJSA 1G69A 5FJOA 5AYYA 3V0UA 4IL0A 4ZEPA 4J9JA 4AF0B 2PD5A 3EOOA 4URIA 3R94A 4C1KA 5CPSA 1L0PA 1XIJA 5BU9A 3WK1A 2G4FA 5A94A 3AIEA 4PUUA 1TCMA 3M0ZA 5JUVA 2WQPA 3R58A 1RJPA 1IWBA 5DY2A 1RY0A 3RLVA 1LWHA 2EEXA 3MSGA 5F4XA 1EB3A 1OFOA 2DSKA 2G41A 2FVKA 4I7WA 5A6JA 3LTYA 3HU7A 3DHUA 4QG9A 2B81A 4AX6A 1GOXA 1D3GA 2QF7A 3SCWA 4RXGA 5A69A 4AVOA 3GC5A 4AFYA 7ODCA 1GZJA 3DFPA 4ZOBA 1QRQA 3W6YA 3W7HA 3LN3A 2ATSA 2Z28A 5T9BG 5D8ZA 3MT1A 4EF8A 1E6RA 4Q4SA 3G1HA 3BOLA 2D2HA 1NEYA 2ABAA 4J3SA 3LLFA 3MQTA 3L0NA 1E6ZA 4UFKA 2QHAA 4S3FA 5AVNA 4MJZA 5J8LA 1QNOA 2NWSA 4GIEA 1SO5A 3LEPA 2QCGA 4FMVA 3FY1A 1G4EA 4CD4A 1BWVA 2DZSA 2X0SA 2ZX9A 3CO4A 3R12A 3QGAC 3I68A 2C7FA 1J2WA 3NAVA 3GH5A 4OUIA 1F73A 1Z42A 2XDFA 3Q65A 3B9NA 4CCDA 2R9RA 2ZA2A 5A3HA 3AJXA 2JGYA 2MNRA 4C6NA 5HXMA 5I3DA 1FVPA 4M29A 3FAWA 4ZBCA 2WC4A 4HA1A 3E96A 3OO2A 1TR9A 4S2BA 1W6TA 3IIVA 3SUTA 2ACSA 2H3BA 4HIBA 3GG8A 1MW1A 3EDFA 2LLEA 1XDJA 4X3ZA 1REQB 2BG5A 9XIMA 1JCTA 1AMYA 1ECQA 2ZCGA 4MIMA 4QX4A 2Z6IA 2GJRA 5C2CA 4ZR8A 3GZAA 4UMCA 3S9YA 2VFFA 1G7UA 1T8QA 4B2DD 1VQTA 3S3GA 2PTZA 3PS7A 1DHPA 3WF1A 3ZYZA 4KEZA 3NPUA 1XL9A 3PZUA 3GKFA 3WBEA 1TG7A 1JYWA 3P0WA 4F0HA 3NL2A 1WUFA 3DX5A 3PSVA 2HK1A 1V6XA 4R7WA 2PDPA 2J7CA 5D37A 4EX4A 4UNIA 6A3HA 3R11A 4FP1A 1DQUA 3QKEA 5DT7A 1R7AA 3RX2A 5HINA 3WLQA 3WQDA 4E38A 4TTGA 3IIOA 3HG5A 3LCWA 1F6KA 3VDCA 1UC4A 3WD1A 1LOSA 2NW0A 4UQAA 1D3HA 1MXSA 2D2GA 3PFMA 3JUGA 2ZX7A 1WAWA 1XSKA 2PFHA 1EPVA 3EDJA 4ZO9A 3QW4B 2WLZA 3BDKA 3VKCA 4GBDA 1SZNA 4BQ5A 1E15A 1OGGA 4D6DA 5I23A 3VD3A 5KTLA 1Y5XA 2VOMA 3VVGA 3ZIZA 4B3ZA 3SSZA 5F2GA 3LI0A 1W0MA 4GWEA 4JXCA 4TX8A 3LQLA 4H9UA 1I0BA 3EOUA 3V7PA 2B7OA 4CU8A 5HQLA 3KTSA 2V63A 3EA3A 3AIQA 4DEFA 2WJEA 1D8CA 3AUOA 2R1MA 1FH7A 4PUMA 3RM4A 3PZ9A 4GQQA 3TR9A 1UWUA 3ZT5A 3OA5A 3ARYA 1W3JA 1RY8A 3DOPA 4CNSA 3L5LA 2E9BA 2ZXQA 2R82A 4FXRA 4XZLX 1HL8A 4A6GA 1IIGA 2JK2A 3PZQA 7REQB 1OC5A 4A3QA 3ERPA 4JAWA 3ZO9A 4U5IA 2YL8A 4M56A 3TN4A 1M7JA 1ZCCA 2V5DA 4ZOEA 4FK9A 1NFPA 4UTHA 4PZVA 4ZFMA 1XLHA 2VGGA 4AEFA 1J93A 3MSYA 3TTOA 5D2VA 3QM3A 3EXRA 2ZOXA 1UMLA 1NWRA 1OZMA 3DFHA 4L9XA 3N2OA 1LL7A 1SJDA 4C6CA 2ABBA 1I9CB 4RCXA 3PNZA 2REQA 5AHIA 2EAWA 5JQ9A 4LEFA 4GC3A 2X30A 4D72A 1QI5A 1FWSA 4QHRA 2PTWA 4Z08A 2P0OA 3BG5A 4N9BA 5HBFA 4H6KA 4LCRA 4S3BA 3WBYA 4LCQA 4R33A 2NX1A 4BF7A 2EPMX 3P5YA 4PGLA 3EXSA 3D5HA 1LRNA 4FA3A 2CLMA 1EHNA 3AU6A 2YZ5A 2Z7KA 2X7VA 3ITYA 3WEZA 3R0UA 4GH3A 4HYVA 1RLCL 4I9AA 4NILA 5FJJA 1TX0A 3F2DA 3ZR5A 1LUCA 4MUZA 5A2CA 3LV6A 4KQNA 1LP6A 4OVXA 3ZQ9A 4JTHA 1IWPA 4K2SA 2R8WA 2QCEA 2C16A 4UTTA 4JIRA 3PUEA 4JYFA 2FGLA 1EXPA 4JKLA 4NNCA 1YXCA 5EY5A 3TQ0A 3U4AA 3D6NA 3GXMA 5DEZA 1CGUA 2PDCA 3FSTA 3G0XA 4L6DA 5A2AA 3P80A 3TQVA 4DXKA 3M5XA 3HQPA 5ABTA 3P8IA 2AGTA 3AIBA 1MUMA 4IXHA 3UZ5A 4OBSA 2WMGA 1S3HA 3TDFA 1ONWA 3W71A 2OGJA 2RFGA 2INFA 3AROA 3CGTA 4IMGA 4O1FA 4AC1X 1IIHA 1OYCA 1MXGA 4J4KA 5LGXA 2Y85A 3VNDA 1I60A 3WLTA 1XXXA 3NEHA 1X38A 2J8FA 4AEOA 4DZIA 3MZ2A 2WXDM 2OXNA 3IJQA 3K4WA 3PULA 2GGJA 1RD5A 1G4PA 1QOQA 4R5EA 2HRWA 4MLRA 5FACA 1X6LA 4WZHA 2ISFA 1XG4A 4RUBA 4OBTA 2ZUMA 3PPCA 1S2WA 3LV5A 1Q8AA 2J78A 2WPGA 1FXQA 5K7JA 4E3VA 3VKKA 2OZ0A 1MFUA 3UNDA 4GJIA 3GLCA 3EWBX 3W00A 1R8LA 4KWVA 3CZ8A 4MB4A 5EMUA 4AIEA 1L8PA 4J28A 3TOPA 3VI2A 5I03A 2CHNA 1V03A 4P7RA 4KFOA 1FWTA 3REQB 3ZZ1A 1KKRA 4M82A 1E1CA 4JQ2A 3GQYA 2C8NA 2HS6A 2W92A 4S3GA 3AYTA 3WL0A 1OD0A 5I2UA 3S0CA 1H50A 3CAWA 1VBRA 3KE0A 2HVNA 4CKQA 1CXIA 4FNQA 1IZKA 3TSBA 4MNMA 3NUKA 1TVPA 4DRSA 5CZTA 2Y24A 4IGNA 4Z0JA 2Y7EA 4CEXC 1M68A 4YTRA 3HF3A 3HBLA 2OTDA 3GTFA 4ES4A 2E5CA 2XVPA 5CBJA 3QLDA 3ITVA 3PFRA 4CEUC 5FAGA 4Z2IA 1ITCA 1HT6A 2NUWA 4GH1A 3B40A 4LF1A 1KXTA 4IX0A 3UY7A 4O15A 1PXGA 3M0LA 3DFSA 1RV8A 1LL4A 1XWYA 5D4YA 5A8OA 2V2CA 4JIHA 4CNNA 4RNJA 4HVXA 2OJPA 5K9DA 3CC1A 3NVDA 3OIXA 4NZCA 4I90A 4Y6GA 3QOKA 4PL2A 3VC6A 3IARA 1EGVA 2Y63A 2VGBA 5DCBA 2J9XA 4HQVA 3IV8A 4YIWA 5DRCA 1RH9A 4W4QA 4LVDA 1E0TA 1WZAA 3BG3A 3KOXA 1NY1A 3WEMA 2C1HA 4D6GA 3P93A 1ITXA 2AQVA 1EYWA 5BXSA 4L6OA 2VZVA 2UY4A 4PRTA 3JZUA 2BB0A 2WMFA 1UD6A 3GZ3A 2QDHA 3LS9A 1HKIA 2I56A 4C90A 2KX9A 2G0WA 2J75A 3WF2A 4JTKA 1UWQA 5AC7A 4ZODA 1P6CA 4WJEA 1IXNA 3QVQA 1TMQA 1DXFA 4BWLC 1OQFA 5FEXA 2V3EA 3TN3A 1VFTA 3BAKA 1GVOA 2OT0A 4MMWA 4LCSA 4O17A 5FJPA 3H26A 4PB5A 2Z24A 1G01A 4UQBA 3RYSA 3RNDA 1L2QA 3GD6A 1RXOB 4GZJA 3F4WA 1OK4A 2BTMA 1A5AA 3TYCA 4X0VA 1DIDA 2GQAA 3RDKA 3QYQA 5D05A 4JTTA 2Y4SA 1LCOA 5F4WA 5JVLA 1TZ7A 3WNMA 4P8XA 3VIMA 4CU6A 3I3DA 3W1PA 5A6MA 3O06A 4LAKA 5HMDA 1A5CA 1EUNA 1ISVA 4XZBA 1HJQA 2OGYA 4HHMA 4OWGA 1WX0A 4QE1A 3UWZA 4CD7A 3THDA 3KBJA 3C2FA 3OZPA 1PIIA 4LUTA 1S3TC 3HGRA 3M41A 3PTQA 3M46A 5G2WA 3H55A 3AYSA 2TMDA 1C92A 1I6NA 4O57A 4O1BA 4IQLA 2ISSA 4TVDA 1A5NC 4HZ7A 1RUSA 3Q94A 1VB9A 4GKLA 2Y1HA 4ECLA 2BOEX 3NZ1A 3KDNA 2QDDA 3QBUA 1J79A 5FL0A 1VJIA 5MHBA 5D9PA 1R9XA 1XDLA 3S9ZA 1KTBA 3RIKA 1CDGA 2IKGA 5BOFA 4Y2WA 1Q6EA 1XV8A 2PF0A 5LNSA 3W1MA 4FIQA 3UA4A 1QCWA 1WBHA 3MWCA 4AYSA 5EL1A 3MV01 2Z6JA 4E8DA 5G2HA 1MXDA 1BSLA 4PH6A 1AQHA 1TMHA 3RX3A 2A0NA 2YYTA 4H8UA 3VNLA 4ZOCA 4TR9A 1ZQ5A 3LPGA 5GNZA 4BQ4A 4QJ4B 3T0AA 4H04A 3W7NA 1BEUA 3WDRA 4WHBA 4S3DA 4GIYA 4LALA 4OFCA 2XIIA 3WKZA 1LQ2A 3KBSA 3M5YA 3VX1A 4RPPA 3DH7A 2QJIA 3SCSA 1F3TA 4R27A 5KMYA 4IFRA 4W7VA 5HK4A 4DAFA 3TFCA 4HNUA 3O0FA 3P60A 3TJIA 1XCFA 2Q8LA 2P88A 5BXPA 5C9RA 1ZZMA 3E0VA 4XIAA 3WQ6A 3DERA 4DY1A 1QW9A 3B8UA 1HL9A 3QY6A 4ROPA 3KCJA 4JIPA 3PUOA 3NDOA 5D2XA 3G3DA 1G67A 5AFDA 1TTJA 2PDXA 5E1QA 1V0MA 3L7RA 3M0KA 1IT0A 2ZXDA 3UFYA 3V18A 2PUZA 3PBYA 1EC8A 4AC7C 1J0YA 4IX2A 4EPEC 3MSDA 4BI7A 3H21A 3AMGA 3W29A 1PYFA 1E6NA 1KCLA 2ZRVA 2HVMA 4GA8A 4D1IA 3P5ZA 1OJXA 2V82A 4O54A 2V5BA 3N13A 5F1VA 3BLEA 2AGKA 7TAAA 2X1IA 1J10A 3T7VA 5CSSA 4CQ9A 5CC7A 1GYLA 2J79A 4H7CA 3LMZA 3L4UA 4H41A 1S38A 4NI8A 4DJFA 4AYGA 3B97A 3LOTA 3PZVA 4TMCA 1JRCA 3NGJA 1DWIM 5FF3A 3PUGA 5AY7A 4ZB5A 2QJMA 1ZRQA 2XH4A 4LNYA 3W2UA 2ZXBA 5GJPA 3SIMA 2C15A 3QMTA 3GG1A 2OYLA 4EPDC 1OWQA 5RUBA 1ZAJA 2CITA 4UFHA 3QZAA 4AZCA 2XIMA 2F9RA 3IAQA 4UZUA 3E0WA 5CJNA 3L4TA 1J12A 1J9YA 2OZTA 4KRTA 3BSGA 4N4QA 1RJRA 1BGAA 1WE5A 1HJXA 4DELA 3GH4A 4PFMA 3CEUA 4OGZA 1A0CA 3K8LA 3LCHA 4WY0B 3U2OA 1LF1A 3OEXA 3GIQA 4LC8A 3N6HA 3DYOA 3L67A 4PCSA 1EQCA 3SCRA 4Q6XA 3A4WA 2ZX8A 3GNOA 1TJPA 5HR7A 3A9BA 3SUUA 3AMKA 3LHZA 5ABFB 3B04A 4MWAB 1IZJA 1E4LA 3P0XA 1AD4A 4M8UA 3GVGA 3WJYA 2DPEA 3O63A 1J18A 1HN1A 3BE7A 3QHMA 5A6BA 2J4GA 1MQQA 1QO2A 2UBPC 2OQYA 2PPGA 4E4PA 5FF2A 4NIRA 2AL2B 2JBMA 4NRSA 3OLIA 2Y8KA 4JTCA 5LSMA 2J8GA 4ALDA 3VGFA 4KCWA 4CQ8A 2YCEA 4PSPA 2FJKA 3SN4A 2XIQA 2CLOA 2PGFA 4AVFA 3LRMA 3AU2A 1LDCA 1Q8JA 3TN6A 1A53A 2UV8G 2QUMA 3IGHX 3J7HA 1L8NA 1FTXA 2QCMA 1N7KA 3PZTA 2DT2A 2CWNA 2W79A 2Z29A 4Q3MA 1O6IA 3CBWA 3YPIA 1EOMA 3BCDA 1EWEA 1VJZA 5U7SA 2ZX6A 1ESWA 2V8ZA 2ZRWA 3ZMRA 1MQPA 3MBFA 3PB2A 1GEQA 3BW4A 3LNPA 2E9LA 5D2TA 1V3LA 4LAUA 1K9DA 1JZ4A 2WZEA 3NFUA 5H2ZA 3N9SA 3UP8A 4HNTA 3IK4A 2ZKMX 3DZ1A 4GG9A 5PTDA 4D6IA 4XZNX 4LW7A 2VL4A 3IIXA 3DBNA 2D2JA 4H1ZA 1X8CA 3AFBA 4WCJA 4HA4A 1EEXA 5XIAA 1GW1A 1UROA 4L1WA 5FD0A 3SEPA 3CO8A 4YN5A 2OX1A 2PWFA 4JIIX 3QC0A 2G95A 1FHVA 1W1ZA 3RGTA 1TJ1A 2WC7A 5T91A 2F8QA 1OFQA 1Z32X 2NX9A 1VYRA 2D24A 5FIPA 1XLGA 2XN0A 5EBUA 2WHJA 3WZ0E 3JW7A 3GTXA 4RE3A 3W7GA 4GO9A 3W7MA 1KLYA 4B9YA 5IHRA 3L4YA 3R0DA 4DF1A 1JPMA 2WMJA 5HNTA 3GVQA 3MMDA 2QAFA 4DBUA 4YCOA 1JPDX 1F76A 4RW5A 2A3LA 4RE0A 3FLUA 3T2OA 4Q7IA 2H6RA 5MKGB 2OWWA 4LYQA 1NWUA 3F4NA 2FJUB 1JUBA 4X63A 3G0SA 1EPXA 1EJRC 3FJ4A 1RP8A 2C0HA 4JQ3A 4OUEA 3STFA 3D47A 4FNTA 4H8HA 4AZ6A 4DZAA 1CPUA 1XJBA 3NR0A 3NQMA 4HNCA 1XUUA 2WWCA 4K36A 1GG1A 3T05A 3G1FA 4DLFA 1FWNA 2DY3A 3S1VA 1EO5A 2VVNA 4E6MA 3LG3A 1XLLA 2VCBA 4CCZA 1RQBA 1F05A 5LNWA 4GVGA 1DOSA 1T0OA 4RZBA 4IFKB 3QFWA 3Q58A 4KMQA 4HMEA 1TCDA 4O4WA 3B0PA 5HNRA 1WP6A 4RE4A 3VILA 2J7DA 3APYA 3IPWA 2DVUA 1XBYA 4NYYA 2XN2A 4NJKA 4HKPA 1RD6A 3FOKA 4IP7A 2JQXA 2DIKA 1U22A 3CAVA 3CQKA 5C71A 2G37A 4XKYA 1E0WA 3I6TA 4AHQA 4EK7A 3EXTA 4HNNA 4C6MA 3B4UA 3B03A 3C0QA 1RR2A 3DKLA 3TE9A 1K3UA 1U30A 2PBOA 2Z0IA 4QGCA 2FLIA 4RR4A 1W1TA 2PRLA 4ICNA 1FCBA 1BD0A 4JQ1A 3WFAA 1AVAA 3MCOA 2D3LA 1YYAA 2J24A 1QOXA 4GD0A 3WH9A 5A8GA 4E3TA 1S5NA 2GJXA 3PN8A 1UR9A 3OQEA 4H7ZA 1GORA 2J27A 1AD1A 2VQUA 4M7TA 1TA3B 1G7VA 1MZHA 3C4UA 3OBKA 3VM7A 1JZ3A 1TIMA 3HZ3A 3V4BA 1EX5A 3TVAA 2GVLA 4P8UA 2VC9A 2GQ9A 1UC5A 2ISDA 5DO8A 1W1IE 1OIMA 4ZXLA 4NF7A 4Q4MA 3R89A 5FAJA 2CPUA 3OQ8A 2QF8A 3PWGA 1GG0A 2ADAA 4MAVA 4NRRA 1IE7C 4WJXA 4AY7A 3OHIA 3SY5A 1F3EA 3GSMA 1M01A 5G4HC 2RGMA 1UH3A 3TQKA 3ISIX 4GOAA 2BWGA 2A85A 1HKWA 4AEEA 4DJED 3C2EA 1U1JA 1ZHAA 4QAIA 2NQJA 3BMWA 2VRJA 3BURA 2YA1A 4UOJA 4Y8EA 1W91A 4GQBA 1XFCA 3BMVA 4F4RA 3CTTA 4XTDA 1PBGA 2DW6A 4I7UA 1XI3A 3T07A 3TTSA 2NQ9A 1H7NA 1VFFA 2A7RA 3MUXA 1JDAA 1K4HA 2IKHA 1N2VA 2QCDB 2PLMA 1KM2A 1POJA 3DYPA 2P10A 1MUCA 4D8ZA 3TN5A 2X41A 3M07A 1W1B1 3K8KA 2E5DA 4B5SA 3RU6A 2VKZG 1FWFC 2ZZ2A 4AZ5A 3FDKA 1IWAA 3NQ2A 3RM9A 2ZADA 4FS9A 4F2TA 3AS0A 3VUPA 3GDKA 4UBPC 5T8GA 2PDLA 4P7NA 1QVBA 2GWNA 4XISA 3UJRA 3M64A 1MYRA 3G3MA 4D2JA 1MRAA 4LS1A 3E5BA 2F6KA 2D0GA 1W5NA 2VD9A 2VENA 5HA7A 5FF7A 1PAMA 3TXVA 3WD2A 1XIBA 3A24A 2QVHA 3AXIA 2L5HA 1R85A 4W7UA 4PSRA 3EAUA 2IW0A 4AWUA 1FXPA 1OABA 4IFOA 2WZMA 1TPVA 1UJPA 2AMXA 3A6OA 3CQIA 4Q33A 4J3XA 5BRBA 3KUMA 3NO5A 4UTKA 3N9KA 1W9XA 3SUWA 2HBXA 4R9XA 4NAFA 3HPAA 5CC5A 4UQEA 3AZRA 4H01A 1B0IA 2DZXA 1V02E 5I77A 4PTMA 3RHGA 4DX3A 3H70A 4WEVX 9RUBA 3VDHA 1SJAA 1TTPA 1QNVA 1SO3A 1MQRA 3KS5A 3XISA 1M7PA 1VEPA 4OOZA 1A5OC 3SCVA 3C2VA 1R0MA 3WNNA 2BDQA 4EANA 4XZHA 3UJFA 1EJVC 2PF8A 4AQLA 2FTYA 5CZ0A 2HROA 2DZPA 1EF3A 2BASA 4IZGA 4V33A 1WKFA 3URBA 1N8IA 1TWIA 3A3XA 1A5MC 1JCYA 1YKWA 1XYCA 2ZQ0A 1IXOA 4CCCA 5ABEA 6REQA 3WMBA 1W2VA 4J35A 3CUXA 2CBIA 3W0KA 1SW7A 2AQOA 2RH9A 4U5KA 3DI0A 3O9NA 4IIHA 3APGA 1YPFA 2BS9A 3TCEA 3ZT7A 1PZ3A 2VEKA 2C19A 4GYPA 3O0KA 1DWJM 4EXAA 3MP5A 5KZEA 4ATWA 1TPDA 1DV7A 5DANA 3TWBA 2YCLA 2VNCA 2JKPA 2X2GA 1XQKA 3S6OA 2J47A 1TWSA 1MO0A 3W9ZA 1NVMA 3BO9A 2Z1BA 4C6BA 1NDYA 5M2FX 2NV9A 3W2KA 3OP2A 5DBTA 3F03K 1C8YA 3MBDA 1I75A 4ZO6A 4AY1A 1C8VA 1ADSA 1NM9A 2WVVA 3VNIA 4ZXOA 3I7SA 1MNZA 2XVKA 3S1XA 3EOEA 4L61A 1ADOA 3C56A 2YX0A 4DN1A 2BZNA 2CLKA 1RBAA 2C1GA 3VGBA 3IGUA 1B2YA 4DXVA 3TMLA 3VOJA 4IH3A 4IMFA 4JX5A 3UZYA 3WNPA 7TIMA 4QDMA 1NDZA 4PMNA 4LU0A 2PODA 2F6XA 1FX6A 4R3UA 1NFGA 1RHCA 4D6FA 5HWNA 4LRTA 1VGAA 3DYMA 2OOFA 2ZUVA 3II1A 3E5PA 4M0XA 2WBGA 3CYJA 1XR2A 4F48A 4C60A 4WXZA 4DYJA 1BQGA 3G24A 3V5FA 2A5HA 2EKGA 4QS6A 3HFTA 2BOFX 4NJGA 3MY9A 3G8EA 2E67A 3M43A 4R9OA 5LIWX 3UZJA 1E4NA 1JPHA 4IGHA 4N0RA 2PDMA 2J77A 4C5ZA 3W1XA 3LDVA 4GMEA 3SCOA 4ZL1A 1IT8A 1GOKA 3JVAA 4E2VA 2XJ7A 5GJNA 4HPGA 4BKNA 1W1YA 3N4EA 5FSDC 3S2LA 3W2MA 2Z2BA 1GCYA 4J5NA 4MB1A 1XIFA 4YU1A 4C6PA 4Q4PA 1XGZA 3UWUA 3AS3A 3NCOA 1I0DA 3U5YA 3R2GA 1UB3A 1QHPA 3DDMA 1TE6A 4NZ3A 1H0GA 2OOGA 2V30A 1QI0A 1OZQA 2RGLA 4WDTA 1TV8A 1D9EA 1DJZA 4I8DA 4N02A 5IDZA 2INEA 3VXGA 2HZGA 1T5AA 2G3FA 3N15A 1SFTA 4UR8A 3BXWA 3H7RA 4JGDA 4MYAA 3T08A 1CB2A 2R24A 2B31A 3FS2A 4PRWA 1K8ZA 1UZ4A 3KLLA 1GJUA 3EX1A 3QY8A 3LGGA 1MSSA 1OG6A 3CV7A 1OCQA 5JH2A 4FOUA 2NT1A 5BXRA 3M47A 4Y8FA 3N2TA 2PGRA 1VH7A 1JUEA 1FCVA 4Z2LA 4JTGA 4G1NA 1TQXA 3P82A 3BOFA 3ZLGA 3NXFA 1HTIA 3ABXA 3NZQA 3FEMA 2I17A 4H8NA 1BHGA 1GW9A 2DZAA 4JZ5A 3PJUA 3ARRA 3H2EA 5DFAA 1L6WA 4HCHA 3ARXA 1CNVA 2FMNA 4HSNA 1FWBC 3UXAA 3LLDA 5C55A 1LT8A 1HF6A 3B3DA 2H3DA 1TPFA 3QFEA 5J5RA 1ML1A 3CL7A 1VBHA 1NSJA 4EWND 3MDUA 1IGSA 3W81A 4BF5A 4F8XA 3MHFA 4OJYA 3CV2A 4D71A 1RA0A 4W89A 4K68A 4LYKA 5CPLA 4QP0A 2D69A 1R2RA 2BY1A 1VLIA 7PTDA 2PCEA 3PZMA 4FNSA 5FJUA 5CPOA 2OODA 3KOZA 3W7EA 2ESCA 1T99A 4ZB2A 4HHLA 1UWAA 4MKSA 1F74A 2X09A 1P5BA 1XFBA 1IXQA 4ZE4A 4E4FA 3ZS4A 1GWJA 4UWMA 1S39A 1JAEA 4OHQA 2QCNA 5XIMA 4K39A 1CXEA 3L21A 3ARUA 2O9RA 3UVIA 1JDDA 5FJTA 3EEZA 3Q2DA 2DZTA 4WDUA 5JMUA 2ZUUA 1OT2A 2QV5A 3KX6A 2VRQA 4JTDA 5DX7A 2J62A 3TNBA 4EIVA 1JGMA 2TYSA 4Q4QA 5D33A 1BQCA 3A64A 5CH9A 4Z17A 3XIMA 4QROA 4WKHA 4GINA 1G4TA 2GK1A 1ZS2A 3WL1A 3PPFA 1KW1A 2WNZA 4WIWA 1A3XA 3STGA 3WF0A 3BVJA 2PDHA 2FZDA 3W01A 1Z9AA 1GJPA 3CWHA 2BY0A 4QR6A 2PMQA 4Z2JA 2VZSA 1K8CA 4OBRA 3U4FA 3EX6A 1VBGA 3PTMA 1NJJA 3QKZA 1M7OA 4HHHA 5HPCA 4KWSA 1ZBCA 3KRZA 4LY4A 1EA9C 3WUGA 1AW1A 1IGWA 1EC9A 1V7AA 2OMAA 4DZ5A 4QEEA 5CSUA 4HN4A 1M65A 2I5IA 2J6VA 2ICSA 3WMCA 3AISA 2VEFA 2XVGA 2XGBA 1M9HA 1KCKA 2FB2A 5AYXA 4AHPA 4LV4A 2OU4A 4UOZA 2I16A 3U6WA 1ONEA 3O6CA 3JS3A 3SBFA 2D73A 1WDRA 1EKOA 2ACUA 1FKWA 2J8TA 1HUVA 3BJFA 4NJHA 5G4WA 1X98A 1B5TA 3ZXWA 5HWMA 4XUGA 4IHCA 4GY7A 1MW0A 4RL3A 3OLGA 3CPUA 1ICPA 4LAMA 5CKSA 3QR1A 1M7XA 2V68A 3PPHA 3FHAA 4JHOA 5C0QA 2YW4A 4Q22A 3GBEA 3DG7A 1H61A 2ACQA 4U31A 4JR5A 4NT0A 1WXYA 2WSYA 4E0CA 4MDPA 3DIPA 1JI1A 2FZBA 3S42A 4UZSA 3S5YA 3G1RA 1C8QA 3WX7A 5E93A 2C6QA 1PIGA 3RJXA 3T4WA 3T1GA 2RKXA 4JTIA 1DYSA 2GZXA 4JYDA 4U3AA 3CMGA 3JR2A 1JQXA 1BVWA 2FGZA 3W25A 4S3AA 4HTBA 1AZ2A 2ZE3A 4C6DA 3GBDA 4I5UA 1R7OA 5HNUA 3MB9A 3EKLA 4JDBA 3UG4A 4AISA 4H9TA 3TYUA 2HWGA 3SGZA 4LWWA 1B54A 4KCUA 4ICMA 1EH9A 4XSMA 3D0CA 3QQ1A 1Y5VA 3ONBA 4AD2A 2OEMA 5CCZA 4CD5A 3DG6A 3THCA 3QF0A 4G2DA 1TJ0A 4AIBA 3UNTA 1EHAA 4MKVA 1LBFA 4IIBA 3QZEA 4C1NB 1RAKA 2WW5A 5CXPA 1XF0A 4GJ1A 3KL3A 3VIKA 4C65A 2GJNA 2AOSA 3W7JA 3BGAA 1V8EA 7ENLA 1R2TA 3FDGA 1VC4A 4MJ2A 2BVTA 2J66A 3GIYA 1X7IA 1B3XA 3E6EA 3HQNA 3ITCA 4ASTA 3AIVA 5HJYA 3FX4A 3H7VA 5LXXA 4Y90A 2PDKA 3NPVA 3LNMA 2OZ8A 4Z1BA 4KWWA 3R0KA 2GLKA 4MFDA 3G1XA 4K8EA 1CGTA 3A5FA 2X42A 1R3QA 4AD0A 1XD0A 2PTXA 4MNLA 3VGDA 5FJRA 9XIAA 3BLFA 8XIAA 2YCKX 1JXKA 4GGBA 4IJBA 3HGOA 3HMJG 4KERA 1OX6A 1TWZA 2VJXA 2A21A 4DWSA 1XSIA 3DKJA 3U7VA 3T2QA 1VENA 2C71A 1UD8A 4UTFA 4AWSA 1TVLA 2OLSA 4O0QA 1H09A 1TE1A 1POKA 2CZVA 5IRPA 3AUJA 3M0VA 4AF0A 3O6DA 2JIWA 3WNOA 3NVTA 5I3JA 3F2BA 2Y0FA 1KCZA 5I3FA 1H62A 1QI2A 1ZAIA 1JUKA 4REQB 1J8VA 3WDPP 2DSVA 2V3DA 1VRXA 4O19A 4U33A 4DM1A 1OYAA 5I06A 1R3RA 4J2MA 3OGRA 3RCMA 3BQ6A 3WDIA 4R34A 1Q4NX 3KEHA 1ZJHA 3S47A 2D22A 3CUJA 2NXGA 2D23A 2GL5A 1OIFA 2I5QA 2H8XA 4OE7A 1EL3A 4HCLA 1K03A 4LVFA 4YVPA 1DJGA 4IJRA 3LZ5A 2EBNA 3INPA 4V15A 4MY1A 1XISA 4V27A 1LORA 1AJ0A 3RUBL 3PJXA 4HPXA 3N11A 2BXZA 3DCPA 3V5OA 3LA4A 5B7ZA 3OHMB 3EOSA 1GZGA 1Z48A 4NNBA 4PMZA 4GX9A 1FCQA 4RJEA 1KFWA 1K6WA 2ZZ7A 4J40A 3GFYA 4XZWA 1DHKA 5LNVA 1DIOA 1K7EA 1KLZA 2GOUA 1UR2A 1NH6A 3ARZA 1BLIA 3PP7A 4K3ZA 2ZTKA 6ALDA 4LS0A 3DFNA 3B0VC 3LCXA 5I3HA 1XLMA 4D6JA 1QO5A 4HJFA 2SFPA 3AQUA 1RK6A 3K46A 4NL1A 1J0ZA 5KSWA 5F2IA 4JEJA 3MDWA 5BW6A 1KO0A 4DUVA 4PUDA 5I79A 1OFPA 4XBSA 1Q13A 1PKNA 1XIEA 1EP3A 3PC0A 5EU9A 3ZT6A 5A1AA 4H7VA 2X2YA 1HKMA 2WHLA 3GAKA 1NWSA 3WQCA 4WGHA 3VNMA 3AHVA 3WO8A 1Q65A 3SCQA 4TX6A 1YTDA 3U57A 3LM3A 3P74A 2I14A 1REQA 2WNWA 5CC3A 2TPSA 3WBWA 1FOBA 3WFLA 2NVCA 1ZTVA 4M3PA 1BXCA 2ANUA 3GM8A 3LCFA 1O95A 1Q7ZA 1EJXC 3D3AA 2E6YA 1GVSA 2Z7GA 1CGVA 1IQ8A 3V35A 3T81A 3PZGA 2XZ7A 4KGLA 1YMYA 1XYZA 2HCVA 1E4IA 1SO6A 4AAJA 1U1UA 4YHGA 3RAOA 2PLKA 5GNXA 4MB3A 4LB4A 5C9WA 4WVXA 3S2NA 1XIDA 5CZSA 3V0SA 1SYTA 1MZRA 1XH1A 3S2JA 3WCZA 1HFBA 2NQHA 2VDIA 3W23A 2O9PA 2YR1A 5HUPA 3UG3A 5LHEA 3K2GA 3PBUA 1IEIA 2P3ZA 5DMLA 5EB8A 3N04A 3TYAA 1O68A 2OX4A 1VIWA 4IOTA 1XGEA 1K8YA 3W88A 1YX1A 2QXWA 1T40A 4Q4RA 3T8QA 3EB2A 3LGEA 4JPGA 1AH0A 2PDBA 3GFXA 3ANYA 3G6LA 4L4MA 2ZUTA 1GQKA 1YLVA 4KEMA 2MANA 5D09A 2ZYFA 3GW0A 1XS2A 2DUZA 2NZLA 4XD6A 2DU2A