1I9CB

Glutamate mutase from clostridium cochlearium: complex with adenosylcobalamin and substrate
Total Genus 200
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
200
sequence length
483
structure length
483
Chain Sequence
MELKNKKWTDEEFHKQREEVLQQWPTGKEVDLQEAVDYLKKIPAEKNFAEKLVLAKKKGITMAQPRAGVALLDEHIELLRYLQDEGGADFLPSTIDAYTRQNRYDECENGIKESEKAGRSLLNGFPGVNFGVKGCRKVLEAVNLPLQARHGTPDSRLLAEIIHAGGWTSNEGGGISYNVPYAKNVTIEKSLLDWQYCDRLVGFYEEQGVHINREPFGPLTGTLVPPSMSNAVGITEALLAAEQGVKNITVGYGECGNMIQDIAALRCLEEQTNEYLKAYGYNDVFVTTVFHQWMGGFPQDESKAFGVIVTATTIAALAGATKVIVKTPHEAIGIPTKEANAAGIKATKMALNMLEGQRMPMSKELETEMAVIKAETKCILDKMFELGKGDLAIGTVKAFETGVMDIPFGPSKYNAGKMMPVRDNLGCVRYLEFGNVPFTEEIKNYNRERLQERAKFEGRDVSFQMVIDDIFAVGKGRLIGRPE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords GLUTAMATE MUTASE
publication title Radical Shuttling in a Protein: Ribose Pseudorotation Controls Alkyl-Radical Transfer in the Coenzyme B(12) Dependent Enzyme Glutamate Mutase
pubmed doi rcsb
source organism Clostridium cochlearium
molecule tags Isomerase
total genus 200
structure length 483
sequence length 483
chains with identical sequence D
ec nomenclature ec 5.4.99.1: Methylaspartate mutase.
pdb deposition date 2001-03-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF06368 Met_asp_mut_E Methylaspartate mutase E chain (MutE)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.240 Alpha Beta Alpha-Beta Barrel TIM Barrel TIM Barrel 1i9cB01
3.90.970.10 Alpha Beta Alpha-Beta Complex Glutamate mutase, C-terminal domain Glutamate mutase, C-terminal domain 1i9cB02
2XIJA 1REQA 2REQB 4R3UA 5REQA 2XIQA 2REQA 1I9CB 1CCWB 4REQB 3REQB 1E1CB 6REQB 3BICA 7REQB 3REQA 1CB7B 4REQA 1E1CA 5REQB 1REQB 6REQA 7REQA
chains in the Genus database with same CATH superfamily
1EA9C 4B90A 2E9BA 4NZFA 1TR1A 2CLFA 1LRNA 3QJAA 1OEPA 3VNZA 2A0NA 2QDGA 1JAKA 1CBGA 1EJSC 4GINA 4C7FA 1W17A 4YTRA 3WJZA 2DORA 4H8VA 1KR0A 1UKPA 1A5NC 3N2MA 4Y8EA 1BKSA 3SCRA 3H8AA 5EMMA 3BH4A 2E0PA 3AHTA 3W75A 3W7DA 4PRTA 2BBFA 4O1FA 1DXFA 5LXXA 4GXWA 4NZ3A 2AL2A 3IJLA 4ZB0A 3DHDA 3BANA 1MUMA 1Z41A 3CIVA 4PFMA 4V1XA 1SQ7A 5JBEA 5I0DA 1W5MA 3VMPA 5E9AA 1H7PA 1IT8A 3VKJA 3FA5A 1A49A 1EUNA 5SWUA 4JCLA 2WKLA 1FDYA 1S3TC 9XIAA 3HMJG 4XX6A 5IDIA 3NO3A 3GNRA 1UOKA 4QEEA 1IYXA 4ZOBA 4I5XA 3GB6A 1TIWA 5DXYA 3CUXA 1DE5A 2QPUA 4ECLA 1SVDA 4CVWA 5E09A 3R1ZA 3OQ8A 2VXNA 3HQPA 4ONVA 3VPLA 4BY3A 1RP9A 5K2ZA 1EIXA 1IHIA 3M5YA 4JTFA 3S1XA 3ALFA 1VZWA 1E6NA 2WVSA 3M0XA 4DJFA 1CLKA 4M19A 3NO1A 2BHYA 1KBIA 2QCHA 1VYPX 1VBUA 1E4MM 4YCPA 1E5NA 5BROA 3IJ6A 2W9MA 4I8YA 4IGHA 1ODUA 3MCOA 3N6QA 1GONA 1BTMA 1PX8A 1J01A 4XKMA 3GZAA 4QLKA 5D09A 3N25A 3IPWA 1XYBA 1ESWA 4KEVA 4XZMX 2YCKX 4EACA 4U2ZA 2QV5A 1VEOA 3A5VA 3QW4B 1YPIA 2RH9A 1BHGA 3E74A 2JGQA 1W1IE 2Y8KA 1QHZA 1OYBA 1XD1A 3C8FA 3L2IA 1BQCA 2ZWYA 3N34A 4W5UA 3MB9A 1H61A 1FWJC 4BQ4A 3T6CA 4GY1A 1KCXA 1MMFA 3FJLA 5CPTA 3F2DA 3JW7A 4DIAA 4F2BA 2BHZA 2D2GA 1VS1A 7ODCA 4Q8VA 2DGAA 3WD0A 4PUJA 2QKFA 4YJ5A 4HYVA 3G18A 3HGOA 3H12A 2QXWA 3LBCA 4C6NA 2FMOA 3PZTA 4WDXA 2O9OA 5H6HA 2R1NA 3VIJA 5HQEA 2E8YA 2W0UA 1W0MA 1E4LA 3SY8A 5JU6A 2PBOA 5DCBA 3PSWA 3TXVA 1ISZA 4FX6M 4HHMA 4W8AA 1SFSA 2XJ7A 3W71A 3F4CA 3NPWA 1I45A 2Z27A 3H26A 2WC3A 3W26A 3VGFA 3OGVA 2PCEA 1RJQA 1LROA 1QNPA 8CGTA 1ICSA 1FCBA 3RK8A 1MWOA 1M01A 4J3TA 4CU6A 3LXAA 4CNSA 2QF7A 2GJLA 2QCMA 2CCRA 4CQ8A 3W7HA 3G0UA 3DIPA 2C14A 2ABBA 4K37A 2R1KA 5D2WA 4HP5A 1W1A1 3UG3A 4M24A 3GKFA 1RD5A 2X05A 4QNWA 3TTQA 5TF0A 4PCTA 1SSGA 4QSHA 1JZ3A 4DYJA 2BOEX 4PUUA 3N2BA 4WKFA 1CLVA 1ISWA 1H1YA 3R25A 2ZRXA 2DP3A 2E67A 1GT8A 4O11A 3SECA 3NQFA 4BQ3A 3SW6A 1EGZA 3SCOA 3PVFA 4DUVA 1DTUA 4FXFA 3C2EA 4G5DA 3GTIA 3KBSA 5GQBA 1DHPA 1TV5A 3AS2A 2ZWZA 2QCGA 3TTOA 4HB7A 3WDRA 2W91A 3GVRA 2QQ6A 4AMAA 3E1F1 4J1OA 1YLVA 4LNYA 5CC5A 5BWFA 1OABA 1XDMA 2I57A 1WDSA 3UJEA 3SADA 1U22A 5EMUA 4F9JA 4AY1A 5E70A 4JN8A 3OPSA 3SAZA 5FACA 3E3HA 2QUVA 1UR4A 1V3KA 2CXEA 1VHCA 4NQ1A 3H6OA 1R9YA 2C1GA 1T5AA 4DI8A 4Q6XA 5E93A 3RCYA 4GFSA 1FHDA 3S2JA 4TU1A 1PZ3A 1EX5A 4ML4A 3B0UX 5FEZA 2E3ZA 1EFZA 5HNRA 1ZJIA 1NU5A 1T7LA 1UR9A 1MDLA 1FWGC 1MUCA 3LCXA 3RM8A 4LV4A 4UFHA 2G41A 1FBAA 2ZUNA 5CXPA 3RJYA 2VJXA 3V0UA 2BV9A 1GQJA 1GKQA 3GE7A 1X1ZA 1MO0A 4RJEA 5H91A 1GK8A 2WBGA 1S2AA 4KEZA 4PEEA 7REQB 4GI4A 3MI2A 3U2OA 3L65A 3GNDA 3BK0A 3ABZA 3WQGA 1DQXA 1TPH1 3VGDA 1Q6FA 3VZZA 4M7SA 1U5VA 4AEFA 3W1MA 1G4PA 4S23A 3LV5A 5DMYA 4ZENA 1KM4A 4RZBA 3IK2A 3UG8A 3APGA 2HROA 1QWGA 1POJA 3T09A 4Y90A 4DBSA 4LJ3A 4DWDA 2EG8A 2X1RA 5F1VA 2I14A 3LTSA 4DWSA 1UR0A 2V2DA 2ZICA 3PPCA 2V6AA 4IFOA 3WN6A 2BDQA 4URIA 2R82A 4DJFC 3LPPA 3OA5A 1GPWA 4NAEB 3THAA 2E5CA 1OC7A 5H8MA 3RNDA 3JRKA 3WH7A 2J4GA 2HK0A 4Y9NA 3BDKA 3HG3A 3QOKA 3DU0A 3EPNA 3MUY1 4BWLA 1CX9A 1H0IA 5FF0A 2VL4A 1GHRA 2X09A 3OHIA 3VDGA 3O1NA 1TR9A 5HMEA 3WLTA 1SW3A 3CAWA 1XC4A 3WDHA 2WO5A 1BFNA 5LIUX 3OLGA 4GYPC 4H7ZA 2ISWA 4E2DA 1M3UA 3BLDA 2I5GA 4GXPA 2A7RA 3HPSA 1V6WA 4JIIX 3GDKA 4AIUA 4HZMA 5HPCA 1XC6A 4UIOA 1POKA 3LY0A 5H2ZA 3GTHA 4R88A 1RQEA 2HK1A 3WQDA 2NWSA 3W0KA 2DZUA 3MKKA 2OZ0A 2XYLA 3WEZA 3RILA 1N2VA 4OV9A 1E1EA 3NAVA 4PB4A 4Z0JA 3GVVA 2PDGA 2YDRA 1TV4A 3IIPA 5G4EA 3TTEA 3K30A 1R0MA 4MPQA 1XLCA 2XFFA 1SR9A 1N8FA 4K39A 5GVJA 4GZIA 1B1YA 3W87A 5CPSA 4AWSA 3UWYA 2PPGA 2QCNA 5CAHA 1E3XA 4XIMA 2I5IA 4WUIA 2V38A 3QHNA 3AMKA 3R89A 3ALGA 1VLIA 1KBJA 3U48A 2VEGA 3QKEA 2QVNA 1UP2A 4EP8C 4UC5A 1S38A 3W24A 3UERA 4GZ7A 4OOZA 3EKZA 4UTJA 4EXBA 4GCAA 1V3HA 3B0YA 4UFKA 1RQBA 1X96A 3PSVA 1O6IA 3WFZA 4D6JA 3S0CA 5AZ0A 2VP8A 2G4FA 2OGJA 1J0JA 5DY2A 1DJNA 3M5VA 3UWEA 2CITA 4O17A 5T26A 1ALDA 6CGTA 3KDNA 4S3BA 1S5VA 3R8GA 1IF2A 1E6QM 3TMQA 4L61A 3DFHA 5F4SA 1FWFC 3M0LA 1FQ0A 3LG3A 3TTYA 1LOSA 1A0DA 2YIHA 3VKDA 1IE7C 3K4AA 1KCKA 2DIKA 3PUGA 3WUFA 1W1TA 1VKFA 3PM6A 2V3EA 1QW9A 5CZKA 4IP5A 1QBBA 3H2CA 2PWVA 2XFWA 3WZ0E 4OECA 4DUXA 1OFRA 2ZKMX 2XH2A 1FWAC 3CZGA 3RYSA 2O55A 2G95A 3ECQA 1I2NA 4WQ6A 3IANA 1XFBA 2OFJA 4LUSA 4JDYA 1W8SA 2CESA 2BGNE 3ZT7A 1RAKA 1JDCA 5AB3A 5JBDA 1D3HA 2FIQA 3O0KA 2C7FA 1FKWA 5A2BA 3S2NA 4ALDA 5G1TA 2XINA 3DN5A 1PCWA 4YXGA 2GSEA 3REQA 3EOEA 3DERA 3DC8A 1S39A 1SU5A 2R6OA 2HTMA 4I90A 3RHGA 1ME8A 3C2OA 4O57A 4XWUA 3L68A 1MFUA 4HZ6A 4AISA 1BVZA 1V0MA 2VHLA 5DLCA 3KBWA 4IHCA 3I6EA 4DZHA 3WIJA 2GQAA 4IFKB 2W79A 4CQBA 5G1YA 1K9DA 5C71A 3CT2A 3N73A 4CVUA 4TUFA 3HF3A 5GJMA 2J66A 4K7YA 4HCDA 4OJYA 3UR5A 3GIYA 4XO7A 4IP4A 1UR1A 1Q6LA 3FVMA 4HZ7A 3RX3A 4KCTA 2FFCA 2PDMA 5I3FA 1RCQA 1OIMA 4DQWA 2R24A 4JNMA 1OX6A 5HMSA 1Y7VA 2HISA 1XIDA 2Z25A 4UFLA 4S3JA 1VBGA 3KZSA 3W3OA 3WELA 1K9TA 1CXFA 4GRSA 4LGXA 1P43A 3M07A 4PUMA 2ZQ0A 2VQUA 5H8UA 4HA4A 2DT1A 3BXWA 3TUUA 3P67A 4IP7A 2FTPA 2CHRA 3DHUA 4QTGA 5LXEA 3ICJA 3K1DA 5BXPA 4AIBA 3RMEA 1PAMA 4UB9A 3MU7A 3O6DA 3L4VA 2ZRYA 3TR2A 3KOYA 3A47A 1RK5A 4GI6A 4AIEA 2H90A 4MB1A 4PL1A 3T8LA 1PYMA 4R3UA 2QDDA 3N4FA 1ONXA 1RBLA 1TPB1 1EBHA 3W1PA 3FGCB 3QKZA 3AS0A 4P2VA 3VZXA 4ZQCA 4FR1A 2GJRA 1GHSA 1GKRA 2WVUA 4QE4A 4DUWA 1SMDA 3MKCA 3QC0A 2ZUWA 1WPCA 4AAJA 1EKOA 4WDWA 3GHRA 3N13A 1X1NA 2OYKA 4JTUA 4ZGYA 1OCNA 1W3HA 4OBTA 2B7NA 1IWBA 2X30A 2NX1A 2J88A 4U4MA 3KBNA 1EP2A 4FLOA 4O50A 4B15A 4NXKA 4NIRA 4W87A 1MZRA 1TMQA 3S5YA 4OIFA 4U31A 3ARVA 4PGLA 1XPYA 2AOSA 1B90A 4UTKA 4JZ5A 1KXHA 4RE3A 3W7LA 4YYFA 3VIKA 3K5XA 1H41A 1UKSA 4A8IA 4FI4A 1QDSA 3DX5A 3NQCA 3NPUA 2NT0A 2ACQA 3NL2A 1EC7A 2FZDA 7REQA 4Z1CA 1E3ZA 3VIIA 3AU2A 4ERAA 4UMBA 1US2A 2WLZA 8XIMA 4S3DA 4GIEA 3GNOA 4QAIA 4DJEC 2BOFX 4I8DA 3LGEA 1XBVA 1QVBA 4W93A 3MSYA 3ABQA 1JCXA 3NZPA 1FKXA 5I6SA 3UVAA 2DSWA 1DQUA 1F61A 4H9YA 2YPIA 4LVFA 1LLZA 3QQWA 3CWNA 1RSCA 1QI5A 4E2OA 1AJZA 1B31A 2JALA 3FKRA 3C61A 2BSLA 3CPUA 1JD7A 1ADDA 3V5CA 2HPMA 4E6MA 5CJNA 2GZXA 4NVTA 4O54A 5A5WA 3WQPA 2OSXA 3FEMA 3N2OA 1F3EA 2JF7A 4ACZA 1EX1A 1XIEA 3QH2A 1DIDA 5IFTA 4ZSUA 5E6YA 2X1SA 4GO8A 4GVGA 4NAEA 2ZXDA 3AUJA 4FXJA 1SSDA 3CUFA 4E8CA 2OPJA 1VR6A 5AVHA 2I1OA 5FSDC 3AUOA 1FUYA 3BV4A 5CPOA 2OWCA 1DL3A 3P93A 4QG6A 3TJ4A 1W5OA 3K8MA 4WJXA 3CPRA 4FXSA 5D8WA 1OZMA 4OTKA 4RE0A 1NELA 3DHPA 2E40A 4QQ3A 1AQ0A 4OOUA 3U2ZA 5MKGA 4RR4A 1OX4A 1OB0A 2E5BA 5G4HC 2WPBA 1V08A 3AI0A 2IKIA 2CW6A 4Q4QA 3VIPA 1KRAC 3NA8A 5IRPA 4XZ9A 1HL2A 3UNTA 3UA3A 3H4XA 1A3HA 1NDYA 3M43A 3QMSA 4GVFA 3G77A 3CV1A 4GXMA 4K68A 4CN4A 3CUZA 3GXFA 2GGEA 3EMCA 5LNUA 1XH2A 1EDGA 2E77A 3EX3A 5GNXA 3G5EA 1FXPA 2QCDB 4J3UA 3R43A 4JPGA 1LOLA 4ZQPA 5M5DA 2CKRA 4Z2JA 4DVOA 3L2LA 1J8VA 2WMJA 2G3IA 2XIIA 3M7SA 4M1RA 4PMRA 3GM8A 3SRHA 4H01A 2X7VA 2F8QA 2ZUSA 5CKSA 2QCCA 3HO8A 1JPMA 1ZENA 1DKWA 4NX5A 4KWSA 4GC4A 2FYMA 3WQFA 1OJXA 3BLPX 3R0KA 1ZBKA 4DYEA 3KCOA 2WSKA 2UY4A 2YCJA 3V16A 1XRVA 4ZXOA 2DH2A 3N2TA 4JTKA 2Q8LA 2DVUA 4WRHA 4R7OA 4PSPA 3CK5A 1NP0A 2GGJA 4PFHA 4U28A 2AAMA 3PPHA 1XLLA 3N2XA 3R12A 5HDRA 3QHOA 3BLIA 1L2QA 2BOGX 1BWLA 1QXLA 2VVNA 2PZNA 3GAYA 1Q7ZA 2OSYA 3NL5A 3W4RA 5ABTA 3UCDA 2E4TA 1EDQA 5M2FX 1RZMA 4K8GA 1KCLA 2YR1A 2X42A 1HL9A 2OEMA 1EP3A 1V6TA 1V7YA 5KSWA 1GKPA 3GNNA 3H7RA 4FO4A 2RAGA 1NWRA 3B06A 2KAUC 5F1UA 2GGIA 5HJYA 1P7TB 1YDNA 1BG9A 3C3NA 2BGQA 5CPMA 4D8AA 4IGNA 2G4JA 2XZ7A 4GIYA 3V1PA 2YL5A 3OLIA 2D0GA 4N6EA 1KQZA 2J79A 2E9MA 4WSKA 3IIXA 4L9ZA 1HT6A 3NXFA 1ZUAX 2OQYA 3VNJA 2WPGA 1EZ2A 2XU2A 3GRIA 3NQVA 1UZHA 4LV9A 4LF1A 3OYXA 5D05A 2PRMA 4HNVA 1AW2A 1PCKA 4UQEA 3N4EA 4RV8A 4RK8A 1RBOB 3WMLA 3EWWA 2VYOA 1OG6A 4IFKA 4UOZA 3HBLA 4Z1DA 3AWNA 2PWUA 3RM4A 1YXDA 2OWWA 5AC7A 3Q2DA 2FFIA 3KFTA 4QISA 1H1NA 2XVLA 3RN6A 3VOHA 4LS1A 3U2CA 1DWHM 1CTNA 4QCEA 3W37A 1J5SA 4NY2A 3G1DA 1DJZA 4XKYB 4U5KA 1NDWA 3R11A 1Q45A 1NF0A 4G56A 3GXTA 1M9HA 2DJXA 4AZ5A 3GFXA 4FNRA 5CZSA 2VRKA 3SUWA 1CGTA 1XH0A 3BSGA 4B3KA 4LAUA 5I3GA 3PFMA 4WXZA 1LRQA 4WOZA 4RUBA 3WCZA 1KM6A 1BYDA 4M6PA 1OQFA 3EA1A 3TROA 2IKGA 1JDDA 2A1YA 2NSOA 4INFA 3PANA 1KRMA 1Q2RA 3JVAA 1XHGA 3W1NA 1S1PA 4NSBA 1MRQA 3BOLA 3OZPA 3TYCA 4AVOA 1LG2A 1NF7A 3SURA 1A4MA 3GR4A 1BXCA 1NQ6A 5J5DA 2FGZA 1J6PA 5A1AA 2CBUA 3VDHA 3ARXA 3GNPA 3N14A 3E2SA 1J10A 4H9TA 1TREA 1U1HA 3BARA 1MEWA 2VRJA 4IOTA 1YPXA 2Y7FA 4FB7A 4LVGA 4PMVA 1DQWA 2Y8VA 2PWHA 4KESA 4DXXA 4AEOA 4MWAA 4Z1BA 3CBWA 4QFUA 3VOJA 1MQQA 3O06A 1GPFA 2ONEA 3POHA 1JZ8A 2D2HA 3LMYA 3WMCA 4ZL1A 4PCPA 4AHPA 4JQ2A 4ZO7A 3GDLA 1HN1A 3TLLA 2BTMA 3VIGA 4N9BA 3C2RA 2Z1XA 3UJSA 3NOEA 1BSIA 3GG7A 2VZOA 4Q4KA 2BXVA 3IVTA 3L4YA 1H62A 1H1ZA 3H2MA 1F74A 3OG3A 4NZ4A 3GC4A 2BODX 3DBNA 7CGTA 2JQXA 3SUTA 3NM1A 1SZNA 1RCXB 1KM2A 1YBQB 1GVRA 1YHTA 3P7YA 3BVJA 4AWEA 5BNKA 1SGJA 3GSMA 1PDYA 3CHDA 5I06A 1HXJA 4AZ7A 3SM0A 3B0VC 4DHGA 4XVDA 4LEFA 1NJJA 3U3HA 4HMEA 4L6DA 3GDTA 2BXZA 4EPBC 3UZXA 3TC6A 3BTNA 4M81A 1PTAA 1TELA 5A6BD 3DYPA 4C65A 4XBKA 4E4PA 3P8JA 1GYLA 1HJXA 4IPIA 3C5QA 3SBFA 2EHHA 1GGOA 4ICNA 3THQA 1A5CA 1A0CA 1JF5A 3WJSA 4L6HA 1TJ0A 2PGWA 1DBTA 2OJPA 4W8LA 3GXMA 2OO6A 5I09A 4PC8A 3W22A 5ABEA 3C0QA 1E9IA 1Q4NX 3URQA 2Z0IA 4MY1A 2Y88A 4LY4A 3ABSA 5XIMA 3C52A 3F5KA 1OK6A 3PZMA 4QS6A 3VGEA 2NZLA 1EYWA 1UA7A 2QJGA 2VFEA 2O0TA 3NURA 4JOMA 3PUEA 1EJUC 3F4NA 3PTQA 2PDCA 4A2SA 5FJJA 1E4NA 4TVDA 3DCPA 1R2SA 1JDAA 3IS4A 1CW2A 4EVZA 2VEFA 3UJ2A 6XIMA 3WLIA 1XV8A 1J9YA 1B4KA 2G97A 1S3HA 1J5TA 4WVXA 1UBSA 1DV7A 1RALA 4NI3A 4KCVA 3S6TA 4NZCA 1K3UA 1WXYA 4UQDA 4PBFA 3WL0A 2IXVA 1FWTA 1Z44A 1OGSA 2GVGA 3CB3A 4JBRA 3QV8A 3L4XA 3THUA 4AZHA 4P5UA 4G8TA 5T9BG 1GVFA 3RLGA 2JIEA 2VCCA 2NQLA 2XN2A 3EX2A 4LVBA 5C0QA 1ITUA 1U1JA 1Q2SA 1H2JA 1K1DA 4O12A 3RJXA 3GIPA 1V5XA 4XUYA 3MBFA 5A6LA 4AD5A 2ASHA 4ORIA 4LCRA 2CIPA 4M51A 3UZWA 1KRBC 1Z42A 2P3ZA 2QJHA 4HOZA 2P0IA 1CXLA 5AVNA 1XI3A 2ZBTA 3LD5A 1GEQA 1SM9A 1MQRA 1PEZA 3GVWA 4GD0A 4ACYA 5FOOA 1AH0A 3TNOA 3NZGA 2ZVIA 2FKPA 5FF4A 2HWGA 1UKOA 3SUVA 4MZ8A 1OFQA 5TQLA 1ZGDA 4HMNA 4NNCA 2GDVA 1VRDA 2VZTA 1BAGA 1EL3A 3EB4A 1FCVA 4X60A 1QBAA 4WHBA 2BB0A 3KAOA 2ZRVA 4RNIA 4JTDA 3UXAA 3QXBA 3TH6A 1HKWA 3PWIA 3WQ8A 2OVLA 3EEZA 1KGUA 5DBUA 1BF6A 3BJFA 4RDYA 4FMVA 5ABFB 2J7EA 3EGJA 5HANA 1DJYA 4CNUA 5CPQA 2FVKA 3LCGA 3ZSTA 2RJHA 3QZ6A 1NWUA 3QFWA 1ZAHA 1TPFA 1F4AA 1I0DA 2XISA 3HG2A 2F61A 1QNOA 3UW6A 1XH1A 1P7TA 3NQGA 1WNOA 4IX0A 4QSFA 2HVOA 5LNVA 4WY0A 4O19A 2VC5A 1YNYA 4F66A 1D2KA 3NQBA 4D6GA 5I3DA 3KX6A 4YU1A 4GUJA 3LRKA 4XAZA 2QAFA 3U7VA 3F2CA 1EJVC 4C5YA 4J3VA 1TB3A 3WK3A 1EF3A 4LC8A 5T91A 1N8WA 3EPOA 2X41A 3B8DA 1C3FA 4HBKA 3FXYA 3IAPA 4AXKA 1HFBA 4F3HA 3CMJA 4F2TA 4O0KA 4DPQA 2VCAA 1IIGA 2FZMA 1ZL1A 3AQUA 3NWRA 3SZ8A 4FLRA 2PDIA 1NOFA 1CNVA 3P5ZA 1ICQA 5C5YA 2ZX9A 4KT2A 3VNLA 3PP7A 4WEVX 3WBYA 2FLIA 3ZM8A 3CGTA 2EBNA 2NX3A 3BW4A 4CEXC 3CZEA 4GMEA 1O66A 5G2WA 3WUBA 3MDWA 1PE1A 4LALA 4AQLA 3AMCA 3QV9A 3STFA 4H2HA 1CB2A 1QO5A 1LLWA 2J8FA 4DX3A 3VNKA 3LXBA 4H4IA 5LA2A 4ERIA 4HU8A 3MO4A 5HNNA 1HKKA 5KINA 3FKKA 4QS5A 5HWNA 4XSMA 4AC7C 2I7GA 2VKZG 3C2YA 2DVTA 3WLHA 3FYYA 4DF0A 4S2BA 4UTTC 4R9OA 4TTUA 4HJFA 4WLCA 1QTWA 4LB4A 4UWMA 1E73M 2A3AA 5EBAA 3EXSA 4I9TA 4GUHA 3SCWA 4G9PA 1D9EA 4FLSA 1W37A 3DGRA 3W7GA 3H24A 3TQ0A 2ZCGA 2DPEA 3CO4A 3PNZA 4P7RA 4GY7A 3KOFA 2VFGA 2XIOA 3B40A 1OYAA 3H21A 1K02A 4A35A 1EHAA 1W5NA 1XLKA 4WK9A 1UMYA 1Q6RA 4CNOA 1R3VA 1KV5A 4N7QA 3GUGA 1E56A 3N29A 3N19B 1JUEA 1TX0A 5G2IA 3BPWA 5EA9A 4D9PA 1YNQA 3VMNA 2WJDA 2XM1A 5F2MA 2XVGA 5I79A 3QPEA 4EPKA 2BGSA 1BYCA 1ZP4A 3NQEA 4JYDA 3TSBA 2FH6A 1PX4A 1ONRA 4NNAA 3ANVA 3WDIA 5DRCA 1H51A 2J7CA 4C1LA 3DECA 4HHLA 3K13A 2F84A 3CL7A 4CNNA 2QUTA 3M9YA 4F0LA 1Q13A 5D9NA 1JXKA 4BF9A 1VJSA 2V3DA 4QX4A 2C13A 2PP3A 1GVOA 3B04A 2OOGA 1R47A 3S9YA 1EPVA 1LF1A 1DWJM 4CD6A 3AC0A 5IFPA 2OKTA 3UA4A 2WK2A 5A2CA 1G67A 3WD2A 4XIAA 4JS3A 1IIHA 5CC3A 3EWBX 1KFKA 2LLEA 1AK5A 2GVLA 3QW3A 3VGBA 1RXOB 1B3VA 2EQDA 1K70A 2JFEX 4M3PA 1K03A 2J8TA 4GKLA 3ZR5A 1AL8A 1WDRA 4N6FA 1R87A 1PKNA 4MZYA 2ZUMA 3HQOA 1FWWA 1R2TA 4LH8A 4ZFCA 1F76A 4TX6A 3ITYA 1XDJA 3VKKA 3WLPA 5T9CE 1XIJA 1QNQA 3GH7A 4JQAA 3WF3A 3S9ZA 1R3WA 1JCYA 2WM0A 4F0MA 2GVJA 1JEZA 2DSVA 3U6WA 3G1AA 5A95A 2J78A 2WOQA 1HP4A 1AL7A 3MTWA 1OD0A 4MYAA 1V6YA 2AQOA 4QHRA 3V18A 3T81A 3H2AA 2Z7GA 3DFPA 4RW5A 4KPLA 3LHVA 3VGGA 4U5IA 1FH9A 1PTDA 4DZ5A 2WV8A 3HIJA 5AHEA 1GYMA 2C18A 4PBEA 1OFDA 4TQTA 3BJSA 1HJSA 1LYXA 4LS0A 5FA5A 3SEPA 1OY0A 1K4HA 1A50A 1WX0A 4DZIA 3IUHA 5DF0A 2HE8A 5A6BA 5LHEA 4FEZA 5HA7A 1W3NA 4UCGA 4AZBA 2O92A 1JPIA 4PMXA 2WCSA 2QF8A 4IT1A 3GXIA 3ZJ7A 3WK1A 2RDXA 4W5ZA 2R1LA 4UFMA 2QDHA 2SFPA 3MVIA 2GUBA 1H5VA 1AD1A 2H9AA 3FNDA 4LU0A 3SFWA 1ADSA 3IJ9A 4IICA 4H04A 3W28A 1HG3A 3IVSA 3EA3A 1BGGA 2OQHA 4HPGA 3VIHA 3EOOA 3INPA 4CN1A 5AOUA 2V82A 3WLQA 2UY3A 4FA3A 4UR9A 1X6NA 2YW4A 2YB1A 1EP1A 2PDWA 4H3DA 3TSDA 3UPBA 2VX7A 2EEXA 2ZTKA 4A8LA 5G5IA 2XFRA 4M0XA 3W81A 1P5BA 3LPFA 4UTFA 1EHNA 1KLYA 5ABFA 3UR8A 5AC8A 3FHQA 1V0KA 1UWTA 3L4WA 2QZRA 4KMQA 2WCGA 3KRBA 5A6MA 3GFZA 3B9NA 3HU7A 5A8MA 2D73A 4AY7A 1QPRA 1YXYA 1V03A 1AUSL 3VIFA 2J7GA 2XH7A 1YE4A 5M1TA 3VOGA 3BCFA 3FJ4A 2GVEA 1KM0A 1RVGA 4AIOA 5EMYA 5DT5A 4NAFA 1KWGA 2ACSA 4J28A 1KFLA 4F4RA 4NHVA 3PHAA 4HPXA 3WJYA 3M16A 3T2PA 2D1ZA 5JMUA 3ZJ6A 1HL8A 3MJMA 3VA8A 3G0SA 3BSHA 1JRCA 3TAKA 4K6AA 1WKDA 1JAEA 4DBUA 2D24A 3CZKA 7A3HA 1XYAA 2Q3RA 3ES7A 1BD0A 3KOWA 1P0KA 1E6ZA 2V8ZA 3F03K 1R7AA 3WL1A 3GTXA 3FSTA 1E40A 3CWHA 1PSCA 2XGIA 3V35A 3LQGA 3AHVA 4C60A 5HXMA 5E0FA 2CZEA 4R34A 1J4EA 4LCQA 1MXGA 3WBEA 1W31A 1VFOA 3LGDA 4WF7A 3NQ8A 3GHTA 3DG7A 1Z89A 1K77A 1LZOA 1SFTA 4MKVA 3ARTA 4UR8A 3N3MA 3G1YA 4B3ZA 4GPNA 1RY8A 3BAYA 2H8ZA 3FJ6A 1EA0A 4XTIA 3BCJA 3GVGA 3M4HA 1C90A 1XYLA 3APYA 3EX1A 4JTQA 3N17A 3LPGA 3W7EA 2QMKA 5BXRA 3F5LA 3SCQA 5KEZA 3VM7A 4MHBA 4XISA 3GG1A 1W2VA 3E2RA 3LNPA 2XFYA 3ENLA 1P48A 2NVAA 2Q8XA 1W1PA 1TWDA 1F3XA 2WSQA 2FZ8A 2VDIA 3F7JA 4Z2LA 3WBWA 2B31A 4IPJA 1XUZA 3KXQA 4EWND 3P6LA 1HTIA 3PS7A 3FJNA 5EB8A 1Q6GA 2GYIA 3B9OA 3GG8A 2WKJA 4GQGA 2R9RA 2HXUA 3URAA 2Y7EA 4N4QA 4O18A 4K3ZA 3TYEA 5EY5A 4LUTB 4KGLA 1LBLA 3GS6A 2V5CA 2O7QA 4LTSA 3T78A 2GJNA 1QI3A 2PDQA 1J0YA 1JPHA 3B0PA 1VYRA 4QDPA 4IIFA 3HPFA 4PTMA 1E70M 2WZIA 4OU1A 1JZ6A 3IJIA 2WW5A 1JF6A 3ITCA 3DUGA 3RM9A 3OVPA 3PR2A 1IZCA 1VAHA 4HCLA 3VVGA 4YTSA 1A5AA 2QJNA 4GABA 4TVUA 1M04A 3GK0A 1GWJA 1O12A 3N04A 1ISXA 3L66A 3M44A 3E96A 3JS3A 3U4AA 2J27A 1ZAIA 3ITOA 4IGSA 4PCNA 4KCUA 2XIQA 5CBJA 3BLFA 1F3TA 1QUMA 4OGZA 3C2FA 1E1FA 2YA0A 2F6UA 1HF6A 3GH5A 2PDYA 3LERA 1DWFM 2YX0A 2NQJA 1LORA 1B3WA 3UG4A 3HGSA 1FHUA 3UR2A 3N1AA 2CLPA 3HJEA 5DCDA 2FTYA 2DY3A 3UCQA 2J7BA 1UUOA 2ZFAA 2Z1SA 4CCCA 4B3LA 3EMQA 3LS9A 4A05A 4Q32A 3AIRA 3AICA 3IARA 1KV8A 3QZAA 4JQ4A 3VD9A 4L4MA 2PE4A 4NZJA 4X22A 4JIHA 2P50A 3NXLA 1OC6A 2WHKA 3NSXA 1EZWA 4Q4OA 1ZU8A 1O7AA 4L64A 2Y0FA 2ISVA 4AFYA 5DMNA 1D8WA 4CCEA 2HBVA 4PZVA 1GW1A 4MPKA 2BZNA 1H7NA 3BC9A 1UQYA 1AMYA 1RK6A 3WH6A 3RR4A 2PF8A 4IZGA 1F6YA 3GHUA 4WIWA 4MMWA 2BHUA 3CO8A 3C0SA 1TV7A 5HJXA 1IT0A 3V0TA 4ERGA 4MIMA 3TW6A 4OHQA 3VCRA 1EGMA 3TYUA 1H0GA 1IGSA 5XINA 1TVLA 3W9ZA 4HVXA 3ATYA 4Z1AA 3CEPA 4FLQA 2OLAA 4P7LA 4JIEA 3EDKA 4LYPA 1TE1A 2OZ8A 1B5TA 3WLRA 1Y8BA 2HJPA 3AHYA 4GGBA 1UR3M 1ZPTA 5AC6A 4C6QA 3UU0A 1IXOA 3WD1A 1MUWA 3T7VA 5A8QA 4H8UA 4LX4A 3FYOA 4Z2HA 4P8XA 2C19A 1GEHA 1VENA 2PODA 3N15A 2UY2A 2QHAA 4H83A 3BSMA 3KHDA 1G69A 1GJPA 4ES4A 4HNTA 4CEUC 1HJQA 3LI1A 4LYRA 1ZAJA 2A79A 5CJ5A 2INZA 5BRPA 5CGMA 1T8QA 4M6UA 4W7WA 2ZUVA 3CLWA 1RUSA 4IIDA 3M5ZA 4HPNA 1XG3A 3UGVA 4JIPA 1LL4A 2PI6A 3T07A 5I3KA 3LX9A 3SJNA 3SGUA 2DZTA 3ABXA 2OEKA 1DXIA 4ZMGA 2PBGA 4JKLA 2ZIDA 1P1MA 5AC5A 4GVIA 1B54A 4EK7A 1UQZA 7PTDA 3UXLA 3OQEA 4RKAA 4HHHA 1ITQA 3GKAA 3M0MA 5HWJA 3I3EA 4GK8A 3R8HA 4C6CA 4HK7A 2VDHA 5BU9A 3M0IA 3VINA 2OMAA 1R46A 4KEUA 5FEPA 4A8NA 2AL1A 2HQAA 3OLEA 2QJIA 1UD2A 1YQ2A 5HAOA 4M56A 1GZGA 4WXYA 3WQ4A 3T08A 1DWGM 1VRXA 4P8UA 1AH4A 4G1KA 4MJ2A 3TOYA 3V5OA 1T96A 5IM51 3WDJA 2GK1A 2XVNA 2F6KA 1VFTA 4N9EA 4C6JA 4CU7A 3AS3A 3A21A 3FLUA 1G9HA 1AD4A 3AXMA 3FW6A 4YL2A 1UKQA 1K7EA 3KP1A 1UW9A 1G7UA 4C6IA 1FVPA 4DYKA 4DO4A 3QV7A 1H7XA 1I75A 1XLEA 3VU2A 4DJDA 2PUZA 2PAJA 5A8NA 3M64A 4NASA 4MJZA 1XG4A 1E51A 3SCPA 3TSMA 4GWEA 5KZ6A 4IL0A 2QUUA 4UTIA 4UBPC 3GG0A 3G1HA 1E6RA 4O28A 3MO7A 2XWDA 3M0HA 1I1WA 3MUCA 3T40A 3LZ5A 4C7DA 2Z28A 3T8QA 1KFWA 6ENLA 4M80A 2XHYA 3GHSA 3SIMA 2CYGA 4XAPA 5JXQA 1FDJA 2FHBA 4NG3A 1LL6A 1PIFA 4MNMA 4POCA 2XWEA 4S3EA 1Y5WA 2FJKA 1OM0A 1HKIA 1TV2A 1XCFA 3PG8A 3NQDA 5CZ0A 1C91A 3PAOA 3H53A 1L0PA 4GQ0A 4JYEA 3UJRA 3IIOA 5M03A 2ZZ6A 3PTMA 1V4YA 4H6QA 3S9IA 2WB5A 1US3A 3QR0A 3AWOA 2GQ8A 1VBRA 4NZ1A 2X0YA 4WDTA 1AMKA 4JTSA 5D38A 4H7CA 3BW2A 2OZ3A 4B5WA 4RPPA 4J5NA 3WD4A 4UR7A 3AOFA 3TC3A 3DI0A 3VNYA 4HNOA 4I3GA 3VX0A 4L1GA 3TR9A 2I9UA 1OD8A 3IK4A 1GNXA 2BASA 1A5OC 2W63A 4D2JA 2OSWA 1X6UA 3S4TA 1G01A 5DELA 3Q58A 3K4WA 1V51A 1JQXA 3W83A 4FX7A 1R38A 5J8LA 3R10A 4DF2A 3CPGA 4I9MA 6A3HA 3PF3A 5DY3A 3W00A 2W67A 2WLYA 3G24A 2CLKA 1EC9A 1TTPA 1CGXA 2FJUB 3E38A 5E6ZA 2Q6ZA 5LNWA 4WJEA 3RCNA 2FB3A 2GOKA 4Y2WA 2V2HA 1HKVA 3W23A 3PAJA 1KC7A 1EQCA 1NP2A 3UZZA 3DKLA 4LXFA 1SR0A 3OW1A 2GJXB 3W2UA 1ZJBA 2ZTJA 5A2AA 1J0HA 3IJQA 2YCEA 1PDZA 1AQMA 1KXVA 3AAMA 3C8NA 2WSYA 3KRZA 1TMHA 2OKOA 2YA2A 4KETA 1ZLPA 1ZHAA 3HGJA 3XINA 4GYFA 3EYPA 3STEA 2OWXA 2VCBA 4UNIA 3TCSA 3FEQA 4GI8A 1ZRQA 3BL3A 3IRSA 1XW8A 2XIJA 3B03A 4LANA 3SGZA 1V3MA 4F0SA 4S3FA 2O9RA 1CCWB 5ECUA 3S2MA 4XBJA 1H7OA 2NQ5A 4CNPA 1OX5A 5JBFA 2WJZA 2Q3OA 4GH1A 1UMLA 2W4XA 1JYXA 4IISA 1KGWA 2YCIX 2D20A 3FK4A 3MHGA 4K8EA 2VM8A 3KBMA 4PTNA 4XUGA 5G4WA 1BLIA 4GJ1A 1OADA 4HYRA 1PZ0A 3PZ9A 4ADUA 2YXGA 3KW3A 1M1BA 1CGYA 4GE8A 3WG6A 3KCJA 4NYUA 3L4UA 3LCFA 1TTJA 4C1KA 2P88A 3BLKA 4EXQA 4HNNA 4XBSA 1TUFA 1SJCA 3WNLA 5M17A 4JQ3A 1UA3A 3GC2A 2P3EA 1SO5A 1YTDA 1ZBCA 4OUIA 4RX0A 2FHFA 2JIWA 2REQB 3D5HA 1SFLA 3ANUA 2VD8A 4LFYA 1LQ2A 3WJXA 3WLOA 1DVJA 1O1ZA 3SQSA 3NQ7A 3NYDA 5L6UA 4IMGA 5KMYA 1KWKA 5CSSA 4GNKB 4DAFA 5REQB 1Z8AA 1SMAA 1Z6KA 2EG6A 1VFLA 6TIMA 5DO8A 1R85A 1UUMA 2VGIA 4GACA 2ATSA 2ZDRA 5HULA 5DT7A 2V69A 4XZBA 5A6AA 3DAQA 2XZ9A 1Z48A 1Q66A 3UP8A 3VMOA 4FP1A 3QVQA 4JTRA 2IKJA 4HU4A 3KS6A 4K1GA 3L5MA 3WH9A 4QNEA 4S2CA 1G1YA 2Y4SA 3TV8A 4RZ6A 4CQ9A 2QJMA 4ZQOA 2C71A 1QW8A 4QJ4B 1XLDA 1JQVA 3WUGA 1E0XA 4PE8A 1VD6A 3ANYA 4HA3A 1UWUA 1HX0A 3EOLA 4G7EA 2WJFA 2F7FA 4GUIA 4N2YA 2YKKA 3WENA 4ZBCA 9RUBA 2WMIB 3R94A 1R8LA 4ROPA 2AKZA 1CXIA 4L6OA 4HMCA 1EBGA 4Z2GA 5J5RA 3P82A 5A8OA 1Q6OA 2PSNA 2YXOA 1E9LA 4KWUA 4Z2IA 4H6EA 1JZ2A 4GHRA 1Q5MA 1NY1A 4H2CA 3UBPC 1PVNA 3HV9A 3IAQA 5XIAA 3BLLA 3O05A 3ZR4A 1FH8A 1A4LA 3K8LA 7ENLA 5GNYA 1I60A 2CLLA 4KWWA 2O9TA 4IQEA 2DW7A 2IQ0A 2QUNA 4PMZA 4XD6A 2XIMA 4UTWC 1D3GA 1WAWA 1XLMA 1VFFA 1BGAA 3EX4A 3WEOA 3W74A 4FALA 1DYSA 4GCXA 3RFAA 4IX2A 1HW6A 4Z42C 5BOEA 3Q4DA 5HMDA 4DM2A 4LAKA 3HPAA 3RX4A 1EIBA 2G3NA 3ARWA 3OVGA 4G7FA 1WE5A 5CGQA 1NFPA 4AYGA 1VBHA 3CT7A 1A5MC 1YNPA 4N9DA 3TJLA 1TJRA 1KRCC 2Z1WA 4HPHA 1U5JA 2P0OA 4CNTA 2WZMA 3Q94A 4K7VA 3FYPA 2YBTA 4X2PA 3W76A 4LBSA 3LTPA 2EXOA 4P7OA 1GORA 3SN4A 3ZVIA 1FWSA 3OBAA 3HQNA 3BMWA 5CGTA 2YL8A 2ZX7A 2C0AA 3AIVA 1A80A 4GYPA 1Q63A 5K9XA 4BF7A 1R3QA 4GX9A 1E0WA 1CYGA 3CTLA 5I78A 4UOQA 5FKYA 3AYVA 2YCLB 1TCDA 3JZEA 5A94A 3GU2A 1FWCC 4FOJA 3S47A 3WF0A 2DT3A 2WVVB 4UQ9A 3DFSA 2OR2A 2YA1A 3R8RA 2DUXA 3AIWA 3MSGA 3S5NA 4E2BA 3L7RA 3GYEA 2HNEA 3UWVA 1H3GA 4M1BA 1OHLA 1S5NA 3QSTA 4XD5A 1LWIA 3Q45A 5T8GA 2XSXA 3B0XA 3UZJA 1LOQA 1TRDA 1BG4A 1YTEA 4D1JA 4CGTA 1WZMA 3LDVA 1NVMA 2WCAA 2XN0A 3CJPA 3ZVHB 3IJ8A 4PH6A 1WUEA 1RLCL 5FSEC 1E0VA 2XSAA 3SCVA 4FF7A 3B8UA 3GDMA 3WF1A 4RDZA 2VNCA 2DQWA 4O8RA 4Y9MA 1TZ9A 2NUWA 1Z69A 1JL8A 3CQIA 4MF4A 5KITA 1TPWA 3L12A 1F9CA 4WZHA 4ROQA 4RDVA 2PDFA 1R2RA 4CUCA 5GPRA 4JTGA 3ITLA 1LDCA 1YPFA 4HNLA 3VE7A 2DV0A 2XIBA 3MANA 3GW3A 1REQB 1XR2A 4FOUA 1D8CA 4OKDA 4UZSA 3TXZA 1AH3A 4H8HA 1WXZA 1EUAA 3TYAA 2GL5A 3CWOX 2X1TA 4U10A 1U33A 3L9CA 1V3LA 5A6KA 3MP3A 3E0VA 4JTCA 2GJXA 1L6YA 3TN4A 3MS8A 1RP8A 1WKFA 1O5KA 1BQGA 5H8PA 5AHLA 3SSJA 3J7HA 1UJPA 4JY8A 1RR2A 3BWWA 3TA6A 2WVTA 4O53A 3TVAA 3AMGA 1W32A 2CU0A 4EPDC 5FCZA 1ELSA 3OP2A 1SJDA 3FDGA 1S2VA 3PY2A 4DPPA 3S1VA 3XISA 2ADAA 4JDBA 2A7NA 4K2SA 4U33A 3GAKA 2ODOA 3UG5A 2P53A 3T9PA 1NARA 1DOSA 5FJOA 4ZR8A 3KWXA 3AJXA 4Q4RA 2DDXA 1GG1A 3W1LA 5HR6A 4QAWA 5EFDA 3T4WA 1R7OA 4IIHA 5EU9A 4V33A 1BSLA 2WHMA 4LNCA 3QC3A 1R9ZA 1M7XA 4GJIA 1RHCA 1QT1A 4UCFA 1E9YB 4X0VA 2A21A 4ENLA 4J27A 4GO9A 3AIEA 2EAWA 1CZ1A 1JR1A 4QITA 4OQVA 4GLEA 3S5ZA 3L67A 4YWSA 5LIKX 1E0UA 1C7TA 1GVYA 3IUDA 3U5YA 5BYWA 2OGYA 4LQ1A 1CGWA 3W1XA 2A5HA 6ALDA 1HO1A 3B9AA 4BI5A 1WO2A 1OCJA 3E49A 1B9ZA 2INFA 5I3IA 2PLMA 1YX1A 2VWSA 4RXFA 4YYCA 1WYIA 3IRDA 5C2XA 1UD8A 5BXTA 3VOIA 4B9ZA 3ZJ8A 5CQ1A 2B7OA 3M41A 3SI9A 3KLLA 3F2BA 1I2RA 1M68A 3R2GA 5B80A 3RR1A 1QMLA 1X7FA 3VD5A 4C7GA 1LTDA 1L6FA 4EX4A 4D71A 3VDBA 5REQA 3KRUA 1UC4A 4ZE4A 1MI3A 1U30A 3V7PA 3OJGA 1V6XA 4QJ1A 1JVNA 4PN2A 3LRLA 5AHNA 2PDHA 2TODA 3D0CA 4YIWA 5HNTA 3GBEA 4GUGA 1M53A 3DESA 4IG2A 1B3XA 3P60A 3W25A 4JTHA 1W9XA 2ZC8A 1MW3A 1GW9A 4PUEA 3W7PA 3LQLA 4L4OA 4WGXA 1Z7AA 2V63A 1Q4WA 4Y96A 4WR3A 4FOKA 1YXCA 1FP8A 3AYRA 1XL9A 2WANA 2QR6A 3DFQA 4MKSA 4J2PA 4AZGA 1F05A 4AZ6A 4IUOA 4W89A 3MW7A 4AD3A 3HJZA 3W7KA 1N8IA 3T42A 3DFNA 4JEJA 2CZ5A 3MCNA 5I77A 3TYZA 3EWZA 4GI9A 5CZTA 3NO5A 3SO7A 4UMAA 1HVQA 3NUKA 2WKGA 3RRXA 1HVXA 2XVPA 1TQJA 3WD3A 1B3ZA 1WDPA 2WMIA 1WKYA 4Y6GA 1FWHC 1EWEA 3ABOA 2BNJA 3B4YA 3LCLA 2RFGA 1V77A 1M5WA 2X16A 2ZXAA 2TYSA 1NDZA 4HN4A 2JBMA 2QYGA 3D3AA 1GZJA 2IS7A 1VPYA 4MFEA 4NX0A 2TMDA 1F7BA 3XIMA 1OF6A 1OGGA 3I4KA 3TWAA 1LRTA 4M6QA 3N6JA 5A6JA 5EPDA 5J04A 3MUAA 2FTWA 1FDZA 2YXXA 2PC8A 3H4GA 2PDNA 5C70A 3AZSA 1G0CA 4C6DA 3TTSA 4DJEA 4YCOA 3W02A 3IACA 2NXHA 2XUCA 4WSJA 4E2VA 1SPQA 2E25A 4B2DA 2VX4A 3DZ1A 3WQ6A 3SUUA 4Q8QA 3KS5A 3DFTA 1ZZMA 4XD4A 3E5PA 4GA8A 1DJXA 1PUDA 2Q02A 3WQOA 4Q8PA 2AMXA 1Y5VA 4JY9A 3TQVA 2C1HA 3U7BA 2W5FA 1PKYA 3MSDA 2WQPA 1C9DA 4PTVA 1XDLA 3MUXA 4O16A 3LEPA 4OE7A 4XVEA 4M29A 3BAKA 1P6CA 3LU2A 3RGTA 1YEYA 3EXRA 1IZKA 2VGGA 1QI4A 5AYXA 2A2IA 5C2GA 5BMWA 3IGHX 5K9CA 3O7UA 4K38A 4GZJA 4AVNA 4B4FA 1J12A 5E5CA 1W5QA 2RHGA 3QY7A 3MT1A 2I5QA 5D30A 2OELA 2QW5A 2I17A 3MI3A 4CQAA 3E0WA 1TG7A 2HEJA 1BYBA 1GVQA 4YN5A 1ZTVA 3G0XA 2ZA3A 3OU8A 1UPPA 3KBJA 2J75A 1JCTA 2PDLA 2C3ZA 5RUBA 3I65A 2WC7A 3MI6A 4KFNA 4NKCA 2Z29A 1KM1A 3EWCA 1YADA 3A13A 4RXGA 2PEVA 3ONCA 3UWZA 2WHJA 3UWWA 1Q6DA 4FR6A 3NVDA 2ISSA 4CD8A 1TVNA 2W3ZA 2Q01A 2QUMA 3USBA 1JCJA 3RITA 4RNHA 3KWSA 1TUXA 2HMCA 2V5BA 3BMVA 1NQKA 1JZ7A 4PMUA 5B7ZA 1MSSA 1MW2A 2VMFA 2VELA 3N4AA 3NQ6A 1J79A 3W70A 1XBZA 3AISA 4HN8A 4ADSA 3FHAA 5IDZA 4ML9A 5I3JA 1IGWA 1T41A 3U57A 4LAMA 5KTLA 4PL2A 2VZVA 4A4AA 1W9UA 4NT0A 1XINA 2XVKA 3P0WA 3OGSA 4YVXA 1FFQA 1UD3A 1PIGA 3B8IA 2DFAA 2B4GA 3ITGA 3O16A 4F0RA 1KQYA 4H9VA 2AL2B 1XQKA 1LG1A 4JCMA 1LWJA 3I10A 1FH7A 3BUVA 2D23A 4FX8A 3WMSA 2WM1A 3EOUA 4Q22A 1S5WA 4RNFA 2Y5EA 3AZRA 3VDCA 4NXSA 2QCEA 5CLTA 2EPMX 3MC5A 4MDOA 1R86A 4CD4A 1EJTC 1VHNA 3S2LA 1B57A 3NL3A 3EBVA 4N02A 3DC0A 3ME3A 1JFXA 5D32A 4D6IA 3TA9A 3MBDA 1W1ZA 1BVWA 3ZT6A 2ZE0A 1IEVA 5HNUA 1JCNA 4B5NA 1GTHA 1MXDA 3OVRA 2QGHA 1J0IA 3LCHA 5F2GA 9CGTA 4LT9A 2P76A 5GNZA 3UYIA 1YRRA 5C9ZA 3A4XA 5C9RA 1M7JA 4LRSA 1TPUA 3UF9A 4JTEA 1MVYA 1WB0A 3SSZA 1SJAA 2UBPC 2PLCA 3ZLGA 1OINA 3MZ2A 3AO0A 4DNMA 4ZO6A 3FS2A 3PPFA 2PB1A 3LBOA 2QV4A 2PMQA 3GZ3A 3EKLA 4KQNA 4CKQA 4XZLX 3I7SA 2GGGA 2D22A 1KTBA 1W3LA 1KO0A 3WO8A 4HOXA 1VLWA 3II1A 3QY6A 2ZZ7A 2WZEA 1KXQA 1QFEA 2IPFA 3TWBA 1C8XA 3MYOA 1JPDX 2L5HA 4S3KA 3S6DA 1LT7A 5CG7A 2HBXA 4X3ZA 2DH3A 4PBGA 2ICSA 4JHZA 3DH7A 3LHYA 1QAPA 5HJLA 1FWIC 2PGRA 3H70A 4MB3A 2NV9A 3H2FA 3A9IA 1A47A 1P0EA 1UZ1A 4AD4A 3OA3A 3HB9A 3RRAA 1M65A 2CBVA 4B4HA 3P2VA 5D9PA 2J6XA 3OLDA 2A3BA 2VOTA 3OZOA 4W9TA 1C8YA 2Y8UA 3OHMB 4V28A 2IQTA 4JFTA 2AQWA 4DO5A 4J3ZA 1SFJA 5AHFA 3W27A 1Q8AA 1H50A 3LOTA 4HA0A 4ZB5A 3C0LA 3W2NA 3O8AA 3OG2A 3BLOA 4PR4A 3MMWA 1XIGA 4GX8A 4ZB2A 1HNYA 3M6DA 1I8JA 1RA5A 5FD0A 3NDZA 4K36A 1UIOA 1K8CA 3O2LA 1VQTA 4YPJA 1B30A 1W8GA 4DLMA 3WNMA 2XN1A 1E0TA 5LA1A 2Y7DA 3MUZ1 1F07A 1V93A 2QVHA 5KETA 2J9ZA 3K8KA 4AF0B 5CPLA 4EF8A 4IM4A 1HO4A 3UVIA 2DZSA 1GVEA 3KP0A 1W9PA 4HCHA 3POCA 2IPWA 2PWGA 5EKYA 4LY8A 3NSMA 1JD9A 1C93A 5D33A 1VPXA 1ISYA 1ZBWA 6XIAA 3CL8A 4PCFA 3CAVA 1EJRC 3OEXA 3BAJA 3NZQA 2YJQA 3WNPA 1MDRA 4AZCB 4AXNA 3FX4A 3OBKA 4MOZA 4QQUA 1VFUA 2OYMA 3OVQA 4MDPA 1WDQA 3M0YA 5CSRA 4DWSD 1T0OA 5LIXX 1YDYA 1MEIA 5CLWA 3G1RA 1HKJA 3BGJA 4AZIA 1EEXA 3COTA 1H49A 1F6KA 1SO6A 1PS9A 2CHNA 1GOKA 4D6CA 2NT1A 4QGCA 3KRSA 1V7AA 2RUSA 3IJ7A 1S5TA 4JEQA 1GQIA 2EKCA 4Z17A 3NPXA 2PC4A 4MZ1A 3MA8A 2VGFA 2YGYA 4IFRA 4PSRA 2EPNA 4GIRA 3MHFA 1U1UA 4PTDA 1K7XA 2VEKA 2V3FA 5AYZA 2EJ1A 1ZNNA 3T0TA 4AX7A 3BZJA 7XIMA 2R1MA 3LCWA 1PBGA 4QJ5B 4Z2KA 2FB2A 3PJXA 4UTLA 1MW0A 1US0A 3GWQA 5CC7A 5HPOA 4J7RA 1M41A 5LIWX 2X2GA 3SCUA 1ML1A 3G22A 1KFBA 4GJJA 3P8IA 1XICA 4LBRA 1TPVA 5KZEA 3WFLA 2CPUA 3AROA 4XTDA 1QCWA 1OIFA 4OV4A 1PX3A 4KIEA 4IF2A 3L5LA 2ISDA 1KD0A 2ATMA 1KTNA 3W1AA 2QCFA 1W3TA 4BQ2A 2G3JA 4E3VA 1S46A 1I0BA 2FDSA 3PNUA 1XLGA 4QDWA 1TWZA 2WBKA 3WNKA 1VB9A 2IPJA 3W7CA 3H2EA 3HA1A 4S38A 5AYYA 1THFD 1KW1A 2GWNA 4DWSB 1T99A 2YDAA 1X8FA 4LWWA 4QR6A 3G6MA 3WKZA 2Z2BA 1G4SA 3GW0A 4A2RA 2VZSA 4QEHA 1VCFA 3AXIA 2Q8ZA 3HQ1A 3P0XA 3QN3A 1U83A 4MNKA 1J93A 2VUYA 5LZLA 4YWIA 2E6DA 3C56A 1WUFA 2CETA 3PBYA 1AZ1A 1VC4A 2V0TA 1JNDA 3WDQA 2YBUA 2BVTA 1WBJA 4XSLA 1LP6A 2E8ZA 5ABGA 5LGZA 4Q4MA 3VIMA 1RJPA 3KVMA 4FNQA 1L6GA 5DXXA 3WK0A 3W53A 2V2CA 2E09A 4YVPA 1DIKA 3EAUA 3RX2A 3N9RA 5BOFA 3IJDA 3DEQA 1QO2A 3OOQA 5GJNA 1OGBA 4KRUA 4GY0A 3STPA 2ZA1A 3UPMA 5FIPA 1QNVA 4O0ZA 1VCGA 3A22A 4MM1A 1XRFA 3QRHA 4CCZA 1XIBA 3CYVA 3EWUA 4KFOA 1XKJA 4JTAA 2JF6A 4XB3A 3CL6A 4RE2A 4FNTA 2GOUA 1T40A 3I6RA 3RF9A 1JNEA 1P0NA 2OU4A 3EX6A 5M3WA 1GJWA 3W6YA 1P1XA 3QPYA 4I7WA 4IXXA 1F4HA 3ITXA 2JGYA 2Z7KA 3GO2A 3GBDA 3KM8A 2Z6JA 3KVJA 1QU4A 1Q7QA 4J3WA 3VFLA 1M6JA 4REQB 1GVSA 4PMQA 3OZYA 1PHQA 4RCXA 1L9WA 2DZVA 3MWCA 3SJ3A 4PYSA 2H3BA 3RUBL 1I2PA 4G2DA 1NTHA 4HKPA 5DMLA 3A6OA 1KKOA 1NM9A 2DVXA 3A3HA 4FHAA 5TBOA 4DY1A 1E6PA 5U7SA 3FGCA 4HA1A 1C9WA 1O60A 1IEQA 2RDUA 2F38A 1CLXA 1XGDA 1YDVA 1XBYA 4NILA 1QPQA 3IGXA 3CZ8A 5K9DA 4I5RA 3VD4A 1TPC1 2NV1A 3KEHA 5AECA 1B3OA 4GYJA 3KOZA 1H4PA 4F8XA 2WWCA 4QG8A 2IMRA 3SN1A 1R9XA 2TSYA 3R79A 1ZCCA 3ZO9A 4ZQNA 1XYZA 2G5WA 3PN8A 2CZFA 4J9JA 3H2OA 1EOKA 2RGLA 4YHEA 3QLDA 1KTCA 1WOAA 1GZ1A 4BEUA 2HCVA 1GOXA 4LUSB 1W56A 4AWTA 3BOFA 4KCWA 1ECQA 4FNSA 1MNSA 5AFDA 2D0FA 2OG9A 4X0NA 1EO7A 1TYGA 2W61A 4MYXA 1WQ5A 4C1NB 2XH4A 2P10A 3QV6A 1IV8A 5HOSA 3RCMA 3REQB 2X40A 4R7WA 5EMJA 7TAAA 1JXJA 4JHMA 1TQXA 5IHSA 4GYKA 2PGEA 4UTTA 4PUKA 4HU3A 3VOFA 4QLLA 1V6VA 2VT0A 2VQTA 5C7HA 4A22A 3LPOA 4GQRA 4FIQA 3I7RA 3RIKA 3DG3A 4RV3A 2JKPA 2CLHA 4L9YA 3NL6A 1DE6A 4ZO9A 1QR7A 2PF0A 1V6UA 4I7VA 4TR9A 4JL2A 5BW6A 3VX1A 1GG0A 3GDRA 1IT7A 1ZY9A 2OT0A 1XSKA 3PZGA 1JFHA 2Z6IA 3O3RA 2KX9A 4MLJA 4AF0A 2V81A 4MWAE 3QEZA 4EAMA 3TKFA 2O9PA 3EPMA 2VEIA 3VOCA 4KFPA 3NZ1A 4AWUA 4WD0A 3CUIA 3UWUA 4M5PA 3QF0A 5FL1A 2ZVRA 1SW7A 1XRTA 3EXTA 2IXUA 4NYYA 4GBDA 5IBXC 1BPLB 1RPKA 1H11A 3ELFA 4H7VA 4XO6A 4DNHA 2PP1A 1QRQA 2BVDA 4ICMA 3KUMA 2QPXA 2ZUTA 3LHWA 1ITCA 2CBJA 1A3WA 2G8ZA 3WQVA 3PTKA 4NJKA 1TX2A 2POZA 4AZCA 3BICA 4O4WA 3MQTA 4QJ3B 3HG5A 4W86A 5BXSA 4CQDA 1RVKA 2VX5A 3S6OA 5JIPA 1QPNA 2QCDA 2VENA 1XCXA 4LPCA 4N0RA 2W27A 3FY1A 1PWMA 3ZQ9A 3B05A 2DT0A 2DW6A 4LAZA 1XP3A 4U2YA 3E02A 1K9EA 4PUDA 1UWQA 5I24A 4DO6A 1UIPA 2PCQA 5AKQA 3TEVA 1EXBA 2J7FA 2CZDA 5F2LA 3CTTA 4ZOCA 2J24A 4Z0SA 2H8XA 3S1WA 1WZAA 3AXKA 4LW7A 2EPOA 2PU1A 1OFEA 4B92A 4PEKA 4UNKA 4KGJA 2ZRUA 3WLMA 5JQ9A 3CEUA 4AVFA 3HFTA 2PLKA 5JIWA 2BP1A 3QY8A 1PB0A 1WDWA 3M7WA 3I4EA 1TPEA 3GXPA 3W1UA 5CCZA 1HUVA 3ITVA 4YHGA 1XISA 4E4FA 2NUYA 3TCEA 1ME9A 3TFCA 1NH6A 1E55A 5C55A 4OWGA 4E38A 4R9XA 3A64A 4LSBA 1H7WA 1IXNA 5C9XA 4WOQA 1H5YA 3PZOA 4E5TA 2VFFA 3P5YA 1UWRA 1PO9A 1K8YA 2VUNA 1RV8A 1LCOA 2E6AA 3CU2A 2FVMA 2WWDA 1WA3A 3BOXA 1AJ2A 3M47A 1KFCA 1ICPA 4BK9A 3AHZA 2E68A 4V2XA 2WHLA 4ACZB 3VKAA 3VUSA 5HWMA 1EEPA 3T55A 3GR7A 2WYSA 3DBPA 3L0GA 4A3RA 2OLHA 2WJEA 2WNQA 4Y9AA 4YLWA 1J2WA 2QULA 4KRTA 4NZ5A 2BY2A 3TYDA 3UESA 2I56A 2NX9A 3TW7A 4I9AA 2FMNA 4AD0A 3AMLA 4KEMA 3HM7A 5E0CA 5LNRA 2ESCA 2V5LA 2V67A 1K6WA 3M46A 3W7NA 5C9WA 1R3YA 3ARYA 5MKGB 1O95A 3NDYA 3PBGA 1OX4B 3WFAA 3AXXA 3LENA 4CLMA 4CN6A 3IUIA 5LNSA 2ANUA 3NZRA 1DORA 4Y7EA 2CZVA 3S42A 3W38A 4WCJA 3TJXA 5E9XA 2W6RA 4RL3A 3MP4A 4XAGA 3HV8A 1O5RA 3FCPA 3SIZA 5EBUA 3SUSA 4XKYA 1HQTA 4AG0A 3WBAA 1XGZA 3VAVA 2NLIA 4AHQA 1QK0A 1WDDA 2AQVA 2YBVA 1TO3A 4TTGA 1PV8A 1UP3A 4KERA 4S1FA 3W72A 2VFHA 3ARZA 2G50A 4C6EA 4ZFMA 1NWTA 4A3QA 1F5ZA 2RJGA 3BW3A 5A6SA 2HZGA 2PWFA 3BCDA 1JG9A 2J62A 4REQA 5LIYX 3ES8A 2B81A 2JKEA 1KR1A 1WP6A 3KTCA 2ZRWA 3A9BA 3TN6A 2OYLA 3L0NA 2A3LA 1S2UA 2AGKA 3NSNA 4Q6JA 1O94A 4NJHA 1IEXA 1PTGA 1EPXA 2PD9A 3A4AA 3RPTA 3CYJA 3WNOA 4O10A 1XRSA 5HINA 3AXHA 1QJWA 2P1FA 1I1XA 1C7SA 4IH3A 1ZQ5A 3HFYA 4MNLA 1IQ8A 4HMDA 4Z1YA 1ZB5A 3B97A 3IIVA 3C6CA 5CSUA 3VGHA 2E5DA 1K9FA 3G6LA 4IIEA 1Q3NA 2PTYA 3CAKA 5FI8A 1J18A 3SGGA 3W7QA 1NAL1 4W7UA 5K4ZA 1JUKA 4JX6A 4C6BA 1YBQA 3RO8A 2ZXBA 4UOJA 3QZEA 2YLAA 2PZ0A 1EDTA 1B3YA 5MF5A 4GUFA 4AHOA 1D7KA 1KXTA 1NWSA 4C1NA 1VIZA 1VPQA 3PK7A 3EDEA 2OCZA 1OWQA 4IJCA 4IMCA 1UKTA 2Y7GA 5CH9A 4KWOA 1JCLA 1X39A 4H41A 3NCOA 3ZOAA 4O15A 1J0ZA 1KFEA 4Q8MA 2ZDSA 4IIBA 3CV6A 5AYBA 2YDQA 3UCCA 2Z24A 3CQKA 3LXCA 4MWAD 2NLYA 2VD9A 2GGHA 2V5DA 1EF2A 2J13A 2O7SA 4MJMA 5FAGA 2GLKA 4UNLA 1DHKA 2FZNA 4ZOEA 1FWRA 1G4EA 3E5BA 3WLKX 3QGAC 1W3JA 1VCVA 1KBLA 3DOPA 4W85A 4MKNA 2PP0A 5D2TA 5D2VA 3T0BA 1VP5A 2WMFA 4W84A 5AY7A 3H2NA 2Y89A 5B7YA 3JU2A 4L80A 3HTWA 2G3MA 1WZKA 1UBPC 3TLQA 1J11A 2MUCA 1ONEA 2EPKX 4AUBA 4D6DA 4DELA 3P74A 4JX5A 4PMJA 3BZGA 3OTRA 1O4UA 3KTSA 1UZ4A 4R33A 2JEPA 5D04C 3ZYZA 4O4VA 5G2HA 4GG9A 4ZXLA 3S83A 3N12A 3W2LA 4LVDA 5D37A 3MMTA 4PMYA 4KW2A 3NYZA 3SY5A 4L65A 4LAOA 3JR2A 2W92A 2UY5A 1K6AA 2E6YA 4IMDA 1QOPA 4O1CA 4DWSC 4AB4A 1XF0A 5CC6A 3LV6A 3JUGA 3KVKA 4JFUA 1F3WA 4ZCWA 4PRWA 3A12A 3W1TA 3TW9A 4XZHA 5EYWA 3F1QA 4MWAB 1TA3B 1DJQA 2NQ9A 1DJIA 4G1NA 3MMDA 3CUJA 1NEYA 2WMKA 2HVMA 4UTUA 5D9OA 4QROA 4ZO8A 4TO8A 4BWLC 2A6NA 4Q7IA 2GWGA 5EFFA 1OK4A 4W4QA 3CQHA 3E2VA 2Y85A 3P81A 3MSRA 1KKRA 2PWDA 1E9ZB 3ID7A 4GISA 2HNHA 4HYWA 3CV7A 1RD6A 2E7FA 1KNWA 3LCIA 1L8NA 3AU6A 5K3VA 2VOMA 4A3UA 2C16A 4W7VA 2D69A 4AC1X 4QRNA 3ITTA 2XH0A 4FIRA 4AD2A 1PJ9A 3KDOA 5TIMA 2GVYA 5D2XA 4P8WA 3E0FA 1VF8A 4O1DA 4PMNA 3R58A 3NGFA 2BY3A 3MCMA 4HU0A 1GOQA 3ARSA 2INEA 1X1OA 1UOZA 1RCOB 4KKXA 1MRAA 2QGYA 4X63A 3FXGA 1NFBA 4TXEA 2EPHA 3TNBA 3ZJKA 2J7DA 3NQAA 2CFFA 4IJRA 1TZ7A 2ZX6A 5D2YA 5HUPA 5HR7A 3FVDA 1CWYA 3W7IA 4HD5A 4QCFA 1E6XM 1B9BA 4ZQMA 2C79A 1A5UA 4ZE5A 5ENLA 3OIHA 4H6KA 1KBBA 2E6FA 5I5RA 4UQCA 5HMFA 4B5VA 3OGRA 1PPIA 9XIMA 2EGZA 1TJ1A 5A8PA 4ZEPA 4L56A 4RNJA 4MVAA 4GOAA 3TU9A 5LHFA 2GQ9A 3IWPA 3PFRA 2POTA 3PB2A 4ZA0A 4IWWA 4TV5A 4QIUA 4C90A 3WLLA 5HBFA 3ZLHA 1UB3A 4KIRA 1WCGA 2FQIA 3O07A 1JIBA 1GOOA 2IKHA 4GFIA 4K8HA 3GX9A 4PB3A 2VR2A 4JN6A 4I7UA 2PRHA 1W9VA 3LHUA 2AAAA 3APTA 3A5FA 3NVTA 4UFIA 2DSZA 1AQFA 1H63A 2HE5A 4JL1A 3UETA 3Q37A 1E5JA 4DBEA 4PULA 4HIBA 5CBBA 2V5KA 3KL5A 2NWRA 3EZ4A 4TMBA 3P3BA 1UR2A 3CB8A 3KOXA 1V3IA 3NQMA 4JFWA 3ZFHA 4L4LA 1F6PA 4J3XA 1MFVA 4D6FA 3O63A 4ATLA 3V5FA 3V4BA 3NNTA 3F4WA 2I16A 2V9DA 5I2UA 2X1IA 1OYCA 2R14A 2CLOA 4Q7NA 2HRWA 1DTNA 2CKSA 5CBIA 1JJKA 1RJRA 3R0DA 3HURA 4X9YA 3QM3A 4IQJA 2GUYA 3GC5A 4BI6A 2YB4A 3E0IA 3VFCA 4BKNA 4UZUA 5C8BB 4D6EA 4N9CA 1RA0A 4RZ4A 3PJUA 4LUYA 1KM3A 2BFGA 2VGBA 3HPZA 1R3TA 3W7MA 4LCSA 3H23A 1UH3A 3CIWA 3MVTA 2YL6A 8A3HA 3M0KA 3NQ2A 3BV7A 2OQLA 1QHPA 3D46A 1M03A 3OO2A 4AEEA 3SRFA 4WDUA 1R3SA 2PURA 2WXDM 3AZTA 2VVSA 1GOWA 3MUIA 2TRSA 2ZRZA 3ORWA 4C91A 1D7FA 2Z26A 1IEWA 2G37A 5K4XA 3SFKA 5I23A 1BXNA 3BQ5A 4IL2A 1OG0A 2RKXA 3TMLA 4BA0A 1OC5A 4YMZA 1EO5A 3WQWA 3VIOA 4BZYA 5FEWA 1WBHA 5CPNA 4Q33A 2VZUA 3GY1A 3GD6A 2BY0A 4JFSA 1J0KA 3MV11 5H1WA 4RLIA 4JNZA 1J6OA 4BJHA 4EWJA 4NRRA 1UD5A 4IXHA 2DZPA 3VDAA 4PTWA 2C1IA 1OVDA 2ACRA 3CS2A 4OUEA 4XD3A 4WY0B 2Q09A 4AY8A 3UXIA 1UH2A 4WX2A 4BCEA 3ABRA 3L0KA 4J35A 1OT1A 4CCDA 4Q4PA 3DI1A 5PTDA 4Y9OA 1XFCA 3QFEA 3W2KA 3WH8A 1UG6A 1XIFA 1O5XA 2BVYA 4A21A 3A24A 4C6LA 1UJQA 3G1FA 3GIQA 2CNCA 3CMGA 3SDOA 1KGXA 3CH0A 4JR5A 3L21A 2C91A 1KM5A 1UPMB 1VJIA 3QQ1A 2PLJA 4XZWA 2NQHA 1YW1A 3GR8A 1GOMA 5EMLA 3SR7A 4XZNX 4HSNA 2IQDA 1FRBA 3L4TA 4JICA 4O0QA 2QS8A 2QCLA 4ATWA 4B91A 1TKKA 3KCLA 4PUNA 1FTXA 4PMOA 1XD0A 3E6EA 4B5TA 3PC0A 4IUGA 4MUPA 2FZBA 3R6IA 1ZSXA 3DHFA 3VC5A 5ECVA 1R3RA 2IW0A 3E2QA 3HG4A 4DXKA 4HOWA 4D1IA 1I4NA 2ALRA 1QHOA 3LRMA 4ZVJA 3S46A 3OYZA 1GUVA 3N2CA 1S5MA 3W86A 3ZR6A 3ARUA 1A5LC 4XG1A 1DJGA 2I9EA 4OFCA 5JUVA 2OZTA 5F7UA 3MDUA 4FPSA 1CGVA 5I00A 3U0HA 1UASA 2QIWA 3V75A 2DZWA 3LMZA 4L1WA 3DYOA 3UPWA 4B9YA 3PULA 4M8UA 4GC3A 3HPXA 1HKMA 1I2QA 3SN0A 4CD7A 1GVIA 2O4MA 1GYNA 1R30A 2Y5JA 1TJ2A 1JZ5A 4H9UA 2DZBA 3U9IA 5FJUA 1ME7A 1JDEA 1G4TA 2TAAA 1XGEA 2X0SA 1YIXA 2Y5SA 4PTXA 1DEDA 1DIOA 2ZUUA 4PUWA 4UUIA 4J3SA 1TA3A 4EF9A 1BWKA 4C6KA 1K8ZA 3RMJA 4F0HA 2YDSA 3VYLA 3AFBA 3DKJA 5IOBA 1TIMA 2QPSA 1EOMA 4NJJA 2J8GA 1XPGA 3G1VA 3O6AA 3NEHA 3E9AA 1JYNA 1TWWA 1I2OA 1DXEA 1PZ1A 3PZQA 4W8BA 1NOWA 2H6RA 1E43A 2VX6A 1RY0A 4C6PA 4RZ5A 3VXGA 4UTHA 5HATA 2VR4A 4JHOA 4R27A 3OODA 3SY1A 1YDOA 3CLMA 3EWDA 1W1VA 1OT2A 4JKKA 1SZRA 3MZNA 3G3DA 3TZFA 2GSHA 1A5BA 1VIWA 3U2EA 3QLLA 4FK9A 4ZZ9A 1SO4A 3NGJA 3MP5A 4JFVA 5C2CA 2RDWA 1QOQA 2PDKA 3ARPA 5BOOA 1U2YA 1VBJA 4QBXA 1J2BA 3UZ5A 1Q6EA 4UQBA 3MPGA 4WJ8A 1JYWA 1P0BA 4HNUA 4N42A 1DWIM 2PTWA 3QQ0A 2CERA 4OVXA 3NEVA 3G2GA 1HJVA 1CXHA 3H7VA 2UZ9A 4XAYA 3CXOA 3V0SA 2DEPA 5BCAA 2BS9A 4HNCA 4LVAA 1O68A 3EB3A 3P61A 4CQCA 1LL7A 1HP5A 2Q71A 5HK4A 3RDKA 1ODZA 4DUOA 4DF1A 1CXEA 4L1XA 1AW1A 2XG9A 2IPGA 2ZZ1A 4L9XA 5DN1A 2HPIA 4K1WA 5CSYA 4UXDA 1WV2A 2NXIA 4H19A 3W29A 3AMDA 4BEQA 1VEPA 5FL0A 4S3GA 3WNNA 1KB3A 4R5EA 4HT3A 3GDBA 4Y8FA 4JTIA 3GLCA 3UR7A 2Y63A 3N9KA 3TP4A 2WNNA 3AIUA 1XLJA 4KBXA 4ORMA 4RPQA 4L4PA 2P8BA 1VYSX 3RLUA 3BE7A 1VFSA 1MQPA 4E8GA 5DEZA 1ECEA 1V8EA 4DBDA 3U5UA 3K1GA 4HSHA 5CZJA 1TV3A 1RQHA 2Z1KA 3SCSA 2YYTA 1DJWA 3URNA 3NOYA 3PZUA 3B9DA 3IEBA 5AC4A 1JRBA 2C0HA 3AYTA 3IGSA 1XM3A 5EMKA 1NFGA 4A6GA 1H09A 3NJ3A 1JYVA 3P62A 4GH3A 2ZZ3A 3FN9A 5G1MA 1O5QA 2Z2AA 2J6VA 3BAWA 3IGUA 5LGXA 1JGIA 4NUWA 4AD1A 2AKMA 1QOXA 3LK6A 3QGKC 5FJIA 4UTWA 3LZ3A 1AODA 4U3CA 2HS8A 3A23A 3QHMA 4Z08A 2B7QA 5I02A 1EXPA 4F0KA 1BKHA 4HQVA 4MLRA 2HV5A 2H9AB 1PZ2A 1CGUA 2BWGA 1FWEC 1N7KA 1OCQA 4A29A 4EANA 4MY9A 2A4AA 1W3IA 2Z00A 1QNSA 4BF5A 1E1CB 3O0FA 3AJ7A 4LUTA 1TV8A 3P14A 3I6TA 3EDDA 1XX1A 4DBWA 5A69A 1IWAA 1TCMA 4FXRA 1SZEA 3HGRA 1P4CA 3KL3A 2QDEA 3ARQA 1UR8A 2NW0A 3ARRA 3WSUA 1FP9A 3GUWA 3GTNA 2Z2UA 1IR1A 1RLDA 5TNVA 1V0LA 3GU9A 3W6LA 5C7VA 1FCQA 2VC7A 3S3GA 3VC6A 1S2CA 2XGZA 3IIZA 4FNPA 1K4GA 3O6CA 2PGFA 1UC5A 2ZXQA 4GNJA 1OSEA 3QTPA 8XIAA 1H7RA 2QIIA 3CQJA 3RLHA 1AZ2A 3W6MA 3PWAA 4NAFB 4KWVA 4F79A 2DZAA 2ZADA 3C4UA 1P0DA 1EJWC 4NNBA 1OZQA 2VI0A 2ZX5A 3QR3A 4QDMA 3CZLA 4O8AA 5D9MA 3SCTA 3TIMA 2PDPA 2G96A 5LYRA 1A5SA 1CI1A 2EG7A 3CASA 1E71M 3CC1A 2ZE3A 3TE9A 3K46A 3WH5A 1Q65A 1QATA 3K2GA 3OZMA 3UXDA 2ZA2A 3WMBA 4MWAC 4IQDA 1IR2A 1BRLB 2CC0A 1IWPA 4HK5A 2A6LA 4AMCA 5D8ZA 3AIQA 4DO7A 1JGMA 4R7JA 1L6SA 4MGGA 1R6WA 3G1SA 4WKHA 5EL1A 4MNJA 4KRZA 2ABAA 1QNRA 3W01A 4LS2A 4DZAA 3Q67A 1HGWA 3TN3A 1K8XA 3RU6A 3BGAA 3E12A 3NM3A 2OO0A 3TN5A 3FAXA 3HOJA 2R91A 3B8VA 4QLJA 3N11A 1GTEA 1W2PA 3T2OA 3S5OA 3WX7A 7TIMA 2Y62A 4NP7A 2D3LA 2WQDA 6REQB 5AN7A 2D2JA 3AHXA 1E6SM 3W07A 1Z32X 1W5PA 2WAGA 1NSJA 4Q7BA 3GYCA 3WYZA 4ICCX 4M7TA 2ISFA 5TAOA 5C54A 3H22A 4BS0A 3ZLFA 3M0VA 3PWGA 3R5EA 1CEOA 1AVAA 5DRIA 2E1DA 3R4IA 2UWFA 2BXYA 4U3AA 2J9YA 3EDFA 3GH4A 4FAMA 4FF5A 2PA6A 3TJIA 4EIVA 1TSIA 2Z1BA 2UV8G 3KL0A 1EH9A 1KBKA 1RPXA 3EWXA 3M1ZA 1DPMA 3W73A 2CWXA 4NRSA 1A53A 2BVWA 5CEWA 3LLDA 4IMEA 1M7OA 6TAAA 3THDA 3VKBA 5IXEA 2JEQA 2TPSA 1ZFJA 1AJ0A 4BI7A 3QGVA 3DFOA 4P7QA 3ZT5A 1LUCB 2VRQA 4PRRA 1S2TA 1YMYA 2XSBA 1P6WA 1UROA 3T2QA 4ZSTA 4FS9A 2Y70A 4S3CA 2A7PA 1JCMP 1V02E 4GGHA 2YOCA 4ZTXA 3C3UA 1UCWA 3BG3A 3DXIA 3QR1A 2ZZ2A 1LWHA 2FZ9A 4WGHA 1LJYA 1PWLA 6PTDA 3G8RA 1CDGA 3Q65A 3P84A 3SQLA 2ZZ4A 4E4UA 4LC6A 4WSHA 4O13A 1F73A 4Y9PA 2FDMA 1WKEA 1DJHA 2V5JA 1YYAA 1SJBA 2R1PA 3VNMA 2WNZA 4GIAA 4H9XA 4DM1A 4AW7A 2BX7A 1EGVA 4JTJA 2ZOXA 2VWTA 3BAXA 4YTUA 2HVNA 3BGGA 3CUHA 3C86A 4C6OA 2PTZA 1LM1A 4AYSA 5DQPA 3PBVA 3V1HA 2WSRA 3O15A 3E0LA 1VJZA 2WZTA 4DN1A 2WC4A 1FWDC 3PPGA 4JN7A 1BXBA 3STGA 1GJUA 3TZNA 1XLHA 1FWNA 1HGYA 2ZZ5A 4NF7A 3TYBA 4E0CA 2XGBA 4QG9A 3B8TA 3NDOA 3H55A 4X61A 4O1EA 1CXKA 3V3WA 4QE1A 3ERPA 4US6A 1NOUA 1EJ7L 3R0UA 2FPYA 1SO3A 3SRKA 5C9UA 1D3CA 1TMLA 3RLVA 1P6BA 2QT3A 4XV0A 2C15A 3ZS4A 1JI2A 3VILA 3OB8A 2FPTA 3KHJA 1YKWA 4YNGA 2RGMA 3LM7A 4BQ5A 1C8VA 3W7OA 1UYQA 1Y65A 4IMAA 1EB3A 3THCA 5AZ1A 2CWNA 3F4DA 3GTFA 1F8IA 2HSAA 3QMTA 1HZYA 1JULA 5CG0A 3WDPP 5FEXA 3W7RA 1S2WA 1QI0A 4V15A 2B7PA 4JD4A 5I7GA 4DB7A 3PJWA 4JIRA 1ZP3A 4X2RA 1TE6A 4JX4A 2OTDA 4DRSA 1T8XA 3G1XA 1FXQA 3LA4A 2XPKA 4LF2A 5F4WA 2PWEA 3I68A 2JK2A 1BWVA 3WLNA 1GCYA 3VO0A 1HIZA 3TAOA 3W2MA 2EJAA 4M6VA 4BHYA 1XLBA 4HJWA 3H54A 4NJGA 3T4CA 2FGBA 1XYMA 1XIIA 4DJDD 3QBUA 1T6MA 1JI1A 1ZJHA 3BG9A 2C8NA 1HJUA 1XLAA 4IGMA 3PBUA 1W54A 3NIYA 4YS1A 2J74A 3K4DA 1E1CA 5E0KA 2PTXA 3RPMA 5KZDA 2Y6ZA 4S3AA 3NTYA 1QW7A 2G3FA 3CNYA 1FWBC 5HQMA 2HS6A 3KBVA 5BU6A 3G3MA 3LM3A 4D8LA 4ZQRA 4OBRA 3VNDA 3PBMA 5FJRA 3MMUA 3CIXA 3M6YA 1IEIA 1UWSA 4R85A 1MW1A 3WK2A 5BWAA 2W62A 4PODA 3LTYA 3FDKA 4XQ6A 1W9DM 1M7PA 5LA0A 4US5D 3D47A 1VFHA 3NPVA 4GQBA 3UT0A 3CAQA 2QEZA 1I9CB 3W82A 1E72M 2VR5A 1SYTA 3SRDA 1VFMA 1LLOA 4LB3A 4QXIA 2V30A 4L7ZA 4GNVA 1NIUA 2YLLA 2W66A 3PZIA 3VM5A 4QE5A 2GK1B 5FESA 1AQHA 1OFBA 1GQLA 3WF2A 5HQLA 4KS0A 3LB0A 2OX4A 4HHPA 1FA2A 1UZDA 5BZAA 2CXGA 2YFOA 3CHEA 1CT5A 4PMDA 4AU0A 3H7UA 1KLZA 3TC7A 4GBUA 5TD4A 3LBMA 1W3KA 2VO5A 2WMHA 2PDXA 3UYCA 2PDJA 3QYQA 4P7NA 4IJBA 3MY9A 2F6XA 2GSJA 3FFSA 1XLIA 2B0MA 1JPKA 3EDJA 5U4NA 3W2JA 3VCCA 3VI2A 2D3NA 3DENA 1BRLA 5GJPA 3LHTA 5F2IA 1AW5A 4A3HA 1XIMA 1IXQA 2NVCA 3MKVA 1TWSA 3N3TA 4JTTA 4MTVA 3V36A 5L9FA 4JXCA 4O1BA 2WZHA 4RE4A 5DANA 2E1WA 3AS1A 4FZIA 3PG9A 2FPVA 3T1GA 4F2UA 4MB4A 1OFPA 2NQZA 3B8WA 2X8RA 3TX9A 1UHVA 4JGDA 5JVLA 1XXXA 1Y0EA 1MZHA 1XCWA 1J96A 3FIGA 2FVLA 4A8RA 4NI8A 6REQA 1EQPA 3UY8A 2CHOA 3T0AA 2REQA 1LQAA 2Y61A 2VURA 1UD6A 5E1QA 2YYUA 4HGXA 3WLJA 1W1B1 4MSSA 1WZLA 1OBAA 4ASTA 4BR1A 1X6LA 2BLEA 4C6FA 2FHCA 3W1RA 2EO7A 5BRQA 4QM1A 3KE0A 1VGAA 2VFIA 3B8SA 3I3DA 5D4YA 1GOIA 2QMJA 1TVPA 2OB3A 2X2YA 2DIEA 4IPNB 4JKMA 2GUUA 2ON3A 3W7JA 2OX1A 2IUZA 3PBWA 3LSBA 3VD3A 5FF2A 3I7QA 4JQ1A 3RO6A 2F2HA 4IQLA 1XBXA 5K7JA 3HZ3A 2X0HA 4EKJA 3GXDA 5JH1A 1LUCA 2J7HA 3B9EA 5DFAA 5C6MA 2PRLA 1BF2A 4TX9A 5LKYA 3TOPA 1EWDA 1UD4A 3VABA 2XDFA 4XZIA 4AH7A 3O6YX 4MUZA 1LBMA 2HDJA 2NSXA 2J25A 1MEHA 3GVQA 3R13A 1NDVA 1H60A 1YTKA 2PDBA 4IIGA 3FAWA 3IVUA 3L5AA 3AALA 3ZSSA 2J9XA 4CD5A 4TOQA 3S5SA 3U4FA 1U5HA 3EKGA 3CV2A 1JUBA 5I3HA 3TONA 2JKAA 2MNRA 1V79A 1Z9AA 4I6VA 3D3FA 4MB5A 4MFDA 2WMGA 4Q8NA 4TIMA 5A8GA 1N82A 1TFVA 3L23A 3MYPA 3N18A 4MG4A 1S1RA 2YSWA 3VE9A 1XIHA 3T44A 4GZEA 3VTRA 4AX6A 2A3CA 3BAIA 3KZPA 1TWIA 2PU0A 8TIMA 2YW3A 4NJIA 3D6NA 2DZXA 1QPKA 2Y2WA 4GQQA 4J2MA 2WNWA 4LEQA 1XUUA 3I3BA 3PB0A 5KZMA 1FOBA 1XWYA 4E3TA 3ZWTA 1TTQA 4F9DA 1A5KC 3LI0A 2CLEA 3QSRA 5CJMA 3RG6A 4WY0F 2GFTA 3SQMA 3NR0A 3M0JA 1G94A 1XYFA 1FFRA 2VDGA 3F4VA 4H1ZA 5I07A 3VZYA 2BY1A 4Q8TA 3A4JA 1PXGA 2OXNA 2VC6A 1AFSA 1X7IA 5DBTA 4TX8A 1QASA 1UWIA 4C5ZA 4J40A 1W1YA 1G7VA 4IPLA 1XSIA 1A0EA 5AHIA 1ONWA 2DT2A 3LSCA 4JYFA 3T05A 3DFYA 1PKMA 1PYFA 2O56A 1QI2A 2NVDA 4EPEC 2GJPA 1V3JA 2BG5A 5FJPA 4BFAA 3IV3A 5DCEA 4Q8UA 2GDUA 3N9SA 2DIJA 4B16A 1XLFA 4LOCA 4DI9A 3W88A 3WQCA 2YFNA 1CB7B 2YCLA 2KZHA 3VD7A 1WXJA 2PFHA 1F8MA 1OF8A 2QLYA 2WVVA 1W6TA 4UFJA 1B4EA 5BMXA 3QOMA 4I6KA 5MHBA 2MANA 3FA3A 3GXNA 3DYMA 4X9SA 1G6CA 3T0CA 2EPLX 1Q6QA 3FOKA 4RW3A 3DG6A 1ZCOA