1I9IH

Native crystal structure of the recombinant monoclonal wild type anti-testosterone fab fragment
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
220
structure length
220
Chain Sequence
EVKLVESGGGLVKPGGSLKLSCAASGFTFSTYALSWVRQTADKRLEWVASIVSGGNTYYSGSVKGRFTISRDIARNILYLQMSSLRSEDTAMYYCAREYYGYVGLAYWGQGTLVTVSAAKTTPPSVYPLAPGSAAQTNSMVTLGCLVKGYFPEPVTVTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVPSSTWPSETVTCNVAHPASSTKVDKKIVPRDC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords RECOMBINANT MONOCLONAL ANTI-TESTOSTERONE FAB FRAGMENT LIGHT
publication title Structural insights into steroid hormone binding: the crystal structure of a recombinant anti-testosterone Fab fragment in free and testosterone-bound forms.
pubmed doi rcsb
source organism Mus musculus
molecule tags Immune system
total genus 41
structure length 220
sequence length 220
ec nomenclature
pdb deposition date 2001-03-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF07654 C1-set Immunoglobulin C1-set domain
H PF07686 V-set Immunoglobulin V-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1i9iH02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1i9iH01
2AKRB 5IJVB 5MEND 3HNTH 3QCUH 2PW2B 3GK8L 2XQBH 3B8YA 5AZEH 4WHCA 5KVGL 3OJVC 1EUUA 1JTPA 1MJ7H 1RIUL 1RK1B 4XZUB 2FECL 3QUZC 3S34L 1KJVB 1RUPL 4L3CA 5CS7A 1JTTA 1QO3B 4HV8B 1D9KC 5IB1B 3C5ZB 3PWPA 2ED9A 4WEUD 4DZ8B 1GZPA 3C60A 3FT3A 1QLRB 2W9DL 1T22B 1JHLH 2H45A 2CJUL 5IG7B 1YPZF 4NQCB 4LDEB 5E5UB 5I1HL 5BO1H 3O8XC 4JKPH 2EDYA 1Q9LA 3FQNA 1E6JL 2VXSL 2XXMB 2VLRA 1H9VA 1NAKL 3C6SB 3CFDA 3O6MH 4Z7VE 3VFWB 1FNSH 4CJ0A 3SDCB 5AYUH 1YEJL 1YQ2A 2BNRE 3UTPE 1CGUA 4LLMA 5CWSB 3MLUL 4HHAA 3D0VA 1ND0B 4FFVC 4I3RH 5C86A 5K59E 1KIRA 4PJDE 3WUWB 1FYTB 3MV7B 4B41A 5E8DH 4IOIB 3ARFB 3WUWG 4WCYH 3BN9C 3OG6B 1U8JB 1KG0A 2EICA 5FHBH 4MDIA 3CDYA 4X4ME 4OCMC 2WANA 2BCKB 4HIIB 5FYKD 3WS6C 3MRCA 3N06B 1U3JA 4I2XA 1EJOH 2FGWL 5IMLB 4FFZL 4V2CB 2ZPKH 1FORH 3TCLB 3IF1B 1U2CA 4OF0A 3B3IA 5JDSB 1L7IH 2FCBA 3LQAH 4UV4L 1QBMH 3VXRE 1I8IA 2J5LC 2F54D 1BGXL 2PTTB 1C7SA 2XWJB 1A64A 3KLSA 3GSNB 3PABA 5BJTB 5JLZA 2JJSA 4JPKH 3VFUA 2OL3B 3D85D 5I9QB 3KYAA 1J8KA 2K3TA 5BS0B 4MHHG 4QHMA 4G6AD 3F7VA 3RGVA 2H1PH 2DQJH 1IJ9A 2AK4B 5JW5B 3DHJA 1JGVL 5BQ7A 1GZQA 3HS0B 2A38A 1FNLA 4I3GA 3DROB 3WFEL 3FO0L 4UDTA 1QR4A 4PGDB 3ZT7A 3S5LB 4Z7UA 3CJJA 3MLYL 4N90D 1Y0LA 2VXVL 3MCLL 4AL8L 3V4VL 4WY7L 4X6DE 3UTTA 5E24E 3HPJB 1JPTH 4MNQD 3S5LG 1B0GB 7FABH 1T66D 2ZSWA 3LCYA 1U8MA 4GG6F 3VRLF 3VRIB 4K9EL 3FRPA 5FYJE 5AD0A 4L3EB 2F9BT 1S7WB 5C2UB 5E8EB 5TJWK 4ONOA 4UQ3B 5E5MA 4JO1L 1A3LH 1ES0A 3HUJA 2E5EA 3ISWA 4Q9QH 3N50A 2EDEA 4PRPB 4EDWL 4OGYL 4OF3A 4OLYL 2NR6C 1QKZH 4RMQA 3EGSA 5HGHB 3CFKA 5DMJB 4RAUB 4OZFB 3P0VH 2HN7A 5J12B 4JDZA 3SOBH 1QEWB 4WI7A 3JZ7A 4W68A 2ARJA 2FX9H 2DQHL 3SKMB 3CH1B 1FFRA 4OZFG 4L9LB 2FLBT 4L8SA 2DBLL 4KMTL 2CDGB 1BBDH 1IARB 1K6QL 1MWAL 1IGYA 5H2BA 5HGAB 4HJGA 3DRQB 4NN7C 2QQKL 4TPRL 3MJ9L 4FZ8H 4WHTA 1HEZB 2ZKHL 5FGCB 2Q6WA 2IQAB 4PTUA 1C5DB 4TSBH 5CP7A 3W0WE 1U8NA 1IGCL 1NGPH 1U95B 3MV9A 4HGMA 1G7HB 1I1YB 1E0OB 5D2LF 4C83A 1UT9A 4ZSOA 1YNTB 4IRJB 1E4XL 2FO1A 5C0BE 3GUTB 4F7CA 4G5ZL 5DJ0B 1VPOL 5DHXB 1UCBH 1PG7L 1Q94B 4EN3B 3JV0A 4I9WD 3RGHA 4BELD 3NFSH 3LHPL 1U8KB 3ARPA 5LAXA 3X12A 1I7UB 3MZTA 1BIIB 1N0XL 4GBXB 1UZ8B 3ULUL 1PQZA 1JGLH 3QA3A 5A1AA 3GMOB 3MGTA 4IDLA 5FAAA 3B2UC 2DWEB 4ODHL 4MJ6B 3RPKA 3KS0J 4WFED 5DA0B 4LQ1A 3VXOA 3X14A 4HKXA 4MX7A 2H41A 5T1LB 2V2XB 3BZDA 3H9SA 3GNML 3PF2A 1K5NB 1H5BC 5L2KB 1FO0H 5GGRA 1OF2B 1AKJB 3BAEL 3WIHH 4PRDA 5B8CA 1KB5H 3QUZD 2EC9T 4OLXH 2XNAA 1JK8A 1R3JA 4L8SC 4Y19E 2DLIA 2R0ZL 4ZS7L 1D9KD 5EC2B 4OCSH 2VZUA 1UQSB 3QI9C 3FQTA 4L8DA 4O2CB 3SGDH 2ED8A 1YPZB 3DURA 4U2ZA 2DQTH 1JPGB 3M1BA 3G5XA 1D5BA 2MQ0A 2VIRB 4CKVX 3FMGL 4LPYA 4F7TA 1KB9J 4KQ3H 4YR6B 3TIEB 1A9BA 1KJMA 4M00A 4O2FA 3HI5H 2VDPH 3VGHA 4ZPVB 2E9BA 3WFCL 4FABL 4ZPTA 2E7LA 5DD1L 4QRPD 3H7BA 3HC3L 3UCRA 5D2NE 5FECB 3RWHB 4OCWL 3DPBA 4FP8L 4XBEL 5F7WC 3HHRB 1CGSL 3OKDA 2ARJQ 5EOQL 1MI5E 4FFVD 5C2BL 3DUSB 5I1CL 1PEZA 5E08L 2GTWA 1J05A 3EIFA 1J1PH 3MR9A 3S37H 3NIGF 7CGTA 3V5KB 1JV5B 2CXKA 1IBGL 1H3PL 2FEEI 4LSRL 2EH8L 3BN9D 3QH3B 3IDJB 1G9ML 5JOFA 2IMMA 1A6AA 4D9QE 1OVZA 5CCKL 4NQXA 3CGTA 1A22B 4PS4L 2YD7A 1RJZB 1OB1B 4H5SB 5GGUA 4GXVL 4IDJH 4G8EA 1P7QD 2XZQH 4OBSA 2OJZL 5KSVB 1E6OL 2H32A 4M7JL 4KROC 5DUML 4NM4L 3UDWA 1BZ7B 1TVHB 1PJ9A 3MXVH 3QUXB 4WFHD 1NANI 4M48L 1LDPL 1N4XL 1DLFH 4OQTA 1D5MA 4PJBA 2EYSA 3GMPA 3Q1SH 5KZCB 3MJ8B 1XFPA 4IM8A 1V8HA 1G7LA 4AMKH 3IDYC 3CFEB 3M8OL 5MEQB 5CLTA 1QNZL 1M05A 2QHLA 3TT3H 2EDOA 1MLCA 3PV6A 5J9PB 4PBWD 4TNVK 4EQ2A 1T2JA 4MA3A 1OTUC 3WNLA 5K33A 2H9GA 4YDKH 1QBAA 3EO0A 1JRHL 3WFDH 4HULB 2CKBL 2JB6B 4GAYA 1NUNB 3TC9A 4GG6B 2RAMA 3MACL 4D8PB 5C7XL 1IGIH 1J12A 3QFJD 2OR9L 1S7QA 1FV1A 1HKFA 3DHMA 2EDFA 1IC5H 4G8IB 1YYML 1V3JA 2J4WL 1DVFD 5IBTH 4C58B 5CIPA 4AK1A 1MRDH 2NR6D 4BUGA 4H88H 1MY7A 3VWKB 4KTDH 3MRNA 2YHGA 1DQML 3V0VB 4L8BA 3Q0HA 5C08E 3SPVB 4PJ9A 3D85B 1FNGB 3KPRA 4R4ND 4DEPB 6FABL 5C0GB 2YKLH 1H8OA 4HLZH 1RAMA 5HHQB 5L2JB 5CLWA 4PFEA 1IL1B 1AO7A 4K2UH 3BZEB 4CW1A 4X83A 1RULL 1WC7A 3ARDA 2CUHA 4HBCL 3EYQC 5H37H 3HNVH 4GQ9H 4LRNL 4YBLC 3RWDB 3TT1H 5DQDL 4JM2C 4MNQB 3H9ZA 3VFRA 1MCLA 4NSKA 5AEAA 4HZLA 5BOZG 1YZZA 1N6UA 3HRPA 5TQ2H 1FZKB 1T7ZA 4XBPA 5IKCA 4XAWL 2Y25A 3GZKA 3CPLA 2R2HA 4MNHA 4XVJH 2H26A 1MVUA 4UQ2A 3RWIA 4HSQA 4TQEL 2C9AA 3O2DH 3QXDB 2WW8A 4BA8A 2AK1H 2CIKA 1FH5L 2ZJSH 2ADJB 3UJIH 2XZCH 4CDGC 4N5EC 5D2LB 4I77L 4W70A 5DUBA 2P8MA 4U7KA 3PJSA 5CSBA 2KL6A 4JFEA 4PJFE 1KFAL 1CBVL 1FZMA 3CDGA 3GBNH 2JIXB 3O11B 4LDLB 4M1CC 4WU5A 2BRRH 4LHUD 5GGTA 5K93A 4JFYB 2Q20A 3PWUB 1SEBA 3ZKXC 1Q9OA 4YQXH 1Y18B 2XOTA 3VXTB 5EU3B 5KOMC 3NIDF 4P46A 4LP5A 4PG2C 3F5WA 1PDKA 3QDGE 1S9XB 2BVUA 2OTUB 4UV7H 4XC3L 2HFTA 2NY0D 1QBBA 3CSGA 4RMTA 1T1WA 2P5WB 2ZCKH 1XGUB 3AB0C 3OGCB 5E95B 1CFQB 1IC4L 3IT8D 3CMOL 2ADFL 4BSVB 5KN5B 4UIMA 4HIHB 3L7EB 1MEXH 3FB7A 4J3WA 3M07A 1OW0A 4NDMA 5LGJB 3O41B 5GS1B 1DBKH 2A9MH 4DUVA 5BZWB 3IDUA 3WHE1 5GS2H 1VFAA 5ANME 4GLRH 4YX2L 5D70H 5I1GL 5F9AC 4Z7UF 3FRUB 4JJ5B 4V1DD 4MSWB 3BDXA 5T3XH 4LCCB 4RGNE 4WNQB 2BHYA 3KDMB 3TBYB 1DANU 1DSFL 2QQLL 1CYGA 1BP3B 3VFMA 4JEGB 3WIIL 3RWCA 2DKUA 4GMSH 1CFVL 1C5BL 2HWZL 5HHMD 2ZP0T 1SVCP 5SX5H 2CPCA 3KPLB 3BWUC 4ZUWA 4NQUA 3HUJF 3KLDA 3VW3H 5FCUL 3OB0H 2CLZA 3MNZB 1I8MA 4GG8B 3FN0H 3B8SA 3VXUD 4NQSA 5FGBC 3MV8A 4I4WB 4JM4H 5JMOC 3LKPA 3LVEA 5J06A 2NY7L 1J0YA 1I1CA 4LGSB 1B6DA 1MF2H 3CFCL 2WBJA 4UDUB 5E6ZA 5FDYA 5HI5D 3CD4A 1KULA 2GT9A 4QRRB 3UBXA 2XN9E 4IMKA 5AG8A 2ZCLH 4CNIA 3QUZB 4P5MA 2OTWB 3ULUC 1C12A 4HIJB 1D9KB 3NABL 3C87A 3WKML 4HDIB 3QEQE 4LKCA 3I3DA 3HI1A 2X4NB 5BV7H 1AR2A 4ONFL 2C3XA 3BKCH 2Q8BL 4ETQA 1NQBA 3FTGA 4P59H 2VC2H 3U7WH 5FO9A 3O8XB 4EOWH 3INUL 5EOTB 1OW0C 2R29L 2Q1EA 1ZE3C 1W0WA 3PDDA 3OXRA 5EU6E 2C3VB 5CD3B 3VFTA 2P24B 1X7QA 2G2RB 3O3DB 3KYOA 5ISZE 1UB5A 1LEGA 2PYEB 3RPIA 3TYGH 5ADPH 4XH2A 4V2BA 4O58H 4N0UE 4L4VD 1GJIA 1J7VR 4OF5A 4RQQB 12E8H 1FSKC 5IB5B 1N0LA 3U48A 5FOBA 2NNAA 5EZJA 5EC1B 3K74B 1TETL 3PHOA 5DEZA 3C5JA 4BQCA 2X70B 3OR6A 3TO2A 1OTUD 3ZDZE 1ZT1A 5DI8B 3WNPA 43CAB 3BKJL 4BK4A 1TJGH 2B39A 3SKOA 2V17L 3NIFE 3S35X 3MOAL 4H8WL 5E2TH 4ZS6D 2WBJC 5CILH 4QGTA 4TYUA 3QDJA 4KU1A 2Z31A 3FO1A 3PWLA 1JFQL 3ZKSD 5K9JH 1NCBL 4IMKC 2HKHH 2J5LB 4FQIH 4YBHA 4L3CB 1FRGL 3PDGA 3RAJH 1P4BH 5JORA 5E5RB 4C4KO 4C56E 1G9MC 3NCFB 1IFHH 3FT3B 2NY3D 3SKJH 3VFSA 1RUKH 3RZWA 1FN4B 1RZ8B 1Q9LB 4Y88A 4JFFD 5I1EL 4X9IA 5F1NB 4NM8L 3Q48A 4XVTH 2VLRB 1G6RL 3GFUA 3MV01 2F5AH 1RIHL 3CFDB 1YMMA 4P2OC 1ETZB 3EFDL 3QXTA 4XAKD 4JG0H 3S96A 3O3BB 3OX8A 4DOHE 5MERB 1QRNA 2GSGA 3OKMA 4JM2D 3FKUS 1T0PB 3IB4A 4Y4KA 3W2DL 5EZIH 4LLMB 3LD8B 4I5BA 4FQ1H 2VH5H 2HJKA 5AWNH 3QQ3B 3L1OL 1CFNB 1U93B 1P7KA 4RISL 3IDIB 3T1FA 4N5ED 4P2CG 1DN0B 4KC3B 3H42H 3STZB 1IKNA 1CXIA 1KG0B 4EUPH 1UJ3C 5FKAB 4A6YA 5BRZA 4M1CD 5I71B 2XA3A 1J5OH 1AJ7H 1V3MA 4I2XB 3G5VA 4OCYL 5IFHL 1QFWM 4FXLA 4P48A 5GRXG 5D7JC 4OD1L 5JIKA 1BHGA 3KPMA 4G43A 4IS6A 2DMKA 2Z31C 4LAQH 4XVSH 1W8OA 1I8IB 3PQYE 3SDYH 2C3GA 3RIAF 5CUSL 3F6IA 3PABB 3Q6FA 5GZND 2OX5A 3ULVL 1KT2B 5JLZB 2G9HA 1DBML 3P9LA 4NN7B 1QHOA 4PJBF 1F4HA 3VFUB 5F9DC 2ICEB 5F71A 1NCCH 4QHMB 3F7VB 2BY0A 4R7NA 3B5GA 2PUQT 1SY6L 2BSTA 2EIZA 4BQ8A 5BQ7B 5K9QG 1GZQB 4MXQC 1JN6B 4Z7UB 4LCUA 5DEGA 3DVFA 5MENA 1SJXA 4ZOEA 1Y0LB 1Q1JH 1MCOH 2EDLA 3UX9B 4H1LA 5EO0A 5EOCH 4ELKA 5T3ZL 3UTTB 4L1HA 5F97E 1AGBA 1GGCL 3TBVA 4D9LH 5B21A 4Y4KC 3AS2A 4HWBA 5TE4H 3AVEA 3TLRA 4X6EA 1MQKH 2R0LH 4AQ1B 2HT4C 1NKOA 3F7YA 1CU4L 5AD0B 1KEGL 1DBBL 1XIWA 1N5YL 4OLZL 4OFKA 1KPUA 1XGYH 3VH8A 4XGZA 3FRPG 4HKZB 3RU8L 3HUJB 2VQTA 4R90L 4NKIL 1IKNC 2FH8A 1QBLL 4R4BA 3DYPA 1JZ6A 1NMCC 1NCDH 3EGSB 3U4BH 2KQMA 2A6DA 3L5XL 3QAZB 1BM3H 3P4NB 2HN7B 4PJGA 4JDZB 8FABA 1YUHB 5GJSH 4R0LA 3QQNA 1CVSC 2VLJA 5I8EB 4L8SB 4ETYA 2V9QA 5GIRB 5H2BB 1ZLVK 5SX4I 2FZ3A 3RIFK 1T03L 3I3EA 4HJGB 2I60H 3QI9B 3AUVA 4MVBC 5CGMA 4WHTB 2ZUYA 5DD5H 1VHPA 1D6VL 2Q6WB 3CXHJ 3O6LL 5JW3H 5KSUA 4PJ5E 5CP7B 2Z8SA 4OZHE 4XCNA 3DUUA 3DYOA 4PTTA 1I7TA 4QOKD 2V9TA 2A2QT 1T04A 3LN4A 5KG9B 3QCUL 4C83B 4RX4D 5AZEL 3FQRA 3NCBB 1MJ7L 2IFGA 4X5XA 1EGJH 4X6BA 4Z7NE 2J6EA 3QHFL 3BRGC 1NCTA 4B7LA 2JF1A 5KS9B 2A74A 3OG4B 5I74C 3X12B 5DRZA 3GRWA 2KH2B 4XP1L 1PQZB 5BO1L 1Y6KR 3MGTB 3SKNA 4JKPL 1AGCB 1J88A 1I3VA 2FSEA 3L6FB 5E56A 5C71A 5A16B 3O81A 3ULUF 2XZAH 3UTSA 3PGDB 4HKXB 3O6ML 5HYIA 1L0XA 4MX7B 1F3RB 3MRQA 1KYOJ 3C9NB 1JPFB 3BT2L 3DWTA 5AYUL 1PW3A 5GGRB 5GRUH 3V6BR 5DWUL 4M7LH 4NQDA 5IFAH 1JK8B 4P2QB 4KROB 4Z77B 2ZG2A 1YEFH 4L8DB 1A1MA 4IHOB 4WFFD 2X4QB 2FIRT 1X5AA 3M1BB 1JBJA 5FHBL 4JKMA 3BYYA 1H0DA 1D5BB 2DQIH 2GIYA 4F7TB 1ZHNB 1CLCA 1EJOL 3LB6C 1FORL 1A9BB 1KJMB 5C0CE 4O2FB 3TBSB 4P2OD 2VZSA 4ZPTB 2DLHA 5GGSB 4Z7OE 1HZHL 4YFDB 1L7IL 3LQAL 1KF9B 1QBML 3GMNA 1TTGA 3DX6A 5LG1A 3KLHD 4QNPE 4Y1AE 3OKDB 1NLDH 5E8PA 5DJ8B 3AM8A 4U1GB 1KCRH 3L95A 5CD5C 1A7NH 1EX0A 2GK2A 2GTWB 1J05B 5DTFA 1OAZL 1P2CA 3VRJA 3UAJC 3MR9B 4JFZL 4HCRA 2B1HH 3U36A 3LPWA 2H1PL 5D1QC 1A6AB 5HHNA 4LSUH 2X1OA 1DBAH 3ALXA 4M5ZH 1P6FA 4CN4A 2NY2D 3GHBH 5D7JD 3RVUC 2O93L 2P44B 2ZCHH 1EO7A 5J56B 1RFDH 5IESH 4JB9L 7FABL 4Y4FD 2VDRL 3QXWA 2UYLA 4ZOAA 4H8WC 3KPSA 4MQTB 3QHTC 3JV6A 1NFKA 1DEDA 1D6EA 4OCRH 2UWEA 2VWEE 4FQ2H 4Y16A 4IIQA 4YBLB 3BD4A 1CFSA 1CXEA 1D5MB 4PJBB 5DJAB 1QFWI 5D5MF 4OFVA 4GS7C 3GMPB 1EHLL 4Q9QL 3DGGB 3T4AB 1T2QH 4KAQL 1G7LB 2DM2A 5HYJE 1NJ9A 5AYQA 1MLCB 4U3HA 5IQ9B 1Q9WA 2R4SH 4JQVA 4MA3B 3P0VL 3NCCB 4R4FH 5TH2A 3ZT5A 2QLVB 2H9GB 3SOBL 5C3TA 3EO0B 2DYPD 5I30H 2CRIA 4JRXE 1WSST 1EERB 4TUKH 1QSFD 3AM8C 4NO3B 4J6RH 1KTKE 3ZKXB 2ZUQC 1BBDL 3GSRA 1MFNA 3OR7A 4ZAKC 1A1OB 4BZ2L 5ERWA 4JLRA 2DLGA 1MCCA 1XF1A 2B0SH 3D69A 4FZ8L 1FFNA 5HBBA 1N6QH 2LVEA 3CVHA 5IHBA 2WWKO 4J8RB 2E3VA 2Y4SA 4M62L 4RCAA 3ZL4H 2JE8A 4TSBL 3NAAH 1NGPL 1UM4H 2EYTA 3AB0B 4RFNC 4HWUA 1VGEH 1JCKA 5D7IB 2PO6C 3TCXA 2CDEA 4L8BB 4EXPX 4ZOCA 2ZOKA 3K3QA 5IOPB 3MGOA 5E1AA 3GBML 2OZ4H 2IQ9H 4CW1B 1WC7B 3NCEB 4YFLF 1KV3A 2R15A 3GEWB 3NFSL 4Y16C 3V2AR 3MJ7A 4L8CA 1CGWA 4MVBD 2ZOLA 32C2A 3P9MA 5E00A 3CK0H 1JGLL 1CD9B 3VFRB 4HIXL 1HIMH 1OD7A 4IRZL 4H26A 3RUGE 3ULVC 3O4LD 4XBPB 1EAJA 1RJYA 4HT1H 3CPLB 2R2HB 4MNHB 1QR1A 1OAXH 1X5GA 1MVUB 2H26B 4UQ2B 3VGFA 3RWIB 4N8CL 3RVWC 1EHNA 3GSUA 5C6TL 4LCWE 4PGZA 2VUOA 3WJJA 1P7QA 2I24N 4JQVC 4NFBA 5DUBB 2P8MB 3W5NA 3RY5A 3CFBA 2A9NH 3HG1A 4JFEB 3MLVH 5DMYA 2ORBL 3WIHL 4CVWA 2VL4A 5IW3A 2CD0A 4NUGH 4LLVA 4OLXL 1A7PH 1JGEB 1SEBB 5B39A 1P6AB 5SWZD 1Q9OB 3MCKA 5HHOA 2XV6B 4NQTA 1BZ9B 3JUYA 3FFCD 4P46B 1WCBB 2YXMA 3UC0H 3F5WB 1RPQA 2DQTL 2RIKA 4WEBH 1TTFA 3GGWA 1BVZA 1T1WB 1DL7H 1NGYB 4JY5L 4NRYA 3TPUA 4JFPA 1WEJL 2NZ9C 1G9NH 4LIQH 3HI5L 2VDPL 5IWLA 1VGKA 2NY6C 4UIMB 2AXHA 2NYYD 4ZUVA 5FDWA 4I0PC 3ZHDA 3DTXA 1CR9L 2YZ1A 1HE7A 4L4TA 1WBXB 1A9EA 2BNQA 1MCNA 2JK5A 1VFAB 1K85A 2JJTA 3PIQA 1UWGH 1ZGLA 4NQCE 4FG6D 4UNVA 1U42A 5E94A 5IUSA 1S7UA 1J1PL 5KOVC 4OV5A 1CTOA 1IC1A 4U1MB 2W9LA 4X99A 3VFMB 5HI4C 2D3VA 3VMOA 3RWCB 4MCZA 5FM5O 1FSKB 2IH1A 3SE3C 3LB6D 4OB5H 4M61A 4ZO8A 4P5TA 3H0TA 4ZUWB 4NP4H 2K7PA 4IDJL 4TULH 2DQCL 2WM0A 3D3VD 1EAPA 2CLZB 1I8MB 2XZQL 5EO1A 3UTZA 4OKVA 1R3KA 1IM3B 4NQSB 3EYOA 2EC9U 3ORJA 2FHFA 3MV7E 2DQFA 3FONA 4HJ0C 1INQB 5CEZE 2FGZA 2EXWC 2P42B 3D0LA 1OTTC 1ZLUK 4KKAC 2WBJB 3UAJD 1HHHA 4PJGF 1DLFL 1G7IB 4KUZH 3RP1A 5JQHC 5D7LD 2VAAB 2GT9B 1LNUB 3UBXB 3MMEA 3OZ9H 4CNIB 3UPCA 1EFXA 2AABL 3NH7L 4P5MB 5D1QD 1WFUA 4NO2B 1C12B 3UBXG 4BZYA 5DJZA 3L5WB 3TT3L 4LKCB 4JRYA 3HI1B 4ETQB 3LZFL 5DQ9A 5D7KE 4F80A 3FTGB 1YC8A 5FO9B 4YDKL 2R8SH 2LTQC 1QZ1A 3WFDL 4LHUA 1W0WB 4J12A 3OXRB 3QEUB 2IPUK 4M6NH 1UB5B 4POZC 3K1KC 3MUHL 5BS0E 3QNYA 3RPIB 1NL0L 4XH2B 1OD9A 2AK4E 3L5JA 5IBTL 5D5MB 3SDAA 5DMGD 1KACB 2YUZA 2JB5H 4H88L 3MGAA 2NNAB 2P8PA 5EZJB 1FIEA 4QRUA 3PHOB 3C5JB 3RVXC 3OR6B 3TO2B 1JHTA 4MJID 2YKLL 2KKQA 1UWEH 1UJ3B 4L3EE 5F89A 4K2UL 4QTIL 1OQOA 3GI9H 3SKOB 4X9BA 4YDLC 3OAZK 1HCVA 1I1AA 3LQAC 4XWOC 3A6BH 2WK2A 4ZAKD 4P3WA 2VN4A 2Z31B 4LLQA 4PRPE 3ARVA 4U0RC 4CRPA 4U1LA 4KK9C 4EIGB 2NY4C 3ZE2F 4R7DA 3S35H 5TQ2L 4ENEC 5FO8A 3PWVA 3ETBF 2ATPA 4XVJL 2EDWA 4I18A 3U7AA 4ZUSA 1TQBC 2ZJSL 3UJIL 4K23H 5KVFH 2VXUH 1F5WA 1ZS8A 1FGNH 5SWSD 3VXUA 1XF2A 3GBNL 1CWVA 5DJ2A 4NRXA 3QDMB 2X10A 4W4NA 1LK3H 4U05A 4M9PA 4YQXL 1YMMB 4X7SH 4FRWA 1DTUA 3D18A 5FGCE 3O6FC 1BJMA 3S8WA 4PJAE 1QRNB 2GSGB 4PJHA 3MYZA 1X5ZA 3OKMB 1XAUA 3IDXL 3I50H 4Y4KB 4UV7L 4MA1C 1CI5A 4QT5A 3ULVD 2HJKB 4GAGH 3SBWC 2ZCKL 3I75A 3TO4D 3DXAD 4X8XA 4R26H 2YD3A 3RVWD 4HS8H 1WGOA 4YDVB 4WO4C 1PAMA 3T1FB 3G6AB 2I07A 1MEXL 2GJJA 2IADB 3EAKA 1DQDH 4A6YB 4B5EA 5BRZB 2ITCA 3EO9L 3CLFH 4HH9B 1TNNA 1NMCB 5T3ZD 5EZOH 1I1AC 4OD2A 1FO0A 3MLZL 4TVSa 4ODVH 5DFWH 5T1MA 1KB5A 3KPMB 4G43B 1UB6A 4IS6B 1CGYA 1AD0A 3I6LD 3BGFC 4L4VA 3HRZA 4HC1H 3VGAC 3NCYP 4OZGA 4AY0A 2PNDA 1NGQH 1MFEH 2AXGA 3V6ZA 5TPWH 5CSGA 5CP3H 3X13B 3Q6FB 4I18C 2UWEF 4OT1H 1HQRA 1YEGH 4WUUD 3ZSTA 4LVHC 4KZEH 4HXBH 5L2KE 1PKQA 4F37F 2NY6D 3B4NA 4U6VL 5IVOA 4I0PD 3DSFL 1F4XH 3FN0L 1XGTA 2BNRD 3SY0A 2GEEA 2CSPA 3OF6A 4R7NB 4XWGH 2BSTB 4JM4L 4NN5C 2NCMA 2COQA 3QQ9D 3E3QE 1RSFA 2CMRH 4GRLA 3L5IA 1F3DH 4LCUB 4OGAD 3EJZC 3T0EE 2BMKB 5I1KH 4H1LB 5EO0B 4ELKB 5A2LH 5HI4D 1ADQH 2ZCLL 2Q7YA 4H1LG 1M7IA 4P4KD 3Q3GB 4X6EB 5GHWH 4KZDL 2V7HB 1A1NA 4NBZB 3F7YB 1RZ7H 1U8IB 1XIWB 3ZTNH 2VOTA 4C59B 5I74B 3BKCL 4P59L 3SE4C 3QIBA 3U30C 3U7WL 4EOWL 1KB9K 3VFOA 3EHBC 3WO4C 3I9GH 1NFIA 3BP7A 5H35B 1A6ZA 1ZLWK 4RFOH 4Q0XH 3VD4A 3C8KA 4HJ0D 5ID0A 1UXWA 2EXWD 3RZCC 4OAWA 1EZVY 3MRDA 4M7KL 43C9A 4PJGB 4FQLL 3TYGL 5ADPL 1TXKA 3LRGA 1U58A 8FABB 3BWAA 4MJ4A 4O58L 3SQOH 4OCXH 2VLJB 4P9HL 12E8L 4KRPC 1REIA 5E6IA 4HIEB 5F7YC 4WWKA 3VXSA 5TF1L 1IC7H 1WT5A 4XMLL 4XVUC 3I02B 2MWCA 5C0DA 4CVXA 4NNYA 4PY7A 2D7MA 5I8CA 4QRSA 5EO9A 5KSUB 4N0FB 3U9UA 3MC0A 3V9FA 5HVGB 1WICA 2F53D 3L7FA 3D25B 3DUUB 4XCNB 3T0DA 2CH8A 4JO3H 4RMUA 5E2TL 1T04B 4POZD 4U1HA 3ZYOA 1UM5L 5ITFA 3GSQA 5CILL 1MQ8A 3FQRB 4NZTL 3RTQA 4YXLL 5K9JL 3V5HB 1T6VN 1H3WM 4X7FC 1UACL 4X5XB 1FL6B 1GPOH 4X6BB 3TH4T 5L88L 4O4YH 5CHNB 5CEYB 3RAJL 3C8DA 1P4BL 2P7TA 1F4YL 1IFHL 4JFQB 5FYKE 1RUKL 3RVXD 3QIBC 4HEPG 3QIUD 3NA9L 1NAMA 2CUMA 5D1ZA 3VGBA 5D1QB 3MYJA 5EFIA 3PP3K 2PW1A 3MNWB 3UTSB 2F5AL 3N9GH 1JWMA 1AGDA 3F12A 1G9EA 4PJIB 3ARSA 5EBGA 1QQDA 1FL3B 3GKWH 3R8BB 3I2CH 4GW4A 4JG0L 4G8GA 2F54E 4S1RH 4JZOB 1PLGH 4P3DA 3PUCA 4RRPA 4AIOA 4KK9D 5EZIL 1IGML 4NQDB 5H8DA 1R5IA 4FQ1L 1FQ9C 4ENED 2J7LA 4M1GL 3PL6A 4WWKC 3THMH 3BRDA 3FCTA 1A1MB 2C4FT 4WU7A 1DQTA 3A67L 2FWOA 4GS7B 2YRZA 2V5TA 3O2DA 1H0DB 4HGWB 5C0BD 3DVGA 1MHPH 1AJ7L 3OKKA 3VD9A 1QPPA 5CGYC 1U8HA 5EBLA 4MNQE 3CSYA 5F7DA 3QFDB 4HWZB 1OPGH 3IXAA 1Q0YL 4JZNB 4MJIB 5CBAA 1WZKA 3GMNB 1CS6A 4XVSL 4ERSH 2VE6A 3SDYL 4LKXA 1FDLH 3ARTA 2ZUQB 3ME0A 1AXTH 5D2LE 2R1YA 4PY8J 2XQYG 3BN3B 1XT5A 2DN7A 5ILTH 4PJEA 2PN5A 2VDKH 1LD9A 5T1KB 2QJDA 1NCCL 3K8LA 1V3KA 3V7MA 1RZJL 5HHNB 3GSWB 1I1FA 4M4PA 4EBQH 2Q3ZA 2XYCA 4RFNB 1YECH 3KPOA 4XMKH 2FECI 35C8H 2PO6B 2ESVA 3BH9A 1Q1JL 4HK3N 3IFNL 2BSSA 3QO0A 4RX4A 4JDVA 5HVFB 3MRFB 4GAJH 1JZ8A 2P5WE 4E41D 2EEAA 1NC4A 5TE4L 1V5JA 3QJHB 1MQKL 2RGSA 3JV6B 3E1F1 3PL6C 4OF6A 1IAMA 1Q8MA 1D6EB 2VTFA 2UWEB 1ZEAH 1F6AB 4Y16B 4IIQB 3WSQL 1CFSB 3OHXA 5L8LB 3G6JE 5KANG 1X6LA 3ROOB 4J1UB 3RY6A 1FNEB 4JGUA 5EBWA 4GW5A 1DJSA 2JJWA 4ZNEE 1NEZA 2DIJA 1NCDL 1QTYT 3BP4A 3U4BL 1GVIA 2QQQA 2WQ8A 4M3JA 1Q9WB 2EECA 3FFDB 1DE4A 1NCNA 5JXAL 4JDTH 2A73B 2ZG3A 4JHWL 5LXGH 4OIIH 1JL8A 4I9WE 2GUOB 1AC0A 3MREA 5FO7A 3S9DB 5C70A 1P84J 3IAGC 1LE9A 3JWDH 3GSRB 2BOBA 2I60L 1KN2H 3TZVA 1J8HA 5ERWB 4JLRB 1FFNB 1V3LA 2E9IA 3CVHB 4Y89A 4JQIH 1PY9A 1FJ1B 3NCYS 4JFXB 5DHYA 4Y5VC 2EYTB 4E0RA 4WUUB 3MBEA 1W0VB 1ZK9A 4JN1L 4QRRE 2CDEB 4DVBA 2AJZA 2H2PC 2L7UA 5HVWA 1A6TA 2Y5TB 3RX5A 3QR2A 2ZOKB 4H25A 5F1KC 1NMBL 3DSNA 3MGOB 5E1AB 4NCC1 4KRPD 2XFXA 1EGJL 4FFYH 3ALWA 3BYTA 3T2PA 1D5IH 4OSUL 2AJYL 1DQJB 3BHBB 2VRAA 3MJ7B 1SJVA 4PJHF 5E00B 3V0WL 3H2WA 2IAND 4KDVA 3FL7A 5AZ2H 4H26B 1KPVB 2XY2A 3RWFA 5DGRA 2R9HD 3V6FA 1RJYB 3DLQR 4DKAA 5JIIA 4KHXH 1QR1B 2PYEE 3JWOH 3E6FA 3CUPB 3MUY1 5J1TC 4ODSH 4QRPE 3GSUB 4KY1H 1QSVA 3QEHA 2WMPA 2Z8VC 2XT1B 4M6MH 5AG9A 1NLBH 3CFBB 1AGFB 4Y4FA 3QIWC 5GRUL 4G3YL 4M7LL 3RBSA 3KVQA 4QGYA 4FS0A 5IFAL 1HKLH 4AEHH 2W9EH 2XWBA 1YEFL 5HHOB 3TNMA 4YDIL 3TZVC 2BERA 5C08D 5B39G 5T1DH 1UWXK 4OI8A 3SDXA 5A2FA 3U7YL 5IEHA 3OKNA 1K8DA 3ZKMC 4U1KA 4LU5H 2O5YH 4XCFH 2DQIL 1M6OB 2XY1A 2ILLA 2KBGA 3ZDXF 1AY1H 2M2DA 1QD0A 4LLAA 3RWEA 1F11A 4LNVA 4LSPH 4Y8DC 3HC0A 3MBEC 1LE5A 1CL7L 4JCMA 4OLUH 3ZYIA 1NANH 3UJTL 3OKLA 1H15B 3DTXB 1V7NH 4L4TB 1NBVH 2LTQB 1JYWA 4FQCH 1GOFA 1QSFA 4KJPD 5HDBE 1NLDL 2UZYB 2BNQB 2JK5B 3X3GH 4CL7A 2BDNH 3PIQB 5DMIH 5K9OB 1ZGLB 1A7NL 3EOTH 5KVEL 1GC1H 4HUUA 3DOSA 1S7UB 2ERJC 2J8UF 2FX8H 4X99B 3MRJB 2VLRE 3EOBB 5IBLC 1MAMH 1I3GH 2IALB 3BEVA 4LASL 4LSUL 2L7JA 2R2BB 4X6FA 4M5ZL 1E4XI 4NQVA 5I17B 4M61B 4P5TB 3ECBA 4XX1G 1GCFA 5DF0A 3GHBL 3JTSA 2YUWA 4JREC 5ECJE 2ZCHL 4YHLH 5IESL 3UTZB 4OKVB 3T2QA 3QFJE 3EYOB 5JOPD 5B38B 3T0XA 2YPLD 3DV6B 1BREA 1F58H 1ACZA 3GMQA 3PGFH 4OCRL 5C0NC 1VADB 4X0KA 4LPVA 5B38G 1HHHB 3ZKQD 1B0RA 1JPSL 4U0RB 3H9HA 5FYLH 5JXEA 1BQLH 2NY4B 3MMEB 4G80A 2BFVH 1VACA 5AUMB 1I9JH 2K1MA 4P9MH 2XXCB 3NIDE 3QUYD 1MPAH 2FEDC 3FO9A 5DJZB 5KSAA 1TQBB 4JRYB 3STBA 3RL2B 3MROA 3U4EB 2QR0A 4RGND 5DQ9B 2R4SL 3ES6A 4NQED 3RJDA 2VL5A 5DJDA 1FG9C 1DFBH 1I8LC 2A6IA 5JUEL 1JGDB 4J3XA 5SWZA 1HHIA 4KXZI 2Y9RT 3EOAA 3R0NA 4NC1C 1Z5LB 2X89A 1TIUA 3O6FB 3L3IA 2B0SL 1EEQA 2D7TL 2HFFA 2YC1A 3DO3A 1N6QL 5TGBA 3LKNB 3T65A 4MA1B 3SDAB 4Z7UE 1RIVH 3NAAL 3NACL 1UM4L 5EN2A 5E9DA 1JUFA 3UTTE 4XXDB 2P8PB 2X5PA 4F58L 1FAKT 4NOFA 1SBSH 3RVTC 4QRUB 1XCTB 4WO4B 2BVQA 4WW1B 4KK8C 5DZNA 2XN9D 1JZ3A 5F89B 5CZXD 1S7RB 1T3FA 4LBEA 5TDPA 2OZ4L 2IQ9L 1RZIB 1I1AB 3STLA 2BSRA 2NW3B 4G6KH 4P4RA 4TUJA 4HUVA 5ITBH 1WUNT 2IEPA 3FB8A 4PLOB 1G1YA 3HB3C 4U1LB 4XPFH 1HIML 2AJXH 3UMTA 1IM9D 2IAMC 5FO8B 2VABA 4HT1L 4F2MA 2ATPB 2YUXA 5EU6D 1S7SB 4DGIL 2ICCA 1OAXL 4I18B 5EA0H 5DFVD 5EDXA 5ISZD 4LVHB 2RB8A 5EIVA 5KSAC 1HILA 2OJEA 2H2PD 5ELIA 5BVJA 1XF2B 1SYSA 4NHCL 3RHWF 1QP1A 4HXAH 3MLVL 3GSXA 5J11C 1TTUA 5DJ2B 1KC5H 5GS3A 4NUGL 4Z76B 4NN5B 1A7PL 3V95A 4JFDA 4LNRA 5IIEA 4D9RE 1A47A 5D7LA 4PJHB 3UC0L 4R96A 4POUB 5HHME 4OM0H 2EE6A 1UKTA 2IGFH 4WEBL 4F9PA 5CMAA 4AZ8A 5JPMA 4QT5B 5EU4A 1P1ZA 3P11H 1C8PA 1X44A 1DL7L 3ABZA 2GJ6A 1HHKB 3IRPX 1MCFA 1R5VB 2R0WH 5DXWA 1JRHI 3FN3A 1G9NL 4LIQL 3NGBC 3VD5A 3CXHK 1M7DB 4PJEF 1LQSR 5F7LB 2I07B 2E9JA 3WO4B 2Q3AA 3QIWD 3HCVB 2DTMH 2EC8A 2Y36H 1FPTL 1Q0XL 1E4KC 5KS9E 3GKZA 3L3JA 2NLJA 2ITCB 3TVMC 5EIIB 1UWGL 4JJHA 1FZOA 1O5DT 1OGTA 4Q9CA 1FO0B 2I5YL 1MLBB 2VJXA 3RZCB 5T1MB 1KB5B 3VGDA 1AD0B 2G5RA 2Y07H 4QCIB 3HRZB 3SCMA 3HMXA 4KRPB 2D2OA 3BKML 5T5NF 4LCIH 2H32H 1BVLA 4OZIF 1CLYH 3QCVH 4OCLC 4JZJC 4OB5L 1HQRB 2FB4H 4M1DL 2VLKB 3GI8L 4PIRF 5GS0L 4NP4L 2FJGB 2IANB 3RDTC 4LOUC 4P2QE 4XT1C 1XGTB 3SY0B 4F9LC 2EDNA 4KQ4L 3N0PB 3T3PE 1HOCA 4MB4A 1TZGH 1CICA 1KYOK 1XR9A 1YY9C 4GRLB 4DN3H 2X4SA 4WDIA 2HKFH 3UROR 4FHBD 3MLXH 2J8UB 1DUYB 4G9FA 4M6OH 4F9PC 1IGTA 1IAIL 1NUFA 2IH3B 3OZ9L 2Q7YB 2C1OA 1M7IB 2DDQL 1A1NB 2WINA 3D87B 4ZD3H 5J57B 4RIRA 3FQUA 3VFNA 2H2SC 5DURB 3VMPA 1SJEA 1EFQA 2AXFA 5F96L 4NOBA 1F8TH 3QIBB 2Q8AL 5J1AB 2DD8H 4PRIA 1T1ZA 2R8SL 3HZYA 3EOYG 5BVPL 3PQYD 5CIPH 2E7MA 1A6ZB 4C54A 1LO5A 1MJUL 2ICWB 1FHGA 3PDOA 4MCYA 2W60A 5ID0B 5DVNA 4M6NL 4OAWB 4I0KA 2GFBB 4ZUTB 2NPLX 43C9B 5L6YH 1U58B 3BWAB 1I4FA 2BVOB 2LAGB 3VFPB 2RBLA 4JO4H 3SCMC 4K8RH 4P2RA 4ZFZA 4QTHA 4WWKB 3VXSB 3TO4A 2FEDD 4GKSB 3S36X 3KWWA 1MCPH 3WXWH 4MD4A 3HNSH 4PGBB 1U3HA 4JFFE 2AEQH 2ATKA 3KNBA 5C0DB 5J0BA 1PSKL 1CZ8H 2HT3C 4NNYB 4PY7B 3U9UB 1BAFL 5FK9A 5LQBH 3L7FB 5IROC 1CICC 1W72H 3GI9L 5FGSA 4U1NA 1F3JB 3B9KD 1UJTA 2ICWJ 3IU3A 1CCZA 1DDHA 3A6BL 4U1HB 5BOPA 2FBJH 3GSQB 4TSCH 3O2VH 3RTQB 1WLHA 2Z9TA 3QQ4B 3S35L 2YPLB 3MO1A 1S8DA 2WIMA 3FOMA 4DZBA 4MGXA 4UT6H 5CJXC 3U46A 4Z7VA 3DIFA 1UGNA 4GH7B 5SWQB 5I0DA 2ID5A 4K23L 4XNYH 3T0AA 5KVFL 4OJFL 1KCUL 5D1ZB 5I1LA 4XP5H 4OM1H 3IDMA 5EFIB 4PJDA 2PW1B 1LK3L 2VXTH 3F12B 4PRHA 4X7SL 4G8GB 3CLEH 3AFLA 1E27B 1WVZA 2OZ4A 1YEDA 4PG9A 4HLZG 3HB3D 4X4MA 3I50L 3UPAA 1OOAA 1R5IB 4P4KA 5D7IE 1CFTA 3VXQA 2X9XA 4NGHL 3PL6B 1I9IH 1RU9L 1S9VA 4UIKH 4RRPG 2E8ZA 3E6HA 3WXVH 2Z91B 4R26L 3VXMD 3FCTB 4HS8L 3N85H 4M7ZB 3PWJA 3CFJA 5HYFA 4WU7B 1HWGB 2AERT 5FCSH 1NC2D 4WHYH 2YPVH 4Y2DD 1IZKA 3VXRA 3OAUH 5CJOH 1QHPA 2NY1C 1FAIL 3CLFL 2X4TA 4HFWA 5DS8A 5I2IA 2AJ3B 1J0IA 1RJLB 4HF5H 4JFOA 5LCVH 3CSYB 2OCFD 3KG5A 3IXAB 4FQQB 3TH3T 1WBYA 5F6HJ 1B0WA 5FV2A 5CBAB 4QHKI 4F33B 3KR3H 4LKXB 1T21A 1NGQL 1MFEL 3EYFB 3ZDYF 3ZO0A 2R1YB 1YEGL 2HP4A 4WTZA 1AXSA 4KKBC 4KZEL 1FNHA 4HXBL 2AXJA 3P2TA 4PJEB 4X6DA 4ZXBA 5CFHA 4G6FB 4YHZH 2X9YA 4Z0XA 1NBYA 1R3LB 5FDWB 1F4XL 1IEAB 4XWGL 4PY8I 4Y5VB 2APWA 1U41A 3KGRA 2P47B 1RD6A 3TVMD 3K80A 3VFGH 1KTRL 1VB9A 2CMRL 4G6MH 4S0TD 1MJJB 2ESVB 3BH9B 3MQIA 5HGDA 5SX4H 3TP4A 5I1KL 2B1AH 2BSSB 1R3IH 2VUYA 2YXFA 4JDVB 4LPXA 4BSWA 3ULUE 1Z0NA 4H0HB 1JNNH 5IK3A 3LIZH 1WJ3A 3HR5A 5C6PB 4LARH 5KVMC 3P4OA 4U6XB 2DBJA 1GAFH 4K55A 1RZ7L 4OZIB 1G7QA 4HW6A 4RMWA 3SDCC 1NGZA 1Z3GL 5C0CD 3ZTNL 4TRPH 1F97A 4H20H 1XGQB 4PJ8D 4MXWH 5FV1L 5T5NG 5HHPA 2R2EA 3BPLC 3RDTD 4LOUD 2K7QA 2HG5B 3I9GL 3DRTB 4YHKH 3MUJA 1T89C 5KW9L 4GW5B 3QZWA 4RFOL 1KJ2H 4Q0XL 1RUAH 3ARFC 4LSDA 4QF1A 4OUUA 4XNUL 2EEBA 1NCAL 1KTLA 2X4PA 3U6RA 1F2QA 1DE4B 1NEZG 2YA0A 3PXJA 1R3HB 2EH7L 3QIWB 3SDDD 2VDNH 4JPIA 4OCXL 1QSZA 1FVCA 3MREB 5FO7B 3W0WA 4HKBB 2Y06H 3ARGD 1OTSC 5IJKA 4E42B 3ARBD 1IC7L 3TZVB 3B2VH 4RBPK 5E99H 5FA3B 1NCUA 3KS0H 3BSZH 2Y7QB 4GT7A 3V7AE 5C0BA 1G9NC 3EJYC 5F9WC 5BV7B 4JY6B 2WSKA 3FQWA 3EYVA 4E0RB 4U6HB 4UT7H 1SVZA 3MBEB 4JO3L 4WI6A 1HXMB 3DBXA 2AJZB 3GSVA 4XPBH 5D1XD 5HVHC 3QUMA 4H25B 1BX2B 2NQCA 5C0JA 3SEPA 2XFXB 4O4YL 4B0MM 4WFFE 1OWWA 4K07A 4YUEH 5DJXA 5L9DL 3BISA 2ERJB 1A8JH 1RZFH 1ZT7B 4BQ6A 2IC2A 2DRUA 4Z7WF 2HT3D 4OGXH 4KI5C 3RWFB 3V6FB 4MA8H 4Y19A 2X6MA 2B8OT 3N9GL 3QEHB 5D5ME 1L4IA 4JREB 3I2CL 4CU7A 1PLGL 4JQXA 1TENA 1B88A 1G7PB 2X05A 5BMFH 4IOFD 3C6LA 1P69B 3TYFB 2CKNA 4PJXA 15C8H 3THML 2XWBB 1BFSA 5F3HA 4RNRB 4BFGA 4TTDC 2V5MA 1Z6JT 4HUXB 2DIBA 5IVXF 3OKNB 1K8DB 4GMTH 4U1KB 3M17A 5I6XC 5GQBA 1MI5A 2FIKB 3VD7A 3RWEB 3OXSA 1F11B 4O51A 1XF3A 3HC0B 1LE5B 3NN8A 1KCSL 3RWGB 2QADC 3MRGA 1OPGL 4M7LT 1LO4L 3OKLB 1WIUA 4D0DA 1QFWH 2VN7A 4ZYKA 5D4QA 1BD2D 5IMOA 4LRIA 4NBXB 1AXTL 2W07A 1OCWL 3C8HA 4Y5YA 4HUUB 2NTSP 2L0DA 1NBQA 5ILTL 2A6JB 5I73C 3S37X 1SM3H 3P4MB 2EDXA 4MJ5B 3QDME 1KGCD 5DR5L 5KVDH 4EN3C 2HAZA 1KIUA 4MAYA 1CLOH 4HWBH 2B4CH 2NY1D 5GGRY 1YEKL 4X6FB 1YECL 1IZJA 4GBXC 3PP3H 4K94H 4XMKL 1QRNE 3ECBB 4EUPB 4ZTOL 4HWNA 3BH8A 4GAJL 4M4RA 3C6LC 1HH9A 3QPQC 3UTQA 5HHXH 1SBBA 5T5FL 3Q5YA 3GMQB 2HVKB 4FMFA 1B4JH 2Z8WC 1ZEAL 4X0KB 4CMMB 4HC1A 4J4PA 1F6FB 2C4FU 4KKBD 4BQ9A 5ACZA 1B0RB 4Z6AT 3BP6A 4LMQI 3BW9A 3H9HB 2D0HA 4NRZA 5T33H 1C08A 1IQWH 3WE6B 1VACB 2IAMB 2DLTA 2GITA 4ODUA 4XP6H 3RNQA 3U0WH 3C5ZD 3OAYH 3OQ3B 2XG4A 5FFLA 1JF1B 4K3JH 3FO9B 5C9KA 2X4UB 5KSAB 1HK6A 3MROB 2QR0B 1GRWA 1X5KA 4CU6A 1X4YA 3X3FH 3DMMA 4JDTL 3ES6B 4OLVH 5LXGL 2VL5B 5J11B 4Y5XA 1N64H 5DJDB 2APVA 5FYKH 2A6IB 3VU2A 3QP3A 2BVYA 5IB4A 1U8LB 1HHIB 1A2YA 4GOSA 1DCLA 2J2ZA 3SDCD 5D72L 1A6WL 1ADQA 3G5YA 2G60H 1A3RL 4OLEA 1KN2L 3EOAB 1T1XB 4KKLC 4HUMB 4PREB 3L3IB 3O4LE 1T5XA 2YC1B 1YJDH 4W81A 3O4OC 4YEFA 3RKDC 4JQIL 4MAYC 1FYTD 3JVGC 3MV7D 5DT1H 1F90H 5E9DB 3ZHKA 4JY4A 3ARFD 3NGBB 1MREL 3FB5A 4FTVA 1MCWW 3VG0H 3GRWH 3PHQA 3D39D 2BVQB 4QHNB 4ALAH 1FCGA 1S5IH 1YMHA 2GW5A 3MSPA 1GHFL 3JV5A 1VKXA 1QLFB 5F8RC 5H94A 1T3FB 4LBEB 4PJDF 5TDPB 3TVMB 3FFCE 1VEOA 4DW2L 3WLWC 4FQXC 1KJ3L 4HS6A 4I3SL 3STLB 2BSRB 1J18A 5DK2A 4J4PC 4MQXD 4P4RB 2EDBA 4TUJB 3D48R 4YHNA 2A77H 3T4YA 1LO3H 3FB8B 3OKYA 4PJFA 4XB8A 4UUJB 5AZ2L 3EJYD 5ENWB 5SV4A 5I76A 1EUTA 1YYLH 4KHXL 3K8MA 4X4YA 4Z78A 3JWOL 4JZJB 2F8OA 1QFOA 2VITB 1PX3A 4PJGE 5MEOB 4ODSL 3HR6A 4J7RA 1HILB 4KY1L 4L3AA 1J1OH 1TCMA 3IGAB 5HDQH 5BS0D 4P23A 4Z8FH 2VLJE 4M6ML 3RDTB 8CGTA 3OWEA 2AK4D 5BVJB 4A2LA 3QDGA 1SYSB 1MIEH 3A6CH 5D9SB 3GSXB 1PD6A 3ILQC 4I0CC 4AEHL 4JFDB 3KPTA 2VLMD 3W9DB 4LNRB 1KSRA 4HJJH 4GKOA 3TJHC 1EH9A 1I1RA 5T1DL 2AEPH 4P57A 3B6SB 2AP2A 2I27N 5JTWA 3RFZC 4Z7WB 1ED3A 4LU5L 1HSBB 1I85C 2NXZC 5CMAB 2O5YL 5JPMB 1NDGB 1AY1L 4FQHB 4HPYH 5GS0D 1GGIL 4LSPL 4X4ZA 4OLUL 4QWWC 4X6DF 1IT9H 5JA9A 3PNWA 1I9RH 2VQ1B 4HCRH 4O9HH 1NBVL 3FZUC 3VWKC 1BOYA 3L3JB 3BMWA 3X3GL 5IW1A 1SYVA 2BDNL 5DMIL 2A1WH 3G04B 3EOTL 1GC1L 4N68A 4TTDD 3QBTB 1T7VA 4RFEA 5IVXB 4PJ7E 2FX8L 1GOGA 3NBNA 2F58H 3UTSE 3SCMB 1R0AL 4PJIE 1MAML 4AJ0A 1EXUA 1BVLB 5LWYH 4DJMA 3KXFA 2V7NA 3VD3A 1KPRB 4XPTH 1M7XA 2VZVA 4P23C 3BQUA 1E4WH 3CVIL 1X5HA 4YHLL 2XN9A 4FQJH 4KI5F 3EZ8A 1WQVT 5J6GB 3GMRB 2EZ0C 4Y2OA 1FNAA 1F58L 4QLRA 3ZLQC 1CICB 3PGFL 5I19H 1XR9B 1OHQA 3WLBA 5I8KH 3CX5J 2X4SB 1M1SA 5IVNA 1WWAX 3QEQA 2Z4QA 1JNHA 5GSVB 3OJDB 3O9WA 1L0QA 4YHOL 5FYLL 5MEPB 1RY7B 1UWXH 4G8FA 4BFIA 1MRCH 1ZVYA 2BFVL 4KKCC 4EN3D 2C1OB 5EORH 1N8ZB 1I9JL 4D94A 5EU6A 1P9MA 2WINB 4P9ML 1A6PA 4BH8B 5CBEB 4RIRB 2FR4A 1ZSDA 1MPAL 3ARXA 5JHDA 4GBXD 1OSZA 3VFNB 3O3AA 4MJIE 2RFXA 4LDOB 1G7MB 1OM3H 5D6DA 1LP9E 1J1XH 4LGPB 1ACYH 3W81A 4WUKL 4N0UA 4PRIB 1T1ZB 1M71B 2OMNA 3CVHH 4KMQA 4NWUL 4E5XA 3QPQD 5E4EC 2Z92A 1B6UA 1DFBL 1I7RA 2R0KL 5JW4R 3PDOB 5T1LD 4K7FA 2NMSA 3W11C 4LSTH 3TBTA 1PZUB 1JMXA 3AREA 4YAQA 3PV7A 2QV2A 1AKJD 3NZHH 3HMWL 4MB5A 3WN5C 1I4FB 4HK0A 2XKNA 3P9WB 1VFOA 4P2RB 5DYOA 4ZFZB 1BD2B 1VEPA 4QTHB 5E70A 3VDAA 5LGHH 1CD1A 5SWSE 2PXYC 3QNZA 1U3HB 3BRFA 1L7TH 4OF7A 3BQUC 1MCHA 1OP3K 1U6AH 3KNBB 2P8LA 1AQDB 3TA3A 1ZHBB 3S36H 2NY1B 5FK9B 4HEME 3VA2C 4GRWH 4EI5A 4C56A 1KIQA 1ZA3A 2HJFB 4APQC 4KKLD 5ITBL 3ULVE 4NNXB 1AI1H 3V4PH 4XPFL 3SJVB 4DTGH 2J88H 5E2VH 2XQYK 2AJXL 3DXAE 3RKDD 4PJXF 1S8DB 3FOMB 4AEEA 5ICYA 4DZBB 1S78C 4YPJA 1OLZA 1EPFA 2GSIA 3NMEA 2FATL 3U46B 3VCLA 2DKMA 1LDSA 2W38A 3N1MC 1S7TA 4MNGB 4AH2A 4OFYD 4Z5RB 2SEBA 2CDFA 1ODAA 3WJLA 5T3ZE 4NT6B 1TMCB 4YC2B 4HXAL 5I1LB 1KC5L 1AQKH 4NNPH 4PJDB 1KCVL 3KPQB 3WLWD 4PRHB 5EUOF 3V6OC 3I6LE 3V8OA 1CGTA 3JV4A 4WGWB 5GGVH 2OQJA 5E4IA 4OFIA 2UZXB 5FKPA 1S9YA 1FVEA 1P84K 1YEDB 4PG9B 4BKLA 1NCWH 4PRAA 4OM0L 4AG4H 5IV2A 1MCSA 4WUUE 1KNOA 3QG7H 3MRRA 3IAPA 3QUXD 3VXQB 2OI9B 1DEEA 1CQYA 1Z9SA 3E6HB 2R0WL 1CDYA 4QXWA 2ADGA 2UUDK 3PWJB 3TBWA 5KZCD 4JE4B 2XRAH 3BPLB 4PGCA 1PKOA 1JGUH 2G75A 3VXRB 3TA3C 2DTML 1Q38A 1NUGA 3FT4B 4JPWH 4XP9H 3TV3H 1A5FH 2NX5A 2X4TB 4HFWB 5DS8B 4EI5C 5ALBL 4O02H 1UH3A 4M8QA 3REVA 3MRKA 3D39B 3TJHD 3MLSH 2V5RA 4LQFH 2FHCA 2Y07L 2AEIT 3JWDC 3P73A 4XNXL 4PGEA 2NXZD 2YN3A 1T21B 4LCIL 4K7PH 3QCVL 3LKSA 2VDOH 2FB4L 1AXSB 3QCTH 3W9EB 4LK4A 4XCEA 1T5WB 1MCRA 1PX4A 4X6DB 4ZXBB 3H6JA 4OQTL 2ZNXA 1NBYB 3U79A 1MOEA 4WTZG 5IVZA 1T83A 5DO2C 2EDDA 5CINH 2HFGH 1RUMH 3VWKD 5F9WB 3C60C 5C3LD 2E27H 5FUOH 3HAEH 3QEGL 5I1DA 5DJ6B 5FUCC 1K4DA 2HKFL 3VXPA 4DN3L 3KYNA 5FM8A 5HGDB 5HVHB 2OR8A 3IETA 4IRSA 3MLXL 5D8JH 1MFBH 1NPUA 4M6OL 5DD3L 1OAYH 4BSWB 4ZTPH 4D0BA 1U2HA 5EZLA 1PEWA 3P4OB 1OWRM 1LK2A 3BP5A 1S9WA 3QJFA 3TFKC 2XZZA 1NGZB 4LMQE 4DVRH 5C0RL 4GXUM 3FJTA 4L4TE 3VG9B 4D2NA 5HPMA 3LD8C 5HHPB 5JO5A 1F8TL 1MAJA 3D2UA 5I1IH 2BNQE 2DD8L 2F53E 3JWOC 5ESQA 3P40A 4P49A 5HYSA 2IMNA 5FM5M 3QZWB 1CLZL 3H3KA 4X5WA 2EZ0D 4WHDA 5JIHA 1MFAL 2P5EB 5IFJA 4OUOA 3E8UL 3EDKA 4QF1B 1FC2D 3VMNA 1KTLB 2X4PB 2QKIA 3QZWG 3U6RB 2JIXD 5I71C 5L6YL 4JR9H 1XH3B 2ZWLT 4JPIB 3IFPA 1A6VH 1FVCB 1J87A 1OAKH 3P0YH 4KKCD 5DJCB 4K8RL 4PJ5A 3IKKA 4X8JA 2V2TA 2HLFC 4OZHA 3O6KH 5DJYA 4P3CL 3MJ6A 3UP1A 5C07A 3HPLA 2DLEA 2GY7B 2CLVA 2F74A 1HYSC 4PJFF 1NC2A 4LSVL 1QFUH 5JW4N 2P5WD 5E8OA 5I6XB 3OGOE 2JJSC 3L3KA 1DUZA 3EYVB 4LLUA 1F2XK 1TJHL 3W11D 4YDJA 5EBMA 4FXKB 1FZJA 3DBXB 2QADB 1K4CA 3R1GL 4PUBH 3GSVB 3VXNA 4WV1A 2FBJL 3RGVC 5J4MA 3O2VL 3RI5F 4IRSC 2BOCB 1P4LA 1QRKA 2AJSH 3BVNB 3SGJA 1GC1C 5HI3D 5C0JB 5GGTL 4OZ4A 4UT6L 3RVVD 4JHBA 1K8IA 3AMKA 5A40E 5I73B 3GMLB 5EWIL 4XNYL 5C8JB 4UTAH 3HE7A 3QXAB 4UOW1 3VI3E 1V7MH 1EVTC 3MA9H 3T77A 4YWGH 4XP5L 2JELH 3MBXH 4OM1L 4U6YA 4Y19B 3SE9H 2IFFL 5DMKA 4R2GB 5GJTH 2FYYA 4JN2A 3GIVA 4FZEH 2JCCF 3VI4F 4APQD 3CLEL 4FQPA 4KRLB 5M95B 2M26A 3BPOC 2BP3A 5F7FA 3C6LB 3BE1L 2DMBA 1WIPA 4PJXB 1MJ8L 3K46A 4F57H 5DHVH 3IJYA 3QAZC 1I9IL 4KVCL 4R6UA 4EJ1C 4UIKL 1D5ZB 5C0AB 5KVGH 5F3HB 3RA7L 4PJ8A 1RIUH 2H8PA 1BEYH 4QRRD 4UT9H 3PGCA 4XBGB 1BFVH 4QYOB 2J8HA 1Z9LA 3PWNA 4HMDA 3NCMA 2YPVL 3M17B 5IB3B 2DLFH 4Y1AA 3OAUL 3UPRA 2MHAA 1YNLH 1MI5B 2EIBA 3OXSB 1WV7T 1XF3B 5C0EB 5EUOB 3NN8B 3O45A 2BNUA 3O8XD 4HF5L 3K2UH 2UVEA 3MRGB 4FFWC 4E41E 4WV1C 4TUOA 4P5KA 1E6JH 2BSED 2DOCA 2QSQA 3SDDA 4D0DB 3AU1A 4O2EA 2IBZX 5IHUH 2V2WA 3KR3L 3L3DA 2PYED 5IMOB 3ZYZA 1NBZB 3LQZA 3PXHA 1HHGB 3MLUH 4YHZL 3QXVA 3UXFA 1LEKB 2C1PB 3O4OB 3QNXB 4MAYB 4NC2B 2OR7A 4NUJA 4YO0A 4DUWA 3B83A 3ILPA 4CADA 2FJFB 4YHPA 5IF0A 3VFGL 4G6ML 1BWWA 4LF3A 4DAGH 5FUZH 2B1AL 1R3IL 3B9EA 3BH8B 4F7PA 2EDKA 4M5YL 1EEUA 3UTQB 2EIEA 1JNNL 3BEWB 3LIZL 4Y4HA 4LLDA 5IW6A 4FQXB 5HYJA 1XCQA 2XPGA 4R9HA 4UV4H 3VJ6B 4YK4C 4TRPL 4H20L 3I6KA 4MXWL 1YA5A 5ACZB 3ZDZF 5B8CC 3MRMA 4HLJA 3AAZA 3BP6B 4CMHC 1I8KA 1HQ4B 4KUCF 1IGFL 4CDHA 4JRXA 2AV7A 5DO2D 3NPSC 4L29A 2GITB 4ODUB 4D3CL 3RNQB 1KLUA 3PWPD 3C60D 3NIFF 4PR5A 1RUAL 1JI1A 1U8PA 1RQ5A 2VISA 2E6JA 3EDJA 4XCYA 3DMMB 4JAMB 1TJIH 1JGVH 2VLRD 1C16A 2VDNL 4Y5XB 5JQ6L 3IJSA 3KYMB 3KHQA 2VLKE 2YD9A 4AL8H 2E7LC 4WY7H 2E6QA 5F70A 5GRVL 1JNJA 2IANE 2YRPA 5E99L 1CXKA 4U1GC 1UZ6E 3IXTA 4K9EH 3RJQB 2NXZB 2MCG1 1F45A 4YXHH 4U1JB 3JBG7 2QQNH 2GTZA 1KLGA 1JVKA 4UT7L 1A4KB 5F93C 2O61A 5GZOC 2PKDA 2J8UE 2C7UB 3FB5B 4FTVB 4GSDH 2APTA 3PHQB 4XPBL 2APBA 5ID1A 4OLYH 1YEIL 4KHTH 4AT6A 1YMHB 3CMGA 1VKXB 3RUGA 5I15H 5IGXH 2VXQL 1NAMH 5H94B 4MD5A 2HLFD 2DL9A 4HS6B 1F3DJ 3HE6A 5F9JA 4YUEL 4LCWA 4KK6C 3T4YB 2DQHH 1RZFL 1HYSD 1OGAB 1WBZA 3GHEL 3UDWC 1MWAH 4U1SA 4OGXL 4CVUA 4MA8L 5I76B 3V0AC 4WI8A 4ODBD 4X4YB 4Z78B 3MXWH 4S2SA 1E28B 5DC4B 1YEEH 1BQHA 2ZKHH 1EJ6A 2OBGA 4PB9H 4AIZA 3MFFB 3EJJX 4O5LH 4P23B 3RGVD 4Q2ZB 1W72A 5DLML 3QDGB 1IGCH 3AS0A 3K0WA 2YD5A 3TESA 4XB7A 2AKRA 4A6YL 15C8L 2PETA 4MDJA 1MUJB 1GGUA 3UTTD 1E4XH 1RURH 3UYOD 2IF7A 3GJFK 2DKSA 3DJ9A 3F7QA 1PG7H 4OV6F 1ED3B 2LQRA 1AE6H 5IB1A 3LS4H 5KJRH 3C5ZA 3T8XB 1JNLL 3TNNA 1N0XH 1U3YA 2OSLA 3UZVB 2WUCL 4NQCA 4GXUN 3NFPA 4LSSH 1YEHH 4ZO6A 2MMXA 1N6VA 4ZUUB 1OSPH 3HZMB 5JOPE 2DQDL 2JCCB 4ODHH 3B2UD 3PNWB 2YPLE 4Z7QF 1OAUH 1H3TA 1T2XA 3DX9B 4F15C 5TE7H 1QFWL 5E4EB 2HJLB 4NO0B 3VFWA 5IW1B 1BZQK 2CR3A 4PJ9C 4LVNC 1INEH 4ELMA 1XMWA 4XRCA 1BJ8A 5F1OB 2CUIA 4K8RC 4DFHA 3WN5B 5DUPL 5KVDL 3MRBA 3ARDC 3WEXA 3DECA 4HWBL 1CDUA 1EXUB 5TDNB 2HTKC 3QI9D 2EKSA 1PY4A 2W65B 3KXFB 2PXYB 3U0TB 3IRZA 1TZIB 4KXZH 4NQEE 4FFWD 4XNMB 4D9RD 2BCKA 3BQUB 1OP5H 3FMGH 3MLRH 3LS5L 1ZTXH 2DAVA 4YFEA 4HZAA 4ZDHA 3FAXA 3IF1A 3WLBB 5CAYB 4CU8A 3REWA 2NY5L 5FM4A 4ODXB 4PB0H 4APQB 4JHAL 1CGSH 3CC5A 3AY4A 2PTTA 5GGVY 2XWJA 3GSNA 4G8FB 5T33L 2WIIA 1UA6L 5I1CH 1OLLA 5BJTA 4XP6L 4J3TA 2FO4A 4P46C 5DC0A 1ZSDB 5JHDB 1OSZB 2OL3A 1H3PH 4PP1C 1X5XA 1QVOA 5CZKA 1KXQE 3X3FL 4WENB 4PS4H 3DROA 3K4DA 1N64L 3S5LA 1MH5A 1TZHA 2B7DT 2R23B 1I7RB 4GXVH 2R56H 1EEZA 4PJEE 3HPJA 3AREB 3MLTA 4P2QD 3VRIA 5DUMH 4KROD 4HK0B 2I9LA 1CL7I 2XKNB 4L3EA 1IAIM 5GSRB 4HGKC 5DYOB 4M48H 1CDIA 4EIZC 1EMTH 2ESVE 1F90L 2J6EL 3R8QA 2YMXH 1WCQA 4ZG1A 3BZ4A 3VG0L 3GRWL 1KJ2A 4PRPA 3F8UB 3D1MC 4ALAL 2KDGA 5T3XE 2P8LB 3K81A 1S5IL 1BECA 1DP0A 3M8OH 4TVPL 3TA3B 5F6IC 4OZIE 1JWSA 4OZFA 4EI5B 4C56B 4DK6A 3IFLH 4LEXL 5C09B 1ZMYA 3BZFA 1HNFA 4LFHG 2A77L 2CKBH 3AY4C 2VSCA 3CH1A 3SKMA 4L9LA 3MACH 5C7XH 3LN9A 2CDGA 5HGAA 5ICYB 3NPZB 3DRQA 1YYLL 2GSIB 3UYPA 4YXKH 3H3PH 1HEZA 5GZOD 3QWOA 1DLHA 5HDQL 1S7TB 4Z7OF 4AH2B 4PPTA 2SEBB 4PJAA 3S88H 2CDFB 2QHRH 4BYHA 1C5DA 1A7QH 1PYWA 4OTXL 3LV3A 3T2NL 3SE8H 1MIEL 1QACA 3PWPB 1GZPB 3C60B 1G7HA 4XPHL 1MAKA 6FABH 2FRGP 4IRJA 3JV4B 4HJJL 1IKFL 3FQNB 1FVEB 2AI0H 2AEPL 2CRZA 4BKLB 4PRAB 5IV2B 1Q94A 3EYQD 3MRRB 1CK0L 1KEMH 4HPYL 1IE5A 4LRNH 1I7UA 1A7OH 1DEEB 1NUDA 2FH6A 4NKOA 1JF6A 2DWEA 4HHAB 3D0VB 2F5BH 1H3XA 4Q9RH 1I9RL 2P43B 5SX5K 1KIRB 4HCRL 4YBQC 2MTPA 5T1LA 3OB0K 2NX5B 2A1WL 3HTLX 5L2KA 1KFAH 4MDIB 1AKJA 3MRKB 3MRCB 3DI2B 1QSEA 4M43L 2BY1A 2DICA 1J9CT 3UEZA 5D7SL 1UQSA 5LWYL 4O2CA 3B3IB 3LKSB 3T0EA 1JPGA 1P5UA 2XACC 4XCEB 4XPTL 2DIAA 4CGTA 3IYLW 2VIRA 2MOVA 1E4WL 2HA1A 4GFTB 1ZV5A 4QO1A 3TIEA 5B4MC 3FAWA 1MHCA 5D93C 5I8KL 5I1DB 3G5ZA 4LCYA 1K4DB 3TN0A 3JUZA 2DJUA 3VGEA 3RWHA 4MZ2A 3RGVB 3IETB 1EBAA 4IRSB 1AO7D 5CKGA 1WZ1H 3VWJA 4YX2H 2HFEA 3BFOA 3RQ3A 5I1GH 4UDTB 3ARDD 4D0BB 5EORL 5EZLB 4WTXA 5IR1A 1LK2B 3BP5B 1S9WB 1DSFH 3V5KA 3MRLA 4UB0H 3BKYH 3P4LA 3IDJA 5HPMB 3J7HA 2ZSWB 1J0JA 3IS1X 1U8MB 4NKDA 1CFVH 4HUWA 5JO5B 3D2UB 4QXGH 3SN6N 5HYSB 3CVHL 1OP9A 1OB1A 4H5SA 1GGYA 1C5CH 4X5WB 3T04D 3QXUA 2E7CA 4NC1E 5E5MB 1ES0B 5FCUH 5HYSG 2QKIB 4JFED 4FXGA 3NZHL 1I3RA 2EYRA 1ZWIA 3BPOB 3RUGF 1BZ7A 3IFPB 2B2XH 4MHHI 3QUXA 4X8JB 3CFKB 5DJYB 2CQVA 4P46D 1W2KT 5C07B 3DVIA 5FYJU 3HPLB 2VDQH 1RV6X 2CLVB 2ARJB 1L7TL 1HI6A 4DGVL 1KXTB 3CFEA 3GMMA 3ULUD 1IGYB 5E8OB 1FLRL 1EO8H 3S36L 3ZDYE 2VB5A 3L3KB 4ONFH 1DUZB 4KFZC 4BSJA 4N1HB 4YDJB 3TN0C 2XA8H 1FZJB 1K4CB 1TPXC 4PTUB 3VXNB 1MHHA 4WV1B 2WP3T 3LPFA 1LGVA 1AI1L 1U8NB 3VWJC 1P4LB 4DTGL 2J88L 2P45B 3HZVA 4NCC2 3MV9B 3VXME 4OZ4B 2I25N 3HNTL 3BGAA 4ZSOB 2XQBL 1EDQA 1K8IB 4TNWK 1UEMA 3VDBA 2F54A 3FQXA 2B4CC 4F7CB 5F1SA 3HE7B 1U36A 1KENH 3CFIC 2XTJC 4LGRB 4K94C 4WEMB 1XIWC 3LDBC 1AQKL 5LAXB 4U6YB 3V0VA 2HLAA 1JHLL 3SPVA 5DMKB 3G9VA 3D85A 1FNGA 2Z0BA 3QA3B 1IAII 2FYYB 4JN2B 3GIVB 5L0QC 3GM0A 5GGVL 5HHQA 5L2JA 3BKJH 2ZUVA 3MV8D 5F7MC 1IL1A 4CVZA 1YC7A 1KN4H 3BZEA 4X9HA 3VXOB 2NY5C 3X14B 3QG7L 4XMPH 2CLRA 3IJYB 4ODTH 2WBJD 1FNSL 3H9SB 4OLWH 5TFSH 4ELMF 1U0QA 4MNQA 4YK4B 2H8PB 1NCBH 4R0LC 4PRDB 5B8CB 3LMJH 2XRAL 1FZKA 4MLSA 2XNAB 4NPYA 4CMHB 1R3JB 4I3RL 3PWNB 1JGUL 5DD6A 3NPSB 4Y1AB 2MHAB 4XP9L 3HMXH 3TV3L 4GAFB 5I16A 1A5FL 3FQTB 3OV6A 4X6CE 5E8DL 4MXVF 1FVDA 2DWDA 1XF5A 4WCYL 3DURB 3WNKA 3JSSA 2JIXA 3G5XB 2D03H 5I1EH 3F62A 3MLSL 4NM8H 4LQFL 1ORQA 1G6RH 5CJQH 4NHUA 1T4KA 4O2EB 2ZPKL 1Y18A 1NFDA 2V2WB 4N9GA 1ZAGA 2AJUH 2YRLA 3VA6A 3LQZB 2VDOL 1YJDC 3H7BB 1KOAA 1PFCA 1ZXQA 2Q87A 2OTUA 2I26N 2KZ1B 1AC6A 2P5WA 1XGUA 3L1OH 3OGCA 5CINL 4JFDE 2HFGL 4YBQD 4NUJB 4YO0B 3EDFA 2E27L 4RISH 4JPKL 4CADB 1OT2A 4YHPB 5IF0B 1BF2A 2VNCA 4LF3B 3LSOA 4G6AC 4Z7WE 5JOFB 5LGJA 5DZOA 1TVBA 3G6JA 4LPWA 5BZWA 2DQJL 5D8JL 4F7PB 4HBQA 1GH7A 4NQXB 4OCYH 4WIQA 3WCYA 5IFHH 2P46B 4ZTPL 1UEYA 3FRUA 4JJ5A 5GGUB 4MSWA 4Y4HB 3CDFA 4G8EB 4OD1H 4ZNEA 3TBYA 4LCCA 3KDMA 5HYJB 3IU4H 1XCQB 2XPGB 1JPTL 2Z31D 3BIKA 4DVRL 1P53A 3I6KB 3AAZB 2H32B 4JRXB 2IG2H 4PJCE 1R6VA 3T0BA 1KLUB 1S9KC 3ULVH 3OPZH 4PR5B 1B3JA 1U8PB 1A3LL 4O00A 2WZPD 3I6GA 5IVXE 2EYSB 4GG8A 2VISB 1MIMH 4XCYB 2X1WL 3QDMD 1C16B 1QKZL 3IS0X 4JR9L 1M05B 4MXQD 4NYLA 5HTSA 1A6VL 1OAKL 3P0YL 1YMMD 4OD3H 3PV6B 4RSVA 4X7TA 2ICES 5T3ZH 1QRND 4Y4KD 2ADIA 3QUZA 2FX9L 4U33A 4GAYB 1JIBA 5M94B 4IMLA 1F6LL 4U3XA 4FA8A 2HT4D 1S7QB 1D9KA 1DBBH 1FV1B 4UNUA 1N5YH 4Y7MA 2GTZB 3QDAA 1KLGB 3RU8H 2O61B 2WAHA 4R90H 4NKIH 4U6TA 3IAQA 3CSBA 1WITA 5CIPB 5EOTA 4PUBL 1QBLH 4PJAF 5ID1B 5BRZD 2DQEH 4F15B 2C3VA 5CD3A 1H3UA 3CX5K 3RUGB 2G2RA 3MODH 3MRNB 1UM6H 4MD5B 4EXKA 2EDQA 2PYEA 3RY4A 1FP5A 4PJ9B 3UYRH 3DUHA 3KPRB 4LVNB 3HE6B 4QRPA 5F9JB 4Z95H 4LCWB 4CAGA 3G6DH 4RQQA 1AO7B 4LHJB 3VGGA 4EZMA 4UTAL 4Q7DA 1V7ML 4ORZC 1UCBL 1WBZB 2RR3A 3ARDB 5HYQA 4YWGL 1SMOA 1T03H 2X42A 4IIQC 3SE9L 1JZ7A 3FOLA 1VERA 1J0HA 1BQHB 3FHQA 5DI8A 4NSKB 4HMCA 4FZEL 4HZLB 2FL5A 4MJ2A 3U4AA 3WS6A 5IKCB 2Q86A 1W72B 1BD2E 1BQHG 2IBBA 2W59A 1CF8H 1S5HA 3KHOA 2CIKB 3J8F7 4MDJB 4F57L 4LLWA 3C09C 1LWRA 3PJSB 1KGCE 1FO0L 4PYHA 1BEYL 1FZMB 3CDGB 4UT9L 1BFVL 5J3HC 4WU5B 1KB5L 2VDMH 3SGKA 4X7DC 2R2CA 2DS4A 2GYSA 1BF8A 1OAQH 3QHFH 2XTJD 2DLFL 1XIWD 4JO2H 1H3GA 4OCSL 1YNLL 4G9DA 4DQOH 4ZO9A 3TNNB 4NFCA 2OSLB 4XP1H 3ARZA 1BPVA 3F7PC 1FN4A 3NFPB 1RZ8A 2QSVA 3K2UL 3SJVE 5F1NA 3I84A 5IHUL 4KQ3L 1ETZA 4J3OC 2XWTA 4UBDC 3HZKA 1MRFH 3O3BA 5CGTA 3WIFA 3ZE0E 4MNGE 2NXYB 3FB7B 3BT2H 5FYJH 5MERA 4ELMB 2IJ0C 5IB2A 3QPXH 4XRCB 5DWUH 4NDMB 2IPUG 1S7XA 2VLJD 2AQ3A 3QQ3A 3QFJA 3MRBB 3A0OA 3Q5TA 4MS8C 3WEXB 4PRHE 1CFNA 2NZIA 1U93A 1GOHA 3S37L 2EKSB 1DVFA 3IDIA 1DN0A 3STZA 2R4RH 2GAZA 4X7EC 4D0CA 4DAGL 5FKAA 5FUZL 3HFMH 4WHYG 5F6IB 3ELAT 4W4OA 4ZDHB 3WJJC 2HH0H 3EFFA 1SMAA 1HZHH 3REWB 2X1PA 1I9EA 5EU7E 1ZHKA 1MCJA 2E9WA 3MV8B 3CC5B 1FYTE 3SGKC 1NGWA 3LKPB 2JJVA 4U7MA 2WIIB 5EPMA 2HRPH 2BRQA 5CD5D 3MXVL 3AXLA 1OAZH 2OS7A 1KT2A 2FO4B 3MCG1 3D39E 4JFZH 4UAOB 2ICEA 4TVPD 3Q1SL 1QVOB 5JMRA 1WZMA 4N0RA 2MPAH 5F9OH 1X6NA 4AMKL 1TJIL 3HAEA 4N8VA 3UTSD 1JN6A 3TWCH 1MH5B 1TZHB 5IWLC 1CTNA 4S1SH 3RVUD 1EEZB 2MQCA 4JB9H 2VDRH 1FIGH 4UILH 1JWUA 1TVDA 4LIQE 3MLTB 4NQDD 1HDMA 3WFHA 2J1KA 1TDQA 2JJTC 1JYNA 1IGIL 3VFTB 2I9LB 1X7QB 3QUMH 4YXHL 1NDMA 3UZEA 3KYOB 5I1AA 2QQNL 1LEGB 1IC5L 1VSCA 1T1YA 1DVFC 3LN5A 4HKZA 4AEIH 5E1HB 1JF5A 2GQHA 4NCDA 1EHLH 3L3HA 4DN4H 4HPOH 4GSDL 1MRDL 3BZ4B 3RKPA 4KAQH 1KJ2B 2CK0H 4FMKA 4HUKB 4Z0BH 4KHTL 4OIAA 2EDHA 2VLME 5I15L 5IGXL 4KTDL 5FOBB 3BDYH 1NAML 3QUKA 4P5TC 4W4OC 4GUPA 1JWSB 1AP2A 3P4NA 4R4NC 3WL9A 1ZT1B 1H5BA 1YUHA 5I66A 3BZFB 3ARRA 1UXSA 4KI5E 4OI7A 5I8EA 1VEMA 2YK1H 5DRXA 2P5EE 3S7GA 5DQJA 5GIRA 2BXYA 4HKJA 4V1DA 1FE8H 3HNVL 4GQ9L 4TTGA 4BZ2H 1OT1A 3QI9A 5B3JF 3MXWL 3TT1L 3QDJB 3FO1B 3JXAA 3PWLB 1YEEL 4HQQH 4NZJA 5T1KD 3QWOB 4PB9L 4GRMA 5ALCH 1DLHB 4O5LL 1SQ2N 3GIZH 3NA4A 2CO6B 4M62H 4PJAB 3TEUA 1PYWB 4HMEA 3LV3B 2DJ4A 2WLZA 3CZJA 3K8KA 5JORB 3O2DL 2AK1L 2PO6D 5KG9A 2XZCL 3VFSB 5D93B 1F4AA 1RURL 4R97C 1ZKAA 4U4BA 4WVRA 3GBMH 2BRRL 2QSTA 1TFHA 3KPSD 1O7VA 1NFDF 3BX7C 1AE6L 3LS4L 5KS9A 2QL1A 3K4AA 5KJRL 4Y16D 3S96B 4LEOA 3OX8B 3P30H 5BXFA 4HWEH 4LSSL 1CDHA 1YEHL 3RWJA 4NKOB 4HIXH 4Q9BA 1OSPL 4IRZH 1AGCA 2Y23A 3BPCA 2NY0C 3L6FA 4I5BB 4WFGD 3SDAC 5A16A 1OAUL 2FHBA 4HG4J 5E2UH 1MSPA 2CO7B 5TE7L 1WAAA 3PGDA 4ZFOA 4N8CH 3S4SA 5C6TH 1P7KB 3JTTA 3C9NA 1JPFA 1INEL 2BHUA 3G6JF 2ORBH 1DBKL 2A9ML 5J3HD 5A3IC 5CEXA 5DHVA 4P2QA 4Z77A 3G5VB 5D70L 1QSEB 1MY5A 3B5TA 5T3XL 4IHOA 1EZVX 4JVPA 2X4QA 3T0EB 1GGTA 4KDWA 1FGVH 1UH2A 4GMSL 4PJXE 3MLRL 1ORSA 1ZHNA 4JY5H 1ZTXL 5F7HA 5C0AE 1WEJH 2NZ9D 1MHCB 3TBSA 2G9HB 3P9LB 4UBDD 1CN4A 3VW3L 4M8VA 3G5ZB 1CR9H 4LCYB 5GGSA 3TN0B 3LH2H 1J0KA 3BMVA 1TPXB 5TQ0H 3T0VA 4PB0L 4RDQF 5DRWA 3GJFH 2EIZB 5DJ8A 2RQ8A 3VWJB 1SHMA 2HFEB 4LAJH 1F4WH 3I3BA 5DEGB 1YPZE 4MS8D 5MENB 5EUOE 1MF2L 5IR1B 5HI5C 5F7EH 1YN7A 5JIPA 1MELA 3MRLB 3ZE1F 1AGBB 4RGOH 3TBVB 4CBPA 3TJEH 1YNKH 5M7QA 4MZ3A 4HUWB 4NKDB 4YZFF 5DZLA 2XTJB 3ROLA 4DK3A 2XG5A 2Y72A 1FG2A 3LDBB 1URLA 3T08A 5BV7L 2DQCH 1KPUB 3VH8B 4XGZB 2R56L 2O5ZH 3LEXA 2VC2L 3HG1D 5L0QB 5ACMA 1KCLA 4FXGB 4JFFA 1C1EH 3VH8G 1EBPA 1I3RB 1BWMA 2EYRB 4R4BB 1ZWIB 3ZSSA 5F3BA 5HHOD 1OTTD 2OM5A 4KKAD 2A6DB 1EMTL 1FL5A 2ZUWA 5K9QI 1N3NA 5DJAA 4JM2A 2YMXL 3D5OF 3DGGA 4R0LB 3T4AA 3V8CA 2Z35A 2AABH 3NH7H 1HI6B 2IBZY 3GMMB 2FZ3B 3NVQA 5ETUA 1BVKA 2CRYA 5IQ9A 3LZFH 5E8NA 3IFLL 2LAAA 4L4TD 2OXGA 1MHHB 4LPCA 4GRWF 4N8PA 2BNQD 1TJGL 3UZQA 4NO3A 4LP4A 4PTTB 5IQ7H 3HZVB 4GRLC 4JCLA 1I7TB 4ZS6C 3LN4B 1A1OA 2ZZUT 1NL0H 5HSFA 4PG2A 3GJEA 4YXKL 1HXYA 3H3PL 3LKQA 1WWBX 2HKHL 4J8RA 2F54B 3FQXB 4FQIL 3S88L 2QHRL 5D6CA 1A7QL 3OB8A 1QLEH 3SE8L 3PP4H 5HDBF 3E0GA 2BVTA 2A74B 1HYRC 5D7IA 2NY3C 4NJAH 4P5TD 5DRZB 3SKJL 2HLAB 3N1QC 4GG6E 3SKNB 2AGJH 3VRLE 2BC4A 3W39A 1T6WA 2FSEB 5IOPA 4CVZB 2MCPH 2AI0L 2IBGA 4QTIH 4XVTL 5JR1H 1AFVH 2R1WA 4N0YH 4IJ3C 4CJ1A 4QKXB 3B43A 1KEML 2CLRB 2K9UA 4FTVE 4S11A 4XWOD 1U8QA 4Y8AA 1A7OL 3MRQB 2BHZA 1MWAA 2NY4D 2D4FA 3F65A 2VH5L 4NPYB 2F5BL 1EFXD 1OY3B 4JANA 4Q9RL 4TSAH 5AWNL 5DD6B 5E6IC 5HJ3A 3MJ9A 5FB8A 3GO1H 1WT5C 2WV3A 5I16B 4JRYD 1FVDB 2DWDB 4YPGA 1UADC 1XF5B 4RGMC 3H42L 1OGAE 5FGBA 1T7YA 5FA4A 5LVEA 1J5OL 3QRGH 1ORQB 1VCAA 1JGEA 4NHUB 2R39A 1T4KB 4YIQA 1Z9OA 1NFDB 4N9GB 2BVEA 2DQUH 3MOBH 5BZDA 1BZ9A 4J2XA 1BJ1H 1WCBA 2QSCH 3O6FD 4K9EC 4LAQL 3RTQC 3IDXH 3DX6B 2G5BA 4H0IA 3RNKA 3VFVA 5E8PB 3SDAD 2EXYC 1NGYA 3L95B 5GZNC 5DTFB 1D5XA 1P2CB 3VRJB 4AIXA 4X4XA 3JWNC 3Q2CA 1HH6A 4WO4D 3LSOB 3U36B 2X7LA 2YEZA