1I9IH

Native crystal structure of the recombinant monoclonal wild type anti-testosterone fab fragment
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
220
structure length
220
Chain Sequence
b'EVKLVESGGGLVKPGGSLKLSCAASGFTFSTYALSWVRQTADKRLEWVASIVSGGNTYYSGSVKGRFTISRDIARNILYLQMSSLRSEDTAMYYCAREYYGYVGLAYWGQGTLVTVSAAKTTPPSVYPLAPGSAAQTNSMVTLGCLVKGYFPEPVTVTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVPSSTWPSETVTCNVAHPASSTKVDKKIVPRDC'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords RECOMBINANT MONOCLONAL ANTI-TESTOSTERONE FAB FRAGMENT LIGHT
publication title Structural insights into steroid hormone binding: the crystal structure of a recombinant anti-testosterone Fab fragment in free and testosterone-bound forms.
pubmed doi rcsb
source organism Mus musculus
molecule tags Immune system
total genus 41
structure length 220
sequence length 220
ec nomenclature
pdb deposition date 2001-03-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF07654 C1-set Immunoglobulin C1-set domain
H PF07686 V-set Immunoglobulin V-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1i9iH02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1i9iH01
1BECA 2IFFH 1JRHL 3VFPB 1UCBH 4PG2C 4XAKD 3H9SE 4KKBC 1LEKA 3KYNB 2F19H 4WFFE 5E5MA 2Y06H 1QKZL 4LCUA 1ORQB 3DBXA 4OZIA 3U1SL 4NQDB 4UINH 5F8QC 5KG9A 4PJXB 4OD1H 3O6MH 1MHPH 5A3IC 2B1HH 1GIGH 4KK5D 4YDIH 5ITBL 3QXVA 3WLBA 5KSBE 1BD2E 1FBIH 4X6FB 3WSQH 2OSLA 3WNOA 2KQNA 2E5EA 5F1NA 4MQ7A 1NCCH 4JFFE 4QGYA 3GSWA 3QI9B 3FRUA 3D1MC 3T77A 4NO5B 1OP9A 5HSFA 1AR1C 1KB5A 3O6FC 4K23L 2V2XA 5KN5A 3UJIL 1J8HB 2H32H 4NQDD 1JZ2A 1TNNA 2HFGL 1LP9A 3NFSH 5BO1H 4ZODA 4YEEA 4TSAL 4JZJB 5DQJA 3VFNB 3KXFD 3E0GA 5I9QB 1H3UA 4KQ3H 3O3AB 4KZDH 3MRGA 1E4XI 1VDGA 3VRLF 1OP5H 3UYPA 1G0DA 5E4IA 5EO0A 3S37X 1C12A 2EE6A 4NQSB 5CD3A 4WUUE 2EE3A 4POZC 3FFDA 1TCRA 4MMXC 4OGYL 1JL8A 3CX2A 3QXDB 3W5NA 1J8HD 4GT7A 3C5JA 4OUUB 1ND0B 4WEBL 1HXMB 3RL1B 2X4QB 4KHTL 1CGVA 2MCPL 1VA9A 5FGSA 1CDYA 2NX5B 5JIIA 4R2GD 4XVJH 3HZKB 3W0WB 5C0RH 1W2KT 4PJGA 2V2WA 1QVOA 4JN2B 1ZHKB 5FUZL 1UCTA 4IDLA 2ADJA 1WIOA 2YMXL 4XMKH 1AXTH 1IFHL 5LGHL 1PKOA 4HFUL 1ZGLM 1FZOB 3GSXB 3PWVB 3MNZA 4M3KB 1MI5E 3GJEB 1H5BB 3F6LA 4O51A 4XGZB 3GKWL 4RGNE 1RZKC 4MAUH 3L3JB 5D93C 4JY6A 2Z92A 5EOTB 2NX5D 1N64H 2PYED 3ZE1F 3D18B 2HKHH 3W0WD 5IHBA 1WAAF 1OD7A 1IQDA 1ONQA 1CDUA 2GK0A 4NKMB 4EVNB 4LLWA 4HJ0C 4OTXL 1O5DT 3FQXA 2BMKA 3ZKSD 3RUGF 1DBJL 1ZGLP 2RIKA 1MLCA 3AMLA 4EKXA 3O81A 5HHXL 1CLZL 3LCYA 4XNXH 1FNSH 4JFHD 3MRHB 3BKMH 4XP5H 4UDTB 5GGSB 2CPCA 3BP6A 1IGIH 5DMIL 1IC5H 1GSMA 4K3DL 1T5XB 4J3TA 5TF0A 2A0LC 4PRHE 3GMRB 4PG9A 3LB6D 4R0LB 2R69L 4HWEH 4E42B 2ESVE 3IXAA 2RFXB 5K9KA 1JIBA 3LMJH 3R0MA 3O6FA 1YEEH 3LOWA 3CZJA 1LK3H 2G2RB 2HFEB 2K7QA 4K7PY 1CD9B 1ORSA 4ZUTB 1JWSA 1BHGA 2FL5B 4JM2B 5DHVB 1A9BB 3EYUH 3KLDA 3VXQB 1EGJA 4XRCA 4LPCA 2PUQT 4LMQI 4HDIA 3I6GB 3QJFB 3Q48A 5T1MB 2IH3A 2I07A 5KJRH 3IU3A 5BV7H 2R4RL 1MLBA 1IGCH 4YK4B 1NAMH 2V7HB 1BX2A 4FZ8H 4L4VE 1GC1H 4M9OA 3OR6A 4NM8H 5H2BA 2AEWA 4Z78A 2ZUUA 1FFRA 2XTLA 3DTXA 3EIFA 3BT2H 4RMRA 4JM2D 2PXYB 1WWAX 5HY9B 1CE1H 4XP1L 5E2JA 3OJMB 4XBPA 1RHFA 5EA0H 1HHKB 2Z31B 1FO0B 3EOBB 1U95A 2X4PA 4JKKA 3U9PL 5JW4R 2R2HB 1TCMA 3WS3A 2NNAB 2CK0L 3R06B 1U3HC 1DANU 2AEQL 1DSFL 1LO0L 3IYLW 3BQUB 1N0LA 1XF3A 3D39E 4PS4L 4HQQH 3EGSA 1B90A 2PXYD 1EV2E 1OCWH 1KLUB 5GRYA 3MCKA 4M4PA 3FO1B 2GITA 2Z31D 2BC4A 1H9VA 2FX8L 1GXEA 1C16B 5HI3C 2DQEL 4HPOL 3I3BA 3T1FA 4YBLC 4JAMA 1MCHA 2R0KH 3I3EA 3W2DH 3ZT7A 1LWRA 5GRVK 1ZSDB 1KUMA 3BQUD 3HNVL 3VD9A 3RNKA 1H3XA 5KSVB 2NY0B 3V5HA 4XNYH 4JG0H 1L7IL 2X9XA 1JK8B 3CLFL 1KIQB 5EU5B 4BELD 3FCTB 4F8QA 1ES0A 3TN0B 4UQ3A 3QHFL 3U7AA 1ETZA 3FB5B 3MLUH 4FMKA 5K59E 1NC2A 1RZGB 4LSVL 3V95A 1FV1A 2G60L 3V4VH 4DW2L 1I8MB 4MJIA 2WSKA 1VESA 3INUH 1CIUA 3ESVF 5E8DL 4XBEL 5DGRA 4ISVB 5D70L 1HKLL 2FH8A 5BRZE 3K1DA 2IPUK 4Z6AT 4XPFH 1WC7A 3MLZL 2FR4A 2M26A 4JHWH 2NY0D 4JREB 2UWEF 1XR9B 2J7LA 4P4RA 2XY1A 3NBNA 5IFAL 3VFVB 3QDGB 1FGNL 3LHPL 4YDVA 3TN0D 4OT1H 4LPTA 4BQ9A 3ZL4L 4WY7H 1K4CB 3V6OE 1OD9A 3PE9A 2Q3ZA 3VXSB 3H7LA 4NN5B 5EU6B 4U1JA 4AEHH 4YHYB 3GI9L 1QBBA 3ES6B 5DLML 3V79C 4NPYB 2VZOA 5J9PB 3U2SA 3WFBL 2Z91B 5TDOA 2VDRH 2AV1B 2CJUL 2VUYA 1NFDA 2HVJB 3MPCA 3QFDA 2QJDA 3QDGD 1AQKL 2ZJSL 1F02I 1O7VA 5CGMA 3LQZA 5CKAA 3SJVB 1I3RA 3BGFB 1U3HA 2Q7NA 1OTSC 1RUPL 3LKSB 3VXUE 3THMH 5EBLA 1WWCA 2MSPA 4LCCC 2XZQL 3I9GL 3OKMB 2HT4C 5EU6D 1JYNA 4U0RC 5EZIL 4GUPB 1HH9A 3U0WL 1J5OH 3P9WB 4MDIB 5FKAA 5C0JA 4HJJL 4BK4A 2NY5L 4J6RH 4MNQA 1VFBB 4HIIA 1T66D 3O2WL 1BVKB 3VFSA 3LY6A 1FG9C 1YMHB 2FATL 4NHUB 5C09B 2JELH 4I3GA 4YC2C 5KVDL 4G8GE 3OKKB 1FLTX 5IW1B 1U8LA 3SJVD 4PP2A 3IXTA 2P8PA 2I25N 5J6HA 2YPKA 1EHNA 1DQQB 1P2CA 2AABH 4PJHE 2ICWB 5I71B 2GY7B 3V0AC 5T33L 4Y8DC 2XNAA 4J3VA 3RVWD 2CR3A 5F7UA 4LSUH 1XEDA 5CEZL 3QRGH 3IRPX 4YDLC 2V5SA 1DUYA 4F33A 5C09D 1SJEB 2W07A 3IDMA 3GSUA 5JLZB 3D3VB 2GSIB 5GHWH 4K7FA 5GRWA 1CDBA 3QUML 3GSNL 1DBBH 1I1YB 2IBZY 4KROC 4Z7WA 5GJTL 4JO2H 2X1WL 2J8UE 2BXYA 3HNSH 1JGUH 4LF3A 4ZUSB 1WCQA 1S3KH 1OB1B 2BSSA 3KS0J 5DD0H 4ZQKA 2F54E 3ZZ1A 1NAKH 4KGLA 5ESVB 4N8CL 4Y16A 1KJMB 1U8PA 3UP1A 3MACL 3D3VD 3JV6B 1UWEL 5D5MF 2E7LC 2HTKC 5HI4C 2YA0A 5C1MB 3Q5OA 2DTSA 1F11B 3T0XA 1BVLB 4HS6A 3ARBC 4E0RB 4Z7OF 4I2XB 1LO3L 3B6SB 4QRPA 4AZ8A 4TTDC 4OLWL 5JQHC 4D0CA 1TPXC 4LEXL 2XKNB 4U6VH 5IQ9B 4K8RL 3RWEB 1HE7A 3WHE0 4LCCA 3PV6B 2E27L 1CU4H 1TJHL 3IU4H 3FQWB 5LCVL 3DRQA 4O2FA 1CZ8L 3L3IB 4YWGH 4OCRL 2ITCA 4FZEH 4QF1A 1FO0H 2F5AH 5B8CC 3GRWL 1NJ9A 1J86A 5FB8A 3OF6D 3MXVH 8FABB 3EO1B 1JUFA 3O6KH 1SMAA 1N26A 3CU1A 5E2WL 3D85A 3KPLB 1J1PH 2CUHA 3NABL 3AB0B 2VR5A 3Q6FB 3STLB 2WIIA 3DRTB 1OHQA 3CSYB 5SWZE 5JPNA 2D31A 3CXDH 3DPBA 1BIIA 1S9WB 4E41B 4UT9L 5K9QG 3KLHC 1YYLL 1ZHNA 1JTPA 4ZPTA 1DFBL 4DAGH 5CBAA 1NKRA 3H0TA 3KPNB 3QRFM 5E08L 1FLRH 5T1LD 4ODTL 3BPNC 1I3GL 1XGYL 3FHAA 5CEXA 1JFQL 1FORL 3HE7B 3PL6B 2DMCA 1EFXA 1UYWH 3QO0A 3QFJA 4XPGL 4FTVE 5L2KB 2QBWA 5E8OA 4D0BB 1OSZB 4E41D 3DJ9A 1H3PH 1NGWA 2YK1L 5F1IA 3FQUB 1S5IL 1UZ8A 4ODWB 4KV5F 2D0FA 1AGBA 2HN7B 4TUKH 2DIAA 4AEIL 4TUOB 5ECJE 3RTQB 3LKOB 5BV7C 2E7LA 3NPZB 3C9NB 4H1LA 1R3LA 3HE7D 5D8JH 1NC4A 3DVNA 1GC1C 3BIKA 4IJ3B 4JFOA 4TSBL 5DFWH 5ILTL 1J88A 3WS6C 3CFBA 4PB0H 1RUKH 1YPZE 2DS4A 3ARBA 1MRDH 4X4MA 1IC7H 5JR1L 1CDIA 3U46A 5IFJA 1MCWM 4XPHH 1UKTA 1V7ML 1FNEA 1RK1B 2AXFA 1K8IB 1Q9WA 3F7PC 4PTTA 3RTQD 3VGHA 5GZNC 2JJWA 2Z8RA 2LU7A 4LSRH 4U2YA 3PWPD 1QBLL 5EU7C 1C8PA 4HFWB 1MWAH 1R3JA 1D5XB 4Y7MA 5I1JH 4JFDB 4GLRI 3VE0B 4W4NA 4M61B 5HYJB 3NZHH 3LKPB 5ISZE 5BVJA 4Z7QF 2DF3A 2PW2A 4Z7UF 2APTA 4DGYH 4NQED 5B8CA 4G42B 4BFGA 4WENB 1Z9MA 1MRFL 4OF6A 3OHXB 1NH6A 5DD5H 1F6AA 4E5XB 5IR1A 1C08A 2VLJE 4OFYA 1W72H 4JFDD 3UBXB 1I1AC 1RUML 1S9XA 1UB5B 3TESA 2CDGA 2EC9U 2XFXB 2Q8BH 3B5TA 4RAVB 1W0VA 1DZBA 1FC1A 1U8OB 3BWUC 4XPAL 1EDQA 2VDPL 3BP4A 3LKQB 3MNVA 3MRKA 3V52L 4GBXB 1FDLH 4RIRB 3UBXG 1S7QB 2HJFB 3ALPA 4M43L 3U7YH 4P5TB 3NA9L 1XZ0A 3PQYD 2F53A 3S5LB 1F4XL 3X13B 1BJ1J 2ZNXA 4WJ5B 4KZEH 1PW3A 1NCDH 4ODBD 5DWUH 1VACA 2A6KA 1U8IA 3MROA 2O5YL 3BUTA 3KPSA 1YC8A 2QSTA 4UUJB 2DQFA 4Y1AE 2YOCA 3GHEH 3G6JB 4OAWB 4U7KA 3UTSB 4HUVA 1B0GB 2P45B 3S5LG 3WFZA 3BO8A 2FX9H 4RQQA 3QEGL 4GBXD 4H88L 3FTGA 1TVHA 1CFTA 5B21A 3OX8B 1G6RL 3JWNC 4GRWF 4P5TD 1A6AB 1DVFB 4F7MA 2YUVA 4TULH 2V5MA 4N0RA 3WS6A 5LQBH 4JZJC 2OQJA 2VQ1A 3QR2A 4TUJB 3RJDA 2ZUQB 1FZMB 5EOCJ 4R2GC 2F74A 5C0AB 5I9QC 5D4QA 1OAYL 1YEGH 2H41A 3WEXA 3H9HA 4LHUG 1M05B 3MCLH 3OB8A 4UNVA 3QHZL 1CXHA 12E8H 1HI6B 4YHOH 3VGGA 1F97A 1FAIL 4FQCL 5I1CL 5E2TL 3G04A 4LHUD 1IEAB 4O2CA 1P4LB 2P7TA 4NN6C 1NEZB 3CFKA 3GGWA 3LKRA 4F15B 1MCNA 4YIQB 9CGTA 5L0QB 3M17A 5C0AD 1Y0LB 1MNUL 1DN0A 4OZIE 4ZFFA 1N6QH 1IAII 4U49A 2Z35A 4Z76B 4X0KB 1HN1A 4Y89A 1N2RA 2B1AL 3TNMB 1T5WB 3O9WC 5JUEH 1G7HB 1I1AA 1RIUL 3ZSTA 3AS3A 4YO0A 1I8IA 3IAGC 5IK3B 5FGBA 4M8QA 1CYGA 3FRPG 3S88L 4L8BB 1NLDH 5FF6A 3LB6C 1S7WB 1CXFA 1EVTC 1FFPB 4EN3D 1C5DB 5KTEL 5LJYH 1LP9E 2GHWB 3ULUF 4RX4D 5SX4H 3WNPA 4I4WB 3BD4A 1OAXH 1P84K 4OUOA 5D9SA 4CRPA 1OWRM 2C4FU 3PWNA 3NFNB 4CBPA 1IGJB 1WWBX 3BZFB 2EDXA 5EU3B 4L3EA 1KCSL 3C6LD 3RPIA 5E24E 4PJIF 5T5NG 1K9TA 5CGTA 4IRZH 1BFTA 5KANI 3NIDE 2CLRB 3T8XA 1VHPA 2QKIB 1D5IL 5IMLA 3RA7H 4MCZB 1B4JL 2H3NA 3GBLA 3G6DL 3IFOA 4PJGE 2IANB 4NC1E 1HWGB 1T3FB 3FB8B 2X40A 3PWLA 2HWZH 3RWIA 1VFAB 2YR3A 3OWEA 3C08H 3RP1A 1AI1L 1MFEH 2F58L 5E6IB 3O6LH 2YEZB 4U1SB 1KTLA 4OIBA 1U8QA 4Z7VF 1CT8A 3VXMD 3L5XH 3SDDC 3BKCL 4BZYA 1PKQA 4FNLL 3L5HA 4UB0L 4WW1B 2PYEA 1YMMA 3HR5A 5DF0A 3BESR 1T7XA 3NH7L 2OX5A 3P4NB 5F6IC 3JV4B 1KF9B 1RJYB 3CMOL 5IF0A 2ATKA 3CIQA 3KLSA 4JFZL 3O3EA 3O9WA 5DI8A 1ZEAL 5I1AA 1L0QA 5ETUB 5F44A 4RFEA 3U4EA 5TJWK 4DEPC 1WFNA 1MHHA 1CFNA 2X1XR 4Q9RL 4TQEH 5GGVY 2X1OA 4LPUA 4F7TB 2VITB 4FQJL 3T08A 3IAPA 5DDHB 2DQGH 2VLKA 3L3OA 4OD3L 2X89D 1N8ZB 3B2VH 4NC0B 3BI9X 5DK0A 3VFWB 3Q6GL 4LDEB 3PGDA 4NM4H 3V0WL 1S5HA 1B2WH 2F8VA 3GO1H 1Q9LB 4HS8H 3BE1H 3TN0C 4I5BA 5JW5B 1QG3A 5EG6C 3SDCC 1K6QH 2QV2A 4FFYL 2ILLA 1JPFA 5FHAH 3X11A 7FABH 1ZTXL 1PQZA 3LS5L 3SGDI 3TBVA 1PG7H 5IEHB 3O11A 2XPGB 2VKXA 2OK0H 2UZIH 1WISA 4JREC 4P2OC 4NQVA 5IMOA 4BH8A 2IWGA 4P99A 4G7VL 1ULVA 2Y23A 3BZ4A 4PJCF 2A73B 4BA8A 1AC0A 3OGCA 1HCVA 4L8SC 2AJSL 4ZYKB 3TIEB 2DJSA 2HKFH 5FO7A 4JKLA 3G5VB 3QNZA 3CDYA 3QEHA 5MEOB 1R5WB 4HUXB 4QHMA 1B9ZA 1XF4B 3KJ4B 2PW1B 1S7SB 4NQTA 4PJBA 3SDDA 3SCMC 1T66C 2X5PA 1I7UA 1G7MB 1JZ6A 1BOYA 1P5VA 3CSPA 2QSCL 3AU1B 1CK0H 2RHEA 4XC1H 5IVXF 3RNQB 3OB0H 2HJKA 2B5IB 4KU1A 3NTCH 4FFWD 5HJ3B 2P42B 1J1XH 1V3MA 3DGCR 3MRQB 2HRPL 3U36A 3MRBA 6FABL 3RGVB 2QQNH 2OR8A 1OW0A 1NMAL 2VN4A 2DTML 5FYLE 3MLYL 4OZGF 1KBGH 1YNKL 5EULV 4WFED 2P8LB 5J1TC 3QDJD 3UC0H 1JNHA 4G9FB 2Y07L 4MJIE 3UMTA 5J11B 2PYFB 5F9OH 1HCFX 3SE4C 4CAGA 1DDHB 3VI4E 5KS9A 2X4TB 3QG6A 2JCCA 5DD6A 4MQTB 2XZCH 3MBEB 3RGVD 3UZEA 1J05B 4ZS7L 4OGXL 4QTHA 4XTRC 3VDCA 3OAUL 1QRKA 4OF5A 3L3HB 3LQAL 2J88L 2ZP0T 1YUHA 4PRBA 2AJVH 3SDCA 2AEIT 3GJFK 3SHSA 1KOAA 1H3TA 3UROR 1HHHB 5MEQA 1FJ1A 2EIZB 4NFCA 1Q0YL 2EYSB 4CVUA 2HYMA 4P48A 2BSED 3DX9B 5MEPA 3F7YA 5JPMA 4OCLC 3MBED 5DO2D 4X98B 4XNUH 1NFDE 4K2UL 1SYVB 4P2OA 2VDQL 4I0KA 3T0WA 4NQUA 2EE2A 4NCDA 1SM3H 4LARL 2IPKB 4R96B 3LV3B 5IB5A 2HMID 4W81A 2EDLA 4X8JA 2MMXA 2IGFL 3N1QC 1F3DH 2H9GB 1JRHH 1UWXH 4MD0A 1IC1A 1MWAA 4MNQE 3C6SA 1QKZH 1HHJA 3DV6B 4L1DA 3SGKC 5HVWA 1IZJA 3SCMA 1WFTA 2VE6B 3U1SH 1BZ7A 4MJ6B 5DQ9B 1MQKL 2XIDA 2AJ3A 4QY8B 4QYOA 5ITBH 5JORA 3IDNA 2PR4L 5F7KC 1WFOA 2VXQL 2ZZUT 4QGTA 1L0YA 4Y5VC 5K59F 4KKNA 1Z0NA 2PCPB 4KK9D 2UY6A 3B9KB 4Q2ZB 1JNLL 2K1MA 1W72A 3QIWA 1INQB 3OPZL 4K23H 3ZLQC 4OLXL 1R3KB 3OAZH 2DJ4A 3QA3A 3UJIH 1ZT4B 4DFHA 2EDFA 4Z7WE 3SDXA 4L8CB 5IMMB 3L5WB 5LXGL 3SE4A 4PFEA 4WI8A 3OG4B 4GS7B 4HIHB 4QHNB 2A77L 3K3QA 5FECA 4PGEB 1MHCA 1IEBA 1GZQB 4O4YL 3QDAA 5I30L 5IEKB 1T22A 4GKSB 3I75B 5HHOB 3UTQA 2ZOKB 4W6YB 1DBKL 4KVCL 4FS0A 1RPQA 5F88A 4ZMAT 2PTVA 2DN7A 4WEBH 3RAJL 4KHTH 2X41A 2MCPH 3HE7C 5D6DC 5EORH 3RIFK 2OLDA 4Y2OA 4AK1A 3RKPA 3PP4L 3T0EC 4QRPE 1A1OA 2YMXH 1V8HA 3K8KA 5LGHH 2RB8A 3CVHB 3IFPB 4HFUH 4CU8A 4TVPD 1B88A 3BEWA 5HHOD 4CJ1A 2ADIA 3K4ZA 3GKWH 2GSGA 3MJ9A 4HSQA 2JB6A 3EYQD 1AKJB 2FIKB 4P5MB 1JI1A 3PXJA 15C8L 4G6KH 1MFBL 4I18B 3U0TB 3CD4A 4WTWA 3CSBA 3QIBB 4OTXH 3CPLB 3SGKA 1DBJH 2FEEL 3O0RH 2R1YB 1KCVL 1TITA 1TQBB 3JV5A 3SPVB 4PJHF 4BK5A 1IEHA 4JLRA 1M7DA 5HHXH 1A02N 3QUKA 1T6WA 1CLZH 4KWUA 2R2CA 1WT5C 1JTTA 4QRSA 4NZTH 3F58L 43CAB 5DMIH 5JOEA 3QAZB 4BSWB 5L2JA 1BOGA 2R69H 1IM9B 4PYGA 1ZA3A 1MJUL 2EEDA 5C07A 3QIBD 3DGGA 4NBZB 5C8JA 4IRSD 5J06A 4Y88A 1EO7A 5CP7B 4HKBB 1D5BB 3MOBH 4RFNC 4ZFOL 3MLVL 2D0HA 1U6AL 3RWGB 5ACZB 4H20L 3QFJE 2LE9A 2NY6B 2BSTA 4IMKC 4PRPE 2NXYB 2R4RH 1FVDA 2NLJB 1IM9D 2R2BA 4NQXB 1K5NA 1RI8A 5I73B 1GZPB 1BWWA 1KFAL 5INCA 4Z18A 1NSNH 3VXPB 5GSVB 4M6MH 3GMQA 4U33A 4R7NB 4LLVB 4K07A 3DX7A 4XP1H 4RZCB 2Q7YB 2DM3A 1OY3B 3IDUA 4JRXA 3A6BL 3X12B 4UV4L 1S8DA 2NXYD 3ZTJH 4S1SL 3U9PH 2EDNA 4K7PL 4X4ME 2YN5A 3T0EA 2CK0H 2DOCA 2AEQH 1U8MB 1YC7A 1A6PA 1DSFH 3EOAB 4D9LH 4OKVB 4OF7A 4OZHB 1UKQA 4JY4B 5ALCL 1JF1A 4PS4H 5BS0A 3KPQA 1HDMB 1AP2B 1NGYB 2WINA 1SVCP 5JXEC 3PWPA 3EJYD 1YY8B 4HUWA 2VWEC 1DQJA 3T65B 4IHOA 2DWEA 3S6CA 2BVQB 2EDTA 2FX8H 4LK4A 5C0DB 4UV7L 1TDQA 4HPOH 3WXVL 3TC9A 5IW6A 4XP6L 1A1NB 2GUOB 3PDOA 2IH1B 5EC1A 1LHZA 3IS1X 3GMLA 3HNVH 4KKCD 3LKNA 3L9RA 2XXCB 3WN5C 3EKCA 2I60L 4FFVC 1L7IH 1YDPB 3FOLA 4U4BA 2ADGB 1CQKA 5EN2B 1OQOA 3CLFH 3L95B 4GG6F 3BHBB 4ZS6D 3TP4A 3V9FA 2BY2A 4QRTA 1Q94B 4M7LT 4LVNB 2G60H 3WL9B 4DW2H 2WBJA 4HKJA 1OPGL 4XBGB 4DVBA 3ECBB 4F15C 5E8DH 4B53A 5D70H 1HKLH 4ONOA 4HZLB 1FYTB 4ELME 4EN3C 5KVMC 2F53E 2AI0H 4IMKA 1S7RB 3PQYA 5IFAH 2UUDH 4FG6D 1FGNH 5FK9A 3SOBL 1DBAH 2FYYA 4N0FB 3TZVA 1PD6A 2H1PL 3ZL4H 1JCKA 5ESAB 1JPGB 1OGAA 4M62L 1U93B 2O26U 3EFDL 3KPSE 2XKUA 3N0PB 4O5LH 5E94A 3GI9H 1QSFA 3V7AE 3DX6B 4HUUB 5EWIL 4J1UA 1FYTD 1YPZF 5D2LA 3G5ZA 3C6LC 4CVXB 4PJ8B 4PJFA 1SMOA 3VFTA 1UM6L 3MC0A 1X5LA 3BZEB 2JKXA 4OZ4A 1AQKH 2ZJSH 3MRJB 5HGHB 1A6WL 3QQ9D 3HI5L 3D0VB 2BSRA 4LAQL 5I75B 2XZQH 3I9GH 2YZ8A 5EZIH 25C8H 4U6HB 3GSRB 3U0WH 3DOSA 5HDQL 1HHIA 4D9RD 3QIUB 1S7TA 2NY5H 3BYTA 3ZDYF 3RRQA 2AEPL 3O2WH 5JXEA 2FATH 3FFCB 5TH2A 1HILB 4C56B 4GAYB 1ZLVH 3W39B 5KVDH 2F8XC 3NIGF 2GJ6B 3C60B 4PRIA 3WUWA 3SGEH 1UGNA 5D7IF 3CVHH 3RPKA 4IDJL 1SJVA 3A67L 3HZMA 2NW2B 5T33H 3LEXB 2N1KA 1CR9L 3V6ZB 1UVQB 1D5MB 1RJZA 3WN5A 4HUKB 5MI0B 4G9DB 2B2XL 5E00A 5CEZH 4NRZB 3MRIA 1XF5A 5IB2B 3FFCD 3TF7C 4C56D 3MODL 1FCGA 4MD5B 4XCYB 1KGCE 2GJ6D 3QUMH 1A0QL 1KCKA 2YD8A 3C60D 1LO2L 2B8OT 4NYLB 5HI5D 5L9DL 5GJTH 2FJGA 2ZPKL 1ZVSA 4KMTL 4NCC1 2EH8L 2WBWB 2ERJB 3UYRL 3HPLA 2I27N 4M03A 5ANMB 4Z5RB 1NCAL 3TJEL 2VAAA 3AAZB 4Y4KA 2X10A 1OAZL 1XGTA 4N8CH 3LAFA 2FECI 4XZUA 1KB5L 3MACH 3P4MB 4ZUUA 5SWSB 1UWEH 1A14H 1SEQL 3PG2A 5E0QA 2Q8AH 3U0PA 1MPAL 4MJ4A 5DSCB 1JV5B 1MUJB 3ULUD 1YEHL 2YD3A 3SQOL 4L3EE 2I9LB 2YRZA 4X7SL 3HLAA 1HXYA 5HGDA 1LO3H 3EHBD 5E8NB 4F7EB 2W65B 3NZ8B 3I2CL 4IIQB 4WIQA 3V6BR 1S9YB 5I66B 1MFCL 4U1NA 3OQ3B 4OI8A 4LEOA 4DKDC 5GJSH 4LEXH 1NMCB 3HZVB 5SWSD 3FT3B 2OL3A 4K8RH 3WFDL 2GKIA 4NN7C 3OKEA 2E27H 5CCKL 3UYOD 1FFNA 1TJHH 4MVBD 5F7WC 5T1KB 4MJ5A 5LCVH 5I74C 1TVDA 1CZ8H 2NY1B 4ZOBA 1QR1A 3H9SB 3MLTA 3P30L 3BRGC 4OCRH 5C7XL 4M9PA 1RD6A 3GRWH 4J3XA 4BUGA 4PTUB 4MD4A 3GUTA 1UXWA 3CFIC 5DJ0A 4WHTA 5E2WH 3SE8L 5I16A 5IGXL 3NABH 3QWRD 4HXBL 4F9PC 4HWUA 3VXMA 2VR9A 5KSBB 1BD2B 3GMOB 2PYEE 4K9EL 1KB9K 1YMME 4JFFB 5T1KD 4KY1L 3O3DB 5L8JB 4UT9H 3U9UA 2NY1D 4N5UA 3H9SD 1YYLH 4LGSB 4J8RB 4LOUD 4OF3A 3B5HA 1J10A 2X4NB 4WFFD 4Y4HD 1DFBH 2FJHA 4CVZB 4FFWC 4MXWH 3OXSB 3LN5B 5DR5L 4AENA 4ODTH 4M3JA 1I3GH 1XGYH 4M6AA 1CL7L 4PRAA 1S9KC 5IB3A 1VCAA 5J4MA 3UZQA 1JFQH 5F96L 4YDJA 4CVWA 3RUGA 1BD2D 4F7CB 2FBJH 3CDCA 1LP9F 1U8HB 4P23B 4XPGH 3BYYA 3MZGB 2YK1H 2BK8A 2KZWA 1JGDB 5JHDA 4WUUB 1IL1A 2VLKE 3P4OB 2BHYA 1QQDB 2D9QB 4MS8C 2Z4QA 4MZ3A 3MYJA 4XCFL 1OSPL 4XC3L 1D6EB 4N1EA 4GW1B 3DIFA 4M48L 1QLEL 4F3FB 4TSBH 3GHBL 3ZKXB 4P23D 2A6IB 3MR9B 4BUHA 3GB7A 4Y0GA 4AIXA 5JR1H 1OARH 3IDYB 2BCKA 1E28B 2APFA 1V7MH 5J1AA 3QPQD 2Q86A 4MA3A 4ZUVA 3NMEA 2FHBA 2EDBA 3MBEC 3ROLA 3QHTC 5DO2C 2I9TA 2J5LC 3VFRB 4GRWH 3LSOB 1T0PB 4W68A 4RGNB 5DJ2B 1QBLH 3ARWA 5CSBA 2EO9A 4JGJA 4YHIB 3TH3T 1BPVA 4K55A 3UDWC 3ILQD 5KSUA 1GAFL 3IFNL 4BZ1L 2HMIC 4PLJC 3QBTB 4DUXA 5I76A 3WNNA 1R3HA 3FN0H 3MRPB 5JNYB 4YXLL 1R0AH 1A9EA 3OXRB 4CMHB 4XVTL 4DVRL 3V4UH 4OF0A 4LLDB 1LEIB 4PJBE 1MI5D 4F9PA 5LGJB 1XMWA 1W0YT 4JCLA 2V7NB 3P73B 1P4IL 4J3WA 1FGVL 2ZUVA 3BEVA 4O2EB 4PRHB 1N59B 1L4IA 1RUMH 2J2ZA 3SO3C 2ESVB 2CKBB 4A2MA 1I75A 4ZO7A 2JJSC 4X6EB 4LSPL 2EKSB 5I19L 3L7EA 3CFEA 1VEMA 2FWOA 1IGYB 3CFJB 3MFFB 3L6FA 4DGVL 5DJYA 4RRPG 1UB6B 4KK9C 1YEIL 4M43H 4JN1H 4U1HA 5CD5D 3NA9H 4PV9B 1EBAA 1F4XH 4OLYL 5D1QB 2J4WL 2VLLB 4PRHD 3PWUB 4L4VB 2ESVD 2YSSB 1ZLSL 1AQDA 5KS9E 1I1FB 2O5YH 3D0LB 4G7YL 5FHBL 4UAOC 2PO6D 3K2UL 2W0LA 1NCBL 3TO4A 4NOBA 4LKXA 1R5VB 3L3KB 4H88H 3ULUH 1G6RH 1BF2A 2NW3B 4WEMB 2CLVB 2RCSL 3RWDA 2OI9B 4MAYB 5DJDB 1G7IB 5D1QD 4XWOC 5B4MC 5DRWA 3VRIA 4XNZB 1QRNB 2CDFB 1YNLL 5IBLD 2UWEA 2MQCA 2EH7H 2X4RB 1AHWB 2XA3A 3ZKMD 4GS7C 1OAYH 4ZTPL 3D39B 1T1WA 2B0SL 3G6AA 4N5ED 1FL5B 3JXAA 4WI4A 3VXOB 3QHZH 2QADC 3TM6A 2VOTA 5CJQL 3MOQA 1FAIH 4FQCH 5E2TH 3BPOB 3UDWA 4WUKH 5IG7A 4LCYA 3KPPA 2ARWA 2XYCA 3V0VB 1V05A 2EXWD 4W70A 1GGUA 1DUZA 2NY5C 2NQCA 3RI5F 1AGDA 4HBCH 3V5KB 4NUGL 5IIEA 4G6ML 1MNUH 4LLYB 4PJAA 5DURB 5EOCL 1VB9A 2SEBB 5A43C 2XXMB 4CN4A 1ZS8A 3O4LA 2Q3AA 4KQ4H 4X6CA 4YFEA 2B1AH 5DA4A 1FL3A 3RHWK 2GYSA 4M7ZB 3ZHLA 1RIUH 5HYSB 1JZ7A 5IOPA 4MDJB 3S37L 4MLSA 4G6AC 2JJUA 3S35X 4PY7B 5AD0A 3S88H 5E99L 3U48A 1TMCB 4YPJA 5K9QI 5BRZB 3IB4A 1D5ZA 4IMLB 4J3SA 1GGBL 3QIBC 5HYSG 3ROOA 4IRSC 5F9JB 1PVHA 5GSRA 5FO8A 5TFSL 1TQBC 4Q6IB 4DKFL 5FYKL 3SDXE 3ARPA 4UIMA 4P3WA 5SX4I 3WBDA 4H8WL 4EIGB 2EYRB 5DTFA 3P0VL 5D2NA 5C0FB 4NRXB 1QEWB 2G75B 4P3CL 5FGRA 1I7RA 2GTZB 5BRZD 1KJ2B 1TENA 1EJOL 3SDAB 3DSNA 1AD0A 3E2HB 4NO0A 4OBRA 4WU7B 4GW4B 1CFSB 2AXGA 4HAFA 4I77H 4NSKA 4NO3A 5CBEB 3REWA 3BSZL 1D5IH 5HHME 2MWCA 1AXIB 1KJVB 4OZFB 1B4JH 1HOCB 3P4LA 4ONFL 3VXUB 3D25A 1NFDF 3G6DH 4QCIA 4KUZL 1G7PA 5D1XB 2KH2B 2M2DA 3H3KA 4ONHA 2NXYC 1XGPA 4P2CG 5FUOL 1ED3B 4ZAKB 3TFKD 5FDWA 2XACC 1AI1H 3SDAD 4OZFG 4K8RC 1ZLWH 5J13C 1RZ8B 3VG9C 3IGAB 2A74B 4G8GB 5J12C 4GW5A 3FQRA 4L29B 4XCCH 5ENWB 3OKNA 3VXUD 1A6TA 3EJYC 1CXEA 3BKCH 4PJHB 1LDPH 4S1DD 4FNLH 5D1XD 4UB0H 3VMNA 1HSBA 5HXMA 5GRXG 4ZAKD 5J6GA 3L7FB 3NH7H 4MB5A 4F37F 3O4OC 4FXGA 3DUSB 3RIAK 3S4SB 1MAML 5DUPL 3CUPB 3CMOH 2J6EL 3WXWL 4JFZH 4KKCC 1AO7A 4POUB 4HK0A 4G8GD 4Y2DB 5SWQB 1J7VR 3I6KB 4HKZB 4MNGA 1QFWM 4JPKL 1JPTL 5DJ8B 3IKCB 4TNVK 1CIDA 1A1MA 4I48A 4OLUH 4L4TA 2XQYG 3S4SG 3VFPA 4Q9RH 4ZS6C 1QA9B 2IADB 2J8UB 1RUQH 4PP1D 4X7TA 5AZ2H 2R1WB 1F13A 4WWKA 3QCUL 4HWNA 5JTWA 5D6CA 4NUJA 2YN3A 5AYUL 3QUMA 3GSNA 3KYOB 4FQJH 2F54B 4OIIL 1NFIB 3IDIA 1U9KA 4XP4L 1HINL 4OD3H 4U31A 3UBXI 3PGFL 1OVZA 4YFLI 1Z5LB 3Q6GH 4X6FA 1KC5H 4M8VA 3SQBA 3VXNA 2VXVL 3QI9A 3TYFB 3V8OA 4FG6C 4F7PA 2XA8L 1F42A 4NO5A 2OJZL 1WICA 4NO2B 1AE6H 4XNQB 2XTJB 3TCLB 1NDGA 5FOBB 1PSKL 4FFYH 5EU4B 4U1MA 32C2A 4QXUH 3PF2A 3OKOA 1ZTXH 2F54D 2MTPA 2YD2A 3QO1B 5DYOA 4ZDHB 5GGVL 4PGCA 4PREB 1KENL 2YPLB 2E3VA 4JRXE 4QO1A 2ITDB 4GSDL 1E4XH 4BSJA 1SYSB 3FO2A 4LLQB 1A6ZB 1ZT7B 5KSAC 3P2TA 2AJUL 3VGFA 3T0EE 1NMBL 1T21B 4G7VH 3MJGX 4J12A 4LAJH 1KLGA 2Q1EA 2AJSH 4JFYA 1K3IA 4ODVL 3T2NL 5GGRY 5BS0E 4U1LB 5DQDL 3OKDA 3FB6A 3PWPE 3RDTB 3DURA 5DS8A 5I1HH 1Q9KA 3JTSA 2C1PB 5SWZB 3HZKA 4URTB 4LQ1A 3TV3L 1UJTA 4U6YB 3GRWA 5GIRA 3W5MA 4JFQB 1I8KA 2PN5A 5CZXD 3MMEA 4I0PB 3P9LA 3LRHA 1UJ3C 5I75C 4NT6B 35C8L 3GSXA 3EO9L 3QDMA 1BZ9B 2HRPH 5EZLB 3T0VA 1ZHLA 4OD2A 1NMAH 1XAUA 2DTMH 3QXTA 1SJHA 2IAMB 3PDDA 1YNKH 4Z7UA 4JJHA 5SWZD 1X9QA 4OSUL 4WO4C 4PR5B 4WVRA 4FTVB 3HS0A 4P3DB 4OCYL 5GRJL 2Y07H 3WIIL 5HYQB 2AK1L 3BWAB 5HI5C 5CLTA 2AJYL 2LAGB 4ZPVB 4U7SA 1M4KA 3DUUB 4QXTA 2NXZB 4NC2B 1U3JA 4GOSA 1WZ1L 3PQYE 4ZS7H 1EPFA 3RVXD 3VFGL 3EW3B 4OGXH 2EDOA 3OAUH 3GMRA 5DXWA 4AH2B 5TE4L 3V8CA 1OGAE 3LQAH 1EIBA 4U6XA 2J88H 1CD8A 4FTVD 1ZHBB 1YPZB 4JQVA 1BQHB 2DQIL 5H94A 4JFXB 1JMXA 2Y7QB 4I0CC 1QSFE 2VDMH 3QULB 1INDL 4FXKB 5TPWH 2R2EB 2CD0A 3ULUC 4JHZA 5D2LE 2H8PA 5F8RC 1HEZA 5IHZA 1OOAA 4CW1A 4DUWA 3EHBC 3QJFA 4PJFE 3FOMB 2NXZD 3LEVL 4MA8L 4K2UH 2EE9A 3ARXA 5KSAA 2VDQH 2VSDA 4LVOB 4LARH 4AL8L 1UWGL 3BPCB 3DMMC 1B0WA 4K3EH 1HYSC 4YNYB 3E6FA 2F9BT 1QFUL 5DRZA 1DEDA 3VXTB 1AY1L 2IGFH 2D7QA 3KVQA 4JANB 4H25B 3IJYA 1OM3L 2DYPB 1TZIB 3TT3L 1JRHI 4OZFH 1UH2A 1OGTB 5FM8A 1N6UA 3CSGA 2VWEE 1HHKA 1H15A 1MVFA 3HE6B 2FZ3B 1TIUA 4GJTB 3VGAB 1OLZA 1AGEA 4IS6B 3U4AA 1MQKH 2XG5A 3GBNL 3SKJL 4PRIE 1MHEB 2KQMA 3R06A 3TIDB 3REVA 3CCHA 3NPSC 2H2SD 4KDTA 1CDGA 3NIFE 1LDSA 4LRNH 2C1OA 5ISZD 2PR4H 2CDEA 2K7PA 1UJ3A 4GRLB 4YAQA 2BXZA 2OM5A 3D69A 2VXQH 5LBSL 4F2MA 3G08B 2DYPD 4XNMA 1TETH 3MLRL 1U91B 4LOUC 1JNLH 5HGBA 4Y4HC 4HHAB 3OPZH 3HE6D 2AKRB 2BOBA 4OLXH 1V3LA 3UX9B 4WO4A 4DCQA 2VLJD 1LEGA 1AGCA 3JUYA 1CG9B 5LXGH 4AEFA 1T03L 3W9DA 4ENEC 1ZSDA 4MX7B 3MV01 5FA3A 4Y1AB 2A77H 4PYHA 4CNIA 1A3LL 5KSVA 4OV5B 4WV1B 3K46A 4J23A 3UTZA 1BIHA 4HT1H 1KYOK 3FCTA 4O4YH 3FJTA 3FB5A 3C8DA 1YJDH 2FO4B 4S2SB 4M6OL 5GRVL 5JW4N 1DBKH 3MBXL 4H0IA 1MEXL 2CGRL 5ADOL 2BHUA 3GNMH 1X4XA 3RAJH 1U42A 4LPWA 2BVPB 3S3SA 1L7TH 1J8KA 1CGSL 3GIZL 2O93L 1G6RA 4FQ1L 4Y1AD 3AREB 4P23C 2XZAL 3VJ6B 3PP4H 5TGBA 4HV8A 1XR9A 4XCNA 4Z0XA 4O02L 4ZD3L 5C0IB 1UWXK 2IMNA 5FYJL 3W9EB 2R0WL 1EO5A 1QO3B 2X4OB 4KKAD 3VRLE 4RISL 4EOWL 5T5FL 3UPRA 1MAJA 3DMMA 1EERB 4HGWA 3DXAA 2L0DA 1Y18B 3CZFA 4N1CA 2CQVA 15C8H 4PJIA 1LEKB 4UBDD 1UC6A 3NACH 5E5MB 1FIGL 3ARED 4LCUB 3DBXB 4OZIB 5DJ6A 5JOFA 1MJ8L 1KCVH 3IDYC 3O2DH 5E2VL 2FX7L 1DANT 3GMPA 1KCLA 2BY1A 4Y5YA 2D03L 4JPVL 3VXME 3WLBB 3MSPA 4RBPH 4N8PA 3OZ9H 3F58H 5SX5H 3GSWB 4BM7A 3FRUB 3T77B 3JWDL 1FSKB 3TBTB 1EHXA 3NFPA 1MJUH 1VFBA 2ZCHH 4Z7VA 5DGQA 2JE8A 2V2XB 4Y4HA 5KN5B 1T2JA 3ZE1E 3VWJD 2IBBA 4X7FC 2BOCB 2WAHA 3MLVH 3RFZC 4GQPH 3SBWC 1LE9B 3ARFD 4PJEA 5LWYL 5DQJB 3RUGE 3UJJL 4H20H 1FNAA 4UMGA 3T1WA 3ALXA 5DEFA 3BKJH 4MHHI 1KN2L 5DUML 3HNTL 3MRGB 3TT1L 2OR9H 5EO0B 1C12B 4MJ2A 5F7EL 4FQPA 1NBVH 2D9CA 2FBOJ 4PRNB 5JHDE 5CD3B 5CSZA 3FFDB 1TCRB 1EJ6A 4LASL 2ZG2A 4P9HL 1KTDA 1KFAH 2PO6C 2RAMA 2YD7A 4M93B 3C5JB 1WTLA 1BLNA 1MJJA 3GK8L 3FONA 3BN9D 3A6BH 3K8MA 4PJ9C 4UV4H 4PJGB 3MA7A 2V2WB 1QVOB 1OAKL 5D1QC 5KZCD 1F5WA 4HCRL 1JHLL 3F7RA 5EIIA 3MNZB 3ZKMC 1ZV5A 5ALCH 3OJ2C 4FQ2H 3T4AB 5GRZA 1QHOA 3ARGB 4JY6B 4LSQH 1TVBA 2Z92B 1CGXA 4OM0L 4NNYA 1IGTA 1IQDB 1ONQB 2GK0B 3ZKQD 4OCWL 2HT2C 3FQXB 2BMKB 3Q1SL 4UV7H 4XNZC 3WXVH 2YWYA 1MLCB 1LE5A 3QEQA 1RVFL 1UM5H 4GXUN 2P1YA 3WNKA 2ZCKL 5D7LD 3ZYZA 2IFGA 5EOQL 2I60H 1QBAA 4ODSL 1BFVL 3G5XA 4PJCA 4MCYA 3BP6B 3O41A 4QTIL 4PG9B 1WTGT 1JHKL 4ZTOL 5TDPA 5K9KB 3IXAB 4KKBD 1U2CA 2XQBL 5JW4Q 5E4EC 1KB9J 1MVUA 1FHGA 2GQHA 2IQ9H 2R0ZH 3O6FB 5MHSE 1OPGH 1ORSB 1JWSB 3BP7A 3SY0A 5GGSY 3QZWA 3IF1A 5AZEL 5A3ID 4XRCB 4N0CC 1EK3A 4HDIB 1BF8A 2WNGA 5IVXA 3C8HA 4WFEE 2GJZB 2IH3B 3WJLC 2I07B 4B41A 1GHFL 3IU3B 1MLBB 2VQTA 3SOBH 1F4AA 1URLA 3EOYG 1BX2B 3OR6B 2JB5H 5H2BB 3HAEA 4QKXB 4Z78B 4IOSD 1AR1D 3P77A 5CP3A 2Y6SC 1JZ5A 1QFWL 2EXYD 3D2UA 3DTXB 3JTTA 4LKCA 4MB3A 4OZGA 2PO6A 1ADQL 3M8OL 4F80A 5GS1A 3PL6A 4GMTH 4XBPB 3LQAC 1U95B 2E7HA 2X4PB 4HWBL 5HGAA 5MP6H 5EZOL 5I17B 2N56A 4PJ9A 1UM6H 4WFGD 3WS3B 4Q6IC 5T3XL 1N5AA 2VH5H 1MRCL 4Z0BL 5LVEA 3KR3H 2UWEE 4KJYB 1A6WH 3C5ZD 3HI5H 4PJ7A 4MSWA 4LAQH 1Q38A 2VXTL 4AQOA 4P9ML 1QOKA 1XF3B 4JB9H 3EGSB 2MKWA 1Q8MA 3LEYL 5HDQH 1UADC 3EZJB 3TFKC 2DLTA 5FOJA 5D93B 2AEPH 4JRWA 2BC4B 1A4KA 2FJFB 1UQSA 1CI5A 4EXKA 4OQTA 4JAMB 3FZUD 3QXAA 5ICZA 4IDJH 3A67H 5EUOA 3SGEI 3RNKB 3HB3C 3V5HB 1CR9H 1R5IA 3O4LE 4X6CE 5JW3H 2WBKA 1FFQA 3PJSA 1ES0B 4UQ3B 5H8DA 1Z2KA 1ETZB 3Q0HA 4U0QB 5F7DA 1NC2B 3MODH 3K1KC 4M61A 2PTTA 1VFOA 5FV1L 4HJ0D 1A0QH 3J7HA 1QLRA 2VZTA 4MJIB 1LO2H 4G42A 5L7XL 3UTTB 3LDBC 2ZPKH 2RBLA 1Z9LA 4KMTH 4K7PX 1OQXA 2EH8H 1WC7B 2FR4B 4ZXBC 3UYRH 4DOHE 1NCAH 3TJEH 4QRQA 5JHLH 2R1XA 4K3HA 4P4RB 3P0YL 3U4BL 2JCCF 4YDVB 3MJ6A 4MWFA 4PB9L 3ULVE 5FCSH 1KB5H 3DLQR 4AYFA 4AG4L 1SEQH 4U1JB 5D2NE 2H26A 2UY7A 1U8OA 3GSVA 1ODAA 4UT7L 4OFPA 1YEJL 1YEHH 5IP4A 1P7QA 5JO5A 1CE6A 1DQML 1MIEL 2HJFA 4YR6A 4X7SH 5TDOB 4WGWB 4X9BA 1AJ7L 4JRYD 4EBQL 4IOIA 2OMNA 2BDNL 1CN4A 1NFDB 3QFDB 1MFCH 4LVHC 1YN6A 3B83A 3LQZB 1I3RB 3KS0H 1U3HB 4L9DA 2QQKL 1EXUA 2HT3D 1ZLVK 3WFDH 3QH3A 3UTSA 1HH9B 5FKAB 5C0JB 4OI9A 2YUWA 4Z7NF 4OCSL 4MNQB 3P30H 4NGHL 2RR3A 4HIIB 4DQOL 3VFSB 2DB8A 3OX8A 5C7XH 1S7UB 4KJWC 3R1GL 1BEYL 1A6AA 4G3YL 5CZVH 2ZOLA 1U8LB 4RGOL 4PP2B 3IXTB 2P8PB 4Z7OE 1U3HD 2YPKB 4KRMB 4YBLB 1P2CB 2VDLH 3PABA 3TEUA 5IUSA 2YA2A 4K9EH 3GKZA 5E9DA 2XNAB 1XH3A 4LHJB 5JQ6L 1M6OA 4ORGA 1SJXA 2FD6H 4CJ0A 4KH2A 4MNQD 3HG1D 1DUYB 5J1SC 4YHPB 1YA5A 3OAYH 3IDMB 1KELL 3GSUB 1AO7E 4K7FB 5DR5H 2P5WA 2EIEA 4HIJA 4MNGE 1E6OL 5EPMA 5EZJA 2R8SH 5M95B 1CL7H 4Z7WB 2ICWJ 3OJVC 2Q76A 4L4TE 5F96H 1KULA 5CEZE 4NRYA 2V9QA 1RSFA 3U79A 3KHQA 4ESKA 3K7UA 4LF3B 1MCLA 2D7PA 4PD4K 3WE6A 4G80A 4K94L 4ZXBA 1MJ7L 2E9WA 1XT5A 5FYKD 4JDZA 4ZQKB 4D0DA 4ODHL 2OTUA 1ZA6A 1PBYA 3JVGA 4Y16B 1RQ5A 1A5FL 1HQRA 5F93C 5HDOA 2EC9T 1FAKT 1JGEA 3RWHA 3LZFL 4XCFH 5DJXA 2CR6A 4JR9L 1BFOA 1OSPH 1JF5A 1IM3A 4XC3H 4PV8A 2LV4A 5D7KD 1EGJH 3CXHK 3GMMA 4JFEA 4MZ2A 4M48H 1QLEH 4HS6B 4NNXA 1S7WA 3GI8L 4QRPB 4YHZL 1WZLA 1MFNA 2Q87A 1OF2A 3LPWA 2PF6A 4OJFL 1LMKA 3CK0L 5BZWA 1FRGL 1GGTA 4D0CB 1YQVH 4OF8A 5JA8B 4Y16D 1H8OA 3B2UD 2X70A 3GM8A 5KVEL 4LCCB 1KCRH 4J3OC 4KV5E 3HI1A 1K4DA 3NFNA 4O2FB 1MCJA 4WHDA 2ITCB 4QF1B 1T2QL 3IFNH 4K71C 4NOFA 4BZ1H 3T2PA 2X9YA 4M7KL 1NJ9B 1WBXA 4QRPD 5FB8B 4YXLH 1JUFB 4RGMC 1CXIA 3L3GA 3LN4A 4XVTH 4DVRH 2COQA 5F21B 4TOYL 1R6VA 4MCZA 5DD3H 1OTSD 1BAFL 2WIIB 2KKQA 3NVQA 5FYJU 5JPNB 2D31B 1BIIB 3ARSA 1P4IH 3TYGL 2IANA 5HYIA 3HZYA 1JWMB 5DC0A 4LVOC 1ZHNB 4ZPTB 4X5XA 4YDLB 5CBAB 1GOHA 3H0TB 3BKYL 1HWHB 3EYOA 2CO6B 3QDME 2MCG1 4LSPH 5I19H 4Q6YA 1DTUA 4D3CL 3D85D 4V1DA 5CEXB 5C86A 4DGVH 4KROB 4Z7QE 1EFXB 4Z7UE 1YEIH 2IBZX 3MXWL 3QFJB 3VRJB 2JJTC 3HE6C 3VGAC 4PRPB 4FQQA 1EEYA 3SN6N 4XP9L 2J4WH 1NGWB 4R97C 5F1IB 3ZSSA 3WIFA 3I6LE 4AM0A 5HHPA 4ZFOA 1UZ8B 4YHLL 2NY4D 2GCYA 4KK6C 1AGBB 3DETC 5FHBH 4GG6A 1KCUH 2FGWL 3K2UH 4JQIL 4XVSH 5B39G 1MY7A 1NCBH 3LRGA 3H3PH 4H1LB 4KROD 1EFXD 1NC4B 2E9IA 3DVNB 4HEPG 3BIKB 3QFJD 4JFOB 1Q1JL 2RCSH 2DQDH 3ARBB 4CDGC 3HC3L 3TWCH 2CIIA 3U46B 4H1LG 1IAMA 5IFJB 4JO4L 1FNEB 1MCCA 2AXFB 1BJ1H 1Q9WB 4ZTPH 1XGRA 2B0SH 2LABA 3IVKA 2HTKD 1R3JB 4CADA 1XIWC 3D48R 5ADPH 4F57L 4KKAC 5IVZA 1OWWA 5BVJB 4Q9QL 3ARBD 2P24B 2PW2B 5B8CB 1K3ZA 3QEUB 2BRQA 4GRWE 3VMOA 5IKCA 5GGUB 1OAQL 2D2OA 3ARUA 4TTDD 4NUGH 4D9RE 4G6MH 1GOFA 5FA4A 3AREC 1F6AB 5EOCH 4X99A 4LU5L 4Q58C 2XICA 5E8PA 2DKMA 3QWOA 4C83A 1NCWL 1S9XB 3ARQA 2CDGB 2A73A 3SGJC 3S37H 1SBSL 4FN0A 4X80L 3I3DA 3KG5A 3G5VA 5E99H 3BP4B 3MNVB 3MRKB 4ELMB 4XCEB 2CIKA 4A2LA 2V2TA 1XZ0B 3TO2A 2F53B 2JJTA 3ME0A 5D7IA 3Q5TA 5F7YC 1P7KA 4DKFH 1M71A 5FYKH 4OFYD 3VWJC 1FP5A 2YA1A 4FFZL 3R8QA 1VACB 2A6KB 3ARFC 1U8IB 1T20B 3MROB 1RZFL 4YZFF 2DQFB 2HLAA 4XHJC 3P0VH 4HUVB 3BO8B 4RA0C 4ERSL 1KEML 1SVZA 1QBMH 2VL4A 1FSKC 3FTGB 1JMZA 1TVHB 4OV6F 1CFTB 1NAMB 2X7LA 3NCFB 5DJCA 1A7QL 5EIQA 2P8LA 3HMWL 2F53D 4F7MB 2BNUA 4H0GA 1DL7H 1JTOA 1CVSC 2YKLL 3V7AG 5J3HC 2OQJB 2VQ1B 3BSZH 2W9EH 4QWWD 3WO3B 4ONFH 2Q6WA 3KPSD 3T2OA 2F74B 5HVHB 1G9NL 4KUZH 5F89A 4WEUD 3WEXB 3H9HB 5FUOH 3BVNA 2X1QA 3HC0A 4X6DA 1BMGA 2ED9A 5E56A 1XIWA 3KNBA 4CMMA 3G04B 4P46C 4EZMA 1CQYA 4O2CB 2P7TB 3CH1A 4Y19A 3CFKB 3GGWB 4JKPL 3DXAE 4XVUD 1WEJL 3LKRB 3RX7A 3HUJA 4U1IA 2AJXL 4S1RL 1JBJA 4PJIE 2EIZA 3M17B 2IPTH 5BW7A 3EFFA 2EYSA 2OL3L 2HFFA 1FNFA 1DN0B 3DX9A 2OYPA 3QUYA 1FNLA 4ZFFB 2Z35B 4QOKA 5IHUL 1A22B 2E7BA 1N2RB 1UA6L 5DUPH 4M1GL 3CC5A 4XXCC 3WXWH 3AS2A 1I1AB 3SKNA 3V7MA 4K9EC 2JK5A 4R96A 1X44A 4PY8I 1MCIA 4YO0B 1HHGA 1I8IB 3D5OF 3SGJA 2I5YL 2NY2C 2VXSH 2CSPA 4R8WL 5IMKA 3MFGB 1S78D 5C0EA 5FF6B 1MH5A 2E7CA 3N9GL 1NGZA 4Z7VE 1FZJA 3QCUH 3DV6A 3MJ7A 4S1QL 2R4SH 5F1OB 5D71L 4LSSL 1TZGL 3BW9A 3VWJA 1HINH 1I1CA 4PJEE 1I1AD 5D9SB 3VWKC 1KGCD 3ARFA 3PGFH 3KXFB 3PWNB 2FGZA 2DQTL 3CU7A 1TTFA 5JMOC 4FQLL 2XA8H 3S97C 2VERN 2OJZH 1I3UA 3QCVH 4L3EB 4N0UA 4XX1E 3RPIB 1PSKH 2EXYC 4WDIB 4M5ZH 3GSQA 2AV7A 4RCAA 4KKLC 3T8XB 5IMLB 1J0KA 2A2QT 4BSVA 3M45A 1KENH 2H3NB 3VFOA 5IMMA 5F7MC 3IFOB 2R0LL 4R2GB 2AJUH 4H1LH 3PWLB 1NMBH 3X3FL 4X4YA 3RWIB 3HRPA 3WO4B 2YUZA 4ELKB 4L3ED 1QSVA 5L88L 3C5ZC 2M1KA 3HTLX 3ET9F 1PEZA 4ODVH 1KTLB 3RX8A 5CJOL 2BNRA 1U8QB 4P46A 5DQDH 5EBWA 1A7NL 5F70A 3MRRA 4NN6B 1CT8B 3PWJA 5I8OL 2PYEB 3TV3H 1YMMB 2VXUL 4QHKJ 4R4ND 1S7XA 5DJZA 3QEQE 3FZUC 3KPOA 3CH8A 1KTKE 4UU9A 5IF0B 2ATKB 3NCJL 4Q74A 35C8H 1CFBA 3O3EB 3O9WB 5DI8B 4QHLA 4XXCA 3EO9H 2P49B 3S96B 5KVGL 5D7LA 1U41A 5D7SL 1RY7B 1A7BA 5FKPA 3U4EB 4PJCE 4GKNA 5D96B 4QXGL 1MHHB 1CFNB 1GRWA 1AKJA 4G8FA 3BISA 2F19L 4OSUH 1YMMD 3BGMA 5CJXC 1FCCA 1NUFA 2Y06L 2YD9A 5GRJH 5IT2L 2VUOA 2AK1H 4FRWA 1F4WL 4OD1L 2AJYH 2VLKB 3O9WD 4YDIL 5IVXE 5DK0B 4XT1C 5C9JA 1WZMA 3VWKA 4FQXC 1NCCL 5JDJA 1WZ1H 3VFGH 2BY3A 3KYKL 3TJHC 1IBGL 4I5BB 4NP4L 2EDEA 1I7TA 3EJZD 3JWOL 2W0FA 3S36X 4OZGE 2MQ0A 3X11B 5IV2A 1PQZB 2FLBT 4HKBA 5CP7A 2KL6A 3TBVB 2VLKD 3O11B 4UIKL 3O2VL 1RULH 2WANA 4KQ3L 4KZDL 3LEVH 4MA8H 4NQVB 5IMOB 2DI9A 4NNPL 3WD5L 1DN2A 1Q0XL 2VLRA 1NDMA 2BVYA 4X5WB 3BZ4B 4PJ7E 2G5BB 4NQXA 4R26L 3OGCB 5GS0L 2HT3C 1S9VB 2E9BA 3O8XD 2ICEA 3C5ZA 1F2XK 1QFUH 5FO7B 3X3GH 3F5WA 3QNZB 3QEHB 1PGRB 4QHMB 5BOPA 4LVEA 1OM3H 1C7SA 3TT3H 5ACLA 4L9LA 4PJBB 3SDDB 1I7UB 2AJZB 1T1XA 1CICA 1JYXA 4WFHD 3GBNH 3SKJH 1G9ML 3WMSA 4BKLA 4XMKL 2HJKB 5F6IB 5EUOE 5CUSH 3EOAA 1RK0A 4OKVA 4N9GA 3U36B 4JPWL 3MRBB 5F3HB 3MYZA 5LBSH 1A6UH 3VCLB 3MNWB 4DN4L 4P59L 4DEPB 2X9WA 3SDDD 1YY8A 3BH9A 1OTUD 4MYWB 1JNHB 5MENA 1KN4L 1VSCA 2H2PD 3MLXL 5CJXA 3AY4A 4CL7A 1FVEA 4ZO9A 1A1NA 2GUOA 1CGWA 5KS9B 3QG6B 5DD6B 1T03H 4ACPA 3NN8A 3TA3D 5EBMA 5ESQA 1A3LH 2DLGA 2GIYA 1QTYT 3BKML 4FQXA 2ADGA 4K3JH 1IC5L 4QTHB 4AQ1B 2VIRA 2YD1A 4JG1L 1VEPA 1RURL 4H8WC 3MV9A 5IFHH 5T3ZL 2L7UA 3GMNB 4M6OH 4WNQA 1YUHB 4PRBB 3SDCB 1MEXH 2CGRH 3WL9A 1X5JA 5ADOH 4G6JL 2VDOL 5MEQB 3FT2A 3ULVL 4HS3B 1VKXA 4RMWA 3S3PA 1RZIA 5MEPB 1JPSH 1TJIL 3F7YB 4FQ1H 1QUNA 5JPMB 4FHBD 2XZAH 5F6HJ 4O02H 5EC2A 4ZD3H 4P2OB 4JRYA 5BV7L 4HH9A 5C0CA 5FYJH 2HRLA 5K9JL 4FP8L 2VDKL 2FIRT 4Y16C 2DIJA 4RISH 4EOWH 5T5FH 3BPLC 3B2UC 5IB5B 4NJ9L 5CZKA 3SDCD 4M1DL 4L8SB 1JHTA 1ZXQA 4X8JB 1WBZB 2CMRH 4ZFZB 1A8JH 4HX1A 3HMXL 1MWAB 3BUYA 3WV0A 3C6SB 4J3UA 1W8NA 4BQBA 2DQJL 4C58B 1HHJB 1GJIA 3SCMB 4CVXA 1CD1A 3K2MC 4KTEL 4GAGL 4P2OD 1VGKA 4EEEA 4HF5L 2FEEI 2AJ3B 5E2VH 4XAWL 2FX7H 4G5ZL 2XWBA 4QYOB 5JORB 3TNNA 4PJAF 4JPVH 1TTUA 1XR8A 4YHML 5E9DE 3BRFA 4X6CF 2G5RA 5C0GA 4U6HA 2XQYK 3RVTC 2YBRA 3JWDH 4APQC 1OCWL 3L1OL 5A16A 1W72B 3QIWB 3SCMD 3HG1A 1AGFA 1Y6NR 3QA3B 2BFVL 3GDBA 4GAYA 4AT6A 1SY6L 2P5WE 3TPUA 1MREL 1NGPH 3BD5A 2X4SA 3SDXB 1F58H 5LWYH 3UJJH 1KN2H 5DUMH 5FECB 3OV6A 3ULVF 1MHCB 5KOVC 5F7EH 1IEBB 3QIWD 4LASH 2NY4C 4P9HH 1T22B 3UTQB 1FIEA 4RDQG 2EICA 3VW3L 2ZSVA 5DMJB 5A1AA 3WUZA 2H45A 5HHMB 3GK8H 4UILL 4JFEE 3MGTA 3PV7A 4PJ5A 3DI2B 1J0ZA 1EO8L 1GGYA 2H6PA 1A1OB 4BZ2H 4HCRH 4XTRD 4DZ8A 1JHLH 3QYCA 4WI5A 4XPBL 2A1WL 2ADIB 2VABA 4M1CD 2GSGB 2JB6B 2P47B 4I9WD 1PZUB 4UOW1 5E1AA 5HHMD 2QHRL 4OM0H 3UCRA 3STZA 3Q1SH 1CLOL 2UVFA 3S3JA 4U3CA 4WW2F 5I66A 1RVFH 4JLRB 1T7ZA 1M7DB 2ZCKH 3QUKB 5IB4A 3THML 2BJML 5EOQH 4ODSH 4QRSB 2IG2L 1BFVH 3EO0A 4QTIH 1CLYH 3KPTA 5I1EH 4Y5VB 1JHKH 4ZTOH 2XQBH 1DQLH 1ZA3B 4APQA 2J6EA 3DGGB 1SEBB 4UNTA 5C8JB 5T1DH 3HC4L 3E8UL 4V1DE 5T1LB 5AZEH 2D7MA 3DROA 2BSTB 3Q5YA 2W59A 1GHFH 4PJXF 4JFFA 4ETQB 1UEMA 1FVDB 3O3DA 2XI9A 1GH7A 1U8KB 2VL5A 3IJHA 2R2BB 4B0MM 5C07D 2B7DT 2FHCA 3LS4L 4GG6E 1QFWH 5INCB 4PGJA 3VMPA 5GHWL 4CU7A 3GMQB 4LLMA 1ADQH 3DX8A 5C92A 3M8OH 3ARDC 4ODUA 3DX7B 2MKLC 5L6YL 5INDB 4JRXB 1S8DB 4XXDA 2EDRA 4G8EA 5EZOH 4ODXA 1U8HA 5B39A 2VJXA 3WDHA 3T0EB 1MRCH 4Z0BH 3CXHJ 1DEEA 1H3GA 5EO9B 1BQSA 3RVUD 1OAUH 2FECL 2QSVA 4QWWC 1P4BL 2VXTH 1QQDA 2QHLA 4LCWD 5CINL 4P9MH 3F7QA 4AY0A 1G0YR 1D9KC 3BD3A 1JF1B 1BBJA 5BS0B 1B6UA 3KPQB 4L5FL 3LEYH 1AH1A 1PG7W 2WINB 1ITCA 3PWPB 4TSCL 4HUWB 1RZ7L 1DQJB 4JRXD 4IHOB 2DWEB 2EDDA 3S35L 5CMAA 1T83C 5GQBA 1LK2A 4X9GA 3D87B 3TBYB 3MR9A 3T0ED 2GFBA 4XVUC 4LLUB 5IW6B 3PDOB 1BQUA 4NQEB 2DLHA 5EC1B 5E7BA 3GMLB 5HVHC 4U6VL 2MJWA 3LKNB 3V5DA 3OKLA 4KTYA 3U7WL 2W92A 4YDKH 1YY9C 5BS0D 1X5GA 3FOLB 5F9WC 4U3HA 3SE3C 5DJ2A 4QRTB 4UDUA 2DQCL 5F7LB 5DD1L 4YWGL 1TZHA 1IQWL 4ZG1A 2O5ZH 5M94B 1DE4A 5GGTA 4FZEL 1PZ5A 1FO0L 3ZDYE 4YH6A 4BQ8A 1HH6A 3VH8A 3UPAA 4DVBB 1OP3K 5DVOA 5L7XH 4KTDL 5H37G 4RFNB 1S78C 3NIGE 3AFLA 4XH2A 1X5FA 2BRRL 5C9KA 5LGJA 5D7IE 4JO1L 3CXDL 3P0YH 4JPIA 1AC6A 3DVIA 3PQYB 3U4BH 1XCQA 3BIAX 4PB9H 5CKGA 5AG9A 1MCDA 3QDHA 3W81A 1OGAB 2LU4A 1LD9B 2DJUA 3N85H 4L3CA 4AG4H 2WBJD 1EUUA 1ZWIA 5B38A 5FGBC 5E94B 5IVOA 1QSFB 2DBLL 4GQ9H 3X14A 4UT7H 3S7GA 3GEWB 3ARDA 4J1UB 1MIEH 5D2LB 3G5ZB 1UYWL 1CXKA 5FM5M 1AJ7H 3MRFA 4P4KC 4PJFB 4EBQH 3VFTB 5F71A 4OZ4B 5L8LB 3TZVD 3FQTA 3HI6H 1OGAD 2QQKH 2BSRB 4L4VA 2R9HC 4TNWK 5HVFB 1QSFD 1D9KA 1UH3A 5IW3A 1MIMH 3RVVC 1P1ZA 3GIVB 4X6DE 4OCSH 1R5VA 1LILA 1S7TB 3L3KA 5BZDA 3G5YA 2YS4A 4NGHH 4DQOH 4DN3L 5A2LH 5TH2B 4HKXA 1BEYH 4C55A 3KHOA 3VG0L 2BVUA 4G3YH 4KDWA 4MAYA 1T83A 4Y19E 4LHUB 3U82B 2CLZA 4RGOH 4PRIB 3WUWB 1EEZA 3DYMA 1R24A 3HUJE 3PHQA 3VFUA 1QRNA 3RZCA 2BVOB 2W60A 5IJKC 3HZMB 3ZHKA 1AHWA 4PGDB 4GRMA 5B22A 5H35A 3D39A 4QOKE 1RJZB 3MJ9H 3PUCA 3WN5B 5SV3A 3B9AA 5E00B 4R4NC 4LSRL 1REIA 4HC1L 3WUWG 3WO4C 4HJGA 4ONGL 3SE3A 2GTWA 3MRIB 5JXED 1XF5B 5J7CC 3OR7A 5I1JL 5CILL 1KELH 5MERB 1E6OH 5ICYA 4CKVX 1VPOL 1IMHC 3KGRA 3MRNA 4PRID 2D0GA 3LVEA 5DRXB 3JWDC 3V0VA 3ZDXF 2FJGB 2DLFL 1CL7I 4EUPH 1ZVSB 2A9ML 1F90L 3HPLB 4LFHG 1QSEA 2D4FA 5FCUL 1MJ7H 2VAAB 4FFVD 1D3CA 5DD5L 4EN3B 5ID0A 2OZ4A 4Y4KB 1NL0L 1XGTB 1BM3L 4ZOAA 4Q7DA 4XZUB 2WLYA 4LFHD 1A5FH 4ZUUB 2XRAL 1FFOA 3LZFH 4JR9H 3M07A 5HBBA 5TE6L 1F00I 4UOJA 5D96C 3PNWA 5C71A 3H7BA 4QNPE 4P9HC 5B3JE 4PLKC 3HLAB 4N0UE 1QFOA 1XGUA 1HXYB 3C6LB 3EJZC 3GI8H 4P57A 4Y4FC 4YHKL 4YHZH 5F9JA 4Y4KD 4P4KA 1H0DA 3B5GA 3QWQB 4LEOB 4OJFH 1PLGL 1FRGH 3TBSA 3IDGA 2WIMA 1CGYA 1A2YA 2APWA 2EYRA 4YPGA 5KVEH 1ZT1A 4L1HA 3OKEB 1DR9A 1FFNB 1WLHA 4MJ5B 4AEEA 2Z8WC 1QR1B 3VA2C 3MLTB 4CGTA 1UACL 1JWUB 3O8XC 5B3NA 3ARZA 2I26N 4M7KH 3PDGA 2BNRE 4WU7A 4XPTH 4ALAH 1UXWB 3GUTB 5DJ0B 5BQ7B 4G6FD 4WHTB 5CBEA 5DEZA 2PKDA 2ZG1A 5I16B 3UTPE 4TOYH 5LQBL 4V2BA 1MFAL 3VXMB 1BAFH 5JMRA 5IJKA 2P5EA 4DFIA 5F3BA 3TYGH 1FG2A 2XT1B 5ALBH 1CF8L 3U9UB 5I1GL 3NGBC 2XN9A 1EVUA 2ZG3A 3K81A 4KAQL 2NY3C 3WIHA 2FJHB 5HPMA 1YZZA 3BKYH 4MNHA 4NBXB 5D7LE 4AENB 1KTRL 4D3CH 4PRAB 4L29A 5IB3B 4R90H 5ENWA 3CFDA 4YDJB 3RUGB 4KI5F 5DRNA 5DZOA 2ATPA 3MXWH 5F1KC 3B9EA 1OTUC 4EDXA 3KPMA 5LAXA 5K9OB 3IFLL 1V3JA 3BDYL 4XP9H 2XWTA 3TPKA 1N6QL 2H2PC 4PJEF 3NCMA 5H37H 4JZOA 5JHDB 4RMQA 1IL1B 4YE4L 2B20A 2Z4QB 3T04D 3PHOB 2X05A 4NQCD 3G9VA 2YXMA 2FGWH 1RFDL 1A4JA 2BVTA 3V6FA 3TA3C 4B7LA 1JGLL 1OW0C 4JQXC 5DUBA 3DIFB 4YFDB 1NLDL 4EJ1C 1Q1JH 3UTOA 4NWUL 5C3LD 3GB7B 2C7UA 2XWJB 3HC3H 2PNDA 4Y4FA 4LLAA 2BCKB 5JHDD 2ED7A 4JO4H 5J1AB 1FVCB 4MA3B 5HHNA 3QISA 4DKEH 1OAXL 4WTZG 1TJGL 3ROLB 2I9TB 2HG5A 1Q72L 2ZWLT 1P9MC 5HDBE 4NN7B 2D3VA 3MGAA 2VLRE 3QJHA 4P5KA 4WFGE 3TYFA 4F57H 4IRJC 5I74B 4FQIL 1QNZL 3BFOA 4HCRA 2CXGA 3TCLA 4WU5A 1BGXL 4Q9QH 1E27A 5C0ND 5I76B 3DYOA 3HFML 1R3HB 3O8XA 1A9EB 1LO5A 4PGBA 1OAQH 4HWZA 2ZUXA 4TVSa 3RA7L 2E6QA 2K3TA 3EYFB 2YPLA 1KNOA 2V9TA 4LU5H 1MCOL 3QQNA 1YYML 3FO0L 1NCWH 4KPHH 3WFCH 1MFEL 4YHNA 1SBSH 2DKSA 3L7EB 3CFEB 4OQTL 5DMKA 5AAWA 3L6FB 3QPXL 5DJYB 4YXKL 2QR0A 2RGSA 1VERA 3T4YA 4U1HB 5MENE 2ID5A 6CGTA 1HNFA 4U6YA 3RIAF 3QDJB 3BP5A 2LQRA 4G43A 2Z0BA 4FFZH 4I0PA 1HKFA 1AQDB 1RJLA 4W6XB 3MUJA 2AQ2A 5MHSD 5DVMA 1M7IB 3TVMD 4GFTB 3HRZA 4LKXB 5FV2A 3TA3A 1Z0MA 4ERSH 1AD9B 1KEMH 3QQ3A 5D7JD 3SKOA 3MRDB 4WHYG 4JQXA 2DMBA 4GG8A 3MV9E 3QIWC 4LDOB 5EUKA 1A7QH 3MLSL 3RWDB 1L9NA 5TDNA 4MHHG 1OL0A 4PR5A 2VZVA 1G6VK 3B3IA 5DRWB 2YKLH 1ADQA 2NTFA 4A6YA 2UWEB 4MS8D 1G9NH 2HTLD 3B2VL 1T1WB 3TO4D 3H42L 4P2QD 4ZPVA 2DQUH 1I3VA 1UZ6E 3G6AB 4HWBA 2J5LB 3SEPA 3AS0A 4PJ7F 4JRYE 5C0CE 1P9MA 3GO1L 1IT9L 2X4UB 4IEFB 4IRJA 4H5SA 4HLJA 4UQ2A 5IG7B 2D4DA 4LCYB 3KPPB 1K6QL 4M1CC 4JKPH 2WV3A 3ZTJG 1WEJH 2NZIA 7FABL 4JVPA 2AJXH 3QULA 4S1RH 4JJ5A 1AGDB 1PG7L 3ZT5A 1TXKA 2QEJA 5IIEB 4PLNC 2OL3H 4LCIL 2AXJA 2UZIL 5BOZG 3DUHA 1GYAA 1A21A 5IHUH 2EYTA 2X44D 1ZS8B 3GJFH 5EUOF 3O4LB 4YQXL 5BJTA 4AMKL 1UA6H 2X1PA 1CS6A 5I8EA 4KRNA 4RAUA 3OTTA 4I3SH 3SO3B 1U92A 5IOPB 4YNYA 4PLJD 1T1YA 2I5YH 1FZKA 5AD0B 1NCNA 4R8WH 1EAPA 4J4PC 5FEBA 1MCKA 4YGAB 1D5ZB 1T80A 1A64A 3HG1E 1MF2L 3ROOB 4DOHB 4S1QH 1HSAB 2FZ3A 4Z9KB 5FO8B 3O4LD 2Z93A 1MFDL 3P9MA 4LSSH 4UIMB 4JGMA 1A7OL 2EEBA 4HG4K 1PY4A 4EI5C 2WLZA 2FCBA 4UAOB 1X5AA 2DQTH 2QQNL 3DO7A 1I7RB 4FQLH 4JKWA 3CX5K 4LSTL 4WHCA 5FYKE 4MA7L 2QSQA 5T3ZD 1AD0B 3KPRA 4NO0B 2AXGB 1O0VA 4NO3B 2HFGH 3REWB 5C08A 3ULVD 4TSAH 3IJSA 2P8MA 2Y25A 5D7KE 4QCIB 1YEDA 1G7PB 2R0LH 4PJ5E 4BFBD 3MRMA 4ONHB 2XZCL 1KPVA 3ULSA 4N8VG 1XGPB 1L0XA 3ELAT 1X5KA 4MMZC 1DLFL 2C3XA 4XI5D 2OCFD 4JZNA 5D5MB 5FDWB 4QRRA 2DL9A 3RVUC 2AAVA 3T0AA 2QADB 3G6JF 4NO0D 4OGYH 3K0WA 5D72L 3WKNA 5CJOH 4AIOA 5HPOA 4GW5B 3FQRB 2OJEA 1A7NH 4XWOD 5B4MD 2R23A 5K33A 5DMGC 3OKNB 5I8OH 2ICES 2AGJL 1HSBB 1NGQL 2FNBA 5J6GB 2VXUH 1JYVA 3NCYP 1JN6A 3VJ6A 3RWCA 4FXGB 5FUZH 1A7RL 1K8DB 1PFCA 3NCYS 2QADD 1QO3A 1IFHH 3OJDA 4QT5A 1BQLL 3WFHA 4D9QE 1AO7B 3ORJA 4HK0B 5KVGH 5D7SH 3Q2CA 1I8LA 2UYLA 3T3PE 2JLLA 4MNGB 4U1KA 1MCFA 1A1MB 1W0WB 1V5JA 4I48B 4QXGH 4L4TB 5CEYA 1Y18A 1XCTB 4J4PA 3DI3B 1WSST 4X7TB 1WCBA 1OT1A 4WWKB 2QQQA 2WP3O 3CDGA 5D6CB 2WP3T 5IT2H 4NUJB 4TN9A 3QUMB 4IRSB 3GSNB 3BIBX 4WGVB 1F4WH 3IDIB 3FMGL 1AO7D 4EUPA 5AWNL 3ZMRA 1MOEA 4WWID 4EI5A 2CK2A 4G6AD 4L4TD 3VXNB 5CEZD 1I85C 1PAMA 3KYKH 4K3DH 5EO1A 3UJTL 2FHFA 4F7PB 2UV3A 1IBGH 2NZ9C 4FA8A 3TBTA 4G8IA 4HK3N 4W4OC 4NP4H 4WWKD 1NDGB 3I02B 4HPYL 3JWOH 1RU9L 2IEPA 32C2B 3BMWA 2WBJC 4U1MB 1OP5K 3OKOB 1HZHL 1F6LL 2BOCA 4WHYH 5DYOB 1X5HA 4UIKH 3O2VH 4PGCB 1LE9A 3HN3A 4I3RL 3QSKB 3BJ91 4F58L 3FO2B 3IT8D 5IM7A 4LIQL 4NNPH 3WD5H 3QI9D 4NHCL 1Q0XH 2O61A 3TZVC 2BNQA 4L8DA 4PRNA 4MXQC 1U8NA 1KLGB 4R26H 5GS0H 5T5NF 4JFYB 4WCYL 5BXFA 1FNGA 2AXHA 5J13B 4LGRB 4LCWA 3VG9B 1YN7B 1DJSA 1F6FB 1M1SA 3OKDB 3FB6B 5J12B 3N1MC 3CNKA 2E8YA 5M7QA 3AXLB 3DURB 5DS8B 5FGCE 1Q9KB 3JTSB 5EORL 1X7QB 5I1LA 1PYWA 5IESL 1N7ML 1I4FA 5GIRB 1YNTA 1U58A 1CFQA 1I8KB 3FT4A 1T2XA 1G9MH 3MMEB 2FLRT 3O4OB 4QEGA 3L3DB 3LD8C 3P9LB 1S7VB 3TH2T 1LO0H 4K8RD 3QDMB 4JPWH 3E6HA 1ZHLB 4FQHB 2C3HA 4OD2B 3T4AA 4DN4H 4P59H 1NGXB 5GRUL 3ARGA 1SJHB 4Z7UB 4KRPC 1T04A 4G6KL 1T0MA 4PG2A 2NMSA 4JHBA 5ICXA 1BVZA 3HS0B 1FN4A 5HHQA 1KN4H 3MLXH 3FO9A 3ARTA 5E1HB 3O0RL 2DQEH 4HEME 3ZTNL 2GW5A 1F4YL 3QDMD 3BAEL 1VADA 2R56L 3ALWA 4DZBA 4NFBA 4ZUWA 4LPYA 4QXTB 3KJ6L 4EIZC 4NZTL 2UZYB 4UNUA 4JG1H 1RURH 1I85A 2JIXA 1D6VL 3QHFH 5DJAA 4U6XB 5T3ZH 5D1ZC 4W4OA 2HJLA 4LSVH 3PIQA 5H94B 5AYQA 3QUZC 2VDOH 4G6JH 2W0KA 3I6LD 3MOBL 1EHAA 3ULVH 4XBEH 2DL2A 2H8PB 1TJIH 1HEZB 1IGFL 2YC1B 5IHZB 3MLZH 4CW1B 4N0YL 3LPFA 3T0BA 2GJZA 1UXSB 5KSAB 4Y4KC 5K9JH 4FP8H 2VDKH 3LHPH 1G9NC 3E6FB 4YBQD 4NJ9H 4M1DH 5DRZB 4X4XA 1TNMA 1NSNL 4R3SA 3BXNA 4GRWB 4M6ML 1UKSA 3MJ8A 3IJYB 4LPXA 3HMXH 5DLMH 2GI7A 5GS2H 2DQJH 4X7CC 3WFBH 1H15B 5JDSA 4KTEH 1AGEB 2CJUH 4GAGH 1KIRA 3RQ3A 4PUBL 5KSAD 4HF5H 4XAWH 5HTSA 4G5ZH 1QRNE 3REVB 3CCHB 4KJYA 3IDJA 2C1OB 4D9LL 1RUPH 4YHMH 2CDEB 1JVKA 1UJ3B 4OCMC 3FQNB 4YAQB 3D69B 2XOTA 3ZYJA 4F2MB 1MCSA 3SO5A 4JCMA 4XNMB 1XGQA 3PP3H 3L1OH 1ZGLB 4LQFL 4HJJH 5HGBB 4NDMA 4CUCA 1KXQE 2AW2A 2BOBB 1G7QA 1AFVL 2BFVH 3KLAA 4WO4B 4DCQB 1SY6H 2FJFA 5FUCE 1LEGB 1MREH 4HMEA 1AGCB 1PX3A 2R15A 3W9DB 1AIFB 2V9RA 5FA3B 4WI9A 1QSEE 4CNIB 3VA6A 3MO1B 2ORBL 4GKOA 3UTZB 1UH4A 3QUXC 3KYMA 3VXRA 4WO4D 1INEL 3K4AA 3VW3H 5D1ZA 3SKUD 1NUGA 3GSNH 4IM8A 3RKDD 1FL6A 2IC2A 4W6WB 3QUZA 3UTTA 5JA9A 4UILH 2FEDC 5AUMA 1G6RB 2VISA 4ETYA 1YEFL 5TGBB 1EO8H 4HV8B 3RWFA 3C5SA 2YRPA 3G9AB 4XCNB 1ROWA 2AI0L 4Z0XB 3WLWC 1B6DA 1IILE 1KJ3L 3FN9A 3RU8L 2BX5A 1DBAL 5DK3A 4J2XA 3UPRB 4P2RA 4XPBH 5DVNA 2A1WH 2G9HA 4LMQE 3DMMB 5J0BA 4X6DF 1C1EL 4HGWB 4O5LL 2C9AA 3DXAB 5DEGA 3DVGA 4YLQT 4Z95L 3CZFB 4GAJL 2QHRH 5HD8C 4PJIB 5FYJE 1A7PL 3C8KA 4LL9A 3MUGA 1KIPA 5CWSA 3HUJF 2BP3A 5C0NC 1CLOH 5DJ6B 5JOFB 2GAZA 5I15L 1A6VL 4OLWH 3GMPB 4Y5YB 4QHUA 3DMMD 3NPSB 1HYSD 4TVPL 2BJMH 3VXSD 2P5EE 2IG2H 3DXAD 3QXWA 2WUCL 4YBHA 25C8L 5FFLA 1NBYA 2WMPA 4TPRL 4MGXA 3GJFA 2XN9E 3O3BA 1CWVA 3IRZA 3NFPB 1MAKA 4Z7VB 1ZVHA 5LGKA 4Y4HB 1S7UA 3QG7L 2EO1A 2GT9B 1W8OA 1QR4A 4PJDA 4N1HB 3HC4H 4HGKC 3FB7A 4EXPX 3E8UH 2AERT 5EFIA 3P11L 1YECL 4PJEB 3CVHL 5I2IA 5CIPA 1KPUA 5DEFB 1PKQE 1QHPA 4P49A 3VGEA 3EYVA 1J1OL 1AR2A 5CSZB 3F7VB 4PBVC 4YHPA 3QUXA 3LS4H 1ACYL 1KTDB 3MRCA 4KI5D 3A6CL 3V4PL 4NQCA 1QFWI 5E08H 1BLNB 3TVMC 1N6VA 1J87A 1IKFL 4QNPF 4IOFC 5B3JF 1E0OB 1MJJB 5D7JC 3FONB 4NKOA 5L6YH 1FORH 2HLFD 2C3VA 4XX1G 3K74B 3JWOC 4R4BA 1Q9OA 3MA7B 4ENED 1FC2D 4JHAL 3ZE2F 4O9HL 4OFDA 1P4BH 1S5IH 5EIIB 5CINH 2HTLC 4OFKA 2ZUWA 3S34L 5I6XC 1A14L 3TO4C 4AEIH 3RL2A 4L5FH 4FXLA 2DLEA 2Q8AL 1KPRA 1JP5A 3AROA 1CBVL 2WK2A 1TVBB 5DHVH 4TSCH 4NNYB 1IGTB 1I7ZA 1RZ7H 5GS0C 1P84J 3F8UB 3S35H 2XTJE 5ERWB 4WTZA 5ILTH 3B4NA 4QRUA 2Z8VC 1WIPA 1LE5B 3QEQB 3VFMA 4HH8A 5I8CA 3CFCL 3MRLA 5GJSL 2AK4A 1CVRA 2YPLE 2ZNWA 5ITFA 3U7WH 1T0NB 2IALA 43C9A 3G5XB 1MI5B 4PJCB 4MCYB 2MPAL 3O41B 2R39A 1G9MC 5ID1A 4EQ2A 4WFHE 5CHNA 2DQCH 5DD1H 3N06B 5TDPB 5E95B 3TBWA 1IQWH 1MVUB 5TQ0L 2HVKA 3M1BA 2NR6D 3T09A 4BFEA 3SKMA 3BP7B 3QEQD 3SY0B 1LNUB 4HXAL 3QZWB 3IF1B 4KTDH 3QCTL 1T1ZA 3WHE1 2BRRH 1MY5A 5IVXB 3MV7A 3DV4A 1MRFH 4JO1H 2MFNA 2A6JA 5GGRA 1Y6KR 3QZWG 2V17L 4HAGA 1HQ4A 1JWMA 3HAEB 2I24N 3P77B 5JXAL 3P40A 3D2UB 1G7LA 3JTTB 4LKCB 4MXWL 4OZGB 5A2JH 2PO6B 2DBLH 3MGOA 4XPAH 3TVMA 5GS1B 2VDPH 4Y5XC 3V52H 3GBML 3HAEG 5D7JA 5JZ7C 3VRJA 2FBJL 5HGAB 5C6WH 3ESUF 1WBYA 4PJ9B 4PRPA 2ED8A 1QLFA 1N5AB 3FKUS 1ZE3C 1JGVL 3QNXA 3RGHA 4C4KO 4C4KT 2WUBL 2H32A 3ULVC 1V7NL 2DWDA 4PJ7B 4MSWB 3HR6A 4O00A 3QT2A 3F12A 3D2UD 5HDBF 3AGVA