1I9RH

Structure of cd40l in complex with the fab fragment of humanized 5c8 antibody
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
219
structure length
219
Chain Sequence
QVQLVQSGAEVVKPGASVKLSCKASGYIFTSYYMYWVKQAPGQGLEWIGEINPSNGDTNFNEKFKSKATLTVDKSASTAYMELSSLRSEDTAVYYCTRSDGRNDMDSWGQGTLVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of CD40 ligand in complex with the Fab fragment of a neutralizing humanized antibody.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cytokine/immune system
molecule keywords CD40 LIGAND
total genus 39
structure length 219
sequence length 219
chains with identical sequence K, X
ec nomenclature
pdb deposition date 2001-03-20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1i9rH02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1i9rH01
4R7NA 1WJ3A 4RFEB 1WCQA 3HC3H 1WBXA 3MNZA 1BIIB 2GUOB 2YK1H 1DQDL 4M4PA 4JKLA 4IS6B 1H3UA 1HYSC 2ZOKB 4ESKA 1MJUH 4WEBL 4GRWE 3DTXA 1OARH 2MCPL 3CFEB 3DURB 1B2WL 2BZDA 4CADB 1D9KA 3MRJB 1FPTL 1BF8A 4Y4KD 4NQVA 1UM5H 3HE7B 3VXRD 5HVHB 1AGCA 4XPHL 2B7DT 5EUOB 1KIPB 3KG5A 1YEJH 4JAMA 1P5VA 2CDEB 1GAFL 4ZD3L 4U6XB 2FX8H 4NNXB 3L3JB 2IJ0C 1AR1D 4NKOA 4GKZA 4FQQB 4ZO6A 5C08A 3MV01 4QTIL 4F2MB 1I1AC 1EJOL 3GIVB 3KPRD 3N85L 4KMTH 3ZTJG 5FO7A 3QAZB 1RK0B 4XAKD 2GJZB 3I2CH 3O9WD 5D7LE 4NNYB 2Z31A 1UM4L 5SWZE 5I1CL 4NQTA 5T5FL 3ULUF 5A3ID 4MA3A 1YN7B 4KTDL 3RWEA 4F15B 1JE6A 2HFGL 1EO8L 1OW0C 4JN1H 5JW5A 4YQXH 5EULV 3H3BC 4A6YH 3AAZA 4NHCH 2AJVH 3MNVA 4LCCB 4RMVA 2N56A 1X5AA 4I48B 5FOJA 1JCKA 4P9ML 3UTQB 3P4NA 2I25N 3ZE0E 4K3HA 4P2QB 1UACL 3LKNB 5D2NC 4V1DD 2P45B 2YD5A 2K3TA 4NUGL 4WWID 5FYKE 5HHOA 3VXTB 1EEYA 1NC2A 4JDVA 5CEZE 1KOAA 4JFFA 1QYGH 3LRGA 5HI4D 1LEKA 1GGTA 1N4XH 2QHRH 4UUJB 1BQSA 1UCTA 3ARGA 1KCSH 1LNUB 1U8MA 1K8IB 2H32A 4DGYH 5GS2H 2Y9RT 3RDTB 3MYJB 3CDCA 1B2WH 4YLQT 5D6CB 4FQ2H 2VITB 4ORGB 4LKXA 4PJ5B 1G9MC 4RAUA 1IC7H 5EU4B 1CLOL 3GNML 4QHLB 1RJLA 5I15H 1YEIL 5IOPA 3HAEA 2NQCA 3VRJA 1IKFH 2BJMH 1LE5A 1VFBA 1ETZA 4J23A 3I9GH 2NY1B 3BI9X 2J2ZA 2Y4SA 2NPLX 1TZIB 4C83B 4NZTL 2X4RB 2NY2D 3MRMB 3PP4H 3DVNA 3Q6GL 3Q1SL 3D0LA 1BIHA 3UBXI 4L8CA 2VR5A 2IBZY 5F3HA 3J8F7 3H3KA 3WUZA 4RAUB 4F8QA 4ZUSB 3CFJB 4KVNH 4ETYA 1W8OA 4MD5A 2EH7H 3KYOA 2IH3B 2XG4A 2VWEE 4N9OB 5DI8B 5HYJA 2P5WA 5FO7B 4WO4C 5D6DA 4U1NB 2LU3A 3KYMB 1AI1H 5I16B 2AI0H 1RJYB 4AENA 2VLJE 3EIFA 4NJ9L 1CK0L 2OL3B 3PWJB 5F7FA 1HWHB 5FOBA 4ODVH 4LDOB 1GZQB 1QSEA 3DX6A 2I07A 4Q9BA 4NQCE 1KLUA 1IZKA 4OZFG 3DUSA 1SYSB 5DWUL 4C4KO 4NQCD 1JHKH 2CUHA 3B8SA 5IEKA 5D2NB 5T3XL 1UKTA 4R4BA 4GO6B 5E56A 4O51A 5DHVH 3S35H 1D5BB 3WIFB 5FGCE 4OIIL 3RTQC 5HHVL 5FM5O 3X3FH 5B8CA 2PW1A 3N1QC 3OGOE 3KDMB 4FG6C 4OF8A 5CMAB 3DIFB 4QRPB 3VFOB 4HK3J 1ZANL 1EVTC 4YDIL 4KZEH 1QOKA 4GS7C 1KSRA 3EYQD 5F70A 5CEZH 3CMGA 2R4RL 2FX8L 4OCRL 3RWGA 4HH8A 4IS6A 1BVLA 1CL7H 5JHLL 3PHQA 3CFEA 1ZVSB 1A21A 4W6XB 4HJJL 4YXLH 1PD6A 3P0VH 1R3KA 4L8BA 4N1CA 4HHAB 4Y5YC 5SWSE 4HD9A 4LLWB 2GQHA 2FR4A 3I6GB 1X4YA 3ZYOA 2PW1B 5KVMC 1EFXD 1L6ZA 1BD2A 2G5RA 1KV3A 2A0LC 5FYJD 4NRZA 3RU8L 2NY6C 4LAQH 4C54A 4I0PB 4LOUD 5IB1A 2C1PB 3VD5A 1G7LB 3NPZB 1KBGH 2ZG3A 3GMMB 5D1XB 4HWUA 1T1XB 5F44A 3QEGH 4QXGL 1RFDH 3RY4A 3OKNB 3GIZH 5HBBA 2YHGA 4LHUG 3Q48A 2HFEB 2V17L 1WQVT 1F4XL 3O6ML 1GGBH 4U6HB 5DD0L 5K93A 4BK4A 4ZTOH 2YN3A 3SCMA 3LN5A 5C0BB 3JV0A 4C56D 5KW9L 1INEH 5GJTH 4DOHB 1A6VH 3QIUC 5D9SA 5HHMD 4YBQD 35C8H 3RWIA 5BXFA 1QBLL 4OZHE 3RZCB 1S7XA 1MFBL 1ROWA 1OTTD 4BM7A 4HC1H 2FWOB 2LVCA 5F9OH 4PGCA 5DMGD 2OTWA 4IOFC 5I8EB 2EYRB 1EEYB 3PWLB 3NABL 2QADC 5KBNC 2X4RA 5I15L 1AD0B 2JJSA 3RI5K 3ELAT 4DVBB 5HYFA 1NAKL 3HRPA 4P2YA 4XGZA 5IFAH 3VGHA 4ALAH 5D1ZD 3LQAL 2X89A 3NZ8A 2Y1VA 3JWOC 1FG2B 4L9DA 4Z7UB 2EDEA 4TSBL 4YDKH 1I7TA 4YWGH 1I9IL 3V0WL 2MOVA 3X11A 1MFEH 4X4XA 1JYWA 4PRNB 2H2PD 4MA8H 1CLZH 1PSKH 3FHAA 1F4HA 4WNQB 2ATKA 2ZUUA 5KG9A 1G9NH 3NH7L 1FO0L 15C8H 5DEZA 3L95A 4M7LH 5HHXH 4Y1AB 4MWFA 1FSKC 3WL9A 1BZ9B 3FN0L 4N0YH 3VD9A 2X89D 2Y25A 5FUOH 5H94B 1DLFL 4JY5L 5IKCA 2WQ8A 1QFWH 4Z7VA 2KKQA 4LQFL 5DC0A 1VKXA 5C8JA 1LEIA 2F8OA 5FUCE 4E0RB 4LRNL 3D0LB 5MENA 2VAAA 2CK0L 4WI4A 4GKNB 3CIQA 2R0ZL 2Y72A 1GZPB 3ECBA 3ZDYF 5DMKA 1UZ8A 1HKLH 2XFXA 3NMEA 3U0WL 1EZVX 1MCSA 4NKIL 1MCHA 3QXWA 4C59B 3T0WA 5DK0A 4PJIF 3P73B 2XA8H 4WI6A 2CUIA 2FHBA 5JOFA 5GJSL 3LEVL 1B90A 5TGBA 5CSZB 4ODHH 5E9DA 4YHLH 1QFUL 5CJXA 4QY8A 4KKAD 2NXZD 2BCKA 3BE1L 4UDTB 1UM6H 4DN3H 3BZDA 5DD1L 1JZ6A 3HE6A 1IZJA 5C08E 4DGIL 4MB3A 3NCYP 4ZS6C 5DFVC 4RFOH 5T3XE 5I1KH 5GS1C 4JR9L 3SCMC 5I8KL 1XGQA 5DMKB 3QSKB 4ZUVA 2BVEA 2VLRE 4KXZH 1A9EB 4FTVD 5TE6H 4HLJA 5KVGL 5HYEA 2AJZA 2CDFA 1Q8MA 4HUUA 2R0KL 2G75B 2D9QB 3SY0A 4NCDA 1DR9A 4P59H 1OAQH 4LLQB 1U8QA 5DJ6B 3C60B 5E00A 1MCBA 2FJGA 3JVGA 5SWZB 2JK5B 3BSZL 4NQEA 2NXYB 2NTFA 2VXVH 2B0SH 4M93B 3IU3B 3RBGA 6CGTA 3QDMD 4LARL 3LN9A 2YKLL 3GKZA 1N5AB 2AERT 1S5IL 1OPGH 3DMMD 4PY7A 4JFZL 2OZ4H 5DJ8B 3LDBB 5K33A 3ZKQD 1NBVL 3GHEH 5ENWB 3O3BB 5BQ7A 1BBDL 3GMQB 1PLGL 4KI5F 4F9PA 1AQKH 4PJ5D 4Z95H 3P4OB 1N6QL 1DBBH 4PJFE 1QBAA 1N6QH 5ETUB 2VLLB 2Q76A 4EEEA 5HTSA 1NGWB 3S9DB 4W4OA 3ARTA 2HTLD 2XN9E 3BD4A 4UOW1 2NY3D 1ONQA 5JDJA 2EC8A 4JY4B 4J3VA 4UIKH 5C9JB 1A7PH 3L3HB 1YYML 2BNRB 4MNHA 1AP2B 1QFOA 4MNGE 3GUTB 1S7VA 1HHJA 1IQWL 4UI2A 2A1WL 1IAKB 2V17H 2CXKA 1A4JB 3MLVH 2GJJA 4ZS7H 2EE2A 4ODSL 4XC1L 3MBEC 1EX0A 1MCWW 1J8KA 3Q5TA 4WTZG 4YHMH 4X6BB 2MJWA 3V8CA 1BD2E 1HE7A 1WLHA 2NW2A 5C92A 3SDDB 3QNYB 1MHPH 3VXSB 5C0FB 5FO8A 3WIHA 1E4WL 5IFHL 2I27N 3OKNA 5K59F 1RULL 1VFOA 1JPSL 3KJ4C 1I8IA 1CBVL 5CINH 2NY6D 1CVSC 4TPRL 5LGHH 1GOHA 1LEGA 3FOMA 5EC2A 3OX8A 5DO2D 2VDPH 4P3CH 1MI5D 4NYLB 4YFLI 4RISH 4X9GA 3RWHA 5F9JA 4QHMA 1UG9A 4N8VG 2C3VA 3GUTA 1ZA6A 1KC5L 5D96C 4ONGH 3TNMB 4OLYL 3HI5H 5I1LA 3SDXE 4KHTH 3MJ8B 4KRMB 4JM4H 5IMOB 3TIEA 1FCGA 4XVTL 1GGYA 1C08A 4Q9CA 3KXFB 3NACL 1I8KB 2VISB 5BRZA 5ABDE 3GSWB 3TWCL 3QHZH 4GMTL 2NTFB 3TWCH 3VFVA 1GZPA 3AY4C 3O11B 3GMLB 4JQIL 3TYGH 1X3DA 5E4EB 3C87A 2PYEE 5I71C 1CXHA 5JOEA 3T65A 4HPYL 1JF5A 1IT9H 2VXTH 1AD9A 2AQ1A 3ES6B 1Q1JH 2ADGB 5F7WC 1CXKA 5BS0A 1KYOK 5BQ7B 4U1GC 1U95A 4WUKL 4X4ZA 3FQXB 1UT9A 2AABL 4PJ7F 3S3SA 4CN1A 4Z7NF 4PTTB 1JGUH 1OCWL 4HKZB 3AC0A 5GZNC 4TQEL 2Q76B 1WCBA 1ND0A 1VEPA 4H88L 2QLVB 3MRRB 2VDRL 3KR3H 1QHPA 1UB5A 4HXAL 3QJFB 3VW3L 5J3HD 2IPKA 2D7QA 2OMBA 4KKNA 4X9IA 2HJLB 5L2KA 5DD3H 3SDXB 4GAYB 2IANB 4A6YB 1JGDB 3FB7A 1HSBB 1NC2B 2MNUA 3TZVB 5E5UB 3VXMB 1YY9C 5JPNA 4EOWL 5MENE 1F90H 4WHCA 1T0NA 3K80A 3RGVC 2XN9A 4K94H 4JKPL 5CD5C 3VJ6B 3H8NA 3QWOA 4IOSD 3QEUA 2IPTL 2QQKL 5C0AB 3NZHL 2VLKD 1KLFA 2FECI 4YNYA 5D1XD 4UDTA 4W81A 2F19H 3BVNB 3L3GB 4LK4A 5GRVK 2EKSA 4TTDD 3BISA 5I1IH 4R8WH 2ENYA 4WI8A 2P1YA 4JJ5B 2WBKA 4KK9D 3UTPE 1NGPL 4KI5C 3REWB 4F2MA 3SPVB 4LCYA 3ZE0F 3KLHD 4ZTOL 4HUUB 3IFOB 1KPRB 5I1LB 4Q6IA 2HFTA 3O2WL 3AMLA 5EOCH 4GOSA 4X8JA 5CJQL 2J4WL 3BKML 4R4NC 5TQ2H 4N9GA 3KXFA 5HVWA 3KPPB 2YPKB 3WD5L 1IILE 5BRZB 5DUPL 1A6TA 1A6WL 4OD2B 4YX2H 4UAOC 1K6QL 3P40A 5KSVB 1FYTA 5AUMA 3K2UL 4GRLD 2YRLA 4JFPB 5FYJE 3O11A 1VPOH 1KCRH 5IWLC 3SBWA 1A3QA 1GC1C 1IBGH 5DLML 3ZSSA 4PG2A 5IM7A 2VSDA 4NFBA 2Y06L 3Q2CA 4KV5F 1WAAE 3KPSD 5DHXB 2W60B 3DPBA 2NZ9D 1K4CB 4IMKC 1JV5A 1JMZA 1EHAA 4Z7QE 1Q9KA 4XXDB 3WHXB 5I73B 3ARGC 1SEBB 5IT2L 1T5XA 5AZ2L 1V3MA 5MHSD 3LEXA 2W9EH 4BSWB 1ZLSH 2X4NA 4X6DA 1NFDE 5J6HB 4OGAC 5GGVL 3U30B 4LSUL 1AGDB 4ZODA 3L3DA 3BP5A 1AO7D 4PRAA 5I76A 5L9DH 4OIIH 5IQ9A 1S8DA 2HLAB 5E8NA 4HUXA 2P24B 4LQFH 3R06B 2H1PL 1R0AL 2C4FT 1YMMB 2GCYA 3SGJC 4K3DH 1J8HD 3REVB 3VXNB 4I18A 2WV3A 5DRNA 1F6FB 1F11A 1ACYH 1I7ZB 1QLRA 1WSST 5F8RC 2RGSA 1CFQA 1JMXA 4N5UA 2XZAL 1XR8A 4QYOB 1BIIA 5FYLH 2Y5TB 4M48H 1DLHB 2EDYA 1CD1A 3GJEB 1N0XH 3F6LA 1OGAB 4PJFB 3RX8A 2H6PB 5GHWL 5E1AA 5FM4A 1CDYA 1CZ8H 1OOAA 1OTUC 1BX2B 1PG7L 1YUHA 1ZEAH 3NN8A 2FIRT 3C09B 5D7IB 3UTPD 4LVOC 4XTRC 4WHYH 5JXAL 2AV7B 5DEFB 3QDMB 3EJJX 5A2KH 1DVFD 1E6JL 4WFGE 3WN5B 2EDTA 4ELKB 1LD9A 3IFNH 2CQVA 1CDJA 1NCUA 2XZQL 4WFEE 3QPQD 4QO1A 4R7DB 3JTTA 3DBXB 4I5BA 5KVEL 4XC1H 4O51B 3QI9D 4I77L 1NDMA 1X5XA 3OB0H 4MYWB 3DIFA 1WEJH 4WFFE 2ICWB 3IS0X 3QEGL 4NQDD 5J6GB 2XWBA 4HPOL 2EDXA 4HMCA 3HAEH 1WFNA 3KHOA 3KYKL 3JSSA 1ZWIB 3OAUL 2ADJB 2C9AA 1QBML 4TNVK 3U82B 3MV7D 4EJ1C 3MR9A 3RWGB 3T77B 5E2UH 1F58H 4D8PB 3O4OC 5C09D 3DRTA 3S36X 4PTUB 1KULA 5D72H 2X1XR 4Y5VA 4Y5VC 4U1KA 1JL8A 3TLRA 3LKRB 5JA8B 3INUH 1LHZA 1AJ7H 4HUXB 5C0NC 3VMPA 1U3HB 1RZ8B 4PJ7B 3U36A 2Q7YA 1KN2L 3WS3B 1E27A 3EYFA 3IFPB 3WFEH 2PYED 5DT1L 4LCYB 2DLGA 4YUEH 1J8HA 4PV8B 2H41A 2UVEA 1IAIL 2VZUA 3QDGE 3SDDC 3V6OC 1FIGL 2GSGB 1XGQB 4M1GH 5BW7A 2BOBB 4X99A 2V2TB 4IOFD 4OZGA 4JDZA 3C60A 3H9SB 4AEIL 4G6JL 4DKEL 3DV4A 4XNQB 3KXFD 3DROA 2HTKC 2QKIA 4LSUH 3UTSE 4E42A 2XTJC 3B3IB 1B6DA 2J12B 3SEPA 3UAJD 4ELMA 3RVVD 2J3SA 1RK0A 5JIKA 1SYVB 4FFYH 4PGCB 5CIPB 3MMEA 2V5SA 3NFSH 4HK3N 2R4RH 3HKFA 3HCVA 2F5AL 4OM0L 3MLSH 1ZVHA 3B6SA 5E2JA 1Z9MA 1II4E 9CGTA 3H9SA 1BD2D 1A6AA 1JPFA 1MRFH 2FBOJ 2QHLA 3VMOA 1X5IA 2L7JA 2A83B 3OKYA 3TBYA 3OQ3B 1RHFA 4IRZL 4L4VE 1FGNL 1V7MH 4XP6H 3G5YA 1QRNB 3ULVC 1B0GA 4ZOEA 5JR1H 1F3RB 1L7TL 1FLRH 1LO0L 4LIQH 1DQDH 2J8UB 1MCFA 3RVXC 1JWUB 4ISVA 1D5XA 1NAMB 2C1OB 3IDXH 4ZUWA 3C5ZA 4JDTL 1MCDA 5D7IE 5IMLB 3LKOA 2WP3O 5B3JE 3DUHA 5IWLA 3VH8B 4AQ1B 5TE4L 4MA8L 4RGND 5DUPH 5I71B 4U6YB 5MI0C 4N1HB 5E6ID 4NJAL 1OGAE 4K7FA 3RKPA 3U7WL 1NC2D 3QIBB 5CUSH 4CJ1A 4OLXL 5AWNL 3MLTA 5EOCL 3PNWA 3V4UH 4H1LG 3BZFA 5DZNA 2GJ6E 5L6YH 1I7ZA 4NKDA 2GTWA 3QEHB 4KPHL 3X14A 2DMKA 4HV8B 4RX4D 4UIKL 5I18H 1K5NA 3PQYD 3TH2T 1ZS8B 2BMKB 4FQIL 4UNUA 4XP4H 3NABH 1ZA6B 1FGVL 2Y5TA 4YHOH 5IB2A 3H2WA 1JYVA 4MAYC 4PR5B 2Z92B 3GIVA 4LU5H 5EWIL 1FNGB 3PHQB 4U0QB 3EOTL 4OI7A 1CDUA 3T8XB 3LQAC 3KPQA 5AG9A 2ZUYA 1A7NL 2IBZX 3LPGA 4WUUA 4NWUH 2IPTH 2YOCA 2PO6B 4XPFH 1RSFA 1NMAL 4UTBH 5ADOH 4QRQA 3K4ZA 4MSWB 2Q6WB 3VXUB 1F3DJ 1JRHI 5EORH 2Z91B 1A7OH 5GS0H 4MNGB 3PG2A 2DQHL 5HHQB 5C08D 4X7CC 3CSYB 3PWPD 3B9KB 3CGTA 2ZP0T 2VXSH 4OKDA 3WDIA 4JG1L 3VRLE 3U0PA 1JN6B 2J8UF 1FH5L 1JFQL 8FABA 4PJ8D 5I66A 4OLWL 5EC1B 2D03L 4YHNA 1CWVA 1VGEH 5FKPA 5CJXC 4X7SH 1BQHB 4LGSB 4EDWH 2CRZA 5HY9B 3IU3A 1NUFA 1FG9C 3V6BR 2C3VB 4M5ZL 3S5LG 3A6CH 3BAEH 1CLYL 2VXUH 2NW3A 3TBYB 5MEOA 3VFSB 4JR9H 5SV3A 3S5LA 1HSAB 2ZCHH 3L7EB 3N85H 4PB9H 1MCOH 1NSNH 3BZ4A 5DJ8A 3MXWL 5ADPH 1HNGA 2AV1B 4OBSA 1J0IA 2W0PA 1RJZA 1VEMA 5A16A 1UWXH 1AQDB 5E08L 1HH9A 1U8OA 3CPLA 4MGXA 1MHCA 1CXIA 2OSLA 5DZLA 3WIFA 3S37X 2VXUL 1TZHA 1EO8H 4JN1L 4M7JH 5D5MA 3GM0A 2HVJA 3IDJA 5TH2A 3P0YL 3NOIA 2XOTA 3MRMA 1R5VB 4PP1D 1A0QH 1IC4H 3D39B 1OF2B 3QDAA 3AS1A 5CIPA 2EKSB 4BFBD 1MHEB 1HZHL 2R2HA 1GPOH 1U42A 4YE4H 4BQ6A 4IRSA 1IFHL 2VKWA 2R0WH 4EUPH 2GJ6D 5GS0L 2JJSC 3MLUL 4TULL 2A6KA 2C3WA 3KPQB 3TJHC 4YHKH 4ISVB 3AB0C 1YMME 3MRNB 1QEWA 4HIHB 2FZ3B 3GO1L 1RZ7L 1OGAD 4KV5E 4K3GA 2NYYD 3C2AL 4QXTB 4FXLA 5E2VL 5E2UL 2GEEA 3LKOB 4OZGE 3EYSL 4KXZI 3RDTD 4E42B 5K9JL 4ODSH 1YQVL 1GJIA 3NIFF 1TITA 4ACPA 5JPNB 1NQBA 5HYSG 4Q2ZA 4MX7A 4TUJA 1NFDB 2V9QA 4PJGA 1URLA 2XIDA 4Q97A 2IBGA 4DZ8B 4HFUH 4TUOA 2VDKH 1D5MB 3BKMH 1BZQK 3O2DA 4PLKD 2VUYA 5AAMA 3RVXD 4NWUL 3QYCA 4CMHB 3GSNB 1A7BA 3MRHB 5SWQB 3QT2A 4LPVA 1RZFH 3O6LH 4M1DL 5HI5C 2HYMA 2EICA 4Z76A 3SCMD 5KS9E 1AQKL 3IS1X 4WI7A 4XPAL 4H8WL 1LK3L 1A6WH 2XY1A 1MI5A 1GRWA 3FN3A 1BOGA 5GJTL 4HG4K 3SKJL 4J3UA 3EO9L 3FQWA 1BP3B 4UNTA 4HKXB 4YHKL 1MREH 5F7MC 1U8NA 2FJHB 4P9HC 3BDYL 2HMIC 2FWOA 5D1QA 3VI3E 3EJZC 3KPNA 4LBEB 4LL9A 4OKVA 1QO3A 2YKLH 3OR7A 3QZWB 4PP2A 5KOVC 3WJLA 1AGCB 1C5CH 4UQ3B 2LABA 1AD0A 5SWQA 4L4TA 4AG4L 1CLCA 1UKQA 3MLWL 3BQUD 3CU7A 3R1GH 3PWUB 4GBXC 1P9MA 3M8OL 2VH5H 4PRHE 3ZE1E 5DD3L 3DWTA 4L4JA 4MD0B 4OLVL 1Z3GL 4G7YH 3VCLB 3EGSA 4P2RA 2R69L 5CBAB 4U1SB 4WHTA 1SM3L 4M6OH 3BP4B 4HK0B 3DYPA 3TIDB 5D1QC 2GJZA 2LTQC 4LEOA 2B8OT 1KB9J 4UT9L 1E6OH 3IDUA 3SKNA 4KQ3H 3U7AA 2FATL 4NQCB 3UPRB 5HI3D 4HQQH 4S0TD 4KK8C 3CJJA 5D5ME 4MQ7A 2O5ZH 1NMCC 5FYLL 3RPIA 3BIKA 4G8FB 5ETUA 4J1UB 3PF2A 2X70A 3Q0HA 4NKQB 2H6PA 3SGDI 3UYRL 1G1CA 3UTQA 4ZFOB 3ULSB 5EUOF 1MJ7L 4IRJC 4IRJA 4NO5B 2A77L 2LAGB 5HYIA 4Z8FH 1HKLL 1PKQE 4ZO7A 5TF1L 3CX2A 4U49A 1H5BA 1BECA 5I8KH 4LSSH 5DR5L 3QIBC 4X6CE 5F3BA 4NGHL 3HA0A 1YMMA 2GCYB 3WFCH 4NQDE 3QDJD 4FQPA 1XF2B 5HY9A 5EUOA 5ILTL 5C0CD 3V8OA 3RBSA 1FIGH 4AIZA 5CWSA 2M26A 4MVBD 4YHIB 2GK2A 3O8XC 4AENB 1RK1B 1UWGL 4WFED 1N6UA 4G3YL 2CDFB 3NVQA 3QPXL 1N8ZA 3DETD 4RWYH 3BUTA 5HHME 3MV8A 4GFTB 2DQIH 1VFMA 4W6YB 2PYFA 1U93A 3H9HB 1E4JA 1E4WH 5D7IF 5KSUA 3VFRA 1QTYT 3RTQB 4LCUB 4K7PX 3CFCH 1AGBA 1QSFA 1DQQB 5I73C 1NEZG 1UB6B 1G7QA 1T89A 5DHVA 3JTSA 2OK0L 4QRPA 1WV7T 1MREL 4ZAKA 4KRPC 2QV2A 4UDUB 3WDJA 4DCQA 5HHMB 1BJ1H 1TJGH 3RL1A 2V5TA 3C2SA 2HT3C 1A6UL 3HAEB 2M2DA 1I4FB 1DBBL 3S3JA 1TJHL 4LEXL 1AC6A 1FYHB 5FF6B 3QDJA 3MJ9A 4KK9C 1BFOA 4OI9A 5TGBB 2A6JB 1OP3K 1YEEL 4B50A 4M61B 5D2LE 2BCKB 4F58L 2XTLA 4MNHB 5I0DA 4LPUA 4I3RH 3D3VA 4ZUTB 4FFVC 4PJAF 5F3HB 1TJIH 2B1AH 1CGVA 5TDPA 4LVNB 4OFVA 3WIHL 2MQ0A 1RZ7H 3DI2B 1H0DB 1GOFA 4PRDA 2VXQH 2VLMD 1FO0B 3ZL4H 5MHSE 1KN4H 1PKQB 2FHFA 5JA9A 4PJXA 5SWZD 4Y1AE 2XRAH 5ALCH 3CFIC 2XN9B 4JGUA 3C9NA 2W0FA 3KPRE 4WHTB 3WKMH 1RJYA 3MRIA 4PJ9A 1ES0A 3TCLB 3WS3A 2YUXA 5JIIA 1FC1A 2JJUA 4YGAB 4HBCH 2AJXL 4JLRB 1V7ML 4XCNB 3SKOA 1QRNA 3WJJC 2FLBT 4LSQL 2DTSA 1OCWH 1UADC 5DJXA 5FGBC 4KZEL 1WC7B 4LRIC 4YR6A 4HKBB 2DJ4A 4GG6A 2R0KH 1ZLSL 4NRXA 4YHLL 4PJAA 3RDTC 3T2OA 1VB9A 1SBSL 5F7KC 4XC3H 4NN7C 2OTWB 5CJOH 3ZDYE 2QBWA 3F7QA 3FQNB 5I1JH 3QG6A 4MMXC 1CDCA 1I1AB 4DVBA 1HHIA 1NSNL 4U1SA 5ADPL 3SKOB 4NFCA 1AD9B 2P7TA 1S5HA 2IPUG 3MZGB 3PGCA 1T03H 1K85A 1MRDL 3IETA 3QQNA 2NX5A 4RMTA 4FZEL 2VL5B 3SDDD 4O58L 4FQCL 5HYJD 1TQBB 5JHDB 4OLZL 3GSUA 4DK3A 5DK2B 5FECB 3OZ9L 3ZYJA 3T4YB 3VRIA 1VFAA 3I6GA 1NMBL 1S7QA 4QT5B 5CSBA 4YX2L 1BBJA 3E3QC 3FB5A 5SX5H 4GAGL 4PGJA 2DN7A 2A6JA 4F57H 2E9JA 2EDOA 2VXSL 1UH4A 3WV0A 5DLMH 1MFEL 3EHBC 4YHYB 1INDL 1FJ1A 2QR0B 5E9DE 4KRPD 5TFSL 5KTEL 1NANI 3TNMA 2VLKA 3IU4H 3S98A 1PDKA 5CINL 1JGDA 1FVCB 4APQD 1UXWA 2GAZB 2EO9A 5IHZA 5I17B 2JJWA 5C70A 1H0DA 2F54A 4YC2C 3LKPB 5EBWB 3KWWA 1C08B 3OJDB 3NA4A 5C2BH 4IIQA 1TDQA 2AXJA 1K8DB 1LDSA 1TVBA 3MBED 4Y19A 3MV9A 4R26H 4M8VA 4DCQB 4EBQH 3RL1B 1MWAB 1S7UB 2V5MA 3CSPA 3PDOA 5M94B 2A6DB 2GUOA 1YECL 5JW3L 3RWIB 1G7LA 3KYAA 1TJHH 5B38G 2G60H 3O81A 5JXEC 5LKNA 3MV9E 3MRJA 4JB9L 4E41A 3VWKB 4PV9B 1ODAA 3HE7A 4ZXBD 2OR9H 4MSWA 3VXUA 4JRXD 3ARBD 3VFRB 1INEL 3C60C 1BFVL 5EZJB 1U95B 2I9TA 3WFBL 3WFZA 3RNKB 2F74A 3BRDA 4JFQA 2NXYC 5LCVH 5DUMH 5FK9A 5ANMA 2EDKA 3DVFA 1S7UA 2OLDA 3MRPB 3PL6B 2KUTA 3F5WA 5CZVL 1CD9B 2OS7A 4M62L 3EZJB 4U3XA 3QXAB 3LV3A 4N8VB 1Q94A 3BPOC 2XYCA 4NO2A 1A0QL 1HXMA 3K8MA 1SY6A 4DAGH 3BT2H 4HEME 3O45A 4GXVL 4KZDL 2GFBA 2OZ4A 1RHHA 2M8XA 4MD4B 2E9IA 1JWMB 3FQTA 1AC0A 4AIOA 4J3OC 2YD9A 3TYGL 4Y4FA 1NJ9B 1LWRA 1YMHB 3M17A 5HYSB 4M9PA 1LO4L 1A1OA 1FIEA 2GT9A 3QWRA 1IAMA 1J9CT 4AYFA 1TCMA 4FMKA 1QKZH 3GMPB 1BQLH 2QQLH 4GAJH 4KKLD 5ALBL 5J6HA 1CICB 3BHBA 2BRRH 5TDOB 1HHJB 4OZFH 3RGHA 2VWEC 3OB8A 3O45B 4YJZL 5LJYH 3QG6B 3A67H 1BJ8A 2GTZB 1Y6NR 2EYSB 3E0GA 3WNKA 2OR7A 4PG2C 4LNVA 4UUJA 2F9BT 2X41A 4JN2A 5EU6E 4LNRB 4QY8B 4OV6F 1FPTH 1QFHA 2OX5A 4DAGL 3V0VB 4JFHE 1MVFA 3FT4B 4UILL 4J4PC 3BN9D 3GSVA 5DHYB 5CP3H 5CGMA 4M6ML 4IMKA 2L7UA 1KPVB 3JBG7 1MWAA 1LE9B 4XBEH 1C5CL 5TQ2L 5IVXA 4YHML 4N0FB 5DK2A 5HYQB 3RWFA 4ZS7L 5ICXB 3MSPA 5I9QB 4OB5L 5DUML 3HE7D 2GYSA 2WBJC 2WBJA 4ALAL 5IHBA 4N0CD 5CSZA 3KPSB 5E9DB 2EDBA 3CSGA 1DJSA 5C0EA 2W59A 4YFDB 4HAFA 2OR9L 4UQ3A 1ACZA 1DN0B 3FQNA 1IAOA 2Q8AH 4OCNC 1I1AA 2VLKB 4IOIA 4RMWA 2QKIB 3PQYE 2WWKO 4GRMB 1K6QH 1MELA 4RGNC 1VEOA 4PY7B 2WZPD 5JUEH 4R4ND 3LIZL 4EZMA 3V9FA 4XCYA 4JZOB 2BNQE 1J88A 1CE6A 1T1WB 3PJSA 5E5MB 3AREC 5GIRA 4NQED 3T4YA 3WXWL 3B6SB 2ESVB 5CKAA 1JGVL 3G04B 3SKJH 4NUJB 4OF0A 5BRZD 5FXCH 2FJHA 3LKQA 1MCLA 5D1XC 1K2DA 3B9AA 3QUMA 4NOBA 2ADJA 2B5IC 2EDHA 4DOHE 3VWJB 5T1KA 2J8UA 4PD4K 1MCPH 3MUZ1 1C5BL 4X4ME 3MO1A 4EN3B 2X5PA 1X5FA 2J6EL 2R4SL 3VA6A 2CO7B 1CR9H 4K8RC 1YNLH 4NC1E 2EH8H 2DTML 5DO2C 2UWEB 3N9GH 1YYLL 1ULVA 2J8OA 1GVIA 4DGIH 3TZVA 3VXMA 2CLRB 5F96H 1KJ2H 1T0NB 2X2YA 1U3HA 3FO0H 5EZOL 5J06A 4FXKB 1V8HA 2Q7YB 2VZ3A 3C6SA 2QHRL 3QFJE 1PQZB 5EOCJ 5DJZB 5FYKU 4QWWC 2DICA 4N1EA 3BIAX 3FT4A 4M1CD 3HB3D 3ZTJH 4MNQE 1DVFB 1N7MH 4R6UA 4K9EH 2BRRL 3QIWD 4I9WD 5F6IC 3IFLL 4JHWL 5GS1B 5ESQA 1DTUA 3QNYA 4MXQD 3TZVC 3G08B 3S96A 1T20A 3MXWH 3SGKA 4OZGB 2ZOKA 5E94A 1L7IL 2JB6A 1SJHA 2NY3B 1Q1JL 3IXTA 4GW1B 3HI5L 4LQ1A 3QUXB 1U93B 3H9HA 1FN4B 1F2XK 4NYLA 4XMKH 4CGTA 2IGFH 1A4KA 5TF1H 3GM8A 3I50L 3T3PE 2SEBA 3FB8B 4M7JL 2FCBA 2Q1EA 2EDQA 1XT5A 4RGOL 4O4YL 4D9RD 2H3NB 1MLCA 5HHOE 3CK0H 4M5YH 3L9RA 2C3HA 1AXIB 1ORQB 5C09B 5JNYA 1J8HE 1X9QA 3O41B 1KXTB 2GIYA 4L29A 4LLVA 2QQQA 3GRWL 1NLDH 1CGYA 4TSBH 4YDKL 5FKPB 1MCOL 3MOAL 1IC1A 3DX8A 4M3KB 4XNZB 1V7NH 3MUJA 3C08L 1F6AB 1RK1A 4OCSL 4PBXA 3RVUC 2CPCA 1RUQH 4NQSA 1C12A 3MREA 2YPLD 3DO7A 2YRPA 3EHBD 2OI9C 1FL3B 5BXFB 2ZCKL 3STBA 2YXMA 3PDDA 3T4AB 5HGGS 1KCRL 5F9OL 4EDXA 6FABH 5TDOA 1RULH 2Y7QA 5C09A 4WJ5A 4RAVA 1JFQH 4LOUC 1UJ3A 1WIOA 1NEUA 2EO1A 4EBQL 3AS0A 3QXUA 4MLIA 2BVPB 4QRPD 3SE9H 3BPLC 4PRIA 4S2SB 3MFFB 1XF4A 1Q0YH 5JLZB 3KLHC 2X9YA 5LVEA 5GGUA 4X98B 4KQ4L 4ZFOA 4UU9A 4Z7VF 5MEQA 1J1OL 3KPMA 1BFVH 4Q9RL 3V95A 1TNNA 1X5YA 2NX5E 3SO5A 1WK0A 4UB0L 4K3EH 2FX9L 4GKSA 2PTVA 2PXYB 3IFOA 4UT6H 1AHWB 3FO2A 1GGUA 3GMNB 2IALB 5D2LB 3ARQA 4ZOBA 3HUJB 3BZEB 1F45A 1FSKB 2FO1A 5JIPA 5FCUH 1F8TH 1MIMH 1EH9A 4D3CL 4OIAA 1FAIL 4JFEA 3QDJE 1SEBA 2FD6L 5F6HJ 1OD9A 5E94B 1FRGL 4Z18A 3PWVA 5T1KB 1P7KA 2ITCA 4KVCH 2AK4D 4OB5H 5LQBH 1MRFL 4QXUL 1RZJL 1UEYA 4FZEH 3QHFH 1AY1L 4F7CA 3QEQB 3O6FA 1HHIB 4MA1C 4NQEE 5IM7B 1JGEA 5GJSH 4P48A 4MB5A 3C5JA 1FZOB 5FHBL 1ORQA 2R0WL 1LO3H 2AGJH 4P23B 3WS6A 3KYOB 4OF3A 5E6IB 1NCDL 1YJDC 4O2FB 2VL5A 3PHSA 2A38A 1BEYL 1MAMH 1VGKA 2HWZL 3DOSA 1A22B 3QUZB 1HZHH 2VQTA 3HFML 2ADIB 4OGAD 4HG4J 4JFPA 5I1KL 2DLEA 4JVUA 2AEWA 1PY4A 2HVKA 1XIWD 4RBPH 4XWGH 5ICZA 2V2WA 2DF3A 1A9EA 1BAFH 4QKXB 4GMSL 3MO1B 3HPLB 4EN3A 4V1DA 4H26B 4WU7B 5IW1B 1M05A 2H9GB 2L0DA 1C16B 1MJ7H 1OAXL 4JKKA 5F71A 3NFNB 3CAFA 3W0WB 3HUJE 3NBNA 4PJAE 1CICD 2BP3A 4PREA 3LRSA 3RZWA 1LO2L 4HWEL 4OCYL 4JRWA 5CBEB 1BZ9A 4LCCC 5F1SA 3L5WB 1DL7H 2MPAL 4JGMA 4P2RD 4L5FH 3RY5A 3MYJA 1YYLH 3VCLA 4CU7A 3DRQA 3TYFB 3CMOH 5EOTB 1A64A 1W8NA 3U2SA 2E9WA 4NKOB 2CDGA 4JM2C 4R7DA 1MCNA 3DVIA 4EDWL 1S7RB 3NFNA 4N0UE 2DIAA 4LVHC 5ISZA 4Z5RB 3QUYB 3HZVA 3VRIB 4PJXB 2BXZA 4ZOAA 1MJUL 2CKNA 4FXGB 3UCRA 4YPGA 4PJEE 4RGNB 5FM5M 1QEWB 1U8MB 2BVQB 1IEAA 3P9LA 4LLDB 4YBQC 5FB8B 5L88H 4GQ9H 4N0UB 1YUHB 2BHYA 5IVZA 1OQXA 2J6EH 3ROOB 4PJ8C 2A9ML 3ULVD 5E8EA 5HGAA 4ORGA 5MEOB 4L8DA 1EDQA 1UJ3B 5JW5B 1A7OL 3RL2A 5I6XC 3MRFB 1HSAA 5E70A 2F5BH 4LSPL 4I48A 3CNKA 4WEMB 5K9OB 3HC0A 3QEQA 3NIDF 4JFEE 2BVYA 1AGFB 1D5MA 5FUZH 3O6KH 1R5IA 1HH9B 4JB9H 4QRSB 2D4FA 1CGUA 3TO2A 1WZKA 5ESVA 3ARPA 4CN4A 3RIAF 2CJUH 4LPYA 2R1WA 1TZHB 5DURD 5C0RH 3STZA 4ZO9A 3VXUD 4H0GA 2DLIA 4JEGB 1FZMA 5JUEL 5IW6B 4YXKL 1ZKAA 2XQBL 5I8OL 4Z7WA 4JHBA 4BKLA 3C60D 1IVLA 2HKFH 4L3CA 3D1MC 4JRXE 4D8PA 4Y5YA 3HI1A 4QXGH 4RMUA 5D2NA 3PWVB 3ISWA 3WSQH 4EN3D 5D4QA 5I16A 4XHQA 4OF5A 3BDXA 3UX9B 2QSTA 4JZNB 1BJ1J 1B4JL 4NUGH 5ANMB 1B9ZA 2Q8BH 1WISA 1XF3A 1EO5A 2PO6C 4G9DA 1OW0A 4PGEA 1T21B 4JRYD 3VRLF 2H1PH 3ZKXB 1R0AH 5KVGH 1IEBB 1T7XA 5ERWB 3LV3B 4N8VA 1RIVH 3ZHDA 1LK2A 3KYNB 2CR6A 5BS0D 1J87A 2HRLA 1PG7X 4UT7L 4JM2F 5BMFH 4YXLL 2UWEE 1A3LL 5GS0C 3BIKB 3WNMA 1HI6A 5I1GL 3QFJA 4TSAL 1UA6H 1CF8L 4KI5E 1IM9A 5ECJE 2ARJQ 1L7IH 2NY2C 2XI9A 1K8DA 4TTGA 5H2BA 4ZUWB 1YQ2A 2FL5A 1DQLH 2ZUWA 4I18C 1KB5H 5EU4A 4TUKH 2O61B 5I8CB 3RY6A 2C4FU 3MACL 2R1YB 1RY7B 1DUZB 4P49A 5D7JB 4K9EL 4EIZC 4ONFH 3JWDL 4O02L 3V7AE 2X4SB 5L0QC 2JJTA 2W38A 2VQUA 3VDAA 5HI5D 4NP4L 3I6LD 1DN2A 3IXAB 5TDNB 3WNOA 4F33A 1HHHB 4M5ZH 3MA7B 1UQSB 2VLJA 5D7LA 4KVNL 5LAXA 4E41D 3EOBB 1JN6A 1X6LA 2IBBA 4KUZL 5DF0A 5IR1A 3ARDA 3TFKD 1DFBH 5ESAB 1EJ6A 2DBJA 3VI4E 2DWEB 2DYPA 2AW2A 3G6AB 4H25B 3U1SL 1IGJB 3P9MB 5FK9B 4AG4H 5F9WC 3ULUC 2VDQH 3AM8C 1T6WA 3NCCB 3GB7A 2DQJH 3TGXA 3EGSB 5IVOA 1CK0H 4QGYA 4L9LC 3BD5A 2YC1A 2G60L 2DQHH 4FQLH 1TXKA 4FS0A 2W0KA 5GGTL 4CRPA 1YZZA 3KS0J 3KYMA 1CFTA 2FD6H 1YEEH 4JRYE 3UPRA 3KPPA 1FNFA 4R26L 2OQJA 3BP7B 5CBEA 1YNTA 4K7FB 3TBSA 3QHTC 4PJ5E 4PJEB 4RGNE 5E2TL 1CFBA 2LU7A 3PV6B 1KLUB 4DZBA 4NQDA 3HNTH 5J11C 1JNNL 1ND0B 4XX1G 2ZCKH 1P5UA 5EBMA 1GL4B 4QOKE 5CGYD 1KJ3H 2MTPA 4O2CB 1NANH 5C0JB 4XNUH 1LP9F 2UZIH 4X80L 1VA9A 1I1YB 4F3FB 4PRPE 1ED3B 4NKMA 1RZKL 4JKMA 5T1MA 2P46B 3L95B 4DGVH 1BFOB 3WHE1 4G7VL 2ERJB 4WI2A 3FO1B 4K55A 2AXGA 2B0SL 3PP3H 4NHCL 1NUGA 4RGOH 2DQFB 1XCQB 2ZOLA 4KHXL 4AEFA 2MMXA 2WIMA 5EA0H 4LDEB 4G9FB 5BVPL 5D6DC 5GISL 1U8PA 3VGDA 3MV7A 3NZHH 3VFUA 4AEHH 4P59L 5CCKH 2ED9A 4CAGA 3OKDB 4P2QA 3ECBB 3UC0L 4CVXB 5F89A 1XGPB 2EIZA 4Z7NE 2N4IA 4YHZH 3CH8A 4QRPE 1HQRB 5FIEA 4CU8A 1RIHL 1YEKH 2D7TL 3DSFH 4GUPB 4Q2ZB 3L5XH 3BXNA 5GRVL 2NMSA 3B83A 5C0AD 1DL7L 2MPAH 1JIBA 2P8MA 3IDJB 3GJFB 1A6PA 2KZWA 2NR6C 3QJHB 2WIIB 3V7AG 5EDXA 2FB4H 1T03L 4P23D 1YJDH 3NA9L 4XPBL 3RY6C 3FOMB 2FSEA 2OXHA 3GMRA 3NACH 4PGBB 2CLZB 3RIFK 1PKOA 4NQSB 4K3JL 3MRLB 3N1FC 1HHGB 4LVEA 5I74C 2PO6D 4WCYL 4XP1H 2OMNA 5HHVH 3BMWA 2D31B 1ZT4A 3VG0L 4PBVC 4MXWL 1ZTXL 5E1AB 3ARDC 1BQHA 4WJ5B 4GW5B 5LWYL 1MAML 1G7IA 5FF6A 3QDJB 3A6BH 5D7IA 2R1YA 1XFPA 2YD7A 5HPOA 4AL8L 1JHKL 1DQTA 1CXFA 1P4LB 5TH2B 2BVPA 3OKEB 4G6FD 1P4IH 3OF6A 3WMSA 3MLRH 4XPTL 1G7JB 4U6VH 3T65B 3FZUC 1N59B 2NTSP 1MFDH 2BSTA 4HUVA 1KF9B 4R9HA 2DM4A 3CH1A 2F15A 1DBMH 1AI1L 3G6AA 3AREA 4LPTA 2MSPA 5I1AA 2HLAA 2IALA 4MCZB 1NAML 2APFA 4X9HA 1HIML 3A6CL 1MIML 3BAEL 5L8KB 4KI1A 2HT3D 5C2BL 1JYXA 5LGHL 4CVUA 2AQ2A 1NC4D 1A8JH 3MCLL 4C56E 3UBXA 5ISZE 1UC6A 1X7QA 4Q0XL 3O2DH 4YXHL 3G08A 1X5HA 4DGVL 1CTNA 1JPTH 3GI9H 2CRMA 3BPCA 3O6MH 4KFZC 5GGTH 1UJTA 2RBLA 2P5EA 4ZO8A 3WDHA 1MQKH 3U4BH 4LMQE 3NTCL 4L4TE 4ZS6D 3H0TB 5HVFB 3QI9C 2VABA 5IP4A 5C9JA 3BPOB 1YEFH 3D18A 4JJHA 1JZ5A 2EZ0D 4R4FL 3WLBA 4HZAA 1D6VH 1VFUA 2EIEA 2DS4A 3TN0D 2AS5M 4LCIL 5IG7A 4PGBA 1CG9B 4X4YB 3K74B 3VWKA 5LBSH 1AXTL 3OR7B 3QZWA 5CIPH 5TE6L 3UJTH 5DI8A 5HYJB 4Q74A 5JHDD 1N8ZB 2RCSL 1I8MA 5DVLA 4J1UA 1YEHL 1HDMA 3GI8L 3MGAA 2HAZA 3E3QE 2YEZB 2BNQD 5L6YL 4EI5A 4GAFB 5ID0A 1FNLA 4F9PC 3E6HB 3WE6A 3TA3A 3ARXA 5GRJL 2IEPA 3BN3B 4JRYA 5JPMB 2AJZB 3NCBB 5GZOD 1P4LA 2XWJB 3O8XB 4OFIA 3MLXL 3TV3H 5SX4H 3QULA 5ITFB 3EO0B 4F7TA 2APBA 4O4YH 1IC5H 2FX7L 3BRFA 3T0XA 1G9ML 3SN6N 3C5ZC 5KVFH 3VXOA 4OD3L 5D7SL 5DEGA 3JVGC 4JDTH 2YPLE 4UT7H 5LGKA 3OG6B 5E6YA 4JFFE 4QWWD 3OXRA 5DMIL 3RVWD 2NY5L 4LSSL 3OAYK 4R2GC 3OJDA 1YEGH 2LVEA 4EXPX 3MV7B 3VFUB 1BQLL 2QQLL 4HK0A 4M7LL 5IGXL 5KVDH 3VD4A 3SJVA 5ANME 7FABH 2LV4A 2CSPA 3NPSC 2Q86B 5C6TL 4K8RL 1TQBC 2ICCA 4D0BB 4XVSL 1NBZA 1BPVA 2VN7A 4GUPA 4P2OC 2OJZH 3IAGC 4ZXBB 4HKZA 4KJPD 2BOBA 3KPTA 5K9OA 3U83A 3ARUA 4HS3B 3KPLA 4FQJH 4H1LB 3QO0B 4JG0L 1EEZB 2WIIA 4Y5XB 3ROLA 3UJIH 4ZSOB 2ZCHL 1VDGA 1U8JB 3PWNA 2PYEB 4AEIH 2EIBA 2P49B 2FRGP 2CDGB 5BW7C 3TN0C 3TN0A 3WEXB 1RIUL 4GAYA 1FFOB 1MCJA 2B1AL 5C6PB 3RWFB 1FL5B 4NM4L 4ODUA 15C8L 5GXBB 5T3ZL 1OWWA 4JFXB 5JQHC 1IAIH 2P5EE 3KYKH 5IFHH 1T83A 3HPJA 2IQAB 3QFJD 2H26B 3OX8B 5C7XH 3QEUB 3ZTNL 5HJ3A 4HIJA 5ITBH 1QA9B 5BJTB 4ZPTA 5J1SC 5JW4R 4PJ8A 3PWNB 3X3GH 3BEVA 3WUWA 1MEXL 2MWCA 3VGGA 4GT7A 5CGYC 3MZTA 3CX5K 4JVPA 3WUWG 4ERSH 1UB5B 4PRPD 1D5ZA 3SDAD 3CDFA 1FLTX 3MJ9L 4KTEL 2AV7A 1XEDA 3D3VE 4PUBL 4P46A 4PJXF 4HGKC 1CE6B 2ICEB 3UTTA 4KAQH 1OL0A 3TBVA 4MZ3A 3ARFA 4R3SA 3SQBA 2BSRA 2WAHA 5J7CC 1JGLL 4PRBB 3S35X 3MV9D 5JTWA 1QBLH 5T3ZE 3IT8D 2WWMD 1CDHA 3ARED 1VACA 4P9HL 4C55A 4U0RB 2NW3B 4HEPG 1IGTA 1IGMH 4KJWC 3VFWA 3VGEA 4KC3B 3V6ZB 3LDBC 1BFSA 4U1LA 2I60L 5IB5B 1X4ZA 4R7NB 5ICYA 4ZUTA 3ALXA 4HIXL 3HI1B 1J11A 4PJDA 3VW3H 2EXYC 4FABH 2E7CA 4WW2B 1BZ7B 2RB8A 5IUSA 4RX4A 2V6HA 5F7DB 1MLBB 2Z35A 5D2NE 3U1SH 4FQXB 3QIBD 1PKQA 4GW4B 1T1ZA 1D5IL 2IF7A 5I30H 4OLZH 2B5IB 5IJVA 1RIUH 4E5XA 2XWJA 3F58L 3O8XA 5JDSA 4PRIB 1BAFL 3CLFL 2X4UA 5IR1B 4E41E 1MQ8A 3DYOA 3PQYB 2XQYG 1RV6X 4BSVB 3GGWB 4POZC 1UENA 3LH2L 4X6DB 1TVBB 4KMTL 4ODWB 3JWDH 4O02H 3WLWD 5B39B 2AAVA 4JM2A 1KIQA 2APTA 5CSGA 5T33L 3QQ4B 3SQOL 4YPJA 1IE5A 4TVPD 4D9LH 1KJMA 1I7RB 4OD1H 1IC5L 2P24A 3P9WB 1OP5H 4Q6IC 1NH6A 5ESVB 2VQ1B 1WTGT 3CDYA 1XGTA 1KCLA 2HRPH 1AY1H 3MBXH 3SDCC 1ITBB 3MUHL 4MMZC 2Z31C 3PWPA 1WBZA 4I4WB 3R0NA 4XB7A 1FNEA 5FV2A 3CZFB 1OTSD 3NCEB 1VGEL 5IW6A 3L3OA 1YEGL 3B9DA 1KJ2A 4J8RA 4GLRI 1KIQB 2VO5A 1U3HC 4AMKH 4ONGL 1RUML 3S4SA 5JNYB 3MA9H 5CZVH 1M7DA 5CHNB 1KB5B 2PTTA 5FCUL 4ZFZA 2JIXB 3S4SG 2X10A 4OLVH 2WP3T 2DJUA 5DWUH 3WJLC 2BSRB 4TPRH 2VDNH 2CD0A 5EORL 4B41A 1PSKL 4OZIB 3GHBH 5D72L 3PDOB 3WFEL 4OCLC 1HN1A 1W72L 4CMMA 4X8XA 1PG7W 4LFHD 4FXKA 4QXUH 4R96A 2CGRH 4Y19E 5EU3B 4ODXA 4DUXA 4XZUB 5FA3A 1FJ1B 4AJ0A 2BJML 1ZSDA 2VMFA 3MV8D 1FE8L 1YEHH 3AY4A 4H26A 4WU7A 3H6JA 5IW1A 3PUCA 1Z5LA 5DFTA 2K7QA 5CFHA 3TC9A 4CDGC 1JZ4A 5I1IL 2PTUA 3TF7C 1CIDA 3QIUB 1RAMA 4DN4L 2JB6B 4RSVA 2R15A 3T1FB 1BREA 4HUNB 1FGVH 5JQ6L 5KSAB 1N4XL 1F02I 1R3IH 3MLTB 4EQ3A 3TIDA 4PJHF 4FTVE 3DVNB 1TNMA 2PCPA 5D7JC 4MLSA 1R24B 1PVHA 2JLLA 3M1BA 4S1RL 3EYSH 1LP9B 5HHNA 1YN6A 1KXVC 3ULVE 5HPMB 5EU5A 3C2AH 4U1KB 4BZ1H 4DZ8A 1CLOH 3UDWA 4LPCA 3TVMB 1XCQA 3EJYD 5BJTA 3LKSB 1EVUA 3F7VA 5EIIA 4U7KA 5D6CA 3AXLA 3DO3A 1T22A 4Z76B 3QPXH 3BPNC 3D3VD 2QQKH 2IPKB 5DD6B 2Y07L 1G0XA 2PCPB 4M7ZB 1UYWH 5J6GA 1XF5B 3LOWA 3O6FB 1R24A 2MKWA 4MHHG 2IANE 3MJ8A 2FBJH 4XP1L 3C5SB 4XI5D 3KHQA 5HPMA 4EUPG 4K71B 4X99B 4CJ0A 4KMLB 4P23A 3CXHJ 5ACLA 4IBLT 5I75C 1IGFH 5DS8B 4JCMA 5GSRA 3TO4A 3MBEB 2VISA 3H9SE 1EV2E 3GRWA 2HRPL 1ZHNB 3W11D 1AKJA 4XVSH 1I9JL 3NPSB 3R8BB 1H9VA 4Z78B 1QFWI 1P4IL 4U6HA 5HYJE 3BQUA 3BQUC 3K4AA 4X7FC 1UEMA 3DSNA 4EVNB 3CCHA 3VFSA 5GS0D 1U3YA 5C0CE 3M8OH 4OLEA 3K1DA 3AROA 3G6JB 4OLWH 1ZTXH 4JRXB 2UWEF 5IVXE 2W1NA 2EYTA 1NGZA 4W4NA 3ULUE 3KPOA 4GW4A 4H20H 1JWMA 2FHCA 3BZEA 5C0ND 3D2UA 2RJMA 5CCKL 4M7LT 4HQQL 4BFIB 5GGVY 4GRMA 4OF7A 4BUGA 3T1FA 2ITCB 4X6CA 3MR9B 3RKDC 4QHUA 2WBWB 2VXQL 3RWCB 1QLEL 3GSVB 5I1DA 4P57B 1NGXA 2NLJA 4XVTH 2VSCA 2LTQB 3SE8L 4I0KA 1BFTA 1R3LA 4HJ0C 3F7YA 1D6VL 2VLJD 3CXDL 4Y2DC 1AFVL 2DKSA 4KTEH 4WUUB 1FVDA 4MAYD 1T1XA 4Z77A 4Y5XC 4MS8C 3QR2A 4N8CL 3HRZB 4HW6A 3K8LA 1F8TL 1J12A 5JQ6H 1KPUA 2HH0H 1FFPB 3QFJB 1L9MA 1A1MB 4D0DB 1AXSB 2LU4A 3TBWA 4LDLB 4UBDD 5SWSB 2QEJA 1YY8B 4DTGH 3MRFA 5I1DB 2DI7A 3QFDB 5E2WL 2WUBH 1E4XI 4ZNCD 1RZKC 1AGDA 4OTXH 1JZ7A 2JELL 3MRLA 3FFDA 2FECL 3QUKA 3BP5B 3GSNH 5CHNA 4ZFZB 2HT2C 3OXSA 2PXYD 1MNUH 4GBXD 1BM3H 1F4XH 1UCBL 4JANB 3TO2B 2DAVA 3HC4H 1KTKE 3O3UN 1T5WB 2D7NA 1IL1B 4OLXH 3W11C 5C0GB 2VC2H 3P3YA 4G43A 1KPUB 2ITDB 4HLZG 3IVKA 5FEBA 1BGXL 2ZSVB 4YXHH 3MRQA 2EE9A 1AFVH 1AGBB 1W0VB 2HT2D 5K59E 2L4OA 1DBJH 4FFWC 3DXAB 4H1LH 2WUCH 4BELD 3EO1B 2X4QA 3L6FA 4LLYB 4Z95L 2DI9A 5FA4A 4IEFB 5DQDH 5CEXA 4PGDB 1IQDB 4Y4KC 2BMKA 4XI5C 2QADB 3UZQA 4OM1H 2KL6A 5IB2B 4JZJC 2D0HA 1I9RL 4Z5RA 1ZLUH 2O93L 2Q20A 2IAMA 1Z2KA 1K4CA 1NLDL 3T8XA 4WIQA 2O5YH 3VXRB 2AKRB 1T21A 1K4DA 3I3EA 1IEAB 4NGHH 4XNMB 2ADFH 3P9LB 1F3JA 1HK6A 1CL7L 2IADA 1UA6L 1XMWA 4U6VL 3W2DH 1IC4L 2Z91A 5ACZA 1P69B 4GKNA 3OPZH 2MHAB 3BKYH 2UZXB 4D9RE 3BKCL 1TFHA 1NFKA 1RURL 5BMFL 1T0MB 1I1YA 3IJYB 2NY0C 1DQJA 3A67L 3UYRH 4GMTH 3PNWB 5F7LB 4Z7UA 2D0FA 3FO9A 4K71C 4AH2B 3RDTA 1GGIH 5IQ7L 2NY0D 2QR0A 4WFHD 3W39B 4ZPTB 2R39A 4WU5A 4X7TB 3FTGB 1NBZB 2ENSA 2OBGA 4TN9A 5DT1H 4WY7L 4TUJB 1ZLUK 3U9PL 1HHHA 3F62A 5D7LB 2F54B 3V6OA 3SE4A 3GBNL 3P4NB 4YR6B 5FM8A 5JXEA 4PJ9C 1B6UA 3LKNA 1I1CA 5B4MD 5D7KE 1CBVH 2FH8A 4KAQL 2XQBH 5I8OH 3FO9B 3GJFA 3GMOA 3O9WA 3GI8H 2R9HD 5E8OB 1IGJA 5AYUH 5A43C 3LRHA 5LXGH 2ZSWA 1WZ1L 3IFPA 3QA3B 1WF5A 1IGCH 4JRYB 1CR9L 2WWKT 5D71L 3WNLA 3GB7B 4C57C 4Z9KB 3QIWB 3TA3D 4RMSA 3X3GL 2X7LB 2K1MA 1HILB 5I19L 1C7TA 5KJRH 2E27L 5JMRA 3H9YA 3MRBB 4Z7WF 3GSNL 4IMLB 3VWKC 3OMZA 1MHEA 1DBAH 2X40A 1DBAL 5DMJB 1I3GH 5GGSA 3BPNB 3WXWH 3CVHL 4K23L 1G6RL 4IRSB 4NM4H 5EO9B 4ZMAT 3VFVB 2IH1B 3O9WB 5FYKD 2R23A 2EIDA 1JPTL 2E7LA 1ZEAL 3HAEG 1VESA 3B3IA 3L5WA 2XWBB 4MB4A 2DDQL 1F3JB 1L7TH 1QR1A 4QXTA 5D7JD 1OTUD 3ES6A 2J1KA 5DHVB 4MCYA 3G6DL 4BSVA 4PLKC 2J5LC 5AWNH 1QG3A 4ZTPL 1FZKA 1AHWA 1IARB 3QCUH 4R0LA 3OGCB 5D5MB 1PY9A 4DQOH 4F33B 3GSQA 3QQ4A 5IBTL 2EEAA 5DJDA 5TE4H 4OCSH 2UV3A 1NFIB 1BVKA 3B4NA 5ICZB 1R5VA 1PX3A 2PETA 3MLUH 4FP8H 4P5KB 1J1XH 4MDJB 1TLKA 4OZFB 4WHYG 5CEXB 4OBRA 4HJ0D 4Y19D 4APQB 4HZLA 5I6XB 1INQA 2ICWI 3FFDB 1EGJA 3D3VB 3ZKNC 4K8RH 4XBPB 4TNWK 5KANI 3KPRA 5JOPD 4WO4D 5F3BB 1T5WA 1NBQA 2DWDB 3QPQC 5C0GA 2H2SC 4JFDB 1GIGH 4G6AD 3T0EC 2I9TB 2DIJA 4RNRA 3PQYA 3MV11 4YBLB 3AUVA 4KWUA 1EA9C 5DMIH 4ONFL 1IGIH 4BZ2H 1ZGLA 4I2XE 1QVOA 2V9RA 1J86A 3FFCB 3PL6A 4OCMC 4Y4HC 5T33H 3ZDZF 4K3JH 4OQTA 1D5ZB 3P11H 3ZKXC 3UMTA 4L4VD 2R0ZH 3VWKD 5DYOA 5L7XL 3HI6L 4XBPA 4DUWA 3FONB 3ZT7A 1IGML 3ARBB 1ZT4B 2ZCLL 1DEDA 2EE6A 4O2EB 1MF2H 2OL3A 1WT5A 1SY6H 2Z8RA 4RNRB 2CXGA 3ZMRA 4ZQKA 4KZDH 4X7SL 3FRUB 3UPAA 2R9HC 1QSFE 3C6LB 1X44A 2DQEL 2EEBA 2HMID 3MLWH 2ILLA 2X70B 5IVNA 4MQTB 3X13A 2DTMH 4HBCL 3FQUA 1U3JA 5DA4A 1KENH 4PPTA 4EI5C 3VGAC 3RUGA 8FABB 3ULUH 2YD8A 3CFDA 1MQKL 4I0PD 2F53D 1SJEB 1C5BH 4KI5D 3QISA 5EA0L 4RQQA 1MSPA 3IETB 2XKUA 1NC4A 3BGMA 5IHUL 3IDYB 1U58A 3WSQL 5EIVA 4NZJA 3VFOA 4GBXA 4M6NL 5EN2A 1TETL 1E4KA 4M7KH 2E27H 3VWJA 4U1JB 3DRQB 3TYFA 4AIZB 1KCUH 4L3CB 2X4NB 2KQNA 4JJ5A 2Y36H 3AS2A 4IRSC 5DMGC 2CLZA 1V3KA 3HS0A 3EDEA 3C8KA 5A3IC 3HC0B 1ZXQA 1RUAH 1FVCA 3TCXA 2R23B 1NLBH 2P8LA 4Q6IB 4ZFFB 4TVSa 4QRRE 2ARWA 5KVEH 1K3ZA 3IJSA 4UOW0 4M48L 3ARGB 4HIEA 4AEEA 3EFDL 2DQCH 2I9LB 5IV2A 2WBJD 5BOPA 2UY6A 2NZ9C 3GK8L 3BIBX 4LPXA 4QNPE 1FDLH 1VKXB 1F2QA 4XXCC 5BV7B 4G6FB 3OJ2C 1FQ9C 4PJIB 4MJ5B 2VYRE 4XGZB 1DSFH 2BSED 2AXFA 3HN3A 3TBTB 1CFNB 4JO4L 3M1BB 5HHNB 1UZ8B 2Q3AA 1INDH 1TCRB 3VXUE 2BSSA 1R3JB 5E99L 4OGYL 3VRJB 1C8PA 3VJ6A 5E9DD 1FL5A 4EVNA 4M5YL 2FYYB 3I84A 4ZFFA 4ORZC 3UJIL 4YQXL 4PBWD 1X5LA 2W0FB 1XH3A 3CLEH 5KS9A 4AM0B 1TZIA 3BUYA 1YN7A 1EUUA 2FO4B 4LHUD 3EDJA 4U1IB 3SDYH 5D9SB 1UWGH 4JLRA 3MPCA 1UM4H 3QULB 5I1GH 2JJTC 4NP4H 3AAZB 5LG1A 4D9LL 1YC8A 3K1KC 3QCVH 3FRPG 4WCYH 1UQSA 3MA7A 5I8EA 1UM6L 2O5ZL 1YA5A 3U0WH 3EOBA 5DEGB 4QTIH 3GRWH 3RUGB 2APXA 1X7QB 4JM4L 1WFTA 5KS9F 3RZCD 3CPLB 4LPWA 4F3FA 4G8GD 2FH6A 2X09A 2BFVH 4G6JH 1FO0A 2E6QA 4NKMB 1NDMB 2VRAA 3ME0A 3BGMB 4HUWA 1OB1B 1HXYB 4UINH 1IEHA 3O3AB 3MREB 4X4XB 2Z8WC 2FL5B 3ALPA 4DK6A 1A7RL 3QP3A 2IQ9L 1W72B 4K2UH 4KHXH 3D9AL 3V6FA 5AZ2H 4N0CC 2R2HB 2NNAA 4KRLB 4RAHA 2NY0B 4GXUN 3CFBB 3LMJH 2OQJB 4PTUA 4LHQB 4S1SL 3SGEH 3IFLH 3RWDA 4K7PY 1DSFL 4HX1B 1PZ5A 3GI9L 4YC2B 4ZNEE 4TTDC 2EYSA 3QQ9C 3FQUB 4LMQI 4E5XB 4JN2B 4Y1AD 3KPMB 3QCTH 3ARYA 4M6OL 1NCAL 4G43B 2C3GA 4QHKI 4DTGL 1G7PB 3L5HA 5TJWK 4M7ZC 5D7JA 3V0VA 4QTHA 4KMQA 3C6LC 4XP5L 3QDGD 5CS7A 5DEFA 4XPGH 1NC4B 2XKNA 1RUAL 5EU7E 3MNWA 1ZVSA 3QQ9D 4LSRH 1KTLA 2UUDH 1HINL 4Z7UE 2YD3A 2X4QB 4J2XA 3MJ9H 1Q0XH 4U1MB 3WBDA 1A9BB 4BH8A 3VXSA 3QUXD 3P2TA 1Q0XL 1U2HA 4G6KH 1I7RA 1MCCA 1C5DA 1GGBL 2CJUL 4QRTB 5D70H 1CGSL 4D0DA 3EYOB 1AXSA 1MJJA 3FRUA 1Q9LA 3UROR 4OV5B 5LGJA 5F9JB 1MFBH 1XR8B 5GGRA 4KTYA 4OCWH 4JPKL 1TJGL 1C12B 2XZQH 4NZTH 2H45A 4RGMB 4I0PA 3QUKB 4XVUC 3DGGA 2ESVE 4PS4L 1H5BB 1QHOA 3FHQA 4S1QL 2XKNB 2ICEA 3TP4A 3UTTB 4E41B 3RFZC 3GMMA 4L4TD 4KROB 4LKCA 4XMLH 4Z7VE 1A4JA 3WIIL 2K9UA 4OGXL 1UXWB 2GAZA 5IHZB 1C5DB 1GPOL 1CZ8L 5EFIB 1Q9OB 4H8WC 4K7PL 2AK1L 5CEYB 4YHIA 1NFDF 2A0LD 4J4PA 1H8NA 1NUNB 3OKMA 3GMRB 4ODTH 2KQMA 3OZ9H 4WTZA 4X7DC 4MD0A 3RGVB 4XNXL 3VGBA 1D5XB 1NAMA 1AGEA 2C1OA 3PHOB 3RNQB 3ORJA 4CVXA 5JO5A 2WSKA 4WFGD 5CD3B 2A6DA 1HH6B 3CMOL 1YJDL 1EBPA 3MOAH 3NCMA 2E7BA 1N6VA 2B1HL 5CILH 2BK8A 3DGCR 4AL8H 1WICA 1FYTE 3BP6B 4MS8D 1OM3H 4YHPA 1YY9D 4MJ4A 2AEPH 1MRCH 4HIJB 4J3XA 1SEQL 3HE6C 3MLPA 4MNQA 3SDCA 2YA1A 5HD8D 4JKWA 4HS8H 1SEQH 5CD5D 4JFQB 4PJIA 4Q7DA 3N0PB 2XWTB 3U46B 4POUB 3CFKA 3MLYH 2RR3A 1LO3L 4PRNA 2EDLA 4OQ1A 4X6DF 1HHGA 1MY5A 1RUPH 3S34H 4P46B 1J0JA 3QHZL 3V79C 2JJVA 3VFTA 3ARFB 4Y1AA 3HFMH 1O7VA 2AJXH 4IMLA 2IAMD 2HT4C 4Y4HA 5HI4C 4V1DE 3HG1B 2BVQA 5HVGB 5EZOH 4G9FD 2ZJSL 1JF1A 1KJ2L 3V6FB 5EIIB 2X1WL 3QUZA 4MXVE 4GJTB 4KVCL 4L8DB 3IKCA 2A6IB 3QEQD 2ORBL 3RAJL 1WCBB 4WI5A 5A2FA 3EDDA 3V5HB 4WTWA 3ARRA 4J12A 4JQVA 1TTUA 2YZ1A 4GG6E 5D1QD 1CDBA 3BH9A 4YBLC 2OM5A 3V52H 3GSWA 5K9KA 1E0OB 3ZKSD 3IAQA 3B5GA 3LQAH 4K3EL 3ZE2E 2EYRA 5C0AE 3LRSB 4OI8A 2EH8L 2EDFA 3VXRA 1BMGA 2FGZA 4EI6A 3KPSE 5C0BD 1FZJA 1CDGA 4G80B 4OJFL 3DX7A 1FG2A 4L1HA 4YNYB 4XH2A 4ZAKB 3EZ8A 1WC7A 5F8QC 4G8EB 3PDGA 1AQDA 1A3RL 3VXRE 1A6VL 4L3ED 4MDIA 3DX9B 1BF2A 1U8OB 2COQA 4XPFL 1ZMYA 2JCCE 3IDYC 3UBXG 4MQXD 1T89C 4XWOD 2ZUQB 3QIUA 2Q8AL 5GGRY 4JPIA 1PLGH 5EO1A 43CAB 4NCC1 2OTUA 3WXVL 3QJFA 3U0TA 4N68A 2NZIA 4M61A 5J12B 1IKNA 2UZYB 4P4KA 3LPWA 5A2IH 3SO3B 3HR5A 2A73A 4E0RA 2HJFA 4LKCB 3V4UL 2YMXL 4QOKD 5L2JB 3BGAA 5BRZE 1QNZH 4O58H 1SY6L 5DUBA 1H3XA 1NCAH 4XTRD 1CT8B 1JHLL 5C6WH 1ZAGA 2BY1A 7CGTA 3VFGL 4QRTA 1U36A 1XIWA 2HJKA 2DQTH 3I75A 3MJ7B 3R06A 5I74B 2X1OA 4FG6D 2ICWJ 4HIHA 4KUZH 1WITA 3R4DA 4Z0XB 1QSEE 1K5NB 2R8SL 4NFDA 1KENL 3O9WC 4FQ1H 2VR9A 3UJJL 4RMQA 4APQA 1IGIL 4AK1A 3DGGB 5SX4I 2NY5H 3BKJH 4R96B 4NWTL 4NZRL 4UIMB 3QDME 1SBSH 5B8CC 3KPRB 4NDMB 5TDNA 2CK2A 3KJ4B 3RVWC 2G2RA 5A16B 4KTDH 1CT8A 1PZUB 4L29B 1AKJD 2J5LB 5BV7C 3F12A 1J10A 1I8IB 1VSCA 4U1HB 3CXHK 3T08A 1NDGB 4Z0XA 3OAZK 4MQSB 2CIIA 3SDYL 1LVEA 1EHXA 3IVKB 3SQOH 2Z8SA 1A2YB 4Y89A 1NGQH 1OM3L 1ZHLA 3QWQB 2GSIA 5LQBL 5DVOA 4OZHB 5K9QG 2FATH 4HIIA 1PQZA 5GGQH 1MH5A 3L9RB 4K7PH 1KN4L 3KYNA 3IRPX 2OYPA 3HZKA 4FFVD 2IFGA 4F37K 4ZDHB 5IBLD 3WXVH 1ADQL 5EU6D 4KU1A 1DANU 3WHE0 1MOEA 2N7BA 4PLOB 4U1HA 4Y2DA 1H3WM 2WINB 3TVMD 3LSOA 1QFPA 2VH5L 4XAWH 1FVEA 1BVKB 3JWOL 3HNSH 4NN5B 4GSDH 3QUXA 3GJFK 3EBAA 3JV6A 3RWCA 2OTUB 3AVEA 1ONQB 1J1OH 5CBAA 3RUGF 3RHWF 3BJLA 4LHUA 5E0QA 4GKOA 5DMYA 5E7FA 1OAKH 4XNYH 4CW1B 5E03A 5F9WB 4XMLL 1OGTA 1INQB 2I60H 2SEBB 3TT3L 1R3HB 3PWPE 3HNVH 4UT6L 3SKNB 1MHHA 4IHOA 4X6EB 5J89A 2ZUSA 3DYMA 3HPJB 1ZHBB 1S7RA 2ZUQC 4XBGB 2D7PA 3O41A 4I1NB 3QUYA 3G5VA 3U9UA 3V2AR 3DX7B 1HHKA 4IIQB 2R2EB 3HMXH 3VWJC 2PYEA 4LU5L 2NY2B 5D70L 4HXBH 3DX8B 4IRJB 3T3ME 4I13B 2QQNL 2Y23A 3DX9A 4HFUL 2VTFA 4N8PA 3U30C 1G9EA 2HJLA 4JFDE 1CGTA 3WO3B 3D0VA 2YSSB 3FB6B 3IU4L 5I1HL 4UIMA 4RCAA 3G6JF 1ETZB 1HYRC 3MODH 3IXTB 2X1PA 3ARBC 4KJWD 2P8MB 1QPXA 1C1EH 5GZND 2I9LA 3QJHA 4JDZB 1PYWB 4M4RA 5CP7A 4NT6A 4O2FA 3QRGH 5HI3C 4L4TB 3D2UB 2HJFB 1H8SA 7FABL 3THML 3UO1L 5IFJB 1DANT 3CFJA 2VB5A 3LS4L 3CU1A 3FL7A 3QIWA 4DKAA 4NC1C 5T5FH 5BV7H 4AMKL 2GI7A 4KK5C 2XT1B 1SJEA 1SYVA 5FO9B 3VG0H 3S35L 3KPSA 3G5XB 3D9AH 3VFNA 1EJOH 5GRZA 5T1MB 3IRZA 5EUKB 3P0YH 5C3LD 3BOVA 4MAYB 2YPKA 1LDPL 3TNNA 4U1IA 3SKMB 5EN2B 1K4DB 1U8NB 3MX0A 3LSOB 5DFVD 2HVKB 1G7QB 2IADB 5BVJB 5IMOA 1ACYL 4ZOCA 1L6XA 4ODVL 1M7DB 1FHGA 4OSUL 2MKLC 4HDIB 2BDNL 3DI3B 3TPUA 1XGPA 2EIZB 4MJ6B 4RRPA 5EPMB 4DW2L 1HOCA 2YS4A 2R0LH 2F54E 5IROA 4A2MA 2F58L 3U4AA 5EUKA 2R1XA 4OCXL 1MPAL 32C2A 1Z9SA 2C26A 3F65A 3ARVA 3U36B 1P2CA 2NYYC 4LNRA 1ORSA 2YWZA 2PKDA 3AB0B 3GSOB 2Q8BL 1E27B 1ZLWH 4LSQH 2X05A 2XZCH 2W9EL 3W39A 3IDIB 2JCCB 2YD1A 3WFBH 12E8L 1DDHA 5IT2H 4JCLA 1P7QD 1Q9LB 4WWKC 4PJHA 4R4FH 1QRKA 1KJ2B 1WBXB 3CSBA 5GS2D 2V5RA 3QUYC 4YO0A 4OCWL 1QPPA 5J56B 1WVZA 3DHJA 1RZJH 3QCUL 4Y2DB 4OLUH 4S1RH 4WHDA 1HCFX 3QAZC 4WO4A 2AI0L 2VAJA 5JZ7D 4N90D 1IQWH 2B39A 4HKJA 4QRUB 1EMTL 3OG4B 4BFEA 2PO6A 1XGTB 2PYFB 4B7LA 2V2XA 4U2YA 4WUUD 5EO0A 1U8KB 2RCSH 4LCWE 3BFOA 4ZNEA 3UJTL 3EYVA 3D18B 5DRWB 5DQDL 1KIPA 1G7PA 1QLFB 5DRXB 4OZIF 4HXBL 4HFWA 3U6RA 4ZTPH 4MNGA 2F19L 4TOYH 1TENA 2KBGA 4FQXC 3Q1SH 4QYOA 4W4OC 5E24E 1MVUA 3WD5H 2DDQH 5KW9H 3QUMH 1J1PH 2JIXA 5DD5H 4TVPL 3MROB 2VDML 4HJGA 4HUVB 4LSVL 3FONA 1UXSB 4PJFA 4L1DA 1S78D 3NCFB 1CYGA 2VNCA 4C56A 1XF1A 4WFFD 4XVJH 4OZIA 2VLME 3KDMA 5I1EH 1MFDL 1S7TB 4ZQKB 3I3DA 3D85A 1NGPH 3A6OA 3S5LB 3ARZA 1FFNA 1JRHH 5ERWA 3DURA 5T5NG 4N0UA 3UXFA 5T3ZH 1LK2B 1T66C 3LEXB 2O26U 4ELKA 1KACB 3C8DA 5E8PB 4JFOA 2UYLA 4DFIA 2F54D 1XR9B 1R3KB 4L8BB 3GSQB 5I76B 3BEWA 4G6ML 3OKMB 5HDLA 2EEDA 3VU2A 3BZFB 2R1XB 2KDGA 2ZKHL 3P11L 1OAUL 2NY7H 4Y8DC 3SO3C 4ELME 4JO1L 5E8OA 3AS3A 1R5WA 3VXNA 5J8OA 2IG2L 1KT2B 5B4MC 3F8UB 3LQMA 2AJVL 2EYTB 1U8PB 1MFCH 2JCCA 1MWAH 4TQEH 5IMKB 3EW3B 5CEZL 1KTLB 1XAUA 5DJAB 3O2VL 5CEZD 1RJLB 5GS1A 3V5HA 5ILTH 3B2UD 4XNXH 2WW8A 4U1MA 5ESQB 1RZIB 3SY0B 3BT2L 5T1LD 4BFIA 1Z6JT 2V7HB 1BQHG 1ZE3C 3STLB 5BVJA 2GJ6A 4HS8L 2DLTA 3ZT6A 3IF1B 2DBLH 1J7VR 5EO0B 4JZNA 4KK8D 1QFWL 5D1ZC 5DRWA 3TPUB 3TN0B 2XFXB 2R4SH 5EPMA 4BYHA 1AO7E 5GGVH 1OSZA 3UZEA 4JPVH 4FTVB 5LCVL 4X7EC 4WI9A 3WNNA 3OAZH 2IQAA 2H26A 1QBBA 43C9B 1K8IA 2H32B 3CUPA 5D7LD 3KPOB 5GSRB 4BH7B 4M93C 2D31A 4YEFA 5KSBA 4PJ8B 4HGMA 5HGHB 1CGSH 3HMWL 4QLRA 2A6IA 3BEVB 3WUWB 1GC1L 4QHLA 3O6FD 5IBTH 1BOGB 3L3IB 3PE9A 3WFHA 4DQOL 4MQXC 1HINH 1QUNA 4HWBA 2WLYA 4NRXB 2B4CL 2YA2A 1HEZB 3BH9B 4QCIB 5KSAC 2HKHH 5ACZB 1QO3B 43C9A 4I0PC 3EO9H 3GJFH 1O0VA 4JZJA 4HPOH 4JFFB 1T0MA 2XPGA 3IKKA 3FT3B 4PJGB 3FO1A 3PWUA 4KPHH 2X6MA 3HE6D 3O6LL 3W0WE 1EEZA 4I77H 4NO3B 1OP9A 1T2QH 3E8UL 4OFDA 1QQDA 4NOFA 1I3VA 2FNBA 1I3GL 4S0SD 2VLRA 1MFAL 4HT1H 1K3IA 4PJCB 4P2QE 1KCVL 1IQDA 1CICA 1E4XL 5JHDA 5TPWL 3WEXA 1DEEA 1KIRB 3ET9F 4NSKB 3HNSL 3W0WA 5IEHB 2PXYA 1HWGB 4HKXA 4PREB 4M1DH 5KTEH 3VXSD 5EZIL 1UWEH 5EU7C 3CFCL 2Z93A 4UINL 1KEGH 2VDOH 2AEQL 2AJUH 3BMVA 5DXWA 2A74B 3STLA 1A1MA 3C6LD 4H0HB 2H8PA 2GJ6B 4V2BA 5IESL 3DUUB 5KOMC 5INDA 1ZV5A 1B0WA 5E8PA 5F9DC 5E8DH 4P5MB 1GGIL 3ZLQC 3N06B 4KDTC 4X6DE 3RVVC 3P0GB 4JREC 1NEZB 1NGQL 2UUDK 4BZ2L 4N0FA 1R3JA 2VLJB 2F5AH 5CP3A 3U9PH 4P2CG 2VDQL 3BEWB 5EBGA 3LKRA 3JV4A 5IIEA 5IBUG 4OZHA 1EFXA 4MJID 1YPZE 2E6JA 4Y16A 1JNHB 3QRFM 4JANA 4YGVB 5J9PB 2DL2A 1OLZA 2DWEA 2DYPB 2HFGH 3AU1B 3VG9C 3LVEA 5IQ7H 5DK3A 4YDIH 2EDNA 4KJYA 3A6BL 1XGRA 3DNKA 1S7TA 2KPNA 5HHPB 2HFEA 5I1CH 2Y6SC 1BVLB 1QD0A 1CL7I 1XGUB 2R0LL 4J8RB 3RA7L 3MGTB 3NGBB 4Y2OA 3SCMB 4OZHF 5J0BA 5HDBF 1GIGL 5DD1H 4FN0A 3S4SB 3S8WA 4OZIE 2ZWLT 3JUYA 5FHAL 5I75B 3S7GA 4DVRH 2DM7A 3IB4A 1KJVB 4JFOB 4JFHD 1JBJA 4PGDA 4OSUH 2V7HA 1U9KA 4PB9L 5D1ZB 3UTOA 1LO4H 1MWAL 1SBBA 3IDMA 4FFYL 1UZ6E 3AREB 4M6AA 3NCYS 4UV7H 5FYJU 2ID5A 4MA1B 3BWAA 5I1AB 1CS6A 2GTZA 2CKBB 1ZHBA 2ZG2A 1Q9WB 1UZ6F 5JDSB 4P4KB 1B0RB 2DQDL 5I0ZA 4X5WB 1X5GA 4BUHA 4KKBD 1R5WB 4PJBB 3T3PF 1N59A 4I0CC 4XCCH 2QSQA 5F72S 4IDJL 5B39A 3O3DB 2GY7B 2QQNH 1M71A 4X4MA 1V3LA 2NW2B 5B39G 1PEWA 3WLWC 3W9EA 3QBTB 4LVNC 1YMHA 4HHAA 3ZKMD 4LCIH 2BC4B 1B4JH 1FNGA 1XGYL 4NC0B 3THMH 3UO1H 1JPSH 4XWOC 3Q6GH 4Y2DD 3UAJC 1JWSA 1T2XA 4X8JB 4KGJA 1L0QA 2DWDA 5EC2B 1Q9WA 1VHPA 2F8VA 4M00A 3BH8A 1Q72H 1KYOJ 3VH8G 5IMLA 5BZWB 3C8HA 1EEUA 3EOTH 1LILA 3OHXB 4U7SA 5J1AA 1DVFA 1DVFC 3EFFA 1A7PL 1OTSC 3TJEH 2DLHA 1P7HL 1Z9LA 2ZNWA 1XF2A 3EYQC 4PFEA 3RP1A 2OJEA 1KCUL 4WDIB 3PJSB 1KELH 4GW1A 1S9XB 4XRCA 5IK3A 4MDJA 4HV8A 4OZFA 4F9LA 2W60A 3EJZD 4G6AC 2AEIT 5HJ3B 1SMAA 3REWA 1EZVY 5BZDB 4NUJA 2DQGL 2Z92A 5EB9A 1V7NL 3V5KA 2E5EA 3B9KD 1W72A 1U2CA 2Q7NA 4M43L 4CMHC 2DB8A 3DVGB 4FQJL 1UH3A 3MOQA 3CC5B 4YDLB 1CE1H 4OD2A 3QDHA 4PTTA 1P1ZB 1WUNT 4IOIB 1FYTB 5AUMB 4A6YL 3HLAA 2VDNL 3GBMH 4UMGA 4XB8A 2CMRH 3VE0B 2FEEI 4Z8FL 1VACB 3B43A 4R97C 1LNUA 4J6RH 1U8LB 3FT2A 4QRRA 4PJ9B 4G80A 3G5ZB 2P5WD 2D7MA 3QDGB 4LLAA 3PGCB 3ZE1F 1CFTB 1TVDA 2Q86A 3PXHA 4XP6L 1HSBA 1O7SA 2VITA 2ESVA 3H42H 1LP9A 1UWXK 4IRSD 3TNNB 1J1XL 2YZ8A 3HS0B 3QIUD 4WW1B 4PJEA 2BNRD 2JB5L 3C8KB 4KQ3L 5B21A 3QWOB 5J13B 3HLAB 3QUMB 3TVMC 3TVMA 2NXZC 1JUFB 4WV1A 4HIEB 4EIGB 3MOBL 5TDPB 1LDPH 4PJBE 4JO2L 3CFDB 4NZDA 4K3DL 1PEZA 3H42L 5GSVB 4NCC2 4GQPH 2X4SA 3FB6A 1W0YT 4WEBH 2P5EB 3V5DB 1Y0LA 4CVZA 3OKLB 5DJYA 1OWRM 4OGYH 5DDHA 1YNKL 4TUOB 3W5NA 5FDWA 1N64H 3ARDB 1MCWM 4I5BB 3GEWB 1QLRB 1G7HA 2GHWB 1FDLL 1OY3B 3GK8H 2Z0BA 1MHPL 3VXQA 4OTXL 1H3VA 5AG8A 1AHWC 2J4WH 2VOTA 1IKNC 4P4KC 1HCVA 3ALWA 2YUVA 1KTRL 1T2QL 3E8UH 4KK5D 2JTDA 4C4KT 1RQ5A 1FBIH 1UCBH 2D4DA 3ARBA 1FORH 1X4XA 2I5YH 4PV9A 3ZYIA 3E6HA 4TVPH 3WE6B 3ILPA 2EH7L 4ONHA 1U58B 3LB6C 3EOAB 1YNTB 1FNSL 1OAYH 1IAKA 4L9LA 4R8WL 2W92A 2BY2A 5J1AB 1EFQA 1QRNE 2CIIB 5ITFA 5GPRA 1RZFL 1T04B 2J8HA 1A2YA 4X6CB 4DUVA 2B4CH 4YHOL 3ULVL 4G3YH 2A9NL 2M1KA 1FC2D 1F42A 5L2KD 5FYKH 1RUQL 1I1AD 3T0EE 3ZO0A 3CFKB 3L3DB 1X6NA 5BO1H 2HLFD 3UTTD 3OKKA 4GW5A 2BC4A 2GFBB 2NNAB 1S8DB 5E8NB 4MD4A 3T04D 1I1FA 4I2XA 4KROD 1T1ZB 3QO1B 2B20A 4R90H 3HUJA 3DX6B 4H20L 2EKJA 4R2GB 5EO1B 3DO7B 4TNVF 4Z77B 3OKEA 1IM3A 5C09E 3GSOA 3GHBL 4LSTL 25C8L 2IAND 3MLRL 2X4UB 5I2IA 1RUPL 3S34L 4GXUM 1EGJL 2A73B 1M7IA 2IQ9H 4JG0H 1XGYH 3DLQR 4UDUA 1TZGL 4F37F 2AABH 3BKCH 3QFDA 1I8KA 4JM2B 4X6BA 4XVUD 3MRPA 1QYGL 2AXHA 3S36L 1CD1B 1D5BA 5FO8B 3OXSB 4OD1L 1G0DA 1N2RB 1F4WH 4HCRL 4WENB 4HKJB 4QRUA 1XZ0A 3RVTD 1Q94B 1H15B 2VQ1A 1MCKA 4DN3L 1Y0LB 4CVZB 2AJSH 2BVUA 2AJSL 4C83A 1PX4A 3QUXC 2ITDA 5FB8A 3IJHB 5SWSD 1QLFA 1VCAA 4YIQA 1N5YH