1I9RH

Structure of cd40l in complex with the fab fragment of humanized 5c8 antibody
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
219
structure length
219
Chain Sequence
QVQLVQSGAEVVKPGASVKLSCKASGYIFTSYYMYWVKQAPGQGLEWIGEINPSNGDTNFNEKFKSKATLTVDKSASTAYMELSSLRSEDTAVYYCTRSDGRNDMDSWGQGTLVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of CD40 ligand in complex with the Fab fragment of a neutralizing humanized antibody.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cytokine/immune system
molecule keywords CD40 LIGAND
total genus 39
structure length 219
sequence length 219
chains with identical sequence K, X
ec nomenclature
pdb deposition date 2001-03-20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1i9rH02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1i9rH01
3RGVB 5IFHL 2Z92B 4LSQL 4V1DB 4IRJD 3U2SA 1WZ1L 2P5WE 5M95B 4MA7L 3BSZL 1G9EA 4M43L 2XN9A 5GGQL 3FT3B 5IMOB 1N26A 2X1QA 3A6OA 2GSGB 4NZRL 3I6KA 1P4LB 2I60H 4FXKB 4EIGB 2H8PA 1KPUB 3MLTA 5TF1H 5TPWL 1WCBB 4GW4B 2BHZA 4HZLB 5ID1A 4KRPC 1J18A 1EJOL 1NAMH 4HGWB 2LU4A 3L3HA 4D0DA 5FV2A 5DFWH 2ICES 4JM4H 5BS0E 2A0LD 4KKBC 3VFUA 5E4EC 2E5EA 1D5BA 1T21B 5I1DB 3SDYL 1JV5A 3IF1B 5FGSA 1U8IB 4K3GA 4MQSB 5BVPH 1YUHB 2DWDA 3M1BB 1J11A 1G84A 3QIUD 3IDJA 4B50A 1B6UA 2EDNA 1R0AH 1RUAH 1UYWH 3LEVH 4L3EB 3M07A 3DGGB 2XKNA 3TO4B 2F53D 5I0DA 5D7LB 4LHUG 4PRIA 2ZWLT 5DLMH 4PY7B 1UACH 5FF6B 1NGXB 1VPOL 5KSUA 1FNLA 2UVFA 1MFCH 1KXVC 2OQJB 5T1DL 5I8KH 3JTTB 2HJKA 4JQIH 3X13B 1MVUA 1QLRB 1WV7T 4XBPA 1R3LA 5INDA 2IFGA 5D1QD 3D3VD 1H8SA 1AC6A 1A6AB 3DV6B 2R2BA 4YO0A 4JHWL 5IESL 4WUUD 3PG2A 3UPAA 3SDXF 1FYHB 1JYNA 2L7UA 3DVGB 1OSZA 1JYXA 1JRHH 3MNVA 2ADIB 2PW1A 4GW1B 3C2SA 1U3ZA 3BIKA 5E1AA 1EBAA 3F7YA 4PTUB 5ALCH 4A6YH 5BV7B 2P5EA 3R1GL 1KIPB 1NUDA 2C1OB 3MRDB 4JVWA 1UB5A 1D6VL 3GMPA 5DQDL 1OSPH 4MJIE 2DQHL 1NFDA 4QRPD 3SEPA 1QFUH 5DJDA 1GGYA 1NBZB 4LHQB 2Y5EA 4N9GB 1CFSA 2OJZH 5EUOF 2CDFB 3O6MH 2R2EA 5SWZA 1OSPL 3TA3A 1CR9H 2EE2A 3OGOE 3BHBB 1ORSB 3IXAB 4H1LH 5CSGA 1LD9B 4LCUB 5IVZA 4JFHE 3RWIB 3MV7B 1MJJB 3FB8B 2FX8L 1JNLH 2EC9T 4JFXA 3BH9B 3IFPA 5IVXA 1HH9A 4QRUA 3VG9C 4G3YH 5BV7L 4BJLA 3G5YA 4G42B 4JPVH 2D31A 4MS8D 5IMKB 3LEYH 1NGQL 3O9WC 5BMFL 2I60L 1LDPH 1S7TA 5J8OA 4JN1L 1AO7B 3U82B 2IPUK 1I7TB 1B0RB 1UZ8A 1JHTB 2P5EB 1RZ8A 4HIXL 5DRXA 1MPAL 1DDHB 2GEEA 4P2QE 1J10A 4S0SD 2XRAL 5CWSA 1DVFA 5DD3H 1GZPB 5K9JL 5C0CD 4WHTB 3QNXA 3CLEH 5HHPB 1ZLUH 2GK2A 3DX9A 3OWEA 2DMBA 4N8CH 5HYQB 4YFLF 3MLYL 3CVIL 2DM4A 3L7EB 4Z7NF 4B7IA 3NN8B 5AWNH 1G9NL 2P8PB 4MJ4A 1CZ8L 5FO7B 4GG6E 4OBRA 3F5WA 4NO0D 3ALWA 2DKMA 2DRUA 1BM3L 4RGMB 4XBGB 4ALAL 1NC2B 5D2NA 2IF7A 2NY4B 2ZNXA 3UTZA 5JHDE 4DVRL 2WINB 4JZNA 5GRVK 3G6DH 3V6FB 3ZT7A 3QDJA 2MCPH 3T4YA 3CH1B 2ZUUA 5GGVH 5HPMB 1NUFA 4JHWH 5IESH 5IGXL 2B5IC 1U42A 1EJ6A 1YECL 3S3JA 1V7NH 2H2PD 5EBLA 1H8OA 4KJQC 3MNZB 4AIXA 4LK4A 2YUWA 1Z9MA 4M5YH 2NYYC 3C09C 3GB7A 3RWEA 3TJHD 1S9VA 2R9HC 2MCG1 4J23A 3SJVE 5JPMA 4O2CA 25C8L 1GZPA 1P4IL 4LSRL 5F7NC 4UV7H 1E4XH 2ZG2A 3KPNB 1KTDB 4ELMB 2RFXB 1HHKA 4K94C 1P4LA 1XGTB 2DLIA 5IFJA 3PL6D 3WHE0 5DJ6B 1F2XK 5IM7B 3DLQR 2GI7A 4PJ7F 2NY7L 5ANMB 5KSAA 5HVGB 1P5VA 2PO6A 1T20A 4F37F 3MXWH 3NACL 4HGWA 2DYPD 4L9DA 3MBED 4RMTA 1X5FA 1Z6JT 2VIRA 5CJQL 3CFCL 4GRLD 1AP2A 3DXAE 3PF2A 1LGVA 4NT6B 1IGFH 2EEBA 3SBWC 1FL5B 4NNPL 3ZDZE 5CZXC 1NJ9B 1Y6MR 4PPTA 4P99A 1E4WL 2F15A 2Z31B 4RZCB 5GRZA 2DQJL 5J1AB 2W0LA 4DJMA 1DZBA 1FVDB 1I8LC 1CF8L 4Y2DC 5C07E 1N4XL 1EAJA 5BZDB 4UV4H 1SYSB 3L5XH 2VDOH 3O8XB 4QGYA 4YBQC 4P9HL 4CUCA 2MHAB 1K5NA 5EU6A 3FQWB 5IROC 2IJ0C 4U1HA 3Q48A 4EUPG 4LVOB 4P2OC 1MRDH 1S9WB 3CSYB 5J4MA 3NTCH 1L6XA 4NWUH 4XNXL 3ZT5A 1NL0L 4ZFOL 2H1PH 4X9HA 4YDIL 2W9LA 3IAPA 2EDTA 3GSWA 3AB0C 4D8PB 3S37H 1VADA 3C8HA 3JBG7 3X14A 9CGTA 2Q8BH 3NTCL 1CGUA 4OKVA 2RR3A 1YYLL 1MRDL 1D5MA 1IZKA 4OM1L 3FO9A 4WFFD 5L2JB 2EKSB 2KUTA 4NNXA 1S8DA 3KPSA 3QIWB 1B4JL 4O4YH 3UO1H 2D0FA 4HWBH 2P5WD 4OLXH 8FABB 4FTVA 1GYAA 2P44B 1UM5L 3JWDH 1U8KA 1C12A 4Y5XC 1S7RA 1MJUL 5IB5A 4NKIH 4OB5H 5E2WL 4M7LH 2V2XB 3SE9H 4K3EL 1JN6A 5DMIL 4M93C 4X98A 3TT1L 3HS0A 1OOAA 1KPRB 1ZT4A 4APQB 1F3JB 4DCQA 5DJDB 5BS0D 1G7JB 2AJXH 3MGTB 5I1CH 1FDLH 4U1LB 4G5ZL 1KV3A 2YR3A 2GJ6D 3EYVA 2NX5A 2CDEB 1FSKC 1MCSA 1FV1A 5B8CC 3FRUB 3TT1H 4G6AC 1SY6L 3K74B 3MZTA 3SKOA 2EIZB 1QRNA 2Q8AL 4TPRH 2MPAH 3MV8D 2FATL 5I17A 3QO0A 1Q94A 4PJBF 3ARBC 3K81A 1KBGL 3RNQA 1T4KB 4MAYA 4HWNA 1FFQA 1EFXB 5IQ9A 5C6TL 3Q3GA 3SOBL 5E8OB 3V6OA 4OZGF 5IT2H 3UZQA 2XA8L 4M7LT 4KK9D 5DJCB 1FZKB 4HWEL 2HVKB 3QXDB 3GNMH 1AGEA 2WWKO 3IKCB 3HE6B 3K2MC 5HI3C 3A6BL 4KVNH 5C6TH 3U4BH 5EULV 4JPKL 1J5OH 2JIXD 2YN5A 3T0EA 4I77L 4PB0H 2YRLA 3EYUL 3O4OC 5TE4L 5C70A 1WWBX 1YPZF 2X42A 4NKOB 4XPFH 3ZE1E 5HHNB 3BWUC 3BJLA 3CIQA 5LCVH 1IGTB 3HN3A 5FYJU 1OM3L 4P9HH 2HRPL 2X1XR 4ZUTA 4JRXB 4HPYL 3VFTB 4HK0B 1RIVH 3QJHB 1J8HD 2DQGL 5GZND 2ZCKH 1NCBL 1HYRC 5DMIH 2FJHB 4GRLC 1PBYA 4OB5L 2F8OA 4PJXB 2UVEA 3VXSE 1MRFH 3WHXA 4QRPE 3OXRA 1PLGL 4E9LA 3JV0A 4UBDD 3H0TA 4XB8A 5I1CL 1RMFL 1KCLA 1NLBL 4QXGL 1FFPB 3VG9B 1XF4B 3BQUD 3WN5B 5CLTA 4IRJC 3OF6A 4PBXA 5DHVB 3HZKA 4QWWC 3QCVH 3NCEB 3MJ6A 4JFFA 2HFFA 1JNHA 4DAGL 3T3ME 2BVPA 3FHAA 1SEBA 1TPXC 2QADB 1H9VA 4G8EB 4KJWC 1KT2A 1HOCA 2EICA 2WV3A 5C9JA 3WNMA 1CICA 5HGGS 5DS8B 4ZO7A 4XPHH 4PGDB 2X4TB 1N6QL 2DQIH 3DETC 4JRYD 4O2CB 4YDIH 4JO1L 2WLZA 1XGUA 3DHJA 4P2RD 4EI5B 5D7IB 5E2JA 2K1MA 3CFKA 1LEIB 4MXVF 1Z3GL 3ARZA 3V5HB 1W72B 5C0CE 3ULUF 4XP5H 3TH4T 3ILQD 3GSOB 3WD5H 1R5WB 1JF6A 4L8SC 4QLRA 3MUGA 2F58L 1XIWA 4PJFE 4XMPL 4DUWA 3MJ8B 3BKMH 1DBJL 2KKQA 3VGBA 1XGPA 1P7HL 2BOBA 4G6KH 3MOQA 1HWHB 4PJ7B 3T09A 4Y16D 4YNYB 4ZOEA 3JWDL 2DLFL 2RCSH 1CD1A 4XXDA 4G6MH 2OTWA 4KHTL 2AEPH 5JHDD 3W0WD 2AK4E 3BMWA 4R96A 3UROR 3U9UA 3IU3B 1GGUA 2H8PB 3MLWL 2FB4H 4UNVA 1GIGH 2PUQT 2HG5B 4LU5L 3RJQB 1TJGH 4KVCH 4UINL 1NMCC 4PJ8B 4JG1L 1XAUA 3HCVB 2R0ZL 2RIKA 4FA8A 3OKKB 5C9JB 4NCC2 4ODHL 4OLUL 3IAGC 3MJ9H 4GFTB 2HH0L 2Q7YA 3MRIB 2AK4B 4NWUL 4XP4H 1L6ZA 2WUCL 2H45A 1JBJA 3QR2A 4NQSB 1QZ1A 5J7CC 3SCMB 2B7DT 1VACA 1D5MB 1UM6H 2ERJB 1LO5A 2HLFD 4WHYH 4XMLL 1GJIA 4TNWK 3P2TA 5C1MB 3LKSA 4X6DE 3QI9D 5GSVA 5ICZA 2EZ0C 4FQJH 2ZSWB 5FF6A 1TVHA 1UXWA 3GJFK 3LPGA 5ANME 2IAMA 5GGTA 3H7BA 4IJ3C 1G6RH 3GHEH 4D9RD 1IGFL 3CNKA 1XIWD 1S7SB 2D7TH 1CWVA 5C92A 4R3SA 2AV1A 5I6XC 5DMKB 3HMWL 2LV4A 4GMSH 5KVFH 1L0QA 1KJ3H 2DQDH 4IHOA 2F5AL 2Z35A 1IT9L 5ENWB 1ZT1B 4G6ML 4YUEL 1IMHC 4GXVL 3DXAD 5TE6H 2EE6A 2I24N 7FABL 4X99A 4ODSH 3U36A 1VFOA 4XP1H 5K9JH 3FRPA 3VRJB 4GS7B 3M45A 2DQDL 2BC4B 5DJZB 2ZCHH 5K9QI 5IF0B 2VDQL 1JZ8A 1K4CB 5I17B 5DWUL 3WIIH 5T1KD 1CGVA 5FFLA 1GRWA 2V7HA 4MQ7A 5FUOH 5J6GB 2A74B 5CJ5A 2D03L 5MEND 5JHDB 3IDYC 2CKNA 4PJXF 4U3XA 1NFIB 5C07A 3JWOH 4GBXD 1CFSB 5E03A 3E6HB 1UYWL 4PG9B 5GGUA 2NY3B 4QEGA 1KELH 1MHEA 2E27L 2VDPL 3UC0L 5I9QC 1HILB 2JK5A 3NFNB 4WFFE 3L1OH 4HS6B 3U7WL 1PG7L 4HUVB 5ESVA 3VDBA 1BP3B 3ZSTA 2R0ZH 2H2SD 3BMVA 4AEEA 1BD2A 3T8XA 3TM6A 4J3UA 3FO1A 3LKPB 4X9BA 3GO1H 3OR6B 2BSRB 3QQNA 5DUBA 1ZT1A 4DGIH 3L1OL 1GSMA 4Z9KB 4D9QD 1RZJC 3VGDA 3ULVE 4GMSL 4F15B 1KB9K 1FO0H 1X5ZA 1T22B 4LOUD 5B38A 1K4DB 1MUJB 2BDNL 5HYJA 1P53A 4G6KL 4QHNA 4F7TA 4B0MM 4POUB 2GJ6E 3TPKA 5F7FA 4XC1L 5D7IF 1U3HD 1B0GA 4O2FA 1U8OB 3VE0A 4I18A 1NEZA 3EOTL 1YEGH 1Q9LA 2SEBA 5JIPA 1TDQA 5EORL 5ALCL 5F6HI 1OAYL 4UU9B 5A16B 5IJVA 3CDCA 2VRAA 4LNRA 4LPWA 2EH8H 1RPQA 3O11B 2VLKD 1OT1A 2VXVL 2HKHL 1YEFL 5IV2B 4XWGH 5D71H 2K7QA 5FDWB 1KB5H 4X9FA 4PV9A 2X1OA 3VXQA 4MDJA 3VXOB 1MFCL 3HAEA 1OF2A 4LASH 1K85A 4NQCA 4XNMB 1NBYB 2CLRB 4KGJA 5HVHC 1MHPH 4LARL 4KTEL 5LXGH 1S7QB 3CMGA 4XCCH 5BQ7A 1NCTA 2DLTA 4TUKL 4H1LA 5D7SH 5CSZB 4OLEA 2FSEA 3CVHB 3F7VA 2B0SH 1X6NA 2CK0L 4ODVL 2F9BT 1KG0A 2CRMA 1BBDH 1RUMH 2CKBB 3HE6C 4KJPD 1DBJH 5HHVL 3QG6A 5F9JA 4YHZL 3QDGB 3U46A 2EIBA 5CKAA 4QHNB 2HJLA 3RWDB 2JIXB 2A9NH 4G5ZH 3T3PF 5D1ZC 2Z9TA 3O41B 1A7PH 2IWGA 4JFQB 3V79C 1UH2A 2J12B 3ZKNC 2IQAA 2SEBB 2VITB 4OF3A 3UJJH 5CEZD 4MA7H 3SDDD 5ANMA 3TN0A 4E5XA 5F7DB 3HG1D 3DIFA 3VFSB 1FL6A 4UAOC 4NQDB 1EPFA 5D7IE 5FCSH 2E7MA 1FNFA 5BW7C 5EZIH 1OP3H 3BWAA 2Q7YB 2OZ4L 4LQ1A 1UGNA 1U58A 3DWTA 4Y5XB 1J5OL 2NY1C 4RMVA 3ZDXE 4DAGH 2ZUVA 5D1ZB 5BS0A 1OLZA 2J4WH 4PD4J 4YHYC 1AD9A 4X9GA 3E8UL 4KK6C 4JKPL 5DD5L 4P59L 4AL8H 2YXFA 3H9SE 5IEHB 4N90E 2ZSWA 4F33A 1AXSB 2P4AB 1HYSD 4P2RE 5A2KH 3H7BB 5IT2L 1N59B 1MCQA 2XNAB 2H6PA 4KRMB 1PX3A 4OCRL 2YD1A 2WIIB 3QNZA 2XWBB 3C2AH 3IDMB 1IGMH 3K8LA 2Z4QB 3MRRB 4C57C 3PV7A 2MQ0A 3PWPE 5SWQB 3WIFB 5EOQH 3DI2B 5E6IA 4P2OB 1JE6A 2CR6A 3C60C 4NKMA 2X4UB 3V5KB 1C5BH 2XOTA 4HCRA 4HCRL 1BBJB 2D9QB 5CINH 1HKLL 2YC1B 3QCUH 3JWDC 2PYFA 4U6TA 2AK4D 2HT3C 1P7QA 3SKMA 1A6AA 4J3OC 3Q1SL 4KTYA 2JJWA 3WLBB 5IHUL 2L0DA 4WV1C 3GI9H 2B1HL 1NMAL 3HE7A 3JWNC 3MX0A 2PETA 2OK0H 2Y07H 3DURB 3O4LD 4NQED 1EH9A 4RFOL 3W0WB 3DMMB 3FAXA 2EKJA 5I8CB 2OL3A 2VXQH 3U4AA 4RWHA 1KEGH 2V2WB 4OCSH 2VJXA 3MRDA 3GIVB 4LSPL 3TVMB 4RFEA 3DRTB 4MSWA 1BJ1J 1GGCL 3OAYK 3QEQD 1OAKL 4J7RA 4U0QB 1QSVA 3QHFL 1A64A 5EIIB 5J1TC 1KTKE 1CG9B 4B7LA 3RPKA 1IAIM 3LQMA 1FORL 2R2BB 4Z95L 1PY9A 3QBTB 3ZTNH 2DDQL 2E9BA 4NKIL 4JHZA 1A9EB 1DP0A 1I1YB 1TJHH 2UYLB 4KPHH 2MKLC 3JUYA 1F11A 2EDKA 4R0LA 4F8QA 4HJGA 3KYOB 2NY5L 3TWCH 5CBAB 2DDQH 2VAJA 1HNGA 3BIKB 5B21A 3QFJE 3FN0L 4N0CD 1T1WA 4BK4A 3GJEA 1T4KA 2LTQB 3C6LD 5FK9A 5LAXA 4OLWL 1N8ZB 1HZHL 4H25B 5MI0C 1PYWA 3VFRA 3EJZC 1DQQB 1S7UA 4LNRB 4HUMB 4FQIH 5I1EL 1IEBB 3AY4C 3OBAA 5T5NG 1Q0YL 5MP6H 4KROC 3TZVA 1RZKH 3T77A 4YDJB 5ICXA 1QHOA 1HHIA 2WM0A 3VA2C 5KANI 4F8TA 3DX8B 2NY4D 4HG4K 3G5ZA 1N5AA 1DQDL 5AZEL 3DRTA 5AZ2L 3CMOH 2BK8A 2NY3D 4OCXH 3VRIB 2AJSH 1XGRA 5ACMA 4GBXB 3E1F1 1VESA 2O5XL 5DD1H 4R8WL 4GAFB 4LCWD 4NRYB 1CFQB 4OCYL 3RUGE 5DJAB 1FGVH 3ZTNL 3ULUE 2D4FA 4I2XA 1F11B 2P8LA 1RUKH 4JRXD 1HHHB 5I73B 3OAZH 1S7TB 4CJ0A 1IQWL 5E6YA 4HAGA 4NHUA 3FZUD 2P24B 4I18C 4JDVA 4PRBA 4JO4H 2OSLA 3I02A 5T1LA 6CGTA 4HV8B 1B0RA 1UZ8B 4Y8AA 4JFEA 2XXCB 4BA8A 5F96L 2DMKA 5JXAH 1AR2A 3RGVA 1KCSL 1KEGL 1N7ML 1J05A 1U8PA 1YY9C 5GS2D 5GRYA 4RMWA 5HD8D 2O5YH 3MNZA 4DW2L 1E6OL 1S9YA 3D18A 2EECA 3IETB 4WUUA 2ED7A 5EU3B 4FFZH 3FFCD 1VEOA 1IL1B 5D1QA 4Y4HA 1XIWB 2YKLL 3U83A 2VLJD 4UT9H 3B9EA 3CUPA 3H9SA 2BNQE 3ROLB 2VQTA 4HULB 3KLSA 4DGYH 4HJJL 1OY3B 5INCA 4PRID 3ABZA 4Z18A 1CD1B 1MFBH 5EZOL 1YEEL 4NN5B 1KN2L 5FIEA 3LOWA 4UOW0 2XTJC 4HS3B 1OAYH 3T2OA 3TA3C 1JF1B 2OR9H 1OGTA 1NMBH 5MEOB 1QR1B 3F6IA 3KJ6L 4OLYL 5C0BE 2DQFB 4XCEB 4XWOC 2AAVA 1QPPA 4KUZL 3C2AL 4EUPB 4BQBA 1G7MA 2HA1A 2YZ1A 1U8QA 1KUMA 4PBVC 1RZIA 3DXAA 1QBBA 3BIAX 3DVNB 4BQ6A 5D5MF 1FVDA 1H15A 4GUPA 3IAQA 3D6GA 5DVKA 3KPSE 1AGDB 4Y16B 2OM5A 4YH6A 2HG5A 1YMMB 3TO4C 3LN4A 2R23B 4WWKC 4MJ6B 4ZXBB 3IDXL 5CEZE 1EEYB 4JFZL 4F2MB 4MB4A 1XCQB 2Z93A 1CGWA 3QDHA 4OV5B 4XP6H 3HG1E 4BSWA 5GGVY 4GQ9L 4IHOB 3GZKA 1X5LA 4R4BB 3MRKB 1FL3B 2ZCHL 3O3AA 5E9DD 1FNGA 2ICEB 3EUUA 1Y0LB 3G5XB 2X5PA 3BYYA 3U6RA 3GKWH 3HI1B 4YHLL 3O9WA 1EHAA 32C2A 4POZC 2CLZB 4PR5B 4HFWB 4G7YL 4FFVC 4K2UH 5FHAL 4XC3L 4EDWH 4JJ5B 4GRLB 2DLGA 5IVZB 4S1QL 3N1QC 4YE4L 2Y06H 3MRLA 3WEXB 3T4AA 4KMQA 2AK1H 5EOTA 3MBEB 4YXHH 2XZCL 3NZHL 1OGAD 5E94B 3W39B 3O6FB 4Y19B 2GK0B 3DECA 2CLVB 5IR1B 4WI2A 3P9LA 5CHNB 2DWDB 2Q86B 2QV2A 4OQTA 4X5WA 3P30L 3BZ4B 4NUJB 2EDLA 5F1IB 4DN3H 5DFTA 2X2YA 4Q9QL 3PWPD 1QUNA 3BQUB 3S88H 3ZO0A 3FFDA 1ZS8A 4QTIL 2ADFL 4MZ3A 4HF5H 4XRCB 5CSBA 2C3XA 3MRCA 4HC1H 1DE4A 5ERWA 3ULVL 4IMLB 3MYJA 5GS3A 1R3LB 4ZFZA 4OZGB 4X4YB 4QRRA 1R6VA 3GHEL 3ARUA 3BGAA 1MCLA 5B3JF 5DK0B 5C09A 4L29B 4BH7B 2I5YL 3AS2A 3OKOA 1DANU 4XP6L 2WWKT 1I7RB 5EC1B 4JY4A 4M43H 5GISH 3V0WL 2DS4A 4KJPC 4KRLB 3TT3L 2IH1A 3V5DB 3DX8A 2OJZL 3NZ8B 3BPOC 3P73B 4IIQB 3QXAB 4H88H 2JK5B 3GMPB 3EJZD 5GS0C 5ADPH 4TOYL 3MRNA 5DZNA 5IB1A 1PKQA 3H9ZA 3VGHA 3VFVA 5KS9E 1A6VL 2BERA 4AEHH 2Q86A 5CHNA 4LCCB 4ZFGL 3ZKND 3STLA 4YE4H 3D5OF 1UVQA 1UG9A 4PJXA 3EHBC 3N1GC 4J6RH 1F4YH 1XZ0B 2DN7A 3SDYH 3SKUD 2R29L 1I3GL 2WBJD 3MRGB 5CAYB 2VDKH 1CFQA 1ZE3C 2MQCA 2Q87A 1MIEH 2ZUXA 5KSAC 1S7VB 5GS0H 4OLYH 4PJBE 3KJ6H 4PBWD 4EJ1C 5IHZB 1UJTA 3GB7B 3RWEB 3LKRB 2AXGB 2A6KA 1RZGB 1GPOL 5DI8A 4NCDA 1JGDA 3WJLC 5KW9H 1MH5B 4P46B 2CRYA 3CZJA 2V17H 3IKKA 4IDJH 3SO3C 1U8OA 1E6JH 2CJUH 5CP3H 1NC4A 3FZUC 3TIDB 4ZAKD 1T66C 4LBEA 3QWRA 4NBXB 3SGDI 4L3CB 4QY8A 3HNTH 3FKUS 1ZWIB 4ELMA 1IL1A 5I6XB 4OCXL 3BN9D 5F89B 1WBYA 4LVNC 1Q72L 1CU4L 1TNMA 1CD8A 3S35X 3MRHA 4JKLA 2VKXA 12E8L 1OGAA 5HDQH 3S98A 5E5UB 4AEIH 4OF0A 3LKNB 1MCIA 5CD3A 1MOEA 1KGCE 1KN4H 3QPXH 1AIFB 2MQ3A 4MA3B 5F7HA 1KIUA 2Y5TB 4Z78A 2FGZA 1IGJB 4FFWC 1BF2A 5F7KC 5KS9A 43C9A 3O8XD 3PHQA 1QLEL 5D6CA 3V6OC 1NLBH 1JV5B 1TQCC 3IF1A 3L5WA 3D1MC 1KYOK 4KDTA 1PD6A 3CXDH 3LV3B 4C54A 2BNRA 1UEMA 2DJ4A 2Z31D 5JXED 4JFQA 2R4RL 5F6IC 3U4BL 1NC4B 2GAZA 4XNYH 1AGDA 3P4OA 3FO9B 4MA1B 4P57B 1FIGH 4FXKA 4CW1B 1SEQL 3QHFH 4U1NB 2DTML 4ZMAT 1KC5H 4UTBH 5D70L 1D9KD 1WCBA 2W07A 5D72H 5T5FH 5IBTH 4HBCH 4JDTL 2CDGB 4ODUB 1XGPB 1N3NA 4CJ1A 4GKZB 1UB6A 4DZ8A 1YJDL 4Q74A 4BFEA 3BVNB 5IQ7L 4JR9H 3VJ6A 5EO0B 3PL6B 3H3PH 4OGAD 2F53B 1C16A 1IAKB 2BNQD 1ZA3B 5B38G 5I15H 5HI5C 1F00I 1QYGH 3V6ZA 2YC1A 3SKJL 4DN4H 4PRIE 3X12A 3EYVB 4J4PD 1UT9A 1X5GA 1FIEA 3U0PB 2B1HH 1GOHA 3BH8A 4M1GL 4EBQH 5TE7H 2X4RA 2AXHA 4R97B 5T3ZH 2XKSA 5E2WH 3TNNA 3HMXA 2DI9A 2J8UA 2K3TA 2HRLA 4OD2A 5KSVA 1G7JA 2J5LC 2QSTA 2O5XH 2XTLA 4MJIB 4KXZH 5C2BL 3RY5A 1J0KA 3RL2B 2XFXA 5T1MA 3OAYH 5CGYC 5C0JB 4XGZA 3B5TA 2R1XA 3CFJB 4XTRC 4NUJA 4M1GH 5KSAD 5C0BD 4Q9RL 2EZ0D 4Y19A 1R3HA 2YUVA 5JOPD 4X6EA 2DMCA 5KOMC 1XCTA 2FBJH 4NQVA 3NMEA 2CR3A 5I16A 4IRJB 1FCCA 4A6YA 2BHUA 3WNNA 4F7CA 3Q6FA 5TGBA 1RZFH 3C8KA 5IW3A 2NXZC 3AAZA 4I0CC 3MPCA 4KTDL 2JE8A 1DBBL 2F53E 3WIHH 5I66A 2Q3ZA 4U1GB 1SM3L 4PJHE 2MMXA 1VB9A 3FN9A 4IOFC 2VDOL 1RU9H 1V05A 2MOVA 4NPYB 3BO8A 4CU6A 4L4VE 4PB0L 4PJEB 2Q7NA 1MREL 4OQ1A 1I7RA 4IMKC 4M7JH 1INQB 4UZGA 4JFYA 4JRXA 2BP3A 2R1YA 5FGCB 3PL6C 2QQQA 3QCUL 2O61A 2KBGA 4LHUD 4XPGL 1Q0XL 5H2BA 3SDCD 1IM3B 1NBZA 3NCCB 3V52L 3HFML 4HCRH 4Y8DC 1NGYB 1WZLA 1LO3L 4ISVB 4K71B 4LCCA 2R2CA 1YY9D 1KFAL 1PLGH 2EXYC 3E6FA 4X7SL 1WVZA 3MGTA 2NYYD 1F45A 4G9FA 1RZJH 3NA4A 5J12B 3V2AR 4WTZG 5F3HB 2HFGL 3FB8A 3TCXA 5T33L 2QTEA 5DHVA 3RI5F 4QRSB 3DTXB 4ERSL 4LIQL 3G5VA 4CMHC 1YZZA 5J6HB 4OT1L 5HHOA 2EC9U 5FXCH 3LMJH 4NO0A 1AY1L 4JFHD 2NW2B 3UXFA 4JPKH 4ZTOH 1Q9WB 4XCCL 5DS8A 4PP2A 2YMXH 1CQYA 2AJYL 1CS6A 4HUNB 1V7NL 4JN1H 4DN4L 4V2CB 2Y4SA 3VXUB 4M4RA 4H0GA 2EDBA 4K55A 3KPMB 3MA9L 1LK3H 2C4XA 1DEEB 3RL1B 1MAJA 5F72S 4NRXB 1AJ7H 4J2XA 4Z77B 5SWZD 3K1DA 5IBTL 2X89D 3QFDA 1CLZL 1BFOA 4RWYH 4AG4L 4M6MH 3T4YB 4BQ9A 4ZUWA 2PCPA 3H9HA 1E4KC 3FOMA 4P2QD 4N0UB 1A7PL 5K59E 4Q6IA 1WZMA 4WUUB 1T1ZA 1WIPA 1JP5A 2X4QA 1G7HA 4C56B 4ODWB 5CD3B 3L5JA 2VABB 3QIBB 4Y5YB 1SYVB 4EN3A 1FN4A 1JFQL 4L4TD 4WFEE 3VFGL 1OLLA 3UJIL 5IB4B 2A6JB 4WJ5A 5AAWA 3MACL 4LVNB 2DQHH 3S34L 1FBIH 1DQJB 4PB9H 3KYMA 4G8GA 4X7FC 3U2SB 5D7SL 4YDVA 3MCG1 3LHPH 3ET9F 2YUXA 4XNMA 1RJZA 1MAML 1YMME 2OQJA 1AHWB 1XF3A 3QUYB 4U1KA 4WENB 1ZA6B 3MCKA 4HH9A 1K8DA 1G7QB 1S9XB 2Q1EA 2RFXA 2UZYB 4JKKA 1JWSA 4G8IB 5I19L 2XQBL 1FH5L 3GRWA 3D39A 3IJHB 2G60H 1YEFH 2A1WH 5D71L 3LDBB 2CKBA 5HGDA 4JDTH 4IRSB 2R0LH 1IQDB 3RDTB 1SJEA 4TUOA 3DVFA 5CKGA 3HB3C 2FL5B 4ZNEE 1ADQA 3REVB 4X6CB 1QBLL 5IBUG 1P2CA 4I0PA 1LO2H 2F53A 5C08A 5GJTL 1HSBA 2LVEA 1YDPB 4NKDA 1AGBA 4UUJA 4HKXA 3VJ6B 4NWTL 3SJVD 1JCKA 2V5YA 3MRBA 2ZUSA 3FQUA 1IEHA 4G6AD 4TNVK 3C5ZC 4RGND 1DL7H 3B9KA 4LLMB 2IC2A 5GRXG 3QEGH 5D5MB 1KNOA 3CFDA 5GZNC 5E2TL 1U6AL 1CI5A 2EXYD 2GSIA 1I9JL 4NHCL 1CFNB 3T0BA 4X5XA 1KGCD 4O02L 1HCVA 2HFEA 5KAQG 2ICWI 2BVUA 2EIDA 3BAEH 2R2EB 4PJ5B 4HMDA 4R7NB 4ODSL 4HXAH 3OXSA 4JM4L 2ARJQ 4HIHB 3WHE1 2X7LB 1KLGB 1KIRB 5E2VH 5ABDE 1S9WA 1W72H 2GUOA 4IRJA 4A6YB 1CFTA 4PY7A 1KENH 3MZGB 4JREC 5DUML 1P9MC 4H20H 4S1RL 4XH2B 1D6VH 1R3JA 3KPRA 1T89A 2PF6A 3O6FC 3RTQC 4MJ6A 3MRFB 4P3CL 3P0YH 4WUKH 1QTYT 4OCLC 3SGKA 15C8H 3U1SH 2OXGA 3VWKC 3ZE1F 3HNSL 3LSOA 2NY0D 4RGMC 3BDXA 1X6LA 1JPSL 3D0VB 4GAYB 4QRTA 4LLQB 3BKCH 1CFVL 4PJAA 3FO1B 1H3VA 1UZ6E 3RUGB 2R69H 2B8OT 3PDDA 4CADB 5ESVB 5DGQA 1RAMA 4TQEL 1XGQB 3EFDL 2AXFA 3IFNH 3VMOA 3WFEH 4YXKH 1CXLA 3WNLA 4YHKL 5TQ2H 2I5YH 1C08B 1F4WH 1IM3A 3QFJA 2VL4A 1D3CA 4UQ3B 4WW2B 1KJ2B 1XGYH 2V9TA 1KTLA 3FHQA 1K3ZA 4HT1H 4GXVH 4TSBL 3KYKH 1YQVH 3WKNA 4DUVA 1RJCA 1P7KA 1OP3K 4KQ3H 2Z35B 4DWHA 4JGJA 4ZPVB 1T83C 1HI6A 1F4WL 1QRNB 1CZ8H 3SQOL 1GHFL 4H8WL 3TIEA 5LGJB 2W0KA 4LLWA 4Z0XA 3B2UC 3NFSL 5GGQH 5AAMA 1QLFA 3KPLA 3MUZ1 2VXSH 5IWLA 3D2UB 4JANB 3GMMA 3OKLA 4PG2C 4XCNA 4PJDE 3UJIH 3NZ8A 4X8JA 1NPUA 1JTTA 1J1PL 3GMRB 4MDJB 3MV7A 1IM9B 1DL7L 2D03H 1OP5H 2C7UB 4GRMA 4XNZB 3LSOB 4BZ1H 1ND0B 5FO9A 1GL4B 2Y06L 3GSVA 3HHRB 3MV8E 1EXUB 4LCWA 3PP3K 4PJBB 3S3PA 1TVDA 4G7YH 2VDQH 2HVJA 4U1MA 5JORA 1FZOA 4PLKC 4PRHB 4BKLB 3WMSA 5J89A 3LPWA 1IFHL 3SDCA 4X4XA 3MA9H 1HHKB 4KKLD 5E6ZA 3PWPA 4U6YB 4YXLL 5F70A 4OI7A 3LIZL 2CUMA 3QB7C 5EDXA 1QSFA 4PJAF 4U1SB 1ES0B 2FIKB 3QXUA 4NP4H 4HD9A 1P7KB 4HC1L 5FK9B 1I85C 2PYEB 3R4DA 4MNQE 4OZ4B 3BRGC 1Z0NA 5DO2C 3TBYB 4IMKA 1RK0A 3MV9A 2ITCB 1JPGB 5D2LF 1V3KA 3O6LL 1VENA 5DURD 1JFQH 1DBAL 1J8HE 3O3BA 3W5NA 1UH4A 4L1HA 3HC4L 5HJ3B 4HQQH 2F58H 2A6JA 3VFSA 8CGTA 1RMFH 3VXSD 1KCVH 1AFVH 4LRNH 1RZ7H 4XXDB 4F9PA 3MROB 4HGKC 3N85H 3E0GA 4YHPB 5FYKD 4RX4D 2HLFC 3ARFD 3SDAA 1D6EB 1YN7B 5I1HH 4NQUA 4BELD 3EGSA 1PG7W 3GGWA 3HPJB 3RTQD 5A40E 5HY9B 3O4LA 4NQEA 1LEGB 1WFNA 3VWKD 1QRKA 2YUZA 5I19H 4LEOA 3QDMB 5HHXH 5DJ0B 5FDWA 1W72A 2Z0BA 2ZJSH 4QYOA 4XPFL 1ZWIA 2EDFA 4M3KB 1E28A 4RGOH 43C9B 3NA9H 4KWUA 2VLRE 3LZFL 4FTVD 3ZE0F 4KRPB 1T03H 4DOHE 4HV8A 3ME0A 2CLRA 2DLEA 1NJ9A 5T1DH 5LKNA 5B39A 2Y23A 1URLA 1KTDA 4W4OC 1QNZH 3MLSH 1QG3A 1NLDH 1OW0C 1ITCA 5F8QC 1UKTA 4JRYE 2BOCA 4MD5A 4OKDA 4PJGB 4XBEH 1JWUA 4QXUL 2KPNA 5D5MA 3KGRA 1AQKH 1JJUA 3FQNB 4P0DA 1MCCA 1FJ1B 1A4KB 2A9ML 1Q8MA 5BJTB 1FC1A 3SKMB 3HUJA 3RWCA 4NZUH 3VWJC 5MERB 1PG7X 1OSZB 1I8KA 3GSNH 5KTEH 2BMKB 2DQIL 1RIVL 2DQGH 4LCIL 1I1CA 2LE9A 2O5ZH 1P5UA 1A6TB 3AM8A 1FDLL 4MXWH 3QG7H 2Z31A 4RZCA 4DFHA 4IM8A 5I18H 2X4PB 1AGFB 3CFBA 1X4ZA 3MXVL 3P4OB 1HIMH 1HQRB 5MI0B 3X13A 3BH8B 2F5BL 3FB7B 3W0WE 1CFTB 2XZQL 3BKYH 2FIRT 3G6JB 2ADJA 2M26A 2WBKA 4GAGL 5DD0H 4PRPA 4KVNL 4BYHA 4HWBL 4OLXL 4X0KB 5C3LD 3KJ4C 3VWJB 2NY6C 3CFJA 5IFAH 4DZ8B 3MNVB 4JZJB 4PGBA 1CDBA 3IDGA 5IG7B 2IPTH 3BYTA 2DLHA 1H15B 5DFVC 5KVEH 1ZSDB 4HW6A 3MV01 3S37L 3NIDE 3OPZH 4HIJB 2EIZA 3BDBA 2X09A 3I50H 4FABL 4HS6A 1TCRA 2E9JA 2XY1A 4QRRE 4P2QA 2J8UB 2HJKB 5DO2D 1U3HC 4K7PH 1C08A 2W9DH 5GIRB 5D1XB 1I1RA 3SE8L 3VXNB 3PWLA 2YPLD 4R2GB 1BFTA 4JRYA 3HI6H 2IQ9L 2GJJA 1JWMB 2P42B 1S3KL 1ZLSL 3TWCL 5DT1L 3OJVC 3TO2A 1LNUB 1R3HB 1RZ8B 1FNHA 5GGRA 3JZ7A 1VCAA 3AMLA 4NNPH 3HI1A 3HAEG 4NFBA 1ZLSH 5GSRB 2C3VB 1P69B 3O81A 5ITBH 4CL7A 4YDJA 4QRRB 4XAWL 4FXGB 5LWYH 1FZJB 4LF3B 1K2DA 1U8LA 3PWUB 2ZUYA 4OLZH 3HLAA 1XMWA 5DD0L 3UJTL 5E99L 3RWJA 2YD5A 4R9HA 2A6IB 4U1MB 4DKAA 4LHUA 5C0NC 2B4CH 3V4PL 1XF1A 1IC7L 3PGFL 4HHAB 2LU3A 3U0TB 2G75B 1CT8B 4LSTL 2DTMH 1TIUA 3RU8H 3WKMH 5JMRA 3QG7L 4JG0H 1CCZA 1SHMA 4KV5E 1D5ZB 1DBKL 1HH6B 4YIQA 1NCDL 2FGWL 2Q6WA 4KZDL 1ES0A 2FIKA 3IFLH 4M7ZC 2EDQA 3KXFB 4UAOB 1JZ3A 2P8MA 2UY6A 3MV11 5L7XL 4R26L 1RSFA 4XCFL 3NFSH 5KANG 4TUKH 1F97A 4GW5B 4LKCA 4XP9H 3TP4A 2CKBH 4J3TA 4LP4A 3LKRA 2FEDC 2GJZA 3NCJH 3VXMD 5KSBA 3ULVD 3Q5TA 1CDYA 1M7IB 4NJ9L 1NANH 4R96B 4XI5D 4KXZI 4LF3A 3KYKL 4CAGA 5E2UL 5J6HA 5F7WC 1NCWH 1NFKA 3S5LB 1IVLA 1F58L 1OHQA 4HIEA 5L9DL 1XF5A 1G9NH 3N1PC 1BFVL 4ACPA 3GMOB 4F7MB 2JJVA 2NXYC 2PXYB 3CVIH 3FL7A 4HUUA 5DHXB 4K7FB 3MV8A 4PJ9D 4PUBH 3JVGC 2A73A 2VLRB 2GSGA 4XMKL 3SCMA 4YK4C 4LLUB 2VLKE 3K3QA 1UKSA 1HEZA 2QR0B 1YECH 1QR1A 2P1YA 5HYSA 3HR5A 1BGXH 3BW9A 3WFBL 1LE9B 2H2SC 2RJMA 5DUMH 4OZIA 5E00B 1NGQH 2Z8SA 4NQXB 1WJ3A 1I1AB 3B5GA 1E4KA 3HNVH 1LP9B 3QH3A 2VR9A 2HT3D 3NIDF 5EU7E 3O2VH 4XPTL 4TSBH 3JXAA 4MD4B 4MNQD 5GS0L 5DRNB 3FJTA 3NCBB 2Z92A 4PFEA 4XPBL 3MJ7B 2VITA 4TUOB 5MERA 4NP4L 2AJZA 1XCQA 2Z93B 3U30C 3V6BR 4NGHL 5I1GH 1MF2L 2YD2A 2EH7L 1T5WA 2LABA 5IBUB 3SKNA 5A1AA 1NBVH 3RJDA 4Y5XA 4PRAB 1CYGA 3CFBB 2UY7A 5FM4A 3O0RH 4ZNCD 3OB0H 4HH9B 4ZSOE 5FYKE 4NZTH 3BPCA 5HGBA 3FB7A 1L7IH 4K8RD 3L7FA 1KB5B 3KPOA 4F9PC 1OTSC 1S7SA 1IRAY 5F9WC 4JDZA 1GGBL 1KIPA 1PSKH 3OHXA 5SX4I 3TNMA 5IGXH 3FB6B 5BMFH 1JGLL 5GGSA 5DJ8A 1N5YL 5GJSL 1ZV5A 3BPNB 4YHLH 3L3KA 4PGBB 2JELH 1FZMA 4XP1L 4F15C 4L3AA 4OZIB 4QF1A 4RDQG 2VLRD 4NQTA 3UJJL 4OQTL 3LRSA 5JW4Q 1PVHA 1U41A 2D0HA 1LP9A 3O6FA 1J0YA 1FPTL 5TDPB 3DARA 2WBWB 3G9AB 5SWQA 1VERA 2BSTA 3BT2H 3T8XB 1TLKA 4P2YA 4BQ8A 3H9SD 5BOPA 5GIRA 4LSUL 5GS2H 3FO0L 3BGFC 4Q9QH 4DKEH 1HH9B 4QRUB 3O6LH 1MAKA 3DVNA 2B0SL 4YHKH 5FKPA 5IMMA 1YEDA 3FO0H 3VXTB 4QHKI 5DQDH 1JNNH 1SJVA 1J7VR 3SGEI 2I26N 5BZWB 4M3JA 2MTPA 1DR9A 3EOAB 1LVEA 1X5KA 4YFLI 3VFTA 1Q9LB 4FOMA 2UUDK 3GIZH 2CGRL 3S35L 1YEHL 5SX5K 2ZOLA 1D5IL 3KPPB 4XZUA 5L88H 5GJSH 3S7GA 1HI6B 3U6RB 2VAAB 1S7WA 3W2DL 2PTTA 3WBDA 2VL5B 3SDXB 5C2UB 1BIIA 3T2PA 3CDGA 4TSCL 4ZUVA 5BRZE 3UMTA 2Z91A 1NGWB 5MEPA 2DD8L 4PS4H 2G75A 2OS7A 3TEUA 2VE6B 5DLML 3O0RL 3MLXH 1BZ7A 2UZIH 4IOSD 4JO3H 2BXYA 3OX8B 5C0FA 4URTB 1R24A 1JNJA 1J1OL 5HI4D 1ZHNA 2X9YA 4QRRD 4XC3H 3D69A 1BQHG 4OCWH 1Z3GH 4PD4K 1OPGH 3SDCC 5EU7C 4OUUA 5LGHL 4RMUA 5IK3A 4XPTH 2DICA 2GFBB 4JDVB 4PRBB 1I8MA 3P77A 2JKXA 3RZCC 4MD0B 3IDUA 4C4KT 2HRPH 3QXVA 1BX2B 3FTGA 1GOFA 2B2XH 3BRFA 5DK2A 1DQML 4BFGA 4CU8A 3KPNA 1INDH 1X4YA 2W65A 3IETA 1NAKL 1T7ZA 3CC5B 3QFJD 3WYRA 4GG8A 5IFHH 1N64L 2CXKA 2JJTC 3TH3T 1ZGLB 1DUZB 4G6JH 3B5HA 3OL2A 4CVXB 5H94B 2HN7A 3NCYS 1T7WA 1N6UA 3LMJL 4I2XB 3U0WH 1A7NL 4WHCA 4LMQI 1QRND 4K71C 5EBWB 3VWJD 1M1SA 3SOBH 1G7PB 4XVJL 3WS3B 4ZG1A 3S34H 2N56A 1INEL 3MJ9L 4MA3A 5K9OB 4F33B 1F58H 5TJWK 2EYTA 5CZKA 5E08H 3E2HB 5C0AB 3D9AH 1TJIH 2BNRB 3TC9A 4YDLB 1ULVA 3OG4B 4I9WD 2GYSA 4GG6B 5BO1H 3NCJL 3DX7B 4E41E 3MQIA 4MD4A 2IGFH 1FPTH 4GKNA 4LQFH 2CIIA 3TZVC 5CZVH 4N5EC 4MD0A 2IBGA 3CVHL 3ULUD 1SJHA 3PP3H 3W9DA 4ZS7L 4JRXE 3PHSA 1G6RL 1LP9F 5CJXC 1MHCA 2CO7B 3W9EB 3MROA 2PW1B 1FNEB 4L8BB 3VXME 2Y7QB 1MREH 5D2LE 4RCAA 2EDYA 3B2VH 1VHPA 2W0FA 5DDHB 2DQUL 1T20B 1IAIL 4UMGA 3C6SA 4ZYKB 1BQUA 4MNQB 2R2HA 1EHNA 4M02A 1AXSA 1JGVH 1PKOA 3PQYB 1CLOL 1WEJH 2YPKA 3GSOA 3MRIA 3ROOB 1UC6A 4K7PY 3PGDA 2C5DC 3FQNA 4KU1A 2R0WL 4WO4D 4PYGA 3FFCE 1AKJD 1C12B 5L9DH 3FB6A 4O5LL 4KC3B 5EBWA 3V0VB 2VLJE 1HZHH 3QYCA 1GGIL 4PJ5D 3X3FH 5BCAA 4MX7A 2EH7H 1JZ6A 3VRJA 3LKNA 5A2FA 2VLME 4LCYB 5B39B 1KPRA 1ZT4B 1KULA 1I1AC 3QHTC 5GS0D 3U48A 2MHAA 4Z7WE 1UQSB 4YGVA 4YBHA 5EU6B 4F7PA 3MODH 1BQSA 1AI1L 2F8VA 1KLUA 3K46A 5HYIA 3CCHA 3W81A 4XNUH 5DMKA 2KQMA 1TQBB 5L7XH 5TDNA 3G6JA 3T4AB 3PHQB 3MUHL 3GEWB 4XPAH 3SJVB 2ZUWA 2A83B 3BP7B 1F3DH 3HG1A 2UYLA 3WLWD 5IKCA 2CH8A 3ZL4H 3W9EA 2F74A 4LPTA 3FAWA 4GRWB 4XPAL 2LVCA 4JG0L 3JTTA 1ETZA 1FSKB 2WP3T 5DXWA 1XFPA 4GLRI 3RKDC 1Y0LA 5E7FA 3VFNA 4NZDA 5F97E 3RA7L 3B9KB 1QPXA 3VA6A 4F7EB 3QP3A 2I9TB 2FYYA 5CP7B 5KG9A 2ZPKL 4MNGA 4RFEB 1YNLL 1M05B 4GAJL 4RBPH 3D85B 1IGCL 3ARBB 4S1DD 4TTDD 3MRMB 4UQ2B 4KZEL 1CLOH 1ACZA 1FIGL 4MX7B 1IC4H 4AY0A 5IUSA 4PJFB 4JFOA 1LO0L 3GMNB 1D7FA 1OVZA 4HUWB 5BRZA 2L4OA 2XZAH 3C6LC 2FX9L 3MLPA 3JV6B 4FXLA 3V7AG 4PRHD 1NGYA 4ONOA 1QKZL 2NY0C 1WWAX 3OAUL 4BQCA 2BC4A 1CLYL 1A7QH 1Q1JL 2X4OB 3AB0B 4JHAH 3VI3E 4NRYA 3FQXB 3IDNB 4U1IA 4I1NB 5I18L 1RIHH 5IOPB 1V7MH 2D9CA 1M4KA 4K9EL 2P5EE 2ZOKA 2P45B 3GSUA 3QULA 1AE6L 1EGJH 35C8H 1H3PH 3RFZC 1XR9A 1GGCH 1I75A 3HZKB 2NW3A 5EIVA 4XNUL 4K9EC 5FGCE 3H6JA 4JCLA 5JUEL 1KXQE 1XCTB 4E42B 3Q6GH 1OGAE 2BCKA 4EOWL 1NDGB 5E08L 4WDIA 3D0LA 4U2YA 4MCZA 4MXQD 1AO7A 4X7CC 4ELME 3GRWL 1CN4A 4MQXD 2WANA 3UYPA 3JTSB 1I9RH 4H8WC 1T2JA 4I77H 4R2GD 5DRWB 2NZ9C 5D1XD 43CAA 4PJFA 4AMKL 2PCPB 1DEEA 3PGCB 4H1LG 2R0KH 1QVOB 4L4JA 1NAKH 1A8JH 1MHPL 3SY0B 3L7EA 1DDHA 2KZWA 3KAAA 2YSSB 3WE6B 1EK3A 4OFYD 1HIML 4GMTL 1R5WA 4Z7UA 1XZ0A 3MXVH 2P47B 2P24A 2HN7B 5CINL 3DOSA 3G6JF 1LEKA 1C5BL 3QQ3A 1D5IH 1A3RL 3GDBA 2MCPL 4JFEB 5ISZD 3GIZL 1TNNA 5HI3D 4WJ5B 2X4QB 4C56A 2X40A 5IB3A 2NY0B 3HZVB 3EYQC 4EI6A 1DQMH 4S2SA 1RZGA 3N85L 1R5VB 3MOAH 2XWTA 2APVA 2C4FT 2VMFA 1DLFH 5FOBB 4HF5L 2FHCA 4WI5A 4U1HB 3DO7B 1NDGA 4EUPA 3AREB 4Z76B 1D9KC 4TULL 4CMHB 1KIQA 1UEYA 3IVKA 3R0NA 3OPZL 2K7PA 4FZEH 1K6QH 4ODBD 5IMLB 4OF7A 3SPVA 3H42L 3CU1A 4XX1G 1QLEH 3FB5B 5GHWH 5F7LB 5A3ID 4DVBA 1CL7I 2R23A 4C55A 3NFPA 3S36L 3ULSA 4DGIL 1B9ZA 2QHRL 3ZKSD 2A2QT 4GW4A 2R56L 4EKXA 1R3IH 4IOFD 4QYOB 4NBYB 1E28B 2BY1A 5SWSA 3CUPB 3RPIA 4XVJH 2B2XL 4EIZC 4XX1E 4BUHA 5HVFB 4FG6D 2HFEB 3MCLH 1A1MB 1EAPB 4KJWD 1I1FB 3EOTH 3E3QE 1FV1B 3OXSB 2FECL 2EIEA 1WISA 2NNAA 3V6ZB 1MJ8L 4QRQB 1QRNE 3BPLB 1EEQA 4NC1C 4BSVB 1NEZG 3EDEA 4HWBA 4IOIA 3ZKMC 4Z5RA 5C6WH 1QFOA 2WK2A 4KKCD 4Z76A 5HGBB 4X80L 3NIFE 1A4KA 3CSPA 4YXHL 2NXZB 1U92B 4I9WE 5DUPH 1A6VH 4XCEA 4TSAH 2VXUL 3U36B 4DTGH 1V8HA 1QSEB 2R1XB 5B39G 1DFBL 3ZMRA 4E41D 3ILQC 4WTXA 1HNFA 2OX5A 4M6NL 2PO6C 4ONGL 5K9KB 2F74B 3GJFA 4WNQB 1MIEL 1AKJA 5IW6B 1U8NB 1B2WH 4PTTA 2BSSB 4IEFB 3BE1H 4Y16A 4MQ7B 4NKOA 3U7WH 3HMWH 5KVFL 2E27H 5JW4N 1W0WB 3TPUA 5L0QC 5DR5L 3WLWC 2AGJL 4FS0A 1RULL 3I6GB 5IIEB 1L7TH 3TBTA 5DC4B 2X4RB 1MCOL 3HAEH 1PQZB 5BXFA 4W70A 3E6HA 5GGUB 2BNUA 5E8DH 5ENWA 4HFUL 1AO7E 4JRWA 5BV7C 3BZ4A 2D3VA 1AXTH 1KXTB 1QSFD 5DVMA 1ODAA 3CK0H 4D0BA 5T3XH 3MREB 4XGZB 5B22A 4X98B 3V0WH 3MGAA 4MNHB 3L9RA 5ICYA 1RUQH 4TVPD 1S7RB 3EOBB 4NGHH 2C3WA 4N5UA 1QSZA 1JRHI 2VLMD 4OM0H 3ARED 5DSCB 1W72L 3FQXA 1U93A 4Q97A 1A7OL 2P8PA 5FYJE 4FQXC 3AU1B 3O3EA 3G5YB 4G42A 3F5WB 1IEBA 1J0JA 1ND0A 2CD0A 3RWGA 3RIFK 1I3GH 3LRGA 1PG7H 2AQ1A 1JHKL 2R29H 5K9KA 1KT2B 2NX5E 4NM4H 3QUKA 5DUPL 3LHPL 1ZVSB 4AZ8A 3QDJB 1BJ8A 1A4JB 3PWJB 1A7BA 1N6VA 3OMZA 1UJ3C 1AR1D 1XGRB 5JOPE 5I1KH 3PABB 2G5BB 3ZDYE 1FNAA 3MYJB 5A16A 5IJVB 4ZAKB 3BKML 3MNWB 1IGYA 2ZNWA 4BFBD 4ZUUA 4S10A 3BP4A 4FMFA 5I1IL 4GRWF 3HMXL 3UEZA 3UDWC 3NCYP 4NO2B 5HHNA 1GC1H 1YY8B 4WHDA 3S96A 3SDCB 1CG9A 2ENSA 5I1IH 4J3XA 3UAJD 4MXQC 1C5DB 4HFUH 2O5YL 4JY4B 1ZEAL 3T0AA 1VFAA 3F7PC 5GRWA 4I0PC 4OUOA 2O93L 3DGCR 2N4IA 4L4VD 1CD0A 4YUEH 5D93C 2P48B 4N5ED 3T3PE 5CIPB 1FLTX 1EUUA 3SGKC 1PSKL 4PRHE 1LHZA 4ZS6C 4M7KL 1MH5A 4NN7C 3VGAC 5D7JA 3VXPB 4UU9A 1L0XA 2YD7A 3HRZB 3FT2A 4MB3A 1CVSC 3PIQA 4OCYH 1H3UA 4OCMC 4U6VH 3LKQB 4PJCB 4NHUB 5HTSA 3HTLX 4EUPH 1A4JA 2Y6SC 4YHPA 1G6VK 2D0GA 2XI9A 1S5HA 3CZFB 1MLBA 3DSFH 1NAMB 2GFBA 3L3GB 4PRPE 4WO4C 5AZ2H 1P4BH 3RGVC 3CFEB 4B5EA 5KZCB 4G8GB 3QUXC 1OT2A 2LTQC 2WUCH 5FUZH 1XGTA 4NO2A 2H9GB 5MEOA 5J0BA 3TJHC 1IAII 4GSDH 4X7SH 1R5IA 1ZHKA 4LCCC 1RJYA 3HNSH 2I07A 4C58B 5JORB 3BWAB 4P5KA 4FQXA 4H5SB 4PJHA 3BGFB 3EHBD 3TFKC 1AP2B 4KKAC 2NY2B 1BFOB 5DF0A 1HINH 5DVOA 5SWSB 3I3BA 2EO9A 1NUNB 4AJ0A 3DGGA 3OKNB 3X12B 4OCNC 3W82A 4YWGL 1T3FA 2PYEA 4E41A 3KYMB 4N0YH 1TJHL 3RDTD 3WUZA 4TULH 5B4MC 5FUCE 5ITBL 2R2HB 5GGTH 5SWZE 3U9UB 1RVFL 4BSVA 1KACB 3QI9A 1D5BB 2OTWB 2JB5H 4ODTL 1EMTH 1EEUA 4G7VL 3GSNL 4Y89A 4DQOH 1NBQA 3DBXA 3LDBC 4R90L 4L3EA 1AJ7L 4TTDC 1S7XA 4L4TE 2OMNA 1FFRA 3AS3A 4WFED 5GQBA 1OD9A 1C16B 3KPTA 4PG9A 5IEHA 2AJXL 3MOAL 3RNKB 1MFEL 3HR5B 1A6PA 3B6SB 3SGJC 4G6FD 1AHWC 5MP6L 3KYNB 1AKJB 5IW6A 1DSFL 4OD1H 1FAKT 4WO4B 5MEQB 3QDMA 3MRBB 4LPCA 3MLSL 3QIBD 2ATKA 4PJHB 1YMMD 3L3JA 1A0QL 3GSNB 1A1OB 3PQYD 4Z7UE 3C08H 2IAMB 1A22B 4MJIA 2W92A 3M17A 2VC2L 3LS4L 3QRGH 5D5ME 4K3JH 4DK3A 1TCMA 4LVEA 2V7NB 4OGXH 4QF1B 5FA3B 3P3YA 2CUHA 1JGUH 3ESUF 4FFZL 1MCWW 1HE7A 2JCCE 2FLBT 2I27N 2NY5H 4I3RH 1K4DA 4LRIC 3TO2B 2XWJA 2O5ZL 1A3LL 3MRQB 4H26B 3QWQB 2F8XC 2ATPA 3BKJH 3UTSD 1C7TA 1P6FA 5F6HJ 5L6YL 2I9TA 1N0XL 4MNGB 2K9UA 4U3HA 5IVXE 4EDXB 4RGNE 4ETQB 2NY1B 1H8NA 4MXWL 4Y4KB 3IGAB 1OM3H 4M1CC 2AEWA 4Y16C 3KYOA 2BRRH 4LPYA 1ZGLP 4NDMA 3CDYA 1T0MB 4LLDA 3UTPE 4DQOL 1G0DA 4FXGA 3MA7B 4FQPA 2IH1B 4QKXB 2X4PA 5HDBE 2HYMA 4WW1A 3KYAA 5L8LB 5DZLA 3BESR 1MWAH 1C1EH 1OP9A 3IFPB 2D7QA 1OCWH 4FP8L 3CMOL 2HFFB 4CGTA 3WCYA 4GRWH 4L29A 4BH7A 5JIHA 1YNKH 3VRIA 4XZUB 1IBGL 1RUPH 1BREA 3QFJB 3GK8H 1YY8A 1IC7H 4JKWA 3HB3D 3KLHC 2B4CL 1IILE 1XGQA 2DBLL 3K1KC 2MFNA 4KKAD 4P4KB 1NCAL 4N8VA 1KG0B 3GRWH 2APBA 3GMNA 5J56B 1K8IB 2YBRB 4ESKA 4XNXH 1G9ML 2A6KB 2X4TA 3FFDB 1JGUL 3WDJA 5EG6C 1G6RA 1QSFE 3MUY1 4Y4FB 3TCLB 3G6AA 3RUGF 3O2DL 3BEWA 4PV8B 2DQTH 3NAAH 2NTFB 3INUH 3U7YH 5D1XA 4UDTA 4FQ2L 5B4MD 4TVPE 2D7NA 1K3IA 2A9MH 3GM0A 4EVNA 4OZ4A 4R7DA 4HIEB 5C09B 2XACC 1V7ML 4ZDHB 3I02B 5T1LB 1T2XA 5CJ8A 5HBBA 3MLVL 1UM5H 2APTA 3UPRA 5FYJD 5AUMB 4XPGH 3MJ9A 4G43A 1H3GA 4NM8L 4AH2B 5DI8B 2FH8A 4CVZB 4BUGA 1JK8B 1SJXA 5EO9A 1PDKA 1NEZB 4I18B 4WFHE 3PWVA 3I3DA 5I73C 1QP1A 4FFYL 4HBQA 4OCSL 1JGEA 5EZIL 4HUKB 4O58L 1MWAA 1L9MA 4P3DB 3QFDB 2PO6B 1OF2B 4OCWL 4QCIB 4E0RB 1F4YL 2V5TA 1RI8A 2Y6SD 5JA8B 4UB0L 1HK6A 4YEEA 4ZFGH 1TZGH 4YDKH 5FDYA 2PR4L 5D7JC 1JIBA 3RA7H 2GJ6A 3QEHB 1QBAA 5J1SC 2BXZA 2DI7A 4N8VG 1UA6L 4DGVH 5DRNA 3KPMA 1EHLL 1X7QB 3MLZH 2BNQB 2FSEB 1GC1L 5C0AA 4RIRA 2CJUL 3MRJA 2DIAA 4P5TD 4P3WA 3QEQB 4JCMA 2W60A 5JOEA 3X3GL 3ILPA 3LCYA 3MR9B 4XAKD 4KJQD 3C60A 3GHBL 4Q0XL 4U05A 2DL2A 3H9SB 4V1DA 4GKZA 2NY7H 5TE7L 2IFFH 4ALAH 1B4RA 4QO1A 4MJ5A 1FL5A 3IJSB 5HDOA 3RWHA 3OKEB 1MY7A 5E6ID 12E8H 4JDZB 4X4MA 1F42A 4NFDA 4X6CA 4ZD3L 1G7LB 3S88L 5ESAB 4AEHL 4QHUB 4GLRH 4YHML 3MLYH 3O3AB 4MVBD 4X80H 4N8CL 3ARGD 3QXWA 5DJ0A 5D6DA 2WP3O 4ZFOA 2PXYA 4HUUB 4OM0L 1IZJA 4PS4L 2ZUQB 2VXVH 1UFUA 4JY6B 3TT3H 4RAUB 4G8IA 3V8OA 1BAFL 4XHJC 1TITA 1CDJA 3ORJA 4DFIA 1XF2B 2X41A 3R1GH 1JN6B 2ADJB 1I3VA 4CKVX 4LLUA 3NA9L 4OZGE 3R8BB 1MFNA 5ACLA 3BKCL 2WIIA 3LEYL 3O3UN 1ACYH 4Z0BH 4GUPB 1UCBH 1JRHL 2VZVA 1KLGA 2QQKL 4FTVE 4PLJC 3WSQL 1RULH 1MVUB 1QLRA 4XBPB 2FCBA 4GQ9H 1GGTA 2XWJB 4IOIB 5C7XL 4XRCA 2G9HB 1AGFA 2F5AH 3WL9A 4YBQD 3AUVA 1A6WL 1XH3A 5C0JA 3SCMC 5CD5C 3RTQA 1DVFC 3HR6A 3ARDC 1T5WB 3RVVD 2ZOLB 4RX4A 2VXSL 4HDIA 2EC8A 4ZPTA 3PXJA 4OFIA 4KMTL 4XCNB 4RISL 3CX5J 1EIBA 3MFGB 1WC7A 1KIRA 5I71B 1BZ9B 3MA7A 4JM2F 4PR5A 1A7NH 1OW0A 1T04A 2VDRL 1E27A 3ZYZA 4D3CH 5EB9A 5C0DA 1S9KC 4KQ3L 5I75C 3PJSA 3GBNL 1YQVL 2QBWA 1T2QL 2GK0A 5IR1A 2H3NA 2IG2L 1LE5B 4ZS6D 5ISZA 3UZEA 3MRPB 4P3CH 1FFOA 1HDMA 5D7JD 2FX7H 2PW2B 4P23A 3PQYE 4LCUA 4IIQA 4G9FE 3IXAA 2VLLA 2AJYH 4M5ZH 4YBLB 5EUOA 5LQBL 4L4VA 1B2WL 5KSBF 2AEIT 4GKSB 3U7AA 2E9WA 2AJ3B 4UT7L 2ED8A 3VXNA 4XI5C 1KLFA 4M6NH 1PZ5B 2BX5A 2Q6WB 5ESQA 3BPOB 3CVHA 2G2RA 1RUAL 1KTLB 3C6LB 5EZJB 2NTFA 3PDOA 3HKFA 3ZHLA 1JPGA 1NQBA 1T7VA 1HQ4A 3WHXB 1KJMB 4HXBL 2IADB 2BCKB 3P77B 3AGVA 3TLRA 4XB7A 1YEDB 1JHTA 5DRXB 3U46B 5ID0B 4K3DL 3H2WA 1VKXB 4M9OA 2YPLE 3QA3A 1T04B 2E7BA 3GJEB 4UT6H 1CICC 2PNDA 4BM7A 1A47A 4NWTH 4EN3C 5C71A 3UTPD 1IT9H 4X8XA 3SBWA 3HLAB 3EYFA 3H3KA 5ITFB 3PWPB 1ZXQA 2VO5A 4JPIA 5DRWA 5GRJH 4HLJA 4L8CA 3N0PB 3WN5C 5FO7A 4I2XE 4X9IA 1MHHB 1I8LA 1GGBH 1U91A 1ZLVK 5CSZA 2PW2A 3CFIC 4LLAA 5E8NA 1UCBL 4DGYL 1B90A 1T2QH 2YPVL 2HMID 2GIYA 5KVDL 3UTZB 2X70B 4K8RL 3SO5A 4AT6A 3DMMD 3QDGA 5AG9A 5MEPB 4GBXA 2JCCF 1TZHA 3AXLB 3PV6B 5GGRY 2JJUA 1YUHA 1I7UA 4LSTH 3VRLE 2EYRB 4PRNB 4I48B 3VFPB 2C1PA 4ZO6A 4BZ2H 2OMBA 1IJ9A 1G9MC 1N7MH 4QHLA 4LDEB 3HCVA 2FNBA 1YJDC 1A1NB 2YPLB 4DKEL 3D69B 5ETUB 1C8PA 4X7EC 1MF2H 4M9PA 1MCEA 5I74B 3PIQB 1KIQB 5FAAA 2HP4A 4LLYB 5J11B 4HK3J 1VFUA 3RIAF 3I9GH 3LQZA 4Z7NE 2W59A 1KCKA 4NRZA 4ZTPL 4XP9L 5F9OH 1S5HB 3V52H 1P2CB 5EPMB 1I9JH 4NHCH 5JDJA 5IB2B 4ZYKA 3MACH 1U58B 1KFAH 1U8MA 5C3TA 3QNYA 1HSAB 2KL6A 5DT1H 3NABL 4LKXB 4WU7B 1MRCH 1ZLVH 2PKDA 1HCFX 4LDOB 4XVUD 3VDAA 4XVTL 2XWTB 3HPJA 4ZO8A 3BW9B 2CRZA 3MLUH 4X5XB 4MAYC 1OAKH 2W0PA 3BJ91 2BFVL 2NY5C 4LEOB 3U0PA 1DQLL 4NZTL 1F8TH 1I8IA 2QSVA 2R0LL 4RRPA 1WBXA 1JHLH 5I76B 3WFCH 3AS0A 1YA5A 4F7PB 4Y1AD 2VDML 2OL3B 1P9MA 4FZ8H 4M4PA 3RKPA 3IDYB 3C5ZA 4NQDD 4CNIA 5DHVH 5ADOL 3T0EC 1RZIB 3EZ8A 3LRSB 4RNRB 4UIKL 1MAMH 1YEKL 1JPST 2CKBL 3LKOB 1EO7A 4KI1A 2VLJB 1BZQK 3WFDL 4QHKJ 2VDNL 3BGMB 3SDDB 1J1XH 3UYRL 3FT4A 1A14H 3GUTB 3QI9C 3R06A 1X5YA 5I1JL 4XAKE 3MOBL 4R7NA 2XN9D 1F6FB 2QKIA 3T1WA 4PRDA 4MCYA 5F1SA 4JN2B 5LCVL 3WFDH 2VYRE 5CLWA 4HKBA 3Q6FB 4AIZA 1NUGA 2QJDA 3MOBH 4WFGE 2HTLD 3BUYA 1I7TA 3ULVF 4FTVB 1BQLH 4O51B 1X5AA 3QIUC 1FVEB 4ODXA 3S9DB 1CVRA 3V7AE 1FAIH 4JR9L 4WI4A 4UT9L 4XCYA 3HZMB 4AEIL 32C2B 3P40A 4OD1L 1LO3H 1PKQB 4HUWA 5BRZB 4Z7QE 3OJDB 2XFXB 5T1MB 2X4OA 3EO1A 4U6HA 1JYWA 3QWOB 4MLSA 4RFOH 3ISWA 4U1LA 2BFVH 1ZTXL 4DCQB 4AIOA 2FJFA 1JGVL 4Z0XB 3H7LA 4Z7VF 5EOTB 1GOGA 4KTDH 3LS4H 3QRGL 1C1EL 1FFOB 1HDMB 2JF1A 3P9LB 1AD0A 3MO1B 2VLLB 2XZQH 3BKYL 4PJXE 5IBLC 5IOPA 1WBZA 4PJFF 3U9PH 5F7MC 3WS6C 4OJFH 2XKUA 4MAYB 1DSFH 1PKQE 3E6FB 5I1AA 1EFXA 5IQ9B 5DA4A 4QRSA 2XA8H 4MXVE 4L8DA 5DEFA 5DYOB 1GZQA 5CBEA 3TBSA 2IGFL 1QACA 5HYSG 5CS7A 2ZSVB 3U9PL 1VFBB 4P2RB 4EI5D 4ZS7H 1J1XL 4EEEA 1I85A 3ZT6A 5EUKB 1EDQA 1WUNT 2GJZB 3VG0H 1QLFB 3INUL 1MCFA 2MWCA 2DQTL 2EEAA 1PW3A 1FVEA 3M8OH 4ODXB 2P46B 4F7TB 2W9DL 4FQHA 1VKXA 3QPXL 3RIAK 4F7EA 1CDGA 4HK3N 4RBPK 2QADD 5HGHB 4YEFA 4K3EH 3RVTC 1JPTH 4I13B 4M7LL 1FC2D 4ZUTB 4KMLB 3GMOA 4L8SB 1RZKC 4F7MA 1JZ5A 1NGZA 3VU2A 2CK0H 5DK2B 3REWB 1IGIL 4C4KO 2ZUQC 3HNTL 1FAIL 1JMXA 3BZFA 3OJ2C 5DZOA 4HX1A 4FQ1L 1NL0H 4JQVC 5JPNA 2E7CA 2FO4A 2OZ4H 3VH8A 4OZHE 5F1NA 3KS0H 5EWIL 1ZAGA 3JV6A 1R24B 1VEMA 3PP4H 5HJ3A 2XQYG 1ZGLA 3MLUL 3P73A 4EQ3A 1YEIH 5LWYL 4HAFA 3N06B 2NLJB 5F1KC 4K8RH 3SDAC 4OM1H 4POZD 2VZOA 1EGJA 5HHXL 3TZVD 3V4VH 1DEDA 2X70A 3SGDH 5IVXB 1G1YA 2EXWC 2FEEI 3ZYIA 4MMXC 3F58L 2R1WA 2CUIA 1JNHB 1ZHNB 2F5BH 2EYRA 5EOCH 4DVRH 2YOCA 2YD4A 5BRZD 1I7UB 1J8HB 3BZEB 1LEGA 3THML 1A21A 3ZE2F 4BK5A 5D96C 3OKYA 4M8QB 3OTTA 5JOFB 3DROB 3RAJL 4LNVA 1YPZE 4QTIH 4XXCC 3TJEH 5L2KD 1BMGA 2WIMA 4JAMB 4M6OL 4OIBA 1CICB 3B3IA 4PRHA 3ROLA 3DXAB 1A3LH 5F93C 2BVQB 1DUZA 2AERT 5AEAA 2BDNH 3BVNA 1MQKL 5KVEL 2XN9B 4N1CA 4QXUH 5IMOA 1TENA 1TETL 5FGBC 5JW4R 3DYPA 1U36A 3EGSB 3CXHJ 1BLNA 1BOYA 5DK3A 5EIQA 3C9NB 2UV3A 5HYFA 1S78D 1KJVB 1GVIA 4HKXB 4IRSA 4R4ND 2R4SL 4F2MA 1OGTB 1WZKA 4JFDD 4WIQA 5C0IB 3C60B 2OTUA 5T5NF 2AKRA 1IC1A 4U6XB 4YR6B 1JI1A 3IU4L 3C8DA 5ILTL 5DJ8B 1OD7A 4NKDB 4UNTA 2GJ6B 2BVOB 4J4PA 3ZHDA 3CAFA 3HZYA 5BS0B 2YN3A 5IBLD 1MCHA 2RB8A 5D6CB 1KCVL 3VFOB 1P6AB 5D6DC 2DM2A 2J2ZA 3MRJB 2Y72A 4OI8A 1WFUA 3WJJC 4XNYL 4LSSH 1VPOH 3ZKQD 5E8PA 5TGBB 4C83A 2DQJH 1J9CT 2GY5A 1G7IB 1N64H 4WGVB 1W0VA 2AK4A 3MJGX 2ICWA 5K93A 3BGMA 4Z8FL 5FKAB 3LRHA 1MHCB 4HUXB 1KB5A 2NXYD 4O2EA 2BVQA 3VFMA 1VACB 3L3OB 3FT4B 3T2QA 1I7ZA 2EDXA 2NTSP 3G6DL 5DGRA 3GO1L 2RQ8A 4MNQA 3MRCB 1TVHB 1UXWB 5ERWB 4AIZB 4RMQA 4M8VA 5H8DA 1OL0A 3EYSL 5F6IB 1VFMA 3BAEL 1L7TL 5DC0A 2QQLL 1FGNH 3WL9B 3P0VL 4PRPB 3F8UB 3PL6A 5HVWA 1KJ2L 4PJGE 5E94A 3CK0L 1OWRM 2LQRA 4XXCA 1AXTL 4N9GA 2MKWA 5JHLH 2FJFB 2Y36H 4PGCB 1LP9E 3TF7C 3LN5B 4G9FB 4NQCD 5F3HA 3BEVA 1KJ2H 1REIA 2NNAB 2UUDH 3IT8D 4HWUA 4NIKB 3H0TB 1A02N 2V2WA 4ZO9A 1ZLWH 2VOTA 3FQWA 5D9SA 2FHBA 4Y1AE 1BZ7B 3EOAA 5I8OL 1RV6X 4PJ5E 2ZKHH 4TUJA 3BH9A 5H35B 3MRFA 5EC2A 2VLKB 4NQDE 1NGPH 5IKCB 1S5IH 3BE1L 3TYGH 1YNTA 4YHOL 2CGRH 3QWRD 1RIUH 3ARXA 1XH3B 4X6EB 2H3NB 1UM4L 3O2VL 1QSEA 4XT1C 3WXWL 4I8DA 2FEEL 1KCRH 1NFDF 4YHOH 4ONFH 3VFWA 2E7HA 3BT2L 5EUKA 4Q7DA 1M71A 4HMCA 2G5BA 4HJGB 2VDPH 2XN9E 3MNWA 4JZJA 5CP7A 5KG9B 4HUVA 2APWA 2OP4L 4HT1L 3WSQH 3JV5A 1FZJA 1QFWM 3EJYD 4MHHG 1I3UA 3IU4H 5DD1L 3VXRB 3CLEL 1MCJA 1ZK9A 5DD3L 5JA9A 2APFA 4L8SA 3DX9B 4H25A 2D4DA 4XMLH 4XP5L 4Y2OA 1JL8A 1BJ1H 4AENA 3UTQA 1WQVT 1NKRA 3BOVA 2FO4B 5JHLL 3KPLB 2VAAA 5TQ0L 3MV9B 3UBXI 2GTZA 1WGOA 5D7JB 4KHXH 5BW7A 1NBVL 2NLJA 4I5BA 4LLVB 4ISVA 4Y5VA 4I3SL 3VE0B 1M7DB 3EYFB 5DSCA 1FFNB 1F2QA 3BDYH 3DX6A 3GSRA 1GIGL 2QQLH 2B4CC 4LU5H 3RZCA 1JHKH 1MCPH 4KUZH 4HG4J 1EFXD 3HE6A 1ZA6A 1L7IL 3MCKB 1K8DB 4FFYH 1EZVY 2NY3C 2D7TL 3RBGA 3LEXB 3SGJA 2NY6B 1RJLB 4I4WB 1KJMA 2DQEH 4N0UE 1RIUL 3K4DA 1T0NB 1OTUD 2P5ED 3AREA 1SJHB 43CAB 4LHUB 1UWEH 1A9BB 3LQAC 1JK8A 1E4XI 3F12A 3JV4B 1RUKL 3B9AA 5H94A 3U7YL 1FGVL 4Z8FH 1BQHA 1UM6L 3REVA 1DBKH 2JLLA 3SE8H 1IGYB 1RFDH 4Z7UB 3NPSC 4XPBH 4PRNA 3GSXA 3ES6A 1S7QA 1ONQA 2L7JA 1EHLH 1PZUB 3THMH 1Q9KA 1BD2D 2A6DB 2YZ8A 3QH3B 3IFLL 4JO1H 4YHIB 2ZCKL 5E8DL 2DB8A 3ZSSA 2DBLH 1U9KA 5JIIA 1MEXH 3TESA 1JPTL 5HD8C 1X5IA 3WDIA 5DQ9A 4NRXA 2YHGA 3K0WA 1IKNC 4U1JA 1BF8A 5F7UA 4ORGA 2FB4L 3QI9B 2VABA 3EO0A 3F6LA 5EUOE 3K4ZA 4RIRB 1PGRB 1QR4A 1F4AA 2XY2A 4MD5B 1QO3A 2F54B 3GMLB 3UZVB 2E6PA 1OAQH 3HI5H 4RQQA 2DM3A 5IB4A 3LV3A 3QNYB 3IS1X 3O2WL 3QCVL 1I1AA 2EE3A 3WS3A 5C0BB 5DVLA 4DTGL 5ISZE 6FABL 3RRQA 1QFHA 4O02H 3RWCB 4OGYL 1MWAL 1NSNL 4KQ4H 4KY1L 4NN7B 3VGAB 3ARGB 5E24E 1A7QL 1Q1JH 4PGZA 3OAUH 3CSYA 1YEJH 4PREB 3RWFA 3JWOC 4YX2L 1S3KH 3CX2A 5LBSL 5L8JB 3LAFA 1Z9OA 3FOLA 3VI4F 1N6QH 4OZFA 5C8JA 4MQXC 2OTPA 2V9QA 3K8MA 3D3VB 4QOKE 1EAPA 4UB0H 3P0GB 1TTFA 5JW3H 4NQXA 2ZPKH 3D85A 2EYSA 3FQTB 4ZUSB 4F9LC 4P5TB 4LFHG 4K3JL 2YWYA 4OV5A 2ATPB 1LWRA 2CPCA 2M1KA 3L3DB 3CFDB 1C5CH 4OLWH 4JFDE 5BXFB 3LKPA 3GM8A 1UJ3B 1I9RL 1A2YB 4ETQA 5C0EA 3VXTA 4JN2A 1KOAA 3SKJH 5EWIH 3V8CA 1VEPA 4KRNA 4PY8J 3BD5A 4JRYB 4AMKH 4D0BB 3ULUC 3QEUB 1T0MA 1E6OH 2XTJE 4LLDB 3WNPA 1P84K 3BEVB 1KYOJ 1CFNA 4HIHA 4LDLB 5I1EH 3WLBA 3AY4A 1BVKA 3VGFA 5IEKB 1P7QB 1CLCA 5D9SB 1OAUH 1BOGA 5E56A 4BSJA 5ACZA 3PWNB 1BVLA 4O2FB 3KHQA 1FZKA 2R8SH 1W0WA 4K9EH 4FFVD 1MFDH 4U7SA 1N2RB 2A83A 5FKPB 5IMMB 2DIBA 5GGTL 3DSFL 4XNQB 5F3BB 1X9QA 5E4IA 3RWJB 4Q9CA 3RGVD 5ICZB 3EYUH 1JHLL 4N8VB 2ZG1A 4P49A 2AI0H 2RBLA 5T1LD 3OGCA 5CD5D 3CPLB 1KTRL 2BJMH 3EDJA 1X4XA 4TRPH 4JEGB 4P4RB 4OGZA 4R3SB 1LO0H 4KI5C 5LXGL 4RA0C 2E7LA 4XCYB 5I0ZA 5LGKA 3ARDD 5AZEH 4OGXL 3RVVC 5ADOH 3QJHA 1MCRA 3IRZA 5CUSH 2E8ZA 5BQ7B 3MRPA 2ZOKB 5TFSL 3S37X 3HI5L 4PLOB 4Y4FD 2AW2A 5FOJA 4NUGL 4FABH 1LNUA 1IFHH 4LAJH 3RVWC 3O3EB 4YC2B 1I4FA 2VN7A 4HBCL 3UTQB 1W2KT 4ZPTB 1J0IA 1I9IH 4P48A 1AO7D 5FA4A 4CBPA 5FGRA 3KXFA 4GAJH 5IP4A 5FM5O 1Z0MA 4NQCE 4NKQB 5CWSB 2H32B 5E5RB 4ZFFA 1BVLB 1N4XH 3MRNB 3ZYJA 2ZG3A 2YEZB 2HLAB 3HE6D 1CF8H 3I75A 3WN5A 3UBXB 4GQPH 1BFSA 4KAQH 2CK2A 5LBSH 3RP1A 4L8DB 5DYOA 1DBAH 1BQLL 3TBSB 2GTWA 2J5LB 1Z2KA 2JB5L 3HC3H 4WHYG 4CVXA 4JZOB 2W1NA 5F7DA 4QCIA 4E0RA 3QUXB 5EBMB 5B8CA 3DIFB 3B8SA 4W81A 1QVOA 1T0NA 2ENYA 5F89A 4KY1H 3VD4A 3BXNA 2IBZX 4E42A 3D48R 5C0GA 4WEBH 3MV8B 1JGEB 4KTEH 3SPVB 4RAHA 4F57H 4GRMB 1MLBB 4OF8A 4TVSa 4JKPH 3CH1A 2NX5D 5HPMA 3LIZH 2EEDA 3GMQB 4K94L 4ENEC 5EZLB 1T6WA 5D2NE 3DVIA 1PEZA 1MHHA 5EA0L 2GITB 4QRPB 1ZANL 1IGML 1Q9KB 2DWEB 1C5DA 2A73B 4BZ2L 3K2UL 3DRQA 3UTSB 3C6LA 2BOCB 1UCTA 3QEHA 3DX7A 1FCGA 3V5HA 4UTBL 5D70H 3ARDB 1IGCH 4WWKA 3H3PL 1P4IH 3MJ8A 4MA1C 5JR1H 1OTTC 2R69L 3MUGB 3P9WB 4ONHA 2W91A 4GOSA 2CRIA 4G8FA 1FJ1A 1TZHB 2DQUH 5BJTA 5HYSB 2J8HA 4IDLA 3B2VL 3EBAA 5L8KB 2IMMA 4P9MH 2BRQA 3ZKXC 2FO1A 2V2TB 3G04A 1HHJA 3S4SG 2W38A 1EUTA 3D18B 4QRQA 4KK5D 3BN9C 1T5XB 3AREC 3ETBF 2AJZB 5CIPH 3KPRD 4RISH 4P57A 2OL3H 3K80A 1HQRA 2UWEE 1AIFA 3O6FD 6FABH 3IJSA 5IW1A 2VISB 3GI8H 3LS5H 1TTGA 2VLRA 3DROA 1P7QD 4U6VL 2GHWB 1RJYB 1JNLL 3CLFL 3FCTA 4NQCB 4YLQT 5INCB 1AR1C 4CVWA 4LVOC 3ELAT 2AP2A 3OHXB 3TNMB 4HSQA 1FG2B 1IKNA 3T65B 1UH3A 5E9DB 2VDMH 4DVBB 4TOYH 1CXEA 4PRPD 4FQXB 4H5SA 5D2LB 1TFHA 1QOKA 1VSCA 1S5IL 4NC0B 3P4MA 3TNNB 4LFHD 2DKSA 2WWMD 4UT7H 1O0VA 4JFDA 2YPVH 4HIXH 3G9VA 4ZXBD 4HEPG 4U6XA 4YR6A 5IVNA 1SEQH 4HUXA 3BP5A 4WUKL 1VADB 4GKNB 3HMXH 5JIKA 5D7LA 1XT5A 3MV9E 5DJ2B 5C0EB 1E4WH 3EOBA 1UQSA 4YGVB 2Y1VA 3D25B 2HKHH 1NDMB 2V17L 3KHOA 1SYSA 1OP5K 3MC0A 4WW2A 5LGHH 1BVKB 4ZD3H 1G7IA 1MCPL 4YO0B 3TPUB 5DVNA 3I9GL 5I2IB 4JB9L 4WI3A 4G8GD 3ARSA 4XC1H 5I1DA 1VGKA 4OQTH 5KZCD 3G5XA 5DEZA 2ATKB 3L3OA 1BZ9A 4PLKD 2BSED 3STZB 2FWOB 4GAYA 5ESAA 4YQXH 2F54D 1B0WA 5HDQL 1NGPL 2NX5B 4YZFE 4TSAL 1FVCB 4Q2ZA 5FYLE 4KKLC 2V6HA 5F21B 4PRIB 4YC2C 1ZKAA 3BD3A 4FG6C 4GXUM 3MMEB 3MBEA 3IDNA 1NC2D 1T7YA 4OTXH 4U1IB 3G08B 5A2JH 3RNQB 5DTFA 4YAQB 2X89A 3QQ4B 3BP5B 3DUSA 2PTTB 5FUOL 2YA2A 2E7LC 2GT9B 3FFCB 2PR4H 5TH2A 4B41A 1BD2B 4L4VB 4PJEE 4C59B 5A2IH 2OR9L 2XQBH 1DN0B 2N7AA 4L1DA 4KV5F 4YXKL 4HIJA 3RVXD 4NC2B 4HLZH 5TDOB 3VXSA 2DQCH 3A6CL 5GRUL 4KJYA 1HXYB 3S35H 4XHQA 1I4FB 3OX8A 5C0FB 1F90L 1X44A 1ED3B 5H2BB 4AM0B 1A7RL 1SVCP 2G9HA 3UAJC 4TUJB 5H35A 1PY4A 2C9AA 2VZSA 5JQHC 3LQAH 2VLKA 4MAUH 5IMKA 5D1QC 3FT2B 3OSKA 1QBML 4AQ1B 3VFGH 1M05A 1S9YB 3UTSE 1EXUA 4LCWB 1XEDA 3S96B 4PJAE 4K7FA 3ECBA 3SDXA 5E2TH 4DZBB 2HVJB 3CZFA 1QBMH 3QDJD 2UZIL 1EO8H 3EIFA 3MV7D 5CP3A 1U3JA 3MLXL 3KR3H 4MCZB 4U1GC 4LSSL 4LMQE 4WHTA 2VE6A 1IEAA 3GI8L 4M5ZL 5LQBH 1YN7A 1WICA 3PUCA 5I1AB 4I0KA 3BZFB 1GAFL 1P84J 4Y4FA 3TCLA 4JHAL 2FHFA 4DKFH 2QSCH 1YQ2A 3PGCA 2VZUA 2AJUL 5F88B 4WWKB 4XPHL 4R0LB 4IBLT 3WUWB 4ZTOL 2E6JA 2P8MB 4JO2H 5HYJD 3PXHA 3GNML 5I8EA 2XICA 3KNBB 1U8QB 2YPLA 1PFCA 5FYKU 1CXKA 1BPVA 1JNNL 1M6OB 3GSRB 1QHPA 2AVGA 1MQKH 2X4NA 3WIHL 3LPFA 3NH7L 4JFFB 4NZJA 1G1CA 1JWSB 4TN9A 4GG8B 2AEQH 3QUMA 4NRZB 5EU6E 4YDLC 3WFHA 1W8OA 5AYUH 2XZCH 3NZHH 4LPUA 4G8EA 1T1XA 3BISA 1CQKA 4JAMA 5I1GL 3I85A 3C6SB 3PWVB 4TVPH 3M8OL 3RZWA 2IAMC 3SE4C 4MHHI 1FNEA 4L8BA 2FH6A 1DQJA 3PE9A 1O7SA 1A1MA 3ZL4L 3TO4D 4UNUA 1WLHA 4L3ED 1V5JA 1WCQA 3VI4E 3QIUB