1I9RH

Structure of cd40l in complex with the fab fragment of humanized 5c8 antibody
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
219
structure length
219
Chain Sequence
QVQLVQSGAEVVKPGASVKLSCKASGYIFTSYYMYWVKQAPGQGLEWIGEINPSNGDTNFNEKFKSKATLTVDKSASTAYMELSSLRSEDTAVYYCTRSDGRNDMDSWGQGTLVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of CD40 ligand in complex with the Fab fragment of a neutralizing humanized antibody.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cytokine/immune system
molecule keywords CD40 LIGAND
total genus 39
structure length 219
sequence length 219
chains with identical sequence K, X
ec nomenclature
pdb deposition date 2001-03-20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1i9rH02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1i9rH01
3VRIA 5ESAB 3HPJB 1KJVA 1DEEB 4GW1B 1T5XB 1OAUL 2MQCA 4FP8L 1XGRA 2RHEA 1QPXA 4OZHF 3UTOA 3MRKB 5HYJA 1FBIL 3TJHD 2BVPB 2BC4B 1JNLL 2H41A 1K6QH 4LRIA 4EI5D 1W8OA 3ULUF 2FJGA 1U92A 3TYFA 1N7MH 1U95B 2J7LA 4LP4A 4LAQL 1Y18B 1FQ9C 3QIBC 2OL3L 1QHOA 2FZ3B 1WICA 5F89B 1QVOA 3AFLA 5C70A 3WSQH 2UZIL 3CC5A 1N5YL 4JDTH 4GAJH 4N0UE 2IANE 5DDHB 2FX9H 3I6LE 4NUJB 4NRXA 4Q58C 5K9KA 4JN2A 3ZDZF 3P77B 3MRGA 3MUGB 2JB6A 3HE7C 1AQKL 1FNGB 5DLML 4JPIA 1N59A 5KVFH 2EIEA 5EOQH 2GW5A 5BS0A 4RMSA 4NDMA 3VFUA 2NZ9C 3SGJC 1WBXB 3RDTC 1YNLH 1EO7A 1RFDH 2DQEH 2YPLE 3MRNB 4PJEB 4OLVL 4NM8H 5CWSA 4OIBA 3GIVA 5DJ2B 5EBWB 4ELMA 4YFEA 1JNHA 2J8OA 2HMIC 4K8RL 1PFCA 5C2BL 2ZUWA 2HJLA 4NWUL 4X6CF 5MENB 1XF2B 1N8ZA 3CXHK 5GJSL 5FDWB 2H9GA 4KK8D 4GRLB 2IGFH 1YN6B 3HZVA 5FUZL 4PJIE 4OFVA 3RZCB 4D0DB 1RU9L 2GHWB 5D1QB 2R69L 3VWKD 4XHJD 3CFJB 1MJ8H 4MCZB 1N6QH 2DM3A 3MLTB 4NO0A 3IT8D 5I8EA 1OM3L 2E9IA 4FFZH 1XR8B 2HH0L 2R9HC 3BIAX 5I76A 4Y88A 4Q6IC 1CDYA 3SJVA 3TCLB 3QCTH 4TSBH 3V6ZB 3J7HA 4WU7B 4A6YB 4LRNH 5GHWL 5LWYL 1KFAL 1CL7L 2R0LL 2WINA 3RRQA 1EHLH 3MRFA 4YE4L 1JIBA 4TQEL 3R8BB 1CE6B 2WBJA 1U8NA 4ONFH 3P77A 3X3FH 4G9FA 1I3RA 3C60B 3EFFB 4GRMA 1T2JA 5B3JF 3ARFA 4XH2B 4X6DA 1AFVL 4LSVH 3GBML 3IU4H 1WLHA 2OL3A 4RMRA 3RHWK 4L8SA 3WFDL 3VXSB 5GRJH 5I2IB 1OCWH 1MIEH 2Z8RA 4PR5B 3EYOB 4QHKJ 4O58H 5JIIA 3BYTA 4HLZG 4PRDA 2NCMA 5GJTH 3DUUB 1V05A 3MRJB 3Q5TA 4R7NA 4NQVA 4PG2A 3MMEB 4R4ND 3HUJA 1T7WA 3DETD 2J6EA 4M7ZC 4I5BB 4Z5RA 3HZVB 4JJ5B 1TQCC 35C8H 3E3QC 5SWZE 3RL1A 2BXZA 3FT4B 5H37G 4F7TB 2NY2D 3ARFC 5JW3L 3NIFE 4ODUB 3KPQA 4RGMB 3PJSA 4HG4K 2VLJA 1MUJA 2XWJB 5I8CB 2VZTA 1JYXA 1M6OA 2P24A 5K33A 4V1DB 2BJML 1MCOH 1OT1A 1FVEB 2ARJQ 1T20A 5CGTA 4KKLD 4PY8J 5HI5C 1IARB 4M1CC 1ZWIB 4RFEB 1A7OL 2OK0L 2XTJE 2VABA 3UTTE 3HZKB 2EECA 1YYMH 3FRPG 5B8CC 3IXTA 4KZDH 3BDBA 1PVHA 4LLVA 4IRZH 7FABL 1J0HA 1I7UA 5T33L 2OQJA 4ODXA 4NN5B 1SJEB 3NOIA 4JY5H 4EVNB 4EXKA 4L29B 1NAMB 2GJZA 3DX9A 2R2HA 1D9KD 1R3JB 3O9WC 2VXQL 3RAJL 3LRHA 2NY4D 2CO7B 1AQKH 1T89A 1RZ8A 2IC2A 1ZGLP 4L3EE 3RUGF 3T4AA 5DK0B 3U7WL 4GFTB 4ZUSA 3S36H 4O2EB 2O5YH 3JTTA 4ZD3H 3SE9L 3ARGA 1BM3L 4JM4L 4F9LA 3UTZA 4HDIA 5AUMB 5HD8D 5C0JA 4R4FH 1N26A 1G6RH 3BWUC 2X4QB 3VXSE 2GTZB 4JDZA 3CFBB 3U0PA 3EOAB 2BY0A 1FJ1A 3G6JF 1S7XA 3QNZB 4MJ5A 4ONFL 4JN1H 2FR4B 3GRWH 3QUMH 1VADA 4HKXB 1ZS8B 4FHBD 4JPWH 2W9DH 2VZOA 4PJBB 3V6OE 1KB5A 2QLVB 1YEFL 3U6RA 2XTJD 4R0LA 3F7RA 2Z91A 4XBPB 2DQFB 4Z0XB 4QHLA 5GS2D 3U6RB 2R1WA 1DZBA 4HKBA 4FQQB 3D39D 4XT1C 4LKXB 1CLOL 1HI6A 1MWAH 1GC1L 3UTTD 1OM3H 1F3DJ 3W0WE 5I1LA 4F37F 3PWJA 3H42H 2CLZB 4QXUL 4Z9KB 4YHNB 1FO0L 5L9DL 3CDFA 2Q86B 2QQLH 1YMMD 1LDPL 1WWBX 3R06A 1SMOA 3C09B 5HJ3A 3NZ8B 5JUEL 4PYGA 4XPHH 3TC9A 2IBBA 5B3JE 2D4FA 3UDWA 2VDOH 1TZIB 1EX0A 1IZKA 4JFDB 1EPFA 1R3LB 4BQBA 3I3DA 2DIAA 3CFDB 3MGOB 4BH8B 5JO5A 3MSPA 1BM3H 4JM4H 4HIEA 5EH1A 2G5BA 3DXAD 3G6JE 4LU5L 3BSZL 4JM2D 4QTIH 3UJIH 1IILE 2YBRB 1RUQH 4NGHH 2F5BL 2H3NB 2YPKB 4LMQE 2VXQH 4JR9H 2NY1D 4RRPG 5FXCH 4RMWA 1XR9B 2ITDB 1ZHBB 1BJ1H 1O7SA 4QXWA 3O3AB 4M3KB 2F54B 1Q0YL 2FH6A 4HUXA 5EBLA 4JFYA 3SGDH 4PJGB 1YMHB 1JCKA 2ED9A 1P7QA 3O3BA 1F2QA 4BKLA 2B1HL 4LOUC 2HKHL 3DUUA 4OLZL 4PYHA 2V17H 1A47A 5D1XB 4X6EA 2XT1B 2NY5C 4HULB 3QUYA 5E4EC 4HWBA 4ODVL 1OTUC 3QIUB 4IRSA 3KPRE 5CSZB 1RULH 1YJDL 2NPLX 1RZJH 3QIUA 3PGCA 4URTB 1TCRA 5K9JL 3ARGC 3GKWL 1AGCA 3CMOL 3UZQA 2VWEC 4LPVA 4HIHA 1EO5A 1KTLB 2VRAA 4XX1G 1RURL 1KJ3H 1I1FA 1PKQA 4K7FB 1J18A 1HINL 5M95B 3FO1B 3LIZL 5T3ZE 5J12C 4U4BA 4NC1E 4ODSL 3QI9B 4XNYL 2APBA 4G5ZH 3GSQA 3B6SB 5J1TC 3ARDC 1C12B 2NY3C 1RI8A 2R56L 1CD0A 4HUMB 3CD4A 4EIGB 1NAML 3RBGA 2HVJB 4LARL 4PGEA 4P9ML 4DKEL 1U6AH 5LGHL 3NCFB 2YRZA 3BD4A 4PGZA 4OUOA 3ZE2F 1RZKH 3IVKA 2SEBA 4U7SA 1ULVA 5FECB 5C0AE 1AH1A 2NX5E 4TNVK 4YHNA 1FNFA 3AMLA 4F57L 3CFEA 2X6MA 3L95A 3TA3D 3STLB 1IEBA 2AV1B 3GSNA 4JFFB 2AV7A 1GGIL 1CD9B 1JGDA 1G9MC 2LU4A 3WD5H 2NY4B 15C8H 3MLYL 4FQ2H 2FGZA 3WFDH 5ABDE 3QPQD 3MRDB 5J11B 3SGEI 2WP3O 3OKNB 4P5TB 1EBAA 4G43A 3B9KB 3QH3B 2P8PB 5KW9L 4FFVC 1PAMA 3MUZ1 4XNXL 5BO1L 3QG6B 3EO1B 4Y4KC 1DVFB 4HUVB 1XF5A 4E42B 2X42A 4OV6F 2EDFA 2GUOB 4HC1H 1U8OB 3GI8H 5C92A 1NLDH 5E2TH 4KJQC 4N90D 5LVEA 1CLCA 1IGJA 4F7CB 3SGKC 1YDPA 4R9HA 4FZEH 3V0VA 4E41B 3VXPA 5AZ2L 1ZVHA 5IVZB 4PJ5B 4O2FA 3AS3A 5EUKA 4WTXA 4L8BB 5JPMA 2YD2A 1ZTXH 1J12A 3CXDH 5J1AB 4WFGE 1G7LB 1PDKA 1U6AL 3IRZA 2LVEA 4PREA 1G9NC 3SCMA 4CVZA 3V8CA 4OQ1A 4DCQB 1ZVSB 3OXRB 5JOPE 3AC0A 1CD1B 2DICA 4LFHD 3AREB 4HFWA 1FAIL 2GTWB 1EUUA 3ZKQD 3O2DA 1A6PA 2F74B 1QRNA 4M1GH 2I07A 5CAYB 5IW1B 3S36L 1U8PB 4XC1H 4GW4B 1UACH 5DJ0B 1WF5A 3QPQC 4K71C 4KHTL 1NCCH 4U1HB 1DVFA 4V1DA 4HUVA 4HKBB 5FUCC 3CLEH 1MHEA 1MQKH 3MUY1 3PL6C 2N1KA 4DVRH 5DVMA 3MRLA 2UYLB 1HHKA 4LL9A 2BVTA 4XNMB 2MCPH 3HC3L 3TA3C 4O2CA 1R3HA 4UIKL 5HVHB 1TVBB 3MA7A 2VLRE 1ZANH 3DGGB 1PLGL 5E99L 3F65A 5A1AA 2WWMC 2OSLB 4GO6B 4X7CC 3P40A 1INEL 2A77H 4WUKH 1F4YH 2P46B 3DLQR 3V7MA 5EA0L 1BAFL 1KCSL 4FZEL 3SKJH 2WLZA 1MVFA 3OXRA 4LLUA 1LO2H 2B2XL 3H9YA 1ZA3A 1BX2A 1YEKL 3ZE2E 4DKEH 4CVZB 2XPGA 3IKCB 1VGKA 3WFZA 2BOBA 4OTXH 2O5XL 3P4NA 5IB4A 1FFNA 5GIRA 3OKOB 4NNXA 4AT6A 1IAOB 4XWGH 2GAZB 3WNOA 4WI5A 3QI9A 2YMXH 5DEFB 5DD6A 1Q9OA 4RFNB 5TF1H 2Q7YA 2I60L 4N68A 4WENB 3L3KA 5EU5A 1W0VA 3TIDB 4ZUVA 1KCVL 2PCPA 4PJEF 5I8EB 1YNKL 3MCG1 3VI3E 5CEZE 1DQML 1F58L 4H8WC 5J13B 1KFAH 3U0TA 3LKSA 5INDB 3MA9L 1IGYA 4HQQL 4NO2B 5D72L 5BXFA 4LCWD 3KR3H 1G0YR 1MSPA 3IJYB 5GGRA 5HXMA 5SX4H 5T3ZL 5BXFB 4PG9A 5HHNA 1JTTA 4PRBB 5BV7H 3E2HB 1WT5A 4Y5YB 3QUYB 4S1DC 3DX7A 1DTUA 4OCWH 2LE9A 4UV7L 1TZHB 3C6LB 5EPMA 3V0WH 1PZUB 3QT2A 5DJ6A 2FWOA 3LQZA 4OZHE 2BY2A 4O58L 5CFHA 2GJ6B 2I27N 5I2IA 1KB9J 3MYJB 5E9DB 3KYOB 4PJDA 5HY9A 1DBAL 5C6WH 1D5XA 5MENA 2B1HH 1UXSB 4LBEB 3E6FA 5C08D 2X4PA 1FP5A 3TEUA 4NNXB 1MCCA 1X4ZA 2WANA 3JV4B 1FFNB 4NIKB 4RX4D 3KG5A 4XP6L 3BISA 2AXHA 3V9FA 4EUPG 3X11A 3MRBB 1ROWA 2Q7YB 4OGXL 2JJSA 4JO4H 4WFHD 4XMLH 5F9AC 3ZDYF 3PHSA 2V2WA 1Z0MA 4MD5B 4AENB 4NZDA 3PXHA 3AY4C 4Z0BL 1ZHNA 4NBZB 3V7AG 2FD6L 4LVHC 4CNIA 4MCZA 2NR6D 4KK6C 4I0PB 4GRWE 2GT9A 1CU4H 2HT2C 2Z0BA 4DFHA 3NFSL 3QIWD 1S7UA 3QFJE 4YHOL 4D9QD 1A9BB 1S5IH 3P4MB 4NT6A 6FABL 1VPOL 4ZFOL 1A1OB 2A73B 1AKJD 1NAMH 3EZJB 5LXGH 1I1CA 3AMKA 1IAIL 1ORSB 4TVPH 3MRCB 3HHRB 3SQOL 1JHTA 1VFBB 4POZD 1OP3H 1K6QL 3VFVA 3BP4A 4QYOB 1OLZA 1GGBL 1E6OL 4AEIH 2A6IB 3C2AL 4N9GB 1WISA 3QXDA 4M7JH 1DEEA 2VR5A 2C4XA 1WZ1L 4NWTH 2ZCKL 3SDDB 3WFEH 4WFGD 1I1AB 1CD1A 1G7JB 3OKOA 2Q3AA 5HD8C 2D31A 3MUGA 2FEDD 2I9LA 3F58L 4NO5B 4LSTH 4YUEL 2A9ML 5TJWK 3B9EA 3REWB 3X3GL 2Y1VA 2CK0L 1INQB 4R96B 4XAWL 5DLMH 3OKYA 4GRWH 3EW3B 3LQAH 2XRAL 5GRUH 3OJMB 5HSFA 1XEDA 3L5XL 2DKUA 1YNKH 4RA3A 3VXSD 2UUDK 2QQQA 2MHAB 5E94A 4Q9BA 1WT5C 2GUOA 1UB6B 4I3SL 4N0RA 4AQOA 2FECI 3T0EC 4KMTH 3OG6B 4MQ7B 1X5LA 4LPTA 1UKSA 5L2KD 3S4SA 2OQJB 4ODXB 1CBVH 2UUDH 4I2XA 1Y0LB 1KXQE 4BJLA 4XXCC 3IXTB 1PQZA 1RY7B 1OAXH 4NNYB 4U6HB 1IJ9A 3AUVA 4UT7H 4GBXD 3RWDA 1K4CB 4XCCH 5MENE 1C5CL 1BD2D 4PRHA 3VFTA 5JPNA 4X7TA 3K2MC 4PJDE 4OCRH 2CIKB 4R4NC 4O51B 2ADFH 3K7UA 4Y8DC 4M7JL 3U46A 1A1NB 3KYNB 2CPCA 1FYTB 4PB0L 4OLUL 3QXAA 4HIXH 5FGBA 5C0NC 3MLWL 4LVNC 4YHML 3WDJA 4I5BA 1XIWD 5KANI 1EVUA 3QNZA 3REWA 3UO1L 1A6WH 4CNIB 4OZ4A 1CZ8L 4P59L 2KQMA 4Z7WF 4WUUE 3NCYP 1JRHL 1WGOA 3HC3H 4AENA 2GITA 1U36A 1EFXD 5D6CB 3BKMH 1VEPA 3RVUD 2ZUSA 3RZWA 3RGVB 3L3GA 1BFOA 1UZ8B 3GJFH 1AKJA 4NWUH 3TCXA 2H1PL 5EOCH 3HB3D 5FYLD 1T0MB 3C60A 2JLLA 5FYJH 3AU1B 5MHSD 5JMRA 4Q9RL 1FC1A 2WP3T 1C5BL 2YD9A 5CCKL 3D69B 5DMGC 4HX1B 5HDLA 4F7PB 5K59E 4LLQB 1S7VB 3RTQC 3BO8A 4XMKL 1NGYB 4DKDC 1TCRB 5D5MB 1G7QB 1ODAA 1IAIM 2WQ8A 4JFXA 2DQGH 2GJ6A 2VLJD 1W0WA 2EDKA 4KRPC 4UILL 3HCVB 5CJOL 2HG5A 1ZHKA 5IK3B 3VCLA 4OZGE 3DX7B 4ODUA 1KLGA 5IG7A 1AC6A 3O11A 1DQTA 5IEHB 5BCAA 3DUHA 3DURB 3U4BH 5JHLH 1YC8A 4JJ5A 4NN7C 3QDGB 3FONB 4KK9C 3KLDA 3TBSA 7FABH 2XWTA 4H5SB 1YMMB 2APTA 2VTFA 4G42A 2ITDA 3CSYA 4UNVA 5D7SL 4HPOH 2AJSL 1HOCB 2RB8A 1CDJA 3FQNB 4P59H 4N90E 2CMRH 5CJQL 4DW2H 4LCYB 4JY4B 4PUBH 4YDKL 1NCAL 4UTAH 5C08E 4OUUB 5DQDH 5L2KA 2F54A 3ROOB 4A6YA 3EKCA 3FQWB 1HSBA 5TE4L 1FCCA 4PB0H 2GAZA 3OZ9H 4JRWA 3D69A 1R5IB 4XI5C 2QR0B 1KF9B 4LLMA 5D7JB 2QQKL 5INCA 3PL6D 4YAQB 2CLVB 1A14H 2VQTA 5KVGL 3CVHH 3H8NA 3WS3A 4ENED 1HILA 4CJ1A 1C1EH 4FOMA 4K71B 4D9RD 3RL2A 3MCLH 1RUAH 4HIEB 4AH2A 5FOBB 2J5LC 2DIBA 3HS0B 1DBBL 2WWKO 1DLHB 5DMKA 2P8LA 2HJLB 4L3AA 2WK2A 4KROB 2UZYB 1UXWA 5AZ2H 5IMLB 4HT1H 4CDGC 1XF3B 3EHBD 3FL7A 3V79C 4PJ5E 2YD3A 1NJ9B 4J3XA 43C9B 1HHHA 4OI7A 1MCPL 3LDBC 1KIQA 1EFXA 5ADOL 1UCBH 2XN9A 2DQFA 4FTVB 1NPUA 4M6OL 4Z0XA 1VENA 1XT5A 3UCRA 3VJ6A 5CJ8A 4HKZA 1SBSL 3V0AC 3EFDL 3D3VA 2DWDA 2ZOKA 5DEGB 2OBGA 4N5EC 2EIDA 4HBQA 1B0GB 4MAYC 5IB4B 3VU2A 2XFXA 3TNMA 1LK3L 3EGSA 4M6AA 2FIKA 3L3OB 2XPGB 3EDDA 1KTKE 4OCSH 3LVEA 4PRPE 1TENA 3TZVB 1EZVY 1EEZA 1OY3B 2WBJC 1Y0LA 3GSVA 5DQJA 4PJBA 2CR3A 2MPAL 1HKLL 3ARXA 3QI9D 4GH7B 1J7VR 1A0QL 4FS0A 5DRXA 4CU7A 4M5ZH 4XPAL 1NGQH 1HIMH 3FT3B 3SQBA 4OI8A 3P9LA 4DW2L 4QKXB 3QCVL 3QUXA 4R3SB 4MJ6B 1WVZA 3GSXA 3RTQA 3UTZB 2D7OA 1RZ7L 5A2LH 4HGWA 5TDNA 2BFVH 3KJ4B 1WAAA 3KHQA 4Y4HB 3ZKSD 1HZHH 4XHQA 3GDBA 3FO0L 3ZHLA 4CMMB 2QQLL 4NO5A 2R23B 5GRVK 5HHOE 4MDJA 1U8IB 1R3JA 1LP9F 4UDUB 4JDVB 4U2ZA 1M6OB 2P24B 4TULL 4UT6L 4EN3D 1G9NL 1BLNA 4NZJA 4U1LA 5E8EA 1P1ZB 1EFXB 2QQNH 3KJ6L 2X41A 3U30C 2XKNA 4JFOA 1S7RB 5CIPH 1TJGH 5F3BB 4DCQA 5MI0C 3MMEA 1RU9H 4JZOB 2IEPA 4FXGB 3QXUA 3VE0B 3LKOA 4WEBH 5DF0A 5HGDB 2YC1B 4N0YH 4EKXA 4HUWB 3V6FA 3VFMA 3LS5H 3WIIL 1GAFH 4Z7VF 5D5ME 3HI5H 1OTSC 3C5JA 5IMKA 1QSFA 2DQCL 5C3TA 1AR2A 3N1FC 2A6DA 4FQJL 3O3EB 5EIIA 4DN4H 2CLRA 3ARGD 4Z95H 2ITCB 4Y19B 5ILTH 2I25N 3SDXB 2QQKH 2APXA 2ICWJ 1BJMA 3NIDF 1NBVL 4J7RA 5EOQL 4FABH 5IJKA 1YEGH 4M00A 3FO9B 3EO1A 1WFOA 3D3VD 3MOBH 2VITA 3VGHA 3Q48A 1JWMA 4U3HA 4RDQF 1PKQB 3TBYB 2F9BT 3DRTB 4XB7A 4EZMA 1U42A 1MFEL 1NL0L 1U8NB 2AXGA 3MV11 3FTGA 1JHTB 1VFBA 3QFJD 4O9HH 5JR1H 4JFEA 1LO4H 3IFOB 2NY1C 3D25A 3HG1A 4HKZB 4PJ7A 3HR6A 4X99B 1BBJB 1QSED 3D18B 4M61B 5C0CD 3W9EA 4G6AD 3WIFB 5FYJL 5GGTH 4PJDB 1P69B 3BAEL 4K7PL 4C4KO 3E3QE 2X9WA 43CAA 2FYYA 1MPAL 3CLFH 4JREB 4N0YL 1C16A 2DI7A 3MGTB 4U1MA 5CKGA 2VMFA 2HN7A 3MRPA 4MD5A 2I5YL 1NAKL 2OK0H 1J8HE 1G7QA 1QUNA 3KPNA 1LE5B 3HRZB 2FIRT 3U9PH 1KLUB 3WN5C 3O6LH 1FGNL 4G8GD 4K94C 4C56E 3C09C 3U0TB 1XR9A 4U7MA 1FDLL 4GXUM 2VDKH 2JF1A 4PD4J 3GM0A 2YPLD 4IEFB 4K3DL 1OVZA 3AREC 3GBMH 3FJTA 3IU4L 5DSCA 2ICEA 4H1LA 2VO5A 1KNOB 4KRNA 4NRXB 3RGVD 2CKBB 3FT2B 4HWEL 1OP5K 2WQRA 1HWGB 3CU7A 1R5VB 1P2CA 4G8IA 4CVXA 2NXYB 5ACMA 4WUUA 5TPWL 1FZJA 3PGDB 4L5FH 4POUB 2V5YA 4JFQA 3IS0X 2IH3A 3F5WA 4JHZA 1R6VA 3O8XB 1H15B 2E6JA 2H8PB 1RHFA 3C5ZC 3QDME 4YBLC 5DJ6B 5KW9H 4U1SB 3TVMA 3GJFA 1RUML 5L88H 4D0BA 4LAJH 1W0WB 1ZLSH 2QKIA 4NJAH 1BOYA 5DVKA 1NKOA 2NY7L 1OLLA 3UYPA 3KLHC 5HGBB 3TZVD 3WIFA 4CGTA 4R2GC 5IEHA 4K7PH 1ZT1B 4UOW1 4HJ0C 1CR9L 3VWKA 4TN9A 3VD9A 2VDOL 4P23C 2LQRA 4D2NA 1NCBH 1UWEL 1HQRB 4LNRB 3N9GL 1X5JA 1DQQB 1HI6B 3CXDL 4P2QA 4O9HL 5JR1L 3CFCH 4OLZH 4MA3B 5JW4Q 4E9LA 4O2CB 3BQUB 4LASH 3VXRB 3NACH 3QDGD 4PRPD 4PJCE 2XTJB 3O9WD 1BFOB 1UZ8A 3HNTH 3D48R 3EYVA 1FGVH 4WI7A 1YEIL 5ESAA 5J1SC 4ODTH 3TIEA 1TJHH 3LD8B 1LMKA 3RPKA 1JWUB 4HZLA 2OZ4L 4HF5H 1MLCA 1ZOXA 4QRQB 4LVNB 1Q72H 3FFCA 4WHCA 2R4RL 1MFBL 1YN7B 2AJUH 2DI8A 1OT2A 4JFHE 3Q5YA 3AU1A 4L9LB 3Q2CA 4RFNC 1JF1A 3S5LB 1ZA3B 3D85D 3FB8B 1FSKC 2EYSB 1RURH 2OMNA 1NAKH 3K8KA 2R0KH 5FM5O 2CH8A 4JEGB 3THMH 1QVOB 4PJAF 2PTTB 1PX3A 3P3YA 2EC8A 1DANT 2Y25A 4WW2C 4ZUSB 3NA4A 4ORGB 1R24A 1X6NA 3TFKD 4LPWA 3MQIA 5JPNB 2PF6A 4YO0A 4JZOA 3DGGA 3MA7B 4P5KA 3K2UL 1H5BA 2J8UF 1KIPA 4PJEE 5E9DE 1WIOA 3DVFA 3BESR 3SDDA 5GGTL 3QIWB 3C5ZA 4OZHB 1EEZB 4HGMA 3LKPA 1A1NA 3WNLA 3L1OL 4KVNH 2AQ3A 2P5ED 1MAML 2QL1A 4HH9B 1KB5B 2EE9A 2EC9U 3CMOH 1U93A 5ETUB 1JK8A 1MWAB 5TGBA 5ANMB 4YDJA 4LF3A 4XBEL 4C4KT 2ZG3A 5IVNA 4LVOC 1UC6A 4P3DA 1MWAA 2OZ4A 4F58L 5DHVB 3LB6C 3LHPL 5DEGA 4FQQA 4C58B 5E7BA 3NACL 3PG2A 2FRGP 4F7EA 5EC1B 1UM4H 4P2RB 4TUOB 4WEMB 3UZEA 1B4JL 3WKMH 1HH6B 2A73A 1GZQB 4G5ZL 5KSBF 2ZSVA 5ECJE 5EU4A 4RZCA 2D7TH 2AV7B 4E41D 2RR3A 2BVYA 1T03L 4YWGL 1IE5A 2Q8BH 3S4SG 3EDFA 1W2KT 3EDJA 1D6VH 3IDMB 3Q1SL 1H3PL 3F5WB 3ZL4L 5SX4I 4XHJC 1RIUL 2FHFA 4H0GA 2XZQL 2ADJA 5DK2B 2KH2B 3PWVB 5C0GB 5HPOA 2IAMD 2D9CA 3VRLF 2UWEA 2XXMB 1IQDA 3DROA 3KR3L 1BZ9B 3C9NB 1EXUA 1V7ML 4WHDA 2I9LB 2JCCB 2ENSA 1MFBH 3MPCA 3QCUL 1ZV5A 2O61A 3K2UH 2FLBT 3TNNA 3B6SA 1IVLA 3MBXL 4OAWB 5I1GH 1BVKA 2XKSA 5LCVH 4PLOB 5AG8A 3ZSTA 4Y4HD 5FKPA 4PTUA 5D6DC 1TQBC 2VSDA 5DS8B 3G6DH 4JY4A 4WTWA 3FQNA 2W92A 1FVEA 4DOHB 3BIKB 5HYQB 2NYYD 1ZT7B 2IFFL 5I1DA 3V8OA 2K7PA 1T22B 3NA9H 3ZMRA 4NYLB 5ESVA 5K9JH 4XZUB 1RJLA 4YHLL 1RJYA 5FGCB 4DN3H 1G1YA 4CMHC 5E95B 1A1OA 1SJVA 1Q0XH 1A4KB 1Q9KB 4ZXBA 1N2RA 3TBTB 4MJIB 3OHXA 1LO0H 2XG5A 4N5UA 1T03H 1KXVC 2YUZA 2X4OA 4NKMA 4G9DB 3BPLB 1OARH 5DRWA 3O3UN 4X9BA 2BSED 3UTPD 3VG9B 4L8SB 1EV2E 2EDBA 4EI5C 4U0RC 3M1BA 3U4EB 3U79A 4JKKA 4AG4H 3QUXD 4X6FA 1Q38A 2X4TA 3U7AA 1IAOA 2BVOB 2IH1A 3D2UD 3TN0D 3D0LA 2C1OA 1F97A 4ZFOA 4X8JB 2PXYA 2VDRH 4L1DA 5DJZB 4L4VA 3VXOA 5EPMB 5F7LB 2YBRA 5D1QA 3UTSD 2R4SH 2Y6SC 3F8UB 2EH8H 2A83A 2XICA 4TQEH 4Y4KA 3FONA 1CFTA 3JWOL 3MJ9A 3NMEA 1CICC 2ZJSL 3MJ9H 3OAYH 2WMPA 2VXVL 1RJYB 3W2DH 4LVOB 5DT1L 3BXNB 1I8MB 1BQSA 4LPXA 5DZLA 4HUWA 4LCIH 4HWEH 3BKCH 5T1KD 4JLRB 4CBPA 5CJBA 2HKFL 4WHTB 3H2WA 1Q9WB 4UZGA 4WO4B 1P84J 4EI6B 2Z8WC 4ONGL 2B4CC 3UBXI 2I24N 3MV9B 3VG0L 5D9SA 12E8H 3T4YA 5E1AA 1JE6A 4OCXH 3N1PC 5GGVL 4BZ1H 3OF6A 5FM5M 3DX6B 2BNQA 3NPZB 5TDOB 3PDOB 3TT1L 4WHYG 4JN2B 5HYEA 4NO0D 3CX5J 4NQCA 5C08B 3QHZL 5I66B 1D6EB 2DYPA 4GKSA 4RAVA 5FOJA 3DROB 1RAMA 4P2CG 1CF8L 4I9WE 4NHCL 2IALB 5KOMC 4HGWB 5TDNB 4HXBL 3SEPA 1FFOB 1NDMA 1U8KA 4MNQE 4I0PD 4Z7WE 3HG1E 4UT6H 2YRPA 4Y4FD 2VISB 1S9WA 3QO1A 4X4XA 5ICZB 2F8XC 3QHFH 3KXFE 1ETZA 1Z6JT 4J8RA 2R4SL 4PJCB 5FUCE 3C60C 1Z9OA 5CEYA 4HQQH 1C5CH 1BFTA 1QYGL 4JM2F 3V95A 3FN9A 2C5DC 3I6GB 3MV7B 5C07B 4P2RA 4TUOA 4FA8A 1QSEA 4F7EB 4M7ZB 1EUTA 4RWYH 1ES0B 3F7VA 3WLWC 1U92B 1FL5B 3A0OA 1Z3GL 4PJ9A 4X9IA 1FZKB 2GJZB 3OPZH 2EIZB 1ORQA 1U3JA 4HFUL 4JHWH 5C0CE 2VOTA 1KYOK 4ONGH 1KCUL 5JMOC 2FX7H 1MHEB 1YECH 4CAGA 1FFPB 3VFRB 4APQC 1ZKAA 4D8PB 4LIQL 1T1ZA 5I75B 1CIDA 4NP4H 3CCHB 3RI5K 1QBAA 3UPCA 5J6HB 3FZUC 3ZE0F 1IC7L 5IJVA 4G8FA 1XZ0A 4FQPA 2HT4C 4M03A 1S5HA 4OD1L 1HXYA 2WIIA 2VWEE 4LCWB 5C8JA 1FORL 3IDUA 4H1LH 2XNAB 2IPTH 1F4AA 3UP1A 1CFTB 1KSRA 1JYWA 5CEYB 5HYSA 3UX9B 4MD4A 1A6ZA 3ZKMD 4KKCD 3ARDA 4OGAD 5HHQB 2Y4SA 3JWDC 2IGFL 3RNKB 2B4CL 4X5LA 3UTSE 3IFLH 4PR5A 4XP6H 4N1HB 3BPNB 2XOTA 3V2AR 1V5JA 1T1XA 4X6FB 3WUWG 3OJDB 3SOBH 2DQCH 4JFDE 4MXQD 4OUUA 5L2KB 1TQCB 1S9YB 1ZHLA 3OTTA 1NDGA 3BT2H 3CVHB 1WCBA 4L9DA 1HDMA 3VFGL 4HG4J 4WFED 2C26A 4XBGA 5EZIL 3UZVB 3NPSB 2V9QA 3DX6A 2IPUG 2AV1A 2NQCA 3RVWC 3V4VL 1CL7H 2C3VA 2R0LH 4G42B 4LEXL 1RUPL 2VLLA 2LVCA 4F7MA 3T4YB 3QO0B 1A3LL 2DQDL 1JPSH 4Q0XL 4G43B 3HLAB 3FO2B 5F7HA 1CBVL 4U1NB 3HNVL 1A4JA 3OKMB 3N1MC 3IAQA 1QSZA 3HMWL 2X40A 2R2BB 1CDGA 3NTCL 1Q9LA 4LDEB 4NP4L 2P1YA 3PHOA 4G3YH 4RGOH 3MJGX 3HFML 4ODHH 4P2RD 3S37X 3BGAA 3QZWB 1NCTA 4HXBH 4JFQB 5SWSA 3MXVL 5F3HA 2XN9E 2VZ1A 3LH2L 4I48B 3MLRH 2PYFB 4PTUB 1P2CB 4G8IB 3NABL 5GRYA 3GHBL 4GRMB 5DYOB 2P47B 3GMOA 2P45B 5B4MD 2DOCA 2IWGA 4WFEE 4Y19E 4LP5A 2B4CH 3WS6A 2N7AA 2A9MH 1HDMB 1BZ9A 4JPVH 5DJYB 2BVOA 4YX2H 1A22B 5FYJU 2PKDA 4PRHE 1J10A 3K1DA 4AQ1B 2OJZH 1CGWA 1HHIB 1MNUL 4MA8L 3ARBD 2H6PB 1T1XB 4DKFH 1I8IB 3SDDD 1XR8A 2DQHL 1IGIH 4RRPA 4NQXA 3AAZA 3GSUB 4DK6A 3CGTA 3QWOA 4PJHA 2CRIA 3CSYB 3U30B 3BRDA 5CEXB 3B2UD 1D5BA 4O5LH 3OJ2C 4HF5L 1FL3A 2WUBL 3QFJB 4G6FB 3BOVA 1J8KA 1YMHA 3O45A 5D7LA 3NCEB 3X3FL 4P2OC 1F5WA 4CKVX 4L4VE 2PR4L 3RP1A 4NCDA 4UB0L 5IG7B 1IKFL 4J3SA 5T1LB 2Y06H 3DI2B 5F9WC 4DKAA 5DJXA 1LD9B 3ILQD 3RVVD 3F7YA 4KKNA 5J9PB 2HA1A 4IOFD 4LEOA 4JJHA 4RAUB 4RGOL 1AGBA 1KPUA 3RWCB 2GY7B 3LQAC 1BMGA 4N0FB 2ICES 2QHRH 1BF2A 5L8LB 3O4LB 5I8KH 1NFIB 2C1PB 2UY6A 3CH1A 1UT9A 1G7HA 2J6EH 4ZO7A 4U6HA 4DQOH 1L6ZA 3PP4L 1ACZA 2Z93A 1MVUB 4YHKH 1BREA 3VFOA 4LSTL 3VXUA 3FB5A 4AK1A 2PO6C 2EDNA 5E24E 4BUHA 4OZGA 4GAJL 1PYWB 2CSPA 3ES6A 5A2FA 2KDGA 1RVFL 4ZXBC 2UWEE 1RIHL 1SQ2N 1EXUB 4A2MA 4DGVH 4ZUUA 2GJ6E 1AD0B 1AD9B 3SDXA 2F74A 3PL6B 4ZTOL 1JHLH 2XNAA 3MUHL 5DQDL 3JZ7A 4I18A 1ADQH 3QG7H 1LP9B 3I2CL 1IGIL 1XGQB 3H42L 1XCQA 2H1PH 5DHVH 1QFWH 1CT8B 3W9DB 1F90L 2X4SB 4YHIB 3VWJA 2DWEB 2M8XA 2FJFA 3H7BB 4LIQE 2HRPH 2DQEL 3EYUH 5D7IB 4Q6IB 3HG1D 3QQ9D 5KS9E 4UU9A 2BSRA 3LDBB 1GZQA 5CHNA 3B9KC 1X4YA 3CXHJ 1LEKB 4S2SB 3AY4A 1VFUA 2VABB 4XGZA 1IL1B 2YXMA 3DVIA 1VCAA 2LTQB 3SKOB 4FNLH 3MR9B 3MLXH 3TWCL 4N8PA 4QY8B 2B8OT 1FH5H 4R4FL 3RWDB 5ILTL 1A1MB 1JFQH 1MPAH 5F8RC 3KPSE 2J5LB 3I75A 2CQVA 4YQXL 5LGJB 4XC1L 4FG6D 1RZFH 1QFWM 3BHBA 4CL7A 3MV7A 1YQ2A 5C07A 4ZUTB 2YXFA 3SKNB 3TBVA 4OGYL 5HHPA 2XZZA 1H5BB 3Q5OA 2RFXA 3QAZC 3TYGH 3LCYA 4NN5C 1KGCE 2ZOLB 1DVFC 1Q0YH 1NANI 3TN0A 1MEXH 4S1SL 3QWOB 3S37H 4KQ3L 5ALBL 4QNPE 1M7IB 2YWYA 1MJUL 3M8OL 1DSFH 3BP7B 4P5MB 5T33H 2X4RA 2ZKHH 3VXPB 5D7LB 3WO3B 5ENWB 5DO2D 5MERB 1D9KA 1MJ7L 3NAAH 3OSKA 5CEXA 1CFBA 1OF2A 1IC7H 2BK8A 4WNQB 1PD6A 2DQJL 2YR3A 5D7LE 3WFHB 5BV7C 2QADC 5IR1B 4CU6A 4N0UB 1AC0A 1KC5H 5BOPA 4TUJB 3GUTB 1B0GA 4XNUH 2CXKA 2DDQL 3CDCA 3O6FA 4L29A 5EN2A 3MRFB 2NY5L 3O3DB 2H6PA 5L6YL 5J3HD 4P5TA 3TA3B 2ARWA 2EDOA 4KJPC 2ICWA 2XQBH 3NCJH 3MLXL 4G9DA 4L8DA 1I1YA 2OTWB 3FOLA 3VFVB 3WHXB 4R26L 3MRCA 3VGAC 1JGVH 4GG8B 5FA3B 4YZFE 3EJYD 1ZT1A 1UADC 2D2OA 3O6ML 5H35A 4X6BB 3OKEA 4TVSa 5JXEC 1Z9SA 2E5EA 5FOBA 3JV0A 4QHUB 3GZKA 2ZCHL 3KPSA 5LG1A 5DUBA 5JZ7C 1RVFH 4ODTL 3M17A 2QQNL 2VR4A 2Y7QB 3ORJA 5DJDA 3DYMA 1N3NB 4X8JA 2AXGB 1G7MA 1F4WH 4AL8H 3CAFA 1U8MA 5GRVL 5D2LF 4PJGA 3M8OH 2BDNH 4WFHE 1SJXA 1CICA 4FQIH 4D9LH 4N1CA 1FN4B 3HI5L 4ZAKC 3FQUB 5MEOA 3O41A 3DGCR 4UQ2B 3NTCH 2G2RB 4JRYE 5TDPB 3MNWB 4PJFA 4OT1L 5D1ZC 5FM8A 3MOAH 1TNNA 2OI9B 3F6IA 4Y5XC 4Z95L 2WLYA 1RULL 1YJDH 2X1WL 1OP5H 1PG7H 1FPTL 3GSNH 4M5ZL 4PJIA 4KI5D 1FIGH 2YWZA 3BEVA 3MC0A 4P2YA 4UMGA 1FNAA 5CP7A 3OR6B 4Y19A 3BN9C 4NOFA 5E8DH 3C6SB 1MRFH 4JPKH 4N9OB 4QRUB 3WFBL 1WWWX 4PJ9C 4HK3J 5F89A 5D8JL 2EYTB 1HE7A 5CEZL 5FM4A 1AGDA 2IPUK 4YK4C 2GFBA 4C59B 2VKWA 2OTUB 3HC0A 4HJGA 3TESA 5FHAL 2VB5A 1NFDF 4PRBA 2ILLA 1CFNA 1EH9A 2VIRA 5IROC 2ZSVB 1RUKL 3UXFA 1G9NH 2CLZA 5HGAB 4JRYD 5EZJA 3CUPA 3HKFA 5DD5L 5KS9A 2APVA 1W72A 5GZND 3QDGE 3WNNA 3UJJH 4NFBA 4UAOC 4LQFL 4YHZL 1DANU 3P11L 3B8SA 1U8IA 4TUKH 1DSFL 3RVTD 4WW2A 3PDGA 5D7KD 3WJJC 1TQBB 2R1WB 1YEDB 3BZEA 3ULUH 3O6MH 3O8XD 5E6YA 3RGVA 2Z31D 1J1XL 5KZCB 4QCIA 4K3JH 2KKQA 3REVB 3IDYB 3ARQA 1E6JH 4KFZC 3BP5B 4TTGA 3HN3A 4PJXB 5F7EH 5I19H 3K81A 3TN0B 4XNQA 1FHGA 4JG0H 3KPRB 2B5IC 2F58L 4GKZA 4K9EL 1I9IH 1MOEA 3VRJA 5C0RL 2A0LD 3ZE1E 1NUNB 5GISL 1NLDL 5E2TL 3ARGB 4YH6A 3TO4C 3ZHKA 3AROA 5IHZB 2FZ3A 2XQBL 3NCJL 4KJWC 2DLFL 5JW4R 1KCSH 3OAZK 2OXHA 5J6HA 2VC2H 3MNZB 4X4XB 5D4QA 5JHDA 4RISH 1KEML 1UM5L 1RZKC 4X0KB 4MS8C 3DRQB 1MRDH 1YA5A 1TJGL 4PJ8C 4BM7A 4GQ9L 4EBQL 4X7FC 1P7KB 3IFLL 3SE3A 1NGWB 4MVBC 2GSGB 5TH2B 4ETYA 1RD6A 4S1QL 2ZUQB 5CIPB 5LBSH 3O4LD 3R4DA 4GSDL 1BPVA 5CEZH 3AXLA 4V2CB 3SE9H 4IDLA 5TF1L 5KTEH 4MX7B 2DQTL 1T04B 25C8H 2UVEA 2XIDA 4MMZC 1QSEB 1EJOH 4M62H 2EXWD 4JVPA 1DE4B 4KUCD 4UQ3A 4QTIL 3I6GA 3L5WA 1BD2E 1MFAL 3C6SA 1NANH 4FABL 3DO3A 1GYAA 4JB9L 3KS0H 1PG7L 3EOBB 3SY0A 3IFPA 5E2WL 3VDCA 3MODH 4ZUUB 1CQKA 3U1SH 2R56H 4U6YA 1FLRL 5IFAL 5IFJA 1LEIB 4LQ1A 1CLYL 2V5SA 3ZKND 2K9UA 4UIMB 2XV6B 2BSTB 2HVKA 2VLKB 5HI3C 5CD3B 3L6FA 3MNWA 3ARVA 3W5MA 4IRJB 1JN6B 4JCLA 4F7CA 2R0KL 5F9JB 4NNPL 1MY5A 3CSBA 2VZVA 4K3EL 4ZFOB 2W1NA 4KGLA 1AGBB 4XVUC 3D0LB 1AI1L 2A2QT 2B7DT 5F88B 4NM4L 5JLZA 2F8OA 5JOFA 5DJ8A 4WJ5B 3BD5A 1IKNA 1YUHB 5ADPH 3DO7A 1TETH 5CCKH 4PGBA 4ZMAT 1JV5B 8FABA 4J6RL 2V7NB 3LV3A 3E1F1 4LQFH 4NQTA 4P99A 4YHPB 4YHZH 2LTQC 2DLFH 2FO1A 1I3VA 1MAMH 2A74A 3PNWA 3NFNB 4PRAB 4B53A 4MA7H 3RZCA 1QSFD 5FV1L 3QQ4A 1QO3B 3GBNH 2EEAA 3GMLB 4PJXE 3STBA 3T77B 2HTLC 4E5XA 3RVTC 3MUJA 1I1AD 2EE3A 4EBQH 2BOCB 3MRBA 1UEMA 4QXGL 2E27L 4M9OA 2MSPA 8CGTA 1A7PH 5F96L 1YY8B 2A77L 1WBZA 5C9KA 5TPWH 1GPOH 5JW5A 1XGUA 3AM8A 4XWOC 4TVPL 4IDJH 5F9JA 5ITBH 4KKBD 4YXKL 3O9WB 3ZTNL 2H2SC 3PWLA 3QUZD 2HKFH 2OMBA 3TCLA 1N59B 2EXYD 4OF6A 4I48A 1TTFA 1CFVH 4OQTA 3LKQA 5EU6A 3MTRA 3TV3L 4WIQA 4HIJA 3EAKA 1JUFB 1AXSB 4OQTH 1KENH 4HIIA 5DUPH 3CNKA 2R0ZH 12E8L 1EAPB 4JFDA 4OGZA 1YMMA 1CS6A 4F37K 5C7XH 1UQSB 4E0RA 3NCCB 3PDDA 4YR6B 1A6ZB 4I4WB 4NC0B 3D85B 3TBTA 1CLZH 2ESVD 1HCVA 2NY6B 8FABB 4YUEH 1MCNA 1G1CA 5SV3A 1F6AA 5ALCL 1FYTA 4M5YH 4LGSB 1F4XH 2Z31B 4OGXH 4I0CC 1JWSA 2CIKA 3DYOA 1E4JA 2YC1A 2A74B 1QSVA 1QLFB 2G9HB 5GRUL 3LY6A 5DC9B 5L8JB 1D6VL 3PQYA 1EJOL 4M62L 2V2XB 3VH8G 1MI5E 4ZPVB 5HGGS 4WV1B 1NMCC 1T89C 1UB5B 4ZYKA 1Q72L 1P7KA 3ZE0E 1IC1A 4PFEA 4MLIA 4X6DF 3QEGH 1ZHBA 1MCPH 3V0WL 4KUCF 5D2NB 3W11D 5GS3A 4HHAA 2BY1A 5I1IH 3OAYK 1N4XH 4PP2B 1LQSR 3H9HB 1I8KA 2HLFD 2VN7A 2V2TB 1JRHI 1TJIL 3MRQA 1OAYL 3S3PA 1GXEA 4G6KH 4PS4H 3OPZL 4M1GL 1S9XB 5CHNB 4N8CH 5IQ7L 4EOWH 3RWIA 1XGYL 1OP3K 2A6DB 3QNXB 1HXYB 2ADFL 3JTTB 5C0BE 2ZUTA 2E27H 1FFRA 2XQYG 2FX7L 4J8RB 3TVMD 1MCJA 4KJPD 1KCVH 1G7LA 4EI5B 2ZSWA 3AXLB 3GJEA 5HI4C 3WUWA 3GMNB 3K0WA 2JTDA 4CADB 5HYJD 4DN3L 4Y2DA 4C83B 3ARSA 3ECBA 4WHYH 5FUOL 1GCFA 1KULA 1DE4A 4JFFE 3PL6A 2J12B 1G7IA 4GMSH 1RIVH 4U1JA 4K3GA 4X0KA 3PABB 2QADD 1ZLWK 4WV1A 1CFVL 1K5NB 3MJ7B 2HJKA 3RPIA 1FZKA 4ZFZA 4PJXF 4LNRA 2NX5B 5IBTH 3MJ6A 4JQXA 3L3HA 3MJ7A 4JFHD 1QOKA 1RZIA 1S5IL 4PLJD 2Q6WB 1U93B 3V5DA 4DK3A 3OKDA 4MB4A 4JRYB 4OLEA 1HH9B 1NMBH 2GJJA 3WEXB 2WWKT 1ZAGA 4TRPH 3KDMA 2AJXL 4TSCL 3BQUA 3VXRA 4TULH 4D3CH 4NT6B 3FFCD 4TNWF 4PJCA 4L4JA 4UBDC 4XB8A 1B4RA 2FJFB 1DL7L 1I3GL 3H7BA 4RAUA 4XTRC 5SWZA 5J57B 1YYLL 2CUHA 3STLA 1KEGL 1S9WB 1FNHA 3KLAA 2BMKB 3QO1B 4LU5H 3IF1A 2OI9C 3C8DA 1FZJB 3WS6C 4YEEA 4Y16B 5EOCJ 3V6OA 4CVXB 3OR6A 3PQYD 3EFFA 1MCLA 4NQCB 4NKOA 1PZ5B 5E6ZA 1HXMA 1H15A 2H8PA 2H2PC 1CXHA 4QHKI 1R0AH 4E42A 2DI9A 4JZJC 2R15A 4LKCA 1FNEB 1B88A 1XGTA 2WV3A 1TJIH 4U1GB 3QQ9C 5JA9A 2IFFH 3ULUC 1SEQL 3MACL 1QYGH 1QHPA 4FFYH 1QNZL 5DTFB 3VH8B 4OBRA 5FYKD 1HHHB 2PR4H 2AVGA 3P9MA 5KVFL 4WUKL 5LXGL 4MAUH 4E41E 4WTZG 5IBTL 1EEQA 5CS7A 3CJJA 1DBJH 4S0TD 1MREH 1W72H 2RIKA 2XWTB 4Z77A 1I8MA 1LE5A 3JUZA 3P0VL 4FQHB 2D7NA 4U1NA 1ERNA 3ESVF 3SGKA 1IGTB 1OL0A 2V6HA 1RJLB 1G9ML 4GMSL 5IESL 3JVGC 1U8HA 4FFWC 2AXFA 3CZFB 1T7YA 2YN3A 2XWBA 2NXZD 4KPHH 4B5EA 4IIQA 4HIIB 1VGEL 4PJ8A 1DCLA 3QA3A 1KEGH 4NQXB 2VLJE 3LKQB 4WO4D 4P4KA 4JAMB 5C0AD 3NIDE 1DQJB 1ZSDB 4MMXC 1UVQA 3T0EB 1OAUH 2ATKB 3MBEA 5E2VH 3OXSA 3S88L 1FBIH 4QEGA 4OSUH 1IEAB 4TNWK 2XA8H 1MFNA 3T3PF 4F80A 1X44A 4HAGA 1FSKB 1Y6MR 5MEPB 1U8QA 3QRGH 4EEEA 4XXDB 4QXGH 1LK3H 3B2UC 2X4RB 4R7DB 2CUIA 1RIVL 1BJ8A 4KGJA 4FQIL 4U7KA 1JPST 1KBGH 4Y2DC 1DUYA 5FYKL 4OZ4B 2NNAA 4ZQKA 1SEBB 2BHUA 2XYCA 3VXRE 1ZT7A 3ET9F 4XCCL 4YGVA 2VXTL 1HKFA 1NC4D 4XNXH 1WZLA 4TRPL 3RVXD 5KSUB 1JV5A 3L5WB 4DGVL 5F7DA 3MV7D 5C07D 3X13A 4UQ3B 4F9LC 1A5FL 5EC1A 3CVHL 5IEKB 4ZTOH 3VMNA 5CBAB 5GRWA 4HC1A 4QY8A 1VGEH 1TVDA 5F7FA 3K8LA 1BQHA 4YDJB 1PZ5A 5ISZD 1MCFA 1DFBL 3RBSA 5DGRA 2FSEA 3L5XH 4PJAB 4IRJA 5EU3B 4D0CA 3QDHA 1CGSH 4JO1L 5CD3A 5F7MC 2JKXA 2ADJB 5ICYB 3CSGA 3D2UA 4X6CE 5I74B 4LASL 3RTQB 4PB9H 3GEWB 1XF1A 1MRDL 1KXTB 4TUJA 3GUTA 5IMOB 1EA9C 5DD5H 1JF6A 2NXYC 4G7VH 3VXMD 5HI3D 4UTAL 4Q9RH 3IDGA 3K80A 3G9AB 3MROA 3JBG7 2HH0H 4Q0XH 4H8WH 4ZFGL 4K2UL 3VI4F 3G5XB 2NY3B 4FFYL 4ZFFB 5ITFA 4F33B 3OKLB 4MAUL 2LU3A 1KUMA 5CP3A 5FO7B 3SO5A 1A6VH 4P3CH 4ZTPL 4CMHB 3F62A 3GSRA 1K4DB 5L7XL 3OG4B 5IHUL 2VLRD 1X5HA 3BMVA 1MF2L 4P4KD 4JHAL 1F3JB 5D9SB 1AFVH 1A5FH 1F3DH 4U6TA 1VERA 3OKNA 3DARA 1NC2D 4ZOAA 3RKDC 1CGUA 1R3IH 4EI6A 3QEUB 2GSIB 1SY6A 3L7FB 1BQHB 3PQYB 3ZKXC 4CN4A 1KJ2L 5DVOA 1HWHB 1SY6H 2X44D 4NFDA 1BEYL 1I3UA 2BNQB 4P3WA 1A3RH 3SKJL 5CGMA 5IW1A 4NQCD 5KAQG 5IM7A 1U91B 4HXAL 1AHWC 2DWEA 2NY0D 1ZE3C 4MS8D 1G6VK 1LNUB 2NY1B 2FLRT 4YIQA 1L7TL 2Y9RT 5CZXD 4FQXD 1IEHA 2AJVL 2HFTA 2AEIT 3Q3GB 3EFDH 4Y4FA 3FZUD 1C5DB 4Q6IA 3IGAB 3HAEA 4J3WA 2HFGH 3KPOB 4ZO9A 3BE1H 3L3IA 5DJZA 2WBWB 5A43C 1FRGH 1I9RH 5I1AA 5AG9A 3MJ8A 4PGEB 3INUL 5LBSL 3DX9B 3BXNA 2WUBH 4HS8H 3EJZD 3UPRA 4X80L 3RJQB 1KT2A 5TDPA 4N1EA 4XH2A 1SYSB 2A6IA 3IB4A 1FN4A 4N0CC 3WFBH 3CDGA 2M1KA 4HD9A 2VERN 5T3ZD 4G6JL 4QOKE 1XFPA 5HHXL 1G6RA 5AEAA 2JB5H 3QH3A 4LVHB 4UNUA 1N2RB 4OV5A 2C3WA 3MV9A 4G6MH 1KIQB 2ZWLT 3NN8B 4K7PY 1VESA 3MOBL 1WV7T 1NSNL 3FO0H 2CMRL 5CJQH 1ED3A 3QBTB 2IBZX 2Q3ZA 3RIAF 3X17A 4CW1A 3CIQA 4FXKB 4L5FL 4HKJB 2QHRL 5SX5K 2X89D 4PG9B 5HHNB 3GSNL 4QHUA 5I0DA 4OZIE 1MLBA 3HI1A 3ULUL 3QG7L 4MNQB 4Z7WB 5ID0A 3ARFB 2MKWA 1BVKB 5MEPA 3IJSB 5DHXB 3D25B 3QEQA 5DR5L 4WU5A 5F88A 2UVFA 1QLEH 2IADA 3EJJX 3FTGB 5T5NG 4LCCA 4PJEA 1GOGA 5FGBC 4AY0A 5T3XE 4PJAE 3BN9D 5BVJA 4HXAH 3WIHA 1MCRA 4WO4C 5FB8B 1HCFX 2IMNA 3O6FD 3VXUE 1G9MH 2OJEB 4Z0BH 4ZS6D 5DXWA 1FVCA 1M71B 5I6XC 1HHIA 5HY9B 1XGTB 2LAGB 1QSFE 1I1FB 1M05B 4FZ8H 3WDHA 2I5YH 2W65A 3QYCA 5EBGA 1CFQA 3LIZH 2CGRH 3HNTL 4MXWL 4JCMA 4QXTB 4PRAA 1I7TB 2OS7A 4QWWC 5F72S 1H3UA 3UJJL 5ADOH 5E03A 3G5ZB 5M7QA 3P11H 2CRZA 4WWKB 2Y6SD 4M4RA 5GS0L 3IXAB 3ARTA 3GMQB 2GITB 3X12B 3ZTNH 1S5HB 1SY6L 5ESVB 1S8DB 2FBOJ 2BVEA 2VLME 4AIZB 4H1LG 3TO2A 2F5BH 4KQ3H 3OB8A 4QF1A 3KPLA 3KPMA 2BNUA 2C9AA 4KJYB 4NNYA 4MNHB 3HC4H 5D5MA 4JE4B 4G6ML 5LGJA 1KT2B 3HZMA 2NXZB 4RMVA 1O0VA 4M4PA 5GISH 1KN4L 5ALCH 3S3SA 4MNGB 1LEIA 3QRFM 1O5DT 1PG7X 4MSWA 4XNUL 4JDZB 3HE6B 5F1IB 1NDGB 3A6BH 1DBML 4DGYH 4ORGA 1QRND 2NY5H 1KIRA 4IMKA 3B5HA 1OGAD 2ZUVA 3LKPB 3MZTA 4IOSD 5F8QC 1QP1A 4L4TA 4EUPA 3WUZA 4Q9QL 4LCWA 32C2A 5A3ID 4B41A 1INQA 3ABZA 3C5JB 3M07A 5FGCE 5DMJB 1JPGB 2EC9T 4BK4A 4KK5C 5DO2C 3VFSA 4KDVA 2ADIA 3JWDH 4UI2A 3MRHA 3MOQA 5HHQA 5J1AA 3KPPB 1CGSL 3C8HA 3SPVA 1JWUA 4HZLB 5D1ZB 5GGUA 1KPVB 5EO9A 3KXFD 1RZGA 1HH6A 3BUYA 3EYVB 5GS0D 1TVHB 4XNYH 5K59F 2IALA 4W4OC 4BFBD 4ZUWB 3WNMA 4PP2A 3WL9A 2R1YB 3LEXA 1IKNC 4MXWH 3G6JA 4OZIF 2A9NH 3IDJB 3QHTC 2R1YA 3LEXB 2D0HA 3WSQL 5J9PA 1LO3H 4LGPB 4MA7L 3DTXA 4Q7DA 2FX9L 1KCLA 1BBDL 2XZCH 5F44A 4KROC 3HC4L 4PGCA 4PGDB 4XVTH 3TP4A 2LV4A 3LRGA 2BCKB 1MCHA 1HIML 2JIXB 4YHYC 4PP1D 4JHWL 3CLEL 4QOKA 1M7DB 4QYOA 4DVRL 3QCVH 2DB8A 4PD4K 2P4AB 2E7CA 4LSQL 4ESKA 1DQDL 5IMLA 3KYKL 4ALAH 5L8KB 3BKJH 5I15L 4XRCA 3DSFL 4X7SL 1DR9A 3EYOA 5IUSA 4D94A 5IGXH 1A6TB 3D39E 1GZPB 3RY6A 4GUPB 4PJ5A 2A6KA 3OF6D 1MWAL 4BQCA 5SWQA 1ZT4B 1F4YL 4KC3B 2BVQB 3IVKB 4P9MH 5ELIA 5IFHH 4QGTA 1WEJL 5DJCA 1AXIB 5J11C 4FQ1L 4ONHB 4RNRA 3TNMB 1DN2A 1VB9A 2DBJA 1D5ZA 1Q8MA 2ZZUT 1ZMYA 2JK5B 4NPYA 4P49A 4NRYA 5GXBB 2J2ZA 1HSBB 5IJKC 1YEHL 1QBLH 5C0RH 5C0IA 2Z92A 1RIUH 2XQYK 4Y5VC 3IKKA 4R4BA 5T5FL 3V4UL 1UACL 1E27B 4FN0A 4OFKA 3O6FC 2P7TB 1D5IH 1ZVYA 5E1AB 2YN5A 5A16A 1NFKA 3SO3B 4KDTC 1NC2B 2IBZY 3I02A 2DQUL 3GMQA 5ISZA 2H9GB 4L3EA 2A6JA 2AJSH 4JQIL 3W9EB 1AR1D 4L3CA 5EO1B 4IOFC 4YXKH 4XNZB 3T8XA 5C0BB 2FGWH 1QG3A 4GS7C 3PNWB 2HG5B 3VCLB 5EZOH 3CH8A 3G04B 3MNVB 2CDEA 4OLXH 1PEZA 1BHGA 3JSSA 3ZE1F 1NUGA 4HIJB 2QV2A 4D9QE 5BZDA 3C5SA 3QUKA 3P9MB 3TPUB 3B5GA 3HAEG 2VNCA 2A1WL 3BZ4A 3O3AA 3ZLQC 3E6HA 4YDVB 5AD0B 4S11A 1DEDA 2V7HB 4HJ0D 1U3ZA 2HTLD 3JUYA 4OCLC 2WBJB 4ZDHB 1HN1A 3G9VA 3ARBC 5T1DL 5F9OH 1SM3L 3A67H 4KUZH 1U8JB 3HAEH 3VXQB 2ATPB 1CG9A 3ARUA 1F4HA 2YMXL 3G6AA 1Q9OB 4NJ9H 2YEZA 4WI6A 2CRYA 3LRSB 1B0RA 3D87B 2VLRA 2G5RA 1DFBH 3VD7A 1KPRB 3IF1B 1M1SA 3PGFL 1QSFB 4HCRA 2RCSH 3MLTA 4NSKB 5IBUG 3FN0H 3IU3A 4XPGH 4EDXB 4QRRA 5CD5C 3TYFB 1QFUL 3T2OA 3VW3H 3WHXA 4FXLA 5D96C 4K3EH 5D7KE 2RFXB 3QDMB 4XVTL 2AQ2A 1A4JB 1KJMB 3TLRA 4ERSL 4J23A 3VFRA 4JFXB 4V2BA 3RGVC 5CZVL 1BF8A 3HLAA 2WIIB 3CU1A 1CU4L 3WYRA 1OGAB 2ERJB 3U46B 5INDA 2B1AL 4O51A 2O26U 5GGSA 5FGSA 4UDUA 1EJ6A 3UTTB 2H3NA 1G7PA 2X1PA 5ETUA 1ZGLB 1JGUH 3T0WA 3BW9B 4U6XB 5L0QC 1OAKH 1VACB 3LKRB 5SWSD 3RVWD 1SYSA 2X09A 4C56B 5HPMA 4NDMB 3D1MC 3OX8A 2JE8A 5EO9B 1CGXA 4G6FD 3BP7A 4P5MA 2LAAA 1PGRB 5D1ZA 1I9JL 3GSRB 3N06B 2BMKA 4P48A 4OCWL 4L8CB 4N0UA 5D70H 5CINL 5DD0L 4GMTL 4J3OC 5IW3A 2Q8AH 4JO4L 2B39A 4GBXA 4NJ9L 1RIHH 1NEZB 1ZLWH 1EO8L 4KTDH 2AK4D 1J11A 1RMFL 1J5OL 5DD1L 5E70A 4RFOL 4YGAB 4O2EA 4KKCC 3Q6GH 1CQYA 2DYPB 4XMPL 1D5IL 5JOPD 1IT9L 1NH6A 1PY4A 1T2XA 4WVRA 2BRRH 1RZKL 4HHAB 3D0VA 3CMGA 4I0KA 1PY9A 5MHSE 2GK2A 1DL7H 1W72L 1NDMB 1U8KB 3ULVL 4P46A 2MCG1 3W2DL 1TTGA 2AJUL 3VXME 2F54D 4OZHA 1K9TA 4OIIH 2B1AH 25C8L 2NW3B 2EDWA 1ZGLA 2FB4L 1A7QL 3LEVH 4XPBH 3V6BR 3LKNB 1EERB 3JV5A 1KPUB 1L9MA 2OXGA 5ANMA 1FAKT 3RWCA 4CMMA 4DN4L 3G08B 3L3DA 3KPRD 4AEIL 1S7TB 2Z31A 5D2NC 5EZIH 3BZDA 3BUYB 5ITFB 1CDHA 5GRXG 3SDXE 2D7PA 1F02I 3UAJD 2VN4A 4NZRH 5DA0B 4AG4L 2NLJB 1JGDB 4JANB 3GGWB 2XI9A 1AD0A 4OQTL 5J4MA 2CLVA 5DA4A 1GL4B 1QNZH 1R3IL 3WDIA 5DRXB 3BYYA 5INCB 3VXUD 1RFDL 4ELKB 1LP9A 2GY5A 3GBLA 2J4WL 2CDFB 4MB5A 4OKDA 4XVSH 4QRUA 3PWUA 4Y2DD 3UTSB 1U3HC 4RFOH 4G6KL 4PS4L 3C08L 2B20A 3D9AL 5GZNC 2CKNA 5IQ7H 2XN9D 1TCMA 5BMFH 2NTSP 5C0EB 5KSVA 4Z6AT 5DSCB 4ZDHA 1FL6B 4I0PC 2XFXB 3NIGF 5T3XH 1CVSC 1XIWA 1CXIA 4G8EB 4YBQC 5HHOB 2DQJH 3PWNA 1ORSA 4M7LT 2AQ1A 3ZYOA 3M45A 1QTYT 2JJTC 2V9TA 5EZJB 3LN4A 4FFZL 3PF2A 5CBEA 2QTEA 5E9DA 5CSZA 4P4KB 4KTEL 3CH1B 4ZOBA 2IJ0C 1NGXB 2YUXA 2J88H 3O4LA 3RHWF 1IBGH 3D85A 4PJ9D 1G7MB 1UJ3B 2XACC 5GHWH 3GO1L 1VFAA 2AK4A 2X9XA 5I74C 4PRDB 4MA1C 2BRRL 3TH2T 3B4NA 3O6LL 1YN6A 3LS4H 5HHXH 3UJTH 4YPGB 1QA9B 4FQXB 2ZG2A 4OV5B 4UOJA 4ODWA 4NKQB 2ATPA 3B2VH 3VDBA 1AJ7H 5IK3A 4YPJA 4PJHB 1NCDH 1IGFH 4R90H 1ZXQA 4ZAKD 1INEH 4RGND 1I1YB 1QRNE 1WTLA 4ORZC 1ZA6A 1AHWA 3BKML 1A7NL 3DI3B 3FOMB 3QDMD 1UVQB 5FKPB 4U1IB 3T0EA 4PJDF 5J8OA 3L3GB 4X6CA 2VXTH 3L6FB 4P46D 1X5GA 4UV7H 3EHBC 3BPOC 3SJVB 4PLKD 5GZOC 4NRYB 4XMPH 4XP9L 5JW5B 5JZ7D 3ULUD 1UA6H 5EN2B 2ICEB 1EHAA 4H1LB 1D5ZB 2CDEB 5JXED 1DQLH 3OQ3B 2XWBB 1T0MA 2Y7QA 4U1KB 4K94H 1FZMA 3ULVC 2AGJH 5ID0B 1OD9A 1LO0L 2V5TA 5L7XH 4PGBB 5FUOH 2EZ0D 2HLAA 5SWSB 3DO7B 3A6BL 3UC0H 2EO1A 2VL4A 3HZYB 3C08H 3NGBC 2OJZL 2P43B 3QIUD 3WXVL 3IFOA 3VFMB 4S1RH 1F58H 4D9RE 3GIVB 1HK6A 3CCHA 3ALPA 2IAMA 2H26A 3HE7B 4LSSH 3MV9E 1V7NL 1K4CA 5D8JH 4HEME 3MRKA 5HYJB 5HHPB 5I1HL 2WUCH 4HCRL 1JZ5A 2XA3A 3OL2A 1XGRB 4ZUTA 2AKRB 4UBDD 1N5AA 3PGFH 5GSRA 1XF4B 1J87A 4P9HL 3QO0A 4JFEE 5FF6B 1P9MA 4MZ3A 5ERWB 1VADB 1RZIB 4HKXA 5D7SH 5C0AB 5DJ0A 3HFMH 4ODHL 4KK9D 4RWHA 3WO4C 2JELL 2RBLA 1L0XA 4GG6F 3WFHA 1NCAH 3INUH 5ENWA 4S2SA 1LEKA 2DD8L 5EUOA 3NCMA 1KPVA 5SV4A 2W9DL 3BDXA 2CKBL 4UU9B 2IBGA 1YPZF 4MQ7A 4HWNA 5I8OH 4Y5VB 3HR5B 3MXWH 3H9SB 4L9LA 3O4OB 4NWTL 5HYSB 1QACA 2C3HA 2P5WB 1KN2L 5C0JB 4NHUB 3OX8B 4NQCE 3BP6B 2I9TB 3UC0L 4GRWF 1LNUA 4N9GA 3VRIB 4HLZH 1SBBA 3ZO0A 1D6EA 4GKSB 1P6FA 4RAVB 3RWFA 1FO0H 3MFFB 4X7TB 2VLKD 3FQTA 3BIBX 2W38A 4NCC2 5B39A 2NW3A 4U1JB 1OSZA 4K8RH 2XWJA 5IVOA 5LAXB 5FF6A 5KSBB 2HRPL 3H6JA 3K3QA 3VJ6B 3GB7A 3X14B 4ZO8A 1S7QA 3SDCC 5LWYH 3MLRL 5GGUB 1DBBH 1BVZA 1DQQA 1GHFH 2X70B 4EUPH 3E0GA 2PTVA 4AIZA 3TVMB 5E94B 1BVLA 1WBYB 4HWUA 1GOHA 4IS6A 5FO7A 5C0ND 1SEBA 3RY4A 1CT8A 1JTPA 3H3KA 4XCFH 3ALWA 3R0MA 3CFEB 3J8F7 3BP5A 2BX5A 2VDML 1JGEB 5EUOB 4YQXH 2BY3A 3G6AB 4KHTH 3TZVA 4JFPA 3MO1B 4EN3A 1H8OA 1T4KB 3NCYS 3GJFB 4YAQA 5E5MA 5D7IF 3GMRA 4K7PX 1EAPA 1OAZH 2C4FT 5DC4B 4NKDA 1FO0B 3O8XA 3S5LG 2C7UB 3TYGL 1BFVL 1IEAA 2EH7L 1PYWA 3NCBB 1AQDA 4XAWH 3V5HB 3HI6H 1C08B 3T65B 1X9QA 2CD0A 3OXSB 5ICYA 2OL3B 4WRLA 2EYRB 2DM2A 1E4XI 1VFMA 3SDYH 5AYQA 3O9WA 5GSRB 1XH3A 2EXYC 3S97C 5BZDB 3FQRA 4KXZI 5FYKH 4LDLB 3UTTA 4QF1B 2B5IB 1MHHB 1V7NH 2OTUA 3DX8B 3KWWA 4OT1H 4XWOD 1IM3B 3MOAL 1TZHA 2EZ0C 4WU5B 1W72B 4NNPH 2APFA 1MRCL 5KS9B 1AO7A 1J0YA 5HGAA 5LQBH 3V6ZA 4J2XA 3SDCB 5IHLB 3OAUH 1MH5A 2HWZL 5JHDE 3MYJA 5FECA 5C2UB 3BH8A 3SDCA 4WWKA 4PB9L 4FQHA 1I1AC 5ANME 4Z77B 1D5BB 3PUCA 2GT9B 2PXYC 3WLBA 3OB0K 4IHOA 3EYFA 4P46C 2FJHA 1CFQB 4Y5YA 4HLJA 3LN5A 5DQ9B 4M8QB 3BT2L 5IIEB 1W0VB 3TIDA 3UDWC 1VKXB 1HKLH 4X5WA 5KSAA 1SMAA 2YZ1A 3WS3B 3O3DA 3OGOE 1CXLA 3VFPB 4F2MB 2VLLB 4POZC 2AXJA 5C0CA 5JQHC 2YHGA 2ICCA 1LDPH 5DRWB 3KNBB 3Q0HA 4GRLD 2PTUA 5DWUL 2FATL 1KTLA 2MJWA 1YY8A 4KAQL 3KNBA 3C9NA 5KSVB 4XC3H 2ZUYA 4XVUD 2DS4A 2VDKL 4LHQB 3HRZA 1XCTB 2EDLA 2VDMH 4YPGA 4BK5A 2W07A 3BKCL 4D9LL 1FNGA 1U8MB 2NR6C 1QR1A 3MJ8B 4HS3A 5I17B 5C0DB 4H5SA 3AB0C 2UV3A 3BIKA 3QUYD 1BQUA 1ED3B 1V3LA 4GXVH 4MD4B 1RPQA 3RA7L 1S7WA 4WI3A 5B8CA 1T1YA 4UINL 2QBWA 2X89A 3KDMB 2R39A 3BAEH 4GW1A 3BHBB 4ONOA 1N8ZB 4U1LB 5E8EB 5FUZH 4M48H 4X99A 4JG1L 2HFGL 4J4PD 3V6FB 4HX1A 1N7ML 4UILH 4YC2C 4MX7A 3IDNB 4Q9QH 3ARWA 2P7TA 1I4FB 4MNQD 2D3VA 4LAQH 3H9SD 1U3HD 3RPIB 1RUAL 1HHJB 1CR9H 3CVHA 4ALAL 4RBPK 1CDBA 1PSKL 4FRWA 3P4OB 1A21A 3UBXG 4O00A 1F11B 5DD6B 5DEFA 3ULVF 4KRPB 2HVKB 1INDH 1T7ZA 2NY6D 1S7VA 4M6NH 4OGAC 4KQ4H 1UM5H 2MQ0A 4LKCB 3QWRA 1YZZA 4U1HA 3VXNB 1AQDB 4BH8A 1A7BA 2DLIA 3P9LB 1H8SA 4GQ9H 4A6YL 4S1DD 4MJ5B 5C9JB 3QEGL 1K85A 5FKAA 2N56A 3UAJC 1CWVA 2I26N 2X4QA 5IWLC 1IC5H 2ZG1A 4O4YL 4JZNA 4K07A 4UTBH 3Q3GA 4JKPH 4UV4L 4K8RD 5FYLE 3W39A 3FB8A 4DVBA 1YDPB 1QBLL 2JELH 2X7LA 4JFZL 4HFUH 4FZ8L 2A0LC 5JW4M 4LPYA 1K8IB 2VLKE 1MF2H 5I1LB 4Z7OE 2HRLA 4KAQH 1ZLSL 4L8CA 1IM9B 2W60A 5F7EL 5F3BA 1I7ZB 1NMCB 5CIPA 2XG4A 5GJSH 2DWDB 4HIXL 1SVCP 2HWZH 4QCIB 5DFWH 4JG0L 2E3VA 4OZFG 4LSVL 1A3RL 3GKWH 3N1QC 1T0NB 2R69H 3RZCC 3RIFK 3X3GH 1HHJA 1X5AA 2NY6C 4ZFZB 5AYUL 4JFFA 1QLFA 2G9HA 1FL5A 2XY2A 1FJ1B 5ERWA 3ESUF 1P4IH 2WBKA 4EN3C 4GKNA 1MUJB 3B83A 1XCQB 3CVIL 3DVNA 4JM2B 5J56B 4Q97A 4LLYA 4G9FE 4I18B 4C83A 3VA2C 1PEWA 4F9PA 4JY6A 5KVMC 3EOYG 1HILB 3QDMA 2OTPA 1FVDB 3KPPA 3U48A 4JG1H 2DDQH 1L6XA 6CGTA 2CDGB 2ARJB 3SCMD 4XC3L 1L0YA 1TFHA 3LEVL 4XPBL 4XAKE 4GKOA 5D6DA 5EORL 2VLRB 3ELAT 4UTBL 4R7DA 4DEPB 4YK4B 1S9XA 3OR7A 4G6JH 5D93C 3QQ3A 4QRRE 4Y2OA 4U6XA 1AP2A 1G7HB 5F6HJ 4BSVA 1JGVL 3L3OA 2JB5L 4J4PA 4YDIL 2CGRL 2WBJD 3JV4A 3T1FA 2BNQD 4X8XA 15C8L 3MLYH 2ESVB 3GRWL 3QUML 2GQHA 2ZOKB 35C8L 4OJFH 1KJ2A 2NY0B 3I9GH 3MV8A 3E6FB 5D96B 5JW3H 3QXDB 4J3VA 3ULSA 3PXJA 4KHXL 1N5AB 4GT7A 4ZYKB 1T66D 3QEHB 1WK0A 5CD5D 4OLYH 4M7KL 5I1CH 5IP4A 2H45A 4AL8L 1NLBH 2CXGA 3QA3B 4CRPA 3UBXB 1FE8H 3HI6L 4PUBL 5JNYB 4XCEB 5C0DA 2OP4L 1DUZA 3ETBF 3IDYC 3ILPA 4LCUA 4OKVA 1AGCB 4ELMF 3S8WA 3LN9A 4JVWA 3TV3H 1CIUA 3QULA 4LLDA 2VSCA 3PE9A 4P23B 1MCKA 2A6JB 3BRFA 2R0ZL 4IRZL 4KJQD 4CN1A 1SM3H 1CVRA 1MFEH 3QDJB 2PXYD 5E6IC 3SE4A 4XZUA 3OMZA 4P57B 2R4RH 4R8WL 1UWGL 5JQ6H 4LHUA 5JA8B 3O6KH 5J0BA 2BNRE 3HUJF 4FFVD 4M8VA 4LLMB 3MCLL 1NGXA 1P4IL 5DD0H 3DRTA 3RQ3A 2DQHH 4KPHL 4LBEA 5EIVA 1D5XB 2M26A 3RWEB 3BO8B 3FQUA 2PYFA 5F9DC 5MEOB 5J7CC 1FYHB 4YJZL 3U1SL 5JO5B 5I1KL 2X4OB 4XPHL 3V4PL 1F2XK 4LPUA 4QRTA 1AR1C 4MLSA 4YWGH 4PRIE 1J1PL 1OB1B 3HE6D 2FYYB 3IFPB 3RWJB 4D0DA 2BOCA 2NTFB 4JANA 4CN6A 4ODWB 3T8XB 1ZT4A 3IDIA 3B9DA 2QSTA 4E5XB 2ZCLH 3TGXA 1V3MA 4FMFA 1QO3A 4X9GA 1IRAY 4ISVB 4ELKA 1OAKL 3G6DL 1M7IA 4PRNB 4NFCA 4YIQB 5F1NA 4OIIL 2KZWA 2DYPD 5I30H 4LCUB 1OW0C 4IS6B 2NY3D 3LHPH 4FXKA 1T22A 3ARDD 4MD0B 4Y4HC 1LO4L 1KTDB 4XCEA 1A7QH 1Q9LB 4YHKL 5DT1H 4OD2A 5EA0H 4LSPL 3G5VB 4ODVH 4JY6B 4LLWA 3EZ8A 1CGYA 2BNRD 3ALXA 4K94L 5AWNL 3LMJL 1A6UL 3PWNB 1UKTA 4UT9L 5DRNB 3VGDA 4JFEB 4F7PA 4ZNCD 2IAMC 2V5RA 1GGCH 5DD1H 1XGPB 2C7UA 5HVHC 3H3BC 1OAQH 4NKDB 5IKCB 3MR9A 3ZL4H 5E5MB 2AK1L 2Z35A 4KI1A 4JO3H 3FB7A 3MRRB 5DMGD 5CLWA 2I9TA 4LLUB 4Y16A 1HYSC 2CUMA 2BSTA 4AZ8A 3UPRB 4Z7UF 4Z7QE 2Q76B 5ISZE 1OPGL 3WE6B 4DJMA 1RHHB 5E0QA 5FA4B 2F5AL 4MJIE 5KN5B 3B9KD 4XRCB 2HJFA 4Z78A 1X4XA 3EOAA 3AS0A 1MELA 4X9HA 3RDTB 4DVBB 1H8NA 1YYML 4X98A 3RUGA 1UZ6F 4A2LA 3FFCE 5F9OL 1QFHA 1TJHL 1BOGA 2JJTA 3V0VB 1YEHH 2VXVH 3DXAA 4NQDE 5F93C 1AO7E 1BLNB 2FSEB 1J0ZA 2YUWA 4PJAA 2E7LC 2XY1A 5IB3B 5FV2A 2V2TA 2HFFB 1LO3L 3QDJE 4J6RH 3SJVE 2OSLA 5I71B 4OF8A 2JJSC 3U83A 5GS0C 2AJ3A 3WL9B 2HAZA 5A2JH 2VDPL 5IW6B 5IEKA 1IL1A 2FL5B 1QRNB 1R5WB 3DBXB 5IBUB 3MODL 3X13B 2FL5A 3LPGA 1MEXL 3S4SB 5IGXL 4PJ9B 4PRIA 3GJEB 3SDYL 2E9WA 1AGDB 3KYMB 5B21A 1FIEA 2VDNH 4P9HC 3P30L 4R90L 4YXHL 4G80B 3HE6C 1OGAA 5DMKB 3WE6A 1A8JH 4NM8L 1BEYH 4HDIB 2Q76A 5AUMA 4K23H 3T0ED 1WEJH 4AH2B 4BYHA 3T3PE 3VFNA 5AYUH 2R2EA 2A83B 3RDTA 4NQVB 3RWJA 1HEZA 2VDLH 5F6HI 5B39G 1MHCB 3QR2A 5JXEA 4HS3B 5EFIA 5JDSA 3QFDB 3TBWA 1QR1B 4H20L 3AB0B 1ADQA 4MHHG 5FO9A 3VXMA 2F54E 1TXKA 4PBVC 3HZKA 5KG9A 3VDAA 3ZT6A 4R26H 1YEDA 5AZEH 3P73B 3G5VA 4G9FB 5E6ID 3TZVC 4PJBE 4IHOB 4WY7L 3EO9H 5GZOD 2EEBA 4M02A 4PY7B 3GBNL 2P49B 3WLBB 5KBNC 5E2VL 4JQIH 1DBKL 1MFAH 3E8UL 1U8HB 2QSQA 5DJXB 4MAYB 4MNQA 4Z7WA 1Q9KA 4HAFA 5KANG 5IOPB 1T5WA 3DPBA 4LFHG 4RGNC 2DBLL 1X3DA 3RL2B 5FYKU 1YEEH 1NC2A 2KZ1B 1PX4A 4LLDB 4LIQH 4IJ3C 1L9NA 1LHZA 1CE1H 4R7NB 2GFBB 1KTDA 4MQXD 3PV6B 5JIKA 4LSUL 2BHYA 4QRTB 1MHHA 2R2BA 3FFDA 4X7DC 2COQA 1WZMA 3BQUD 1M05A 4M1CD 3VXRD 4F8QA 1FORH 3MCKB 3S6CA 4D3CL 5L2JA 5FYLL 4OLUH 2C3VB 1RUMH 1BQLH 1IQWL 4L4VB 3VXOB 4HJJL 3KWWB 3VXMB 1MJJB 4MWFB 3MRNA 3F58H 3ROLB 5EFIB 4ONHA 3GHBH 3F7PC 1F13A 2P44B 5AD0A 3P73A 3I6KB 3U0WL 1WAAE 5HBBA 2VUYA 3SCMC 4TSAL 2H32A 4PGJA 5H2BB 5GQBA 3OV6A 2WUCL 2GJ6D 4NPYB 3S3JA 1PSKH 2H32H 3ARRA 5DQ9A 4X4YB 4BSWA 3N9GH 3PHQA 4YNYA 3GMPA 3D9AH 1Z3GH 3MFGB 5GGVY 1RK0A 4P9HH 3K46A 3NFNA 4G6AC 4W6YB 2UY7A 4GAGL 4M6NL 3CZFA 3PP3H 2EDEA 4JFPB 4Y1AE 1MCWM 4MJIA 3U9PL 2Q20A 4H88L 4UOW0 5ACZB 4X7EC 1VHPA 1RZJC 2VZUA 1SJHB 2YD6A 4DUVA 4LLYB 5FYJE 5H35B 3EOTL 3ARZA 3DECA 1IC5L 2FEEL 4OKVB 4XCYA 4ZFGH 1T0PB 1H9VA 2FB4H 4G8EA 3VFGH 5GS0H 1T83C 4JKPL 1MY7A 4UV4H 2JCCA 2HT4D 1FL6A 4OD1H 3GIZH 1R3HB 4LHUG 4PJIF 3LH2H 1LVEA 4JRXD 4EXPX 2R9HD 4LVEA 4RGNB 1KB9K 3OKKA 3QP3A 3U4BL 1B3JA 3DWTA 2JK5A 2DJUA 1IQWH 3PIQB 2YD1A 4RNRB 5T3XL 4HPYH 3VGAB 2BOBB 4NKOB 1EDQA 1K8IA 5DJCB 3R8QA 1ES0A 3RWFB 2R1XA 3P2TA 1OTSD 3B8YA 3K4AA 1G84A 1TVHA 4YBHA 1NFDA 4HS6A 4BZYA 1JGLH 1WZKA 3P0YL 5JIHA 5FGRA 2HMID 4M7LL 2NY0C 4Y1AB 3VI3F 4OF0A 4DGYL 2W0LA 1MI5D 4L8SC 1Y18A 4OCNC 3S5LA 3I85A 3BPLC 4OF5A 1T1WA 4KZDL 2VDQL 3O2WL 1DQMH 4QRPB 1WITA 4U33A 4RIRA 3TJEL 2DTMH 4ZO6A 1JJUA 1QQDB 4X9FA 1FGVL 1KTRL 3VXNA 2DBLH 1BIHA 2ZJSH 4XNMA 4P2QD 2P8PA 5E7FA 4JM2A 1U3YA 3MGAA 2FH8A 1KIRB 1OGTB 1GVIA 2WWMD 3DRQA 5IW6A 2MKLC 4XAKD 4B50A 3DSNA 4P2OB 2BERA 4MDJB 5C09B 3TO2B 2AEPL 5JOEA 5HHOD 4HV8B 3F7YB 5F1KC 3QUYC 3HZMB 3VMOA 1K8DA 5HYFA 3B9AA 3H3PL 5DGQA 3VG0H 3WN5A 2XZAH 2PTTA 3MREB 3GI9H 2IANB 5JHLL 3CSPA 2W0KA 3WNKA 3BGMA 4TSBL 5KSUA 5GGVH 5GGTA 4MJID 3WV0A 1WAAF 2R1XB 3BQUC 3T0EE 4U1SA 4Y5VA 2DJSA 5F9WB 2J6EL 4MQXC 5E8PA 1CDIA 1BZ7B 4B7IA 1HYRC 3VXTB 4MAYD 5I1JL 2F19L 5DHYA 4R96A 2WAHA 3FOMA 3X11B 3OGCB 3P30H 4GOSA 1DN0A 5EUOE 5C08A 4MA3A 4F9PC 3U9UA 1A0QH 5K9QI 5TDOA 4Z8FH 5ADPL 2V7HA 1DQLL 3QG6A 4KTEH 3TIEB 2ATKA 2J3SA 1LO2L 1A64A 1N6QL 3IS1X 2IMMA 3U2SB 3TN0C 5F7DB 1SBSH 3PV7A 2EDHA 3R1GL 5IHBA 1A9BA 3KPMB 3PWPD 5HYSG 2LFGA 2FWOB 2X5PA 1ZLUK 1HZHL 5DI8B 4LEOB 1JYVA 3CFKB 5CMAB 1UJ3A 2N7BA 5T5FH 1FLTX 1S78D 2V7NA 3LV3B 4YHPA 1YPZE 4LRIC 1A7PL 3VD3A 1QRKA 5ISZB 3RX5A 3EIFA 1YUHA 1S9KC 4BFEA 3HMXL 1Z9MA 1NGPL 2VDRL 4MXVE 5EWIH 4QRSA 4OFDA 1G6RB 5CGYC 1P4LA 1KJ2B 2NZIA 4DUWA 1I7TA 1FFQA 3T1FB 5IV2A 3IAGC 1IC4L 1IGMH 3UBXA 2PCPB 2YPVL 3NN8A 2V2WB 5F6IB 2AEWA 3NZHH 3ULSB 4WTZA 4U1IA 1IAKB 4GW5A 3PWUB 5TQ0L 4LSPH 1AHWB 3BJ91 4HUUB 3FO9A 3ME0A 3EBAA 3PWPE 3QDAA 1RZJL 4G8GE 4C56D 4I3SH 3RI5F 4I18C 3SKMA 3MXVH 1FNSH 4HK0A 4WNQA 4XP4L 3P0GB 5ALBH 2BJMH 4WU7A 4AJ0A 4G7YH 4YDLB 3GSWA 3R06B 5FYJD 4JPWL 5HJ3B 5I75C 1KB5H 1AO7D 5DK3A 5IIEA 3L7EB 4RAHA 3K4ZA 2VUOA 2FJHB 3DUSA 3BVNA 3SDCD 1T04A 2AK4B 4MJ4A 3WJJA 1KJ2H 1H3WM 1A3LH 3NZ8A 1UH4A 4PRIB 5HDBE 1A7RL 4CDHA 4KMQA 4PIRF 5J89A 1T0NA 1V8HA 2JIXD 4QHNB 1QFUH 3UPAA 3VGBA 2KL6A 4MNGE 4X4ZA 1FC2D 4P46B 4OAWA 5D93B 1HYSD 1S7SA 5C09A 1TLKA 1CZ8H 2DM4A 4XBGB 5F70A 4LF3B 2IF7A 1MHCA 2OR9L 1K5NA 4KROD 2ZUXA 5IVXB 1N64L 4HH9A 3L3KB 5EU5B 1UEYA 3EO0A 3PWPA 5H8DA 1UJ3C 2Z91B 4XBPA 3UTSA 1BWMA 4YZFF 4FQLH 5IB2B 4TPRL 1YMME 3DYPA 1ZVSA 3S34H 1FGNH 3BSZH 1UB6A 1BGXH 2CIIB 1VSCA 4Z7VB 3SCMB 1BVLB 1W0YT 1WBYA 1T4KA 3OBAA 4XP4H 3HR5A 1KGCD 2VXUH 1E4WL 4Z7UB 1NAMA 2YSSA 4UNTA 3BUTA 1NBZB 3WFEL 1Z2KA 3UMTA 2DMKA 1NEZA 5FFLA 2BCKA 5T1KB 3DBXA 5E8OB 1F11A 2J1KA 4GBXC 4Y89A