1IA5A

Polygalacturonase from aspergillus aculeatus
Total Genus 126
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
126
sequence length
339
structure length
339
Chain Sequence
ATTCTFSGSNGASSASKSKTSCSTIVLSNVAVPSGTTLDLTKLNDGTHVIFSGETTFGYKEWSGPLISVSGSDLTITGASGHSINGDGSRWWDGEGGNGGKTKPKFFAAHSLTNSVISGLKIVNSPVQVFSVAGSDYLTLKDITIDNSDGDDNGGHNTDAFDIGTSTYVTISGATVYNQDDCVAVNSGENIYFSGGYCSGGHGLSIGSVGGRSDNTVKNVTFVDSTIINSDNGVRIKTNIDTTGSVSDVTYKDITLTSIAKYGIVVQQNYGDTSSTPTTGVPITDFVLDNVHGSVVSSGTNILISCGSGSCSDWTWTDVSVSGGKTSSKCTNVPSGASC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords POLYGALACTURONASE
publication title The X-ray structure of Aspergillus aculeatus polygalacturonase and a modeled structure of the polygalacturonase-octagalacturonate complex.
pubmed doi rcsb
molecule tags Hydrolase
total genus 126
structure length 339
sequence length 339
ec nomenclature ec 3.2.1.15: Endo-polygalacturonase.
pdb deposition date 2001-03-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00295 Glyco_hydro_28 Glycosyl hydrolases family 28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.160.20.10 Mainly Beta 3 Solenoid Pectate Lyase C-like Single-stranded right-handed beta-helix, Pectin lyase-like 1ia5A00
4YZAA 4YELA 3GRHA 1EE6A 4URRA 4OJPA 1O8FA 3UW0A 4XLCA 3EQNA 4Z03A 4XLAA 3EQOA 4XNFA 4OZYA 2NZMA 2IQ7A 4Z05A 2UVEA 2X3HA 1DBOA 1O8HA 1NHCA 4NK6A 4XLFA 2QX3A 1OFMA 4W8TA 1PXZA 1OGOX 3GQ8A 1VBLA 4EW9A 1RWRA 2NT6A 1IB4A 4XKWA 2INVA 4MR0A 1IDKA 1PE9A 2X6YA 5AMVA 2VJIA 3B90A 4NK8A 4XN3A 2VJJA 2UVFA 4YZXA 2VBMA 4W8QA 3VMVA 4XLEA 5C1EA 3GQ9A 4YEJA 2X6WA 2INUA 3FY3A 1GQ8A 3ZPPA 2NTPA 4OJOA 4AVZA 1OFLA 4PMHA 4XORA 4Z06A 2BSPA 4OJ5A 4YZQA 1CZFA 2O17A 4XM3A 1K5CA 4U4BA 1HG8A 1H80A 1RU4A 2X6XA 2VBKA 1KTWA 1O8GA 2X85A 3VSVA 3VSTA 2ODLA 1XG2A 4XONA 1X0CA 3JURA 3VMWA 2O04A 4XR6A 3LMWA 2VBEA 4W8RA 1O8JA 3GQAA 2NT9A 2NTQA 3GQ7A 1AIRA 1QJVA 4OJLA 1O88A 4U49A 1QCXA 3T9GA 4OZZA 4XL9A 1OGMX 3KRGA 1O8MA 1O8IA 2PYHA 4C2LA 2PYGA 4MXNA 4XOPA 1BHEA 3SUCA 4YZ0A 2O0WA 3ZSCA 1JRGA 1O8KA 3WWGA 4HWVA 1O8LA 1IA5A 1KCCA 3B8YA 4XMYA 2O0VA 2NSTA 4W8SA 1WMRA 4XOTA 2NSPA 1O8EA 1JTAA 4OJ6A 1RMGA 3VSUA 2QY1A 1OOCA 4XQFA 1KCDA 4XKVA 2Z8GA 1IDJA 1PLUA 2QXZA 2O1DA 2EWEA 4I84A 1O8DA 1BN8A 4XLHA 1DBGA 5C1CA 3B4NA 2PECA 4XN0A 2NTBA
chains in the Genus database with same CATH superfamily
4YZAA 4YELA 3SZEA 3GRHA 1EE6A 3N90A 4URRA 4OJPA 1O8FA 3UW0A 4XLCA 4V02C 3EQNA 3PSZA 2V5IA 2W7ZA 3PSSA 4Z03A 2B0RA 3LJYA 4XLAA 3EQOA 4XNFA 4JRAC 4OZYA 2NZMA 2IQ7A 2XTWA 4Z05A 2UVEA 2X3HA 1DBOA 1O8HA 1NHCA 1QA1A 4NK6A 1WXRA 4XLFA 2QX3A 1OFMA 4W8TA 2G0YA 4YEIA 2BM5A 1PXZA 1OGOX 3GQ8A 1VBLA 1CLWA 1RWRA 2NT6A 3BH6B 3JX8A 2F3LA 1K4ZA 1QQ1A 4XKWA 4YFOA 2INVA 1IB4A 4MR0A 1IDKA 1EA0A 4OM9A 1PE9A 2X6YA 5AMVA 2VJIA 3B90A 4NK8A 4XN3A 2VJJA 3BH7B 2UVFA 4YZXA 2VBMA 4W8QA 3VMVA 4XLEA 5C1EA 1L1IA 3GQ9A 2QZAA 4YEJA 2X6WA 3H09A 2INUA 2BM7A 2VFOA 3FY3A 1GQ8A 4YCQA 5DNSA 3P4GA 3ZPPA 2NTPA 1LM1A 4OJOA 4AVZA 1OFLA 2VFPA 4PMHA 3PETA 4XORA 4Z06A 2BSPA 3AK5A 4OJ5A 4YZQA 1CZFA 2O17A 4XM3A 1K5CA 4U4BA 2XTYA 1HG8A 1TYXA 1H80A 1RU4A 2X6XA 5JMCB 3SQVA 2VBKA 1KTWA 1O8GA 1EZGA 1OFEA 2BM4A 2X85A 3TH0A 3VSVA 2YUHA 2XC1A 3VSTA 2ODLA 1XG2A 1QRBA 1X0CA 4XONA 3SY2A 2BX6A 3JURA 2VFNA 2O04A 2VFMA 4XR6A 3VMWA 3LMWA 2VBEA 4W8RA 1QA2A 1O8JA 3GQAA 2NT9A 2NTQA 3GQ7A 1AIRA 3RIQA 1QJVA 4OJLA 1O88A 3DU1X 4U49A 1QCXA 2IOUG 3T9GA 4OZZA 1OFDA 4XL9A 1OGMX 3KRGA 3SYJA 1O8MA 3LYCA 1O8IA 2PYHA 4C2LA 2PYGA 4MXNA 1TYVA 1BHEA 2XTXA 4XOPA 3SUCA 4YZ0A 1TYWA 2O0WA 3ZSCA 1KQ5A 1JRGA 1QRCA 1O8KA 3WWGA 4OPWA 4HWVA 1O8LA 5JLVC 1IA5A 1KCCA 3B8YA 1LLWA 2XT4A 4XMYA 4EW9A 2NSTA 2O0VA 3NAWA 1WMRA 4W8SA 4XOTA 1TYUA 1HF2A 3ML3A 2NSPA 1O8EA 1JTAA 4OJ6A 1K8FA 1RMGA 3VSUA 2QY1A 1OOCA 2QYUA 4XQFA 1KCDA 4XKVA 3NB2A 2XT2A 2Z8GA 1IDJA 2BM6A 1PLUA 2O6WA 2VFQA 4KH3A 2J8KA 1TSPA 2O1DA 2QXZA 4YC5A 3N6ZA 2EWEA 4I84A 1O8DA 1BN8A 1LLZA 4XLHA 4YDTA 1QA3A 1DBGA 2J8IA 1DABA 5C1CA 3B4NA 2PECA 4XN0A 2NTBA
chains in the Genus database with same CATH topology
4YZAA 4YELA 3GRHA 1EE6A 4URRA 4OJPA 1O8FA 3UW0A 4XLCA 3EQNA 4Z03A 4XLAA 3EQOA 4XNFA 4OZYA 2NZMA 2IQ7A 4Z05A 2UVEA 2X3HA 1DBOA 1O8HA 1NHCA 4NK6A 4XLFA 2QX3A 1OFMA 4W8TA 1PXZA 1OGOX 3GQ8A 1VBLA 4EW9A 1RWRA 2NT6A 1IB4A 4XKWA 2INVA 4MR0A 1IDKA 1PE9A 2X6YA 5AMVA 2VJIA 3B90A 4NK8A 4XN3A 2VJJA 2UVFA 4YZXA 2VBMA 4W8QA 3VMVA 4XLEA 5C1EA 3GQ9A 4YEJA 2X6WA 2INUA 3FY3A 1GQ8A 3ZPPA 2NTPA 4OJOA 4AVZA 1OFLA 4PMHA 4XORA 4Z06A 2BSPA 4OJ5A 4YZQA 1CZFA 2O17A 4XM3A 1K5CA 4U4BA 1HG8A 1H80A 1RU4A 2X6XA 2VBKA 1KTWA 1O8GA 2X85A 3VSVA 3VSTA 2ODLA 1XG2A 4XONA 1X0CA 3JURA 3VMWA 2O04A 4XR6A 3LMWA 2VBEA 4W8RA 1O8JA 3GQAA 2NT9A 2NTQA 3GQ7A 1AIRA 1QJVA 4OJLA 1O88A 4U49A 1QCXA 3T9GA 4OZZA 4XL9A 1OGMX 3KRGA 1O8MA 1O8IA 2PYHA 4C2LA 2PYGA 4MXNA 4XOPA 1BHEA 3SUCA 4YZ0A 2O0WA 3ZSCA 1JRGA 1O8KA 3WWGA 4HWVA 1O8LA 1IA5A 1KCCA 3B8YA 4XMYA 2O0VA 2NSTA 4W8SA 1WMRA 4XOTA 2NSPA 1O8EA 1JTAA 4OJ6A 1RMGA 3VSUA 2QY1A 1OOCA 4XQFA 1KCDA 4XKVA 2Z8GA 1IDJA 1PLUA 2QXZA 2O1DA 2EWEA 4I84A 1O8DA 1BN8A 4XLHA 1DBGA 5C1CA 3B4NA 2PECA 4XN0A 2NTBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4YZA A;  4YEL A;  3GRH A;  1EE6 A;  4URR A;  4OJP A;  1O8F A;  3UW0 A;  4XLC A;  3EQN A;  4Z03 A;  4XLA A;  3EQO A;  4XNF A;  4OZY A;  2NZM A;  2IQ7 A;  4Z05 A;  2UVE A;  2X3H A;  1DBO A;  1O8H A;  1NHC A;  4NK6 A;  4XLF A;  2QX3 A;  1OFM A;  4W8T A;  1PXZ A;  1OGO X;  3GQ8 A;  1VBL A;  4EW9 A;  1RWR A;  2NT6 A;  1IB4 A;  4XKW A;  2INV A;  4MR0 A;  1IDK A;  1PE9 A;  2X6Y A;  5AMV A;  2VJI A;  3B90 A;  4NK8 A;  4XN3 A;  2VJJ A;  2UVF A;  4YZX A;  2VBM A;  4W8Q A;  3VMV A;  4XLE A;  5C1E A;  3GQ9 A;  4YEJ A;  2X6W A;  2INU A;  3FY3 A;  1GQ8 A;  3ZPP A;  2NTP A;  4OJO A;  4AVZ A;  1OFL A;  4PMH A;  4XOR A;  4Z06 A;  2BSP A;  4OJ5 A;  4YZQ A;  1CZF A;  2O17 A;  4XM3 A;  1K5C A;  4U4B A;  1HG8 A;  1H80 A;  1RU4 A;  2X6X A;  2VBK A;  1KTW A;  1O8G A;  2X85 A;  3VSV A;  3VST A;  2ODL A;  1XG2 A;  4XON A;  1X0C A;  3JUR A;  3VMW A;  2O04 A;  4XR6 A;  3LMW A;  2VBE A;  4W8R A;  1O8J A;  3GQA A;  2NT9 A;  2NTQ A;  3GQ7 A;  1AIR A;  1QJV A;  4OJL A;  1O88 A;  4U49 A;  1QCX A;  3T9G A;  4OZZ A;  4XL9 A;  1OGM X;  3KRG A;  1O8M A;  1O8I A;  2PYH A;  4C2L A;  2PYG A;  4MXN A;  4XOP A;  1BHE A;  3SUC A;  4YZ0 A;  2O0W A;  3ZSC A;  1JRG A;  1O8K A;  3WWG A;  4HWV A;  1O8L A;  1IA5 A;  1KCC A;  3B8Y A;  4XMY A;  2O0V A;  2NST A;  4W8S A;  1WMR A;  4XOT A;  2NSP A;  1O8E A;  1JTA A;  4OJ6 A;  1RMG A;  3VSU A;  2QY1 A;  1OOC A;  4XQF A;  1KCD A;  4XKV A;  2Z8G A;  1IDJ A;  1PLU A;  2QXZ A;  2O1D A;  2EWE A;  4I84 A;  1O8D A;  1BN8 A;  4XLH A;  1DBG A;  5C1C A;  3B4N A;  2PEC A;  4XN0 A;  2NTB A; 
#chains in the Genus database with same CATH topology
 4YZA A;  4YEL A;  3SZE A;  3GRH A;  1EE6 A;  3N90 A;  4URR A;  4OJP A;  1O8F A;  3UW0 A;  4XLC A;  4V02 C;  3EQN A;  3PSZ A;  2V5I A;  2W7Z A;  3PSS A;  4Z03 A;  2B0R A;  3LJY A;  4XLA A;  3EQO A;  4XNF A;  4JRA C;  4OZY A;  2NZM A;  2IQ7 A;  2XTW A;  4Z05 A;  2UVE A;  2X3H A;  1DBO A;  1O8H A;  1NHC A;  1QA1 A;  4NK6 A;  1WXR A;  4XLF A;  2QX3 A;  1OFM A;  4W8T A;  2G0Y A;  4YEI A;  2BM5 A;  1PXZ A;  1OGO X;  3GQ8 A;  1VBL A;  1CLW A;  1RWR A;  2NT6 A;  3BH6 B;  3JX8 A;  2F3L A;  1K4Z A;  1QQ1 A;  4XKW A;  4YFO A;  2INV A;  1IB4 A;  4MR0 A;  1IDK A;  1EA0 A;  4OM9 A;  1PE9 A;  2X6Y A;  5AMV A;  2VJI A;  3B90 A;  4NK8 A;  4XN3 A;  2VJJ A;  3BH7 B;  2UVF A;  4YZX A;  2VBM A;  4W8Q A;  3VMV A;  4XLE A;  5C1E A;  1L1I A;  3GQ9 A;  2QZA A;  4YEJ A;  2X6W A;  3H09 A;  2INU A;  2BM7 A;  2VFO A;  3FY3 A;  1GQ8 A;  4YCQ A;  5DNS A;  3P4G A;  3ZPP A;  2NTP A;  1LM1 A;  4OJO A;  4AVZ A;  1OFL A;  2VFP A;  4PMH A;  3PET A;  4XOR A;  4Z06 A;  2BSP A;  3AK5 A;  4OJ5 A;  4YZQ A;  1CZF A;  2O17 A;  4XM3 A;  1K5C A;  4U4B A;  2XTY A;  1HG8 A;  1TYX A;  1H80 A;  1RU4 A;  2X6X A;  5JMC B;  3SQV A;  2VBK A;  1KTW A;  1O8G A;  1EZG A;  1OFE A;  2BM4 A;  2X85 A;  3TH0 A;  3VSV A;  2YUH A;  2XC1 A;  3VST A;  2ODL A;  1XG2 A;  1QRB A;  1X0C A;  4XON A;  3SY2 A;  2BX6 A;  3JUR A;  2VFN A;  2O04 A;  2VFM A;  4XR6 A;  3VMW A;  3LMW A;  2VBE A;  4W8R A;  1QA2 A;  1O8J A;  3GQA A;  2NT9 A;  2NTQ A;  3GQ7 A;  1AIR A;  3RIQ A;  1QJV A;  4OJL A;  1O88 A;  3DU1 X;  4U49 A;  1QCX A;  2IOU G;  3T9G A;  4OZZ A;  1OFD A;  4XL9 A;  1OGM X;  3KRG A;  3SYJ A;  1O8M A;  3LYC A;  1O8I A;  2PYH A;  4C2L A;  2PYG A;  4MXN A;  1TYV A;  1BHE A;  2XTX A;  4XOP A;  3SUC A;  4YZ0 A;  1TYW A;  2O0W A;  3ZSC A;  1KQ5 A;  1JRG A;  1QRC A;  1O8K A;  3WWG A;  4OPW A;  4HWV A;  1O8L A;  5JLV C;  1IA5 A;  1KCC A;  3B8Y A;  1LLW A;  2XT4 A;  4XMY A;  4EW9 A;  2NST A;  2O0V A;  3NAW A;  1WMR A;  4W8S A;  4XOT A;  1TYU A;  1HF2 A;  3ML3 A;  2NSP A;  1O8E A;  1JTA A;  4OJ6 A;  1K8F A;  1RMG A;  3VSU A;  2QY1 A;  1OOC A;  2QYU A;  4XQF A;  1KCD A;  4XKV A;  3NB2 A;  2XT2 A;  2Z8G A;  1IDJ A;  2BM6 A;  1PLU A;  2O6W A;  2VFQ A;  4KH3 A;  2J8K A;  1TSP A;  2O1D A;  2QXZ A;  4YC5 A;  3N6Z A;  2EWE A;  4I84 A;  1O8D A;  1BN8 A;  1LLZ A;  4XLH A;  4YDT A;  1QA3 A;  1DBG A;  2J8I A;  1DAB A;  5C1C A;  3B4N A;  2PEC A;  4XN0 A;  2NTB A; 
#chains in the Genus database with same CATH homology
 4YZA A;  4YEL A;  3GRH A;  1EE6 A;  4URR A;  4OJP A;  1O8F A;  3UW0 A;  4XLC A;  3EQN A;  4Z03 A;  4XLA A;  3EQO A;  4XNF A;  4OZY A;  2NZM A;  2IQ7 A;  4Z05 A;  2UVE A;  2X3H A;  1DBO A;  1O8H A;  1NHC A;  4NK6 A;  4XLF A;  2QX3 A;  1OFM A;  4W8T A;  1PXZ A;  1OGO X;  3GQ8 A;  1VBL A;  4EW9 A;  1RWR A;  2NT6 A;  1IB4 A;  4XKW A;  2INV A;  4MR0 A;  1IDK A;  1PE9 A;  2X6Y A;  5AMV A;  2VJI A;  3B90 A;  4NK8 A;  4XN3 A;  2VJJ A;  2UVF A;  4YZX A;  2VBM A;  4W8Q A;  3VMV A;  4XLE A;  5C1E A;  3GQ9 A;  4YEJ A;  2X6W A;  2INU A;  3FY3 A;  1GQ8 A;  3ZPP A;  2NTP A;  4OJO A;  4AVZ A;  1OFL A;  4PMH A;  4XOR A;  4Z06 A;  2BSP A;  4OJ5 A;  4YZQ A;  1CZF A;  2O17 A;  4XM3 A;  1K5C A;  4U4B A;  1HG8 A;  1H80 A;  1RU4 A;  2X6X A;  2VBK A;  1KTW A;  1O8G A;  2X85 A;  3VSV A;  3VST A;  2ODL A;  1XG2 A;  4XON A;  1X0C A;  3JUR A;  3VMW A;  2O04 A;  4XR6 A;  3LMW A;  2VBE A;  4W8R A;  1O8J A;  3GQA A;  2NT9 A;  2NTQ A;  3GQ7 A;  1AIR A;  1QJV A;  4OJL A;  1O88 A;  4U49 A;  1QCX A;  3T9G A;  4OZZ A;  4XL9 A;  1OGM X;  3KRG A;  1O8M A;  1O8I A;  2PYH A;  4C2L A;  2PYG A;  4MXN A;  4XOP A;  1BHE A;  3SUC A;  4YZ0 A;  2O0W A;  3ZSC A;  1JRG A;  1O8K A;  3WWG A;  4HWV A;  1O8L A;  1IA5 A;  1KCC A;  3B8Y A;  4XMY A;  2O0V A;  2NST A;  4W8S A;  1WMR A;  4XOT A;  2NSP A;  1O8E A;  1JTA A;  4OJ6 A;  1RMG A;  3VSU A;  2QY1 A;  1OOC A;  4XQF A;  1KCD A;  4XKV A;  2Z8G A;  1IDJ A;  1PLU A;  2QXZ A;  2O1D A;  2EWE A;  4I84 A;  1O8D A;  1BN8 A;  4XLH A;  1DBG A;  5C1C A;  3B4N A;  2PEC A;  4XN0 A;  2NTB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...