1IA6A

Crystal structure of the cellulase cel9m of c. cellulolyticum
Total Genus 164
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
164
sequence length
431
structure length
423
Chain Sequence
b'AGTHDYSTALKDSIIFFDANKCGPQAGENNVFDWRGACHTTDGSDVGVDLTGGYHDAGDHVKFGLPQGYSAAILGWSLYEFKESFDATGNTTKMLQQLKYFTDYFLKSHPNSTTFYYQVGEGNADHTYWGAPEEQTGQRPSLYKADPSSPASDILSETSAALTLMYLNYKNIDSAYATKCLNAAKELYAMGKANQGVGNGQSFYQATSFGDDLAWAATWLYTATNDSTYITDAEQFITLNKMQDKWTMCWDDMYVPAALRLAQITGKQIYKDAIEFNFNYWKTQVTTTPGGLKWLSNWGVLRYAAAESMVMLVYCKQNPDQSLLDLAKKQVDYILGDNPANMSYIIGYGSNWCIHPHHRAANGYTYADNAKPAKHLLTGALVGGPDQNDKFLDDANQYQYTEVALDYNAGLVGVLAGAIKFFG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CELLULASE CEL9M
publication title Crystal structure of the cellulase Cel9M enlightens structure/function relationships of the variable catalytic modules in glycoside hydrolases.
pubmed doi rcsb
source organism Clostridium cellulolyticum
molecule tags Hydrolase
total genus 164
structure length 423
sequence length 431
ec nomenclature ec 3.2.1.4: Cellulase.
pdb deposition date 2001-03-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00759 Glyco_hydro_9 Glycosyl hydrolase family 9
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.50.10.10 Mainly Alpha Alpha/alpha barrel Glycosyltransferase Glycosyltransferase 1ia6A00
3ACTA 3RRSA 2GH4A 2EADA 4CJ0A 3X17A 1FAEA 5KKBA 4J5TA 4WVAA 1XW2A 5DGQA 3ANIA 1FO2A 3H7LA 2EABA 1G87A 1FMIA 1H13A 1KWFA 3W7WA 1L1YA 3WIQA 3ANKA 1KSDA 3WKHA 4Q88A 3EQAA 4WVBA 2JF4A 2ZBLA 1F9OA 1WU5A 2DRRA 2FBAA 4JJJA 1DOGA 2VN4A 1GAHA 3ANJA 3W7TA 1V7XA 3D3IA 1AGMA 5GW7A 3RX7A 3RSYA 1XWQA 2JJBA 2RGKA 2RI8A 3S4DA 4TXTA 1K72A 2DROA 3ON6A 3K11A 3S4AA 4Z4LA 4WU0A 1NC5A 5MEHA 2AHGA 3S4CA 4AYQA 4CJ1A 5CZLA 1FCEA 2CQTA 2WYNA 1RQ5A 4EL8A 1KKTA 1KSCA 1H12A 3ACSA 2AHFA 1GA2A 3GLYA 2GZ6A 4ZG8A 2RI9A 1X9DA 1UG9A 3E73A 4L0GA 2FV0A 1F9DA 1GLMA 1H54A 4WVCA 5CA3A 4DOEA 1IA7A 3PMMA 4XUVA 1CEMA 1L2AA 4KTRA 2OKXA 3T33A 3VW5A 3WKGA 2F6DA 3RX5A 3A3VA 3GT5A 3QT9A 1WU4A 3EZ8A 4CE7A 3QXFA 1G6IA 3QFYA 4AYRA 1CLCA 3QWTA 3QRYA 3P2CA 2DRSA 3WIRA 4DODA 2EACA 2Z07A 1KS8A 1V5DA 3GZKA 1FBWA 3QSPA 4Q2BA 3W5NA 3W7UA 1KFGA 2B4FA 1LF9A 1LF6A 1FP3A 2EAEA 1IS9A 1DL2A 3W7XA 3W5MA 2D8LA 1JS4A 3WKIA 1V7VA 1V5CA 1FO3A 2AFAA 1UT9A 2FV1A 2XFGA 5CD2A 2DRQA 3QDEA 4TF4A 1NXCA 2D5JA 2A8ZA 4ZH5A 5M7IA 3QFZA 1G9GA 1FBOA 1TF4A 2ZZRA 3QPFA 5GY3A 4Z4JA 3RENA 3RX8A 3E6UA 2CQSA 3QG0A 4AYOA 2FUZA 3WC3A 1WU6A 3AFJA 3H2WA 4L6XA 1G9JA 1XWTA 1H14A 5E2JA 3QT3A 3WKFA 2NVPA 3WUXA 1WZZA 1IA6A 4KTPA 3TF4A 1KREA 4FUSA 3WIWA 4AYPA 5DGRA 2VN7A 1GAIA 1HCUA 1V7WA 3W7SA 3S4BA 3CIHA 2YIKA 1VD5A 1ULVA 3VXDA 1AYXA 2P0VA 2JG0A 3H3KA 5M7YA 3QXQA 1KRFA 2QNOA
chains in the Genus database with same CATH superfamily
4GL3A 2GH4A 2G02A 4J5TA 4LNVA 1XW2A 2V3NA 1FMIA 2ZIRB 2ONHA 3WIQA 1QBQB 1S63B 3ANKA 3EQAA 1GXOA 1H35A 4FNVA 1WU5A 3SFYB 1DOGA 1LOHA 1F1SA 3ANJA 2I07B 5DHIA 3D3IA 1N20A 5IKAA 4YCRA 1N9AB 2RGKA 2RI8A 2WINB 1H3BA 2F0YB 3K11A 3S4AA 1N4SB 5MEHA 2AHGA 2PMVA 1H12A 3ACSA 4C1SA 1GA2A 1OJOA 2GZ6A 5ILDA 1RWFA 1HMWA 1UG9A 4L0GA 3PZ3B 4WVCA 4GTRB 4BOJA 1IA7A 5C05A 3EU8A 1CEMA 1L2AA 1TNBB 4YDOB 3VSNA 2E24A 1WU4A 4CE7A 1G6IA 3Q7AB 1J0NA 3SDRA 1C82A 3C72B 5ILHA 3QSPA 5IK9A 1KFGA 2B4FA 1LF6A 5JMDA 1O1SB 1F9GA 2D8LA 4GTSB 2GOXA 5IL8A 2XFGA 3EU5B 2WY8A 4TF4A 3M72A 1FBOA 3NFVA 2B39A 3E6UA 1OJMA 2ZISB 1H36A 1H14A 5E2JA 3SDVA 2NVPA 4OZWA 3WUXA 2G0DA 1WZZA 1JCQB 3N0GA 4KTPA 3SDQA 4LIXA 4FUSA 2BEDB 1V7WA 1VD5A 1KZOB 1N1BA 4OJZA 5M7YA 3QXQA 3DSWB 2QNOA 3OXUA 5JPMB 4CJ0A 2EADA 4MMHA 1FAEA 4WVAA 5DGQA 1X1IA 1KWFA 1O6RA 2XWJB 3W7WA 3M7LA 3DSTB 1KSDA 1TNZB 1F9OA 1FT1B 4JJJA 1CB8A 3E32B 1V7XA 3RSYA 5GW7A 1XWQA 3DRAB 2JJBA 4MU9A 3S4DA 3ON6A 2BB6A 2BRVX 3Q73B 4Z4LA 4OK4A 1RW9A 4OK2A 1O79A 5CZLA 2WYNA 4EHMB 2AHFA 4ZG8A 1HXCA 1SA5B 3E73A 1N95B 2E22A 2WIIB 4DOEA 2X03A 3PMMA 5IKHA 5IL3A 4ZH1A 1N22A 3VW5A 1O1TB 3M7BA 1GXNA 3DPYB 1I8QA 3QXFA 3QFYA 1CLCA 4V1RA 1N23A 5JPNB 4DODA 2WCOA 1GHQA 1FBWA 3GZKA 3W5NA 1NL4B 4ZRPA 3PZ1B 4ONTA 3W5MA 1N94B 3CU7A 1V7VA 3M7EA 2ONGA 5FO8B 1RWHA 2AFAA 1UT9A 1S64B 2D5JA 2A8ZA 5M7IA 4FJQA 1N24A 5JMFA 2ZZRA 1X81B 3D5SA 5DHKA 3RX8A 3SDUA 3WC3A 1D8DB 3PZ2B 1RWGA 2NOJA 1IA6A 1KREA 1W6KA 2V8IA 4AYPA 5DGRA 1H3AA 5ILJA 3SDTA 4D94A 3CIHA 5GZKA 5FOBB 3KSLB 2XQWA 1O1RB 3EUVB 3RRSA 3X17A 4GTMB 1TNYB 3PYBA 2V8KA 1FO2A 1TNOB 2EABA 1HV6A 1H13A 1GSZA 3HXCB 3K7XA 1L1YA 3G4FA 3M01A 4LNBB 1W3YA 3WKHA 1C3DA 3PYAA 2DRRA 2FBAA 1RWAA 1RWCA 5FO7B 1H3CA 1N21A 1QSJA 1MZCB 1H37A 1AGMA 1H39A 1N4RB 3A0OA 5EATA 3P5PA 4TXTA 4WU0A 5EAUA 1NC5A 4D4DA 4GTTB 4CJ1A 4EL8A 3M00A 1O5MB 1D8EB 5EASA 3S9VA 4F13A 2FV0A 2XWBB 1F9DA 3G6JB 1H54A 5CA3A 4RNQA 1N7NA 4GTVB 3SFXB 3E34B 4KTRA 2OKXA 1JCRB 3T33A 3Q7FB 3WKGA 3RX5A 4DI5A 5ILKA 2FUQA 1UMPA 2BBCA 3E37B 3QRYA 2DRSA 3WIRA 3Q78B 3N0FA 1KS8A 1V5DA 3KQ4A 4Q2BA 4GAXA 1FPPB 5ILIA 2EAEA 1IS9A 1DCEB 3W7XA 1HN0A 1HZFA 1JS4A 3WKIA 3M7CA 3RJ3A 3KLSA 2FV1A 2DRQA 3OEDA 1NXCA 3M74A 3M76A 4ZH5A 2WDAA 3QFZA 3LZ9A 3M73A 1LXMA 3QPFA 4GTQB 1LXKA 3QG0A 4D4AA 3G4DA 3H2WA 4GTOB 1N4QB 2A73B 1XWTA 3WKFA 5AGDA 3QT3A 3NNBA 1OJPA 1N7OA 1N7QA 3WIWA 2IEJB 2VN7A 1GAIA 1NI1B 3W7SA 2R2LB 2BB5A 3VXDA 1AYXA 2H6IB 3DSSB 3P5RA 5ILYA 3ACTA 4F10A 2WY7A 5KKBA 3SAEA 4GTPB 1OJNA 1R76A 4KKJA 4ZRQA 3ANIA 3H7LA 1G87A 1N1ZA 1W6JA 2V8JA 1HXGA 2H6GB 4Q88A 2Q1FA 4D4CA 3Q75B 4WVBA 2JF4A 2ZBLA 3VSMA 4LNGB 1TNUB 3E30B 1TN6B 2VN4A 2BRPA 1GAHA 3E33B 1KZPB 3W7TA 1TN7B 3D5RA 3RX7A 1LTXB 1HM3A 1O6QA 2FUTA 1K72A 2DROA 3M75A 4QT9A 4V1SA 3DSXB 3S4CA 4AYQA 1FCEA 2CQTA 4FXGB 1RQ5A 1KKTA 1KSCA 3GLYA 3HXFB 3HXEB 2RI9A 1X9DA 5IK0A 4KKIA 1GLMA 4OZVA 4NEIA 4XUVA 4E1YA 5IM1A 1TN8B 2F6DA 3M02A 3A3VA 5IK6A 3GT5A 3QT9A 2J5CA 3AFLA 3EZ8A 3KSQB 4AYRA 3E7JA 3QWTA 3P2CA 3DSVB 1QQFA 3M71A 2EACA 1LD8B 2Z07A 1J0MA 3W7UA 1EGUA 1SQCA 1LD7B 1LF9A 4BOKA 1FP3A 5ILZA 4YDEB 1JCSB 1SA4B 1DL2A 4D4BA 4L9PB 1FT2B 1O6HA 2PN5A 1V5CA 1FO3A 5CD2A 4MMIA 3QDEA 3E80A 2H6FB 1G9GA 1HMUA 1N7RA 1TF4A 1QAZA 5GY3A 3RENA 4Z4JA 1HM2A 2CQSA 2H6HB 4AYOA 2FUZA 3M78A 1WU6A 3AFJA 2SQCA 4L6XA 2BRWA 3HXBB 1G9JA 3M77A 3SQCA 4FXKB 2V3PA 5FO9B 3TF4A 4M76A 1N4PB 1HXAA 3Q79B 4MBGB 1HCUA 3DSUB 1X1JA 3S4BA 1X1HA 2YIKA 1N7PA 3PZ4B 1ULVA 1GXMA 2P0VA 2JG0A 3H3KA 1KRFA 1HX9A 3HXDB
chains in the Genus database with same CATH topology
4GL3A 2GH4A 2G02A 4J5TA 4LNVA 1XW2A 2V3NA 1FMIA 2ZIRB 3WIQA 1QBQB 1S63B 3ANKA 3EQAA 1GXOA 1H35A 1WU5A 3SFYB 1DOGA 3ANJA 2I07B 3D3IA 4YCRA 1N9AB 2RGKA 2RI8A 2WINB 1H3BA 2F0YB 3K11A 3S4AA 1N4SB 5MEHA 2AHGA 2PMVA 1H12A 3ACSA 4C1SA 1GA2A 2GZ6A 1UG9A 4L0GA 3PZ3B 4WVCA 4GTRB 4BOJA 1IA7A 3EU8A 1CEMA 1L2AA 1TNBB 4YDOB 1WU4A 4CE7A 1G6IA 3Q7AB 3SDRA 3C72B 3QSPA 1KFGA 2B4FA 1LF6A 1O1SB 2D8LA 4GTSB 2GOXA 2XFGA 3EU5B 2WY8A 4TF4A 3M72A 1FBOA 2B39A 3E6UA 2ZISB 1H36A 1H14A 5E2JA 3SDVA 2NVPA 3WUXA 2G0DA 1WZZA 1JCQB 4KTPA 3SDQA 4LIXA 4FUSA 2BEDB 1V7WA 1VD5A 1KZOB 5M7YA 3QXQA 3OXUA 3DSWB 2QNOA 5JPMB 4CJ0A 2EADA 1FAEA 4WVAA 5DGQA 1KWFA 1O6RA 2XWJB 3W7WA 3M7LA 3DSTB 1KSDA 1TNZB 1F9OA 1FT1B 4JJJA 3E32B 1V7XA 3RSYA 5GW7A 1XWQA 3DRAB 2JJBA 4MU9A 3S4DA 3ON6A 2BB6A 3Q73B 4Z4LA 1O79A 5CZLA 2WYNA 4EHMB 2AHFA 4ZG8A 1SA5B 3E73A 1N95B 2WIIB 4DOEA 3PMMA 4ZH1A 3VW5A 1O1TB 3M7BA 1GXNA 3DPYB 3QXFA 3QFYA 1CLCA 4V1RA 5JPNB 4DODA 1GHQA 1FBWA 3GZKA 3W5NA 1NL4B 4ZRPA 3PZ1B 4ONTA 3W5MA 1N94B 3CU7A 1V7VA 3M7EA 5FO8B 2AFAA 1UT9A 1S64B 2D5JA 2A8ZA 5M7IA 2ZZRA 1X81B 3D5SA 3RX8A 3SDUA 3WC3A 1D8DB 3PZ2B 2NOJA 1IA6A 1KREA 1W6KA 2V8IA 4AYPA 5DGRA 1H3AA 3SDTA 4D94A 3CIHA 5GZKA 5FOBB 3KSLB 2XQWA 1O1RB 3EUVB 3RRSA 3X17A 4GTMB 1TNYB 3PYBA 2V8KA 1FO2A 1TNOB 2EABA 3HXCB 1H13A 1GSZA 3K7XA 1L1YA 4LNBB 3WKHA 1C3DA 3PYAA 2DRRA 2FBAA 5FO7B 1H3CA 1QSJA 1MZCB 1H37A 1AGMA 1H39A 1N4RB 3P5PA 4TXTA 4WU0A 1NC5A 4D4DA 4GTTB 4CJ1A 4EL8A 1O5MB 1D8EB 3S9VA 2FV0A 2XWBB 1F9DA 3G6JB 1H54A 5CA3A 4GTVB 3SFXB 3E34B 4KTRA 2OKXA 1JCRB 3T33A 3Q7FB 3WKGA 3RX5A 1UMPA 2BBCA 3E37B 3QRYA 2DRSA 3WIRA 3Q78B 1KS8A 1V5DA 3KQ4A 4Q2BA 1FPPB 2EAEA 1IS9A 1DCEB 3W7XA 1HZFA 1JS4A 3WKIA 3M7CA 3RJ3A 3KLSA 2FV1A 2DRQA 3OEDA 1NXCA 3M74A 3M76A 4ZH5A 3QFZA 3M73A 3QPFA 4GTQB 3QG0A 4D4AA 3H2WA 4GTOB 1N4QB 2A73B 1XWTA 3WKFA 5AGDA 3QT3A 3WIWA 2IEJB 2VN7A 1GAIA 1NI1B 3W7SA 2R2LB 2BB5A 3VXDA 1AYXA 2H6IB 3DSSB 3P5RA 3ACTA 2WY7A 5KKBA 3SAEA 4GTPB 1R76A 4KKJA 4ZRQA 3ANIA 3H7LA 1G87A 1W6JA 2V8JA 2H6GB 4Q88A 4D4CA 3Q75B 4WVBA 2JF4A 2ZBLA 4LNGB 1TNUB 3E30B 1TN6B 2VN4A 1GAHA 3E33B 1KZPB 3W7TA 1TN7B 3D5RA 3RX7A 1LTXB 1O6QA 1K72A 2DROA 3M75A 4QT9A 4V1SA 3DSXB 3S4CA 4AYQA 1FCEA 2CQTA 4FXGB 1RQ5A 1KKTA 1KSCA 3GLYA 3HXFB 3HXEB 2RI9A 1X9DA 4KKIA 1GLMA 4XUVA 1TN8B 2F6DA 3A3VA 3GT5A 3QT9A 3EZ8A 3KSQB 4AYRA 3QWTA 3P2CA 3DSVB 1QQFA 3M71A 2EACA 1LD8B 2Z07A 3W7UA 1SQCA 1LD7B 1LF9A 4BOKA 1FP3A 4YDEB 1JCSB 1SA4B 1DL2A 4D4BA 4L9PB 1FT2B 1O6HA 2PN5A 1V5CA 1FO3A 5CD2A 3QDEA 2H6FB 1G9GA 1TF4A 5GY3A 3RENA 4Z4JA 2CQSA 2H6HB 4AYOA 2FUZA 3M78A 1WU6A 3AFJA 2SQCA 4L6XA 3HXBB 3M77A 1G9JA 3SQCA 4FXKB 2V3PA 5FO9B 3TF4A 4M76A 1N4PB 3Q79B 4MBGB 1HCUA 3DSUB 3S4BA 2YIKA 3PZ4B 1ULVA 1GXMA 2P0VA 2JG0A 3H3KA 1KRFA 3HXDB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3ACT A;  3RRS A;  2GH4 A;  2EAD A;  4CJ0 A;  3X17 A;  1FAE A;  5KKB A;  4J5T A;  4WVA A;  1XW2 A;  5DGQ A;  3ANI A;  1FO2 A;  3H7L A;  2EAB A;  1G87 A;  1FMI A;  1H13 A;  1KWF A;  3W7W A;  1L1Y A;  3WIQ A;  3ANK A;  1KSD A;  3WKH A;  4Q88 A;  3EQA A;  4WVB A;  2JF4 A;  2ZBL A;  1F9O A;  1WU5 A;  2DRR A;  2FBA A;  4JJJ A;  1DOG A;  2VN4 A;  1GAH A;  3ANJ A;  3W7T A;  1V7X A;  3D3I A;  1AGM A;  5GW7 A;  3RX7 A;  3RSY A;  1XWQ A;  2JJB A;  2RGK A;  2RI8 A;  3S4D A;  4TXT A;  1K72 A;  2DRO A;  3ON6 A;  3K11 A;  3S4A A;  4Z4L A;  4WU0 A;  1NC5 A;  5MEH A;  2AHG A;  3S4C A;  4AYQ A;  4CJ1 A;  5CZL A;  1FCE A;  2CQT A;  2WYN A;  1RQ5 A;  4EL8 A;  1KKT A;  1KSC A;  1H12 A;  3ACS A;  2AHF A;  1GA2 A;  3GLY A;  2GZ6 A;  4ZG8 A;  2RI9 A;  1X9D A;  1UG9 A;  3E73 A;  4L0G A;  2FV0 A;  1F9D A;  1GLM A;  1H54 A;  4WVC A;  5CA3 A;  4DOE A;  1IA7 A;  3PMM A;  4XUV A;  1CEM A;  1L2A A;  4KTR A;  2OKX A;  3T33 A;  3VW5 A;  3WKG A;  2F6D A;  3RX5 A;  3A3V A;  3GT5 A;  3QT9 A;  1WU4 A;  3EZ8 A;  4CE7 A;  3QXF A;  1G6I A;  3QFY A;  4AYR A;  1CLC A;  3QWT A;  3QRY A;  3P2C A;  2DRS A;  3WIR A;  4DOD A;  2EAC A;  2Z07 A;  1KS8 A;  1V5D A;  3GZK A;  1FBW A;  3QSP A;  4Q2B A;  3W5N A;  3W7U A;  1KFG A;  2B4F A;  1LF9 A;  1LF6 A;  1FP3 A;  2EAE A;  1IS9 A;  1DL2 A;  3W7X A;  3W5M A;  2D8L A;  1JS4 A;  3WKI A;  1V7V A;  1V5C A;  1FO3 A;  2AFA A;  1UT9 A;  2FV1 A;  2XFG A;  5CD2 A;  2DRQ A;  3QDE A;  4TF4 A;  1NXC A;  2D5J A;  2A8Z A;  4ZH5 A;  5M7I A;  3QFZ A;  1G9G A;  1FBO A;  1TF4 A;  2ZZR A;  3QPF A;  5GY3 A;  4Z4J A;  3REN A;  3RX8 A;  3E6U A;  2CQS A;  3QG0 A;  4AYO A;  2FUZ A;  3WC3 A;  1WU6 A;  3AFJ A;  3H2W A;  4L6X A;  1G9J A;  1XWT A;  1H14 A;  5E2J A;  3QT3 A;  3WKF A;  2NVP A;  3WUX A;  1WZZ A;  1IA6 A;  4KTP A;  3TF4 A;  1KRE A;  4FUS A;  3WIW A;  4AYP A;  5DGR A;  2VN7 A;  1GAI A;  1HCU A;  1V7W A;  3W7S A;  3S4B A;  3CIH A;  2YIK A;  1VD5 A;  1ULV A;  3VXD A;  1AYX A;  2P0V A;  2JG0 A;  3H3K A;  5M7Y A;  3QXQ A;  1KRF A;  2QNO A; 
#chains in the Genus database with same CATH topology
 4GL3 A;  2GH4 A;  2G02 A;  4J5T A;  4LNV A;  1XW2 A;  2V3N A;  1FMI A;  2ZIR B;  2ONH A;  3WIQ A;  1QBQ B;  1S63 B;  3ANK A;  3EQA A;  1GXO A;  1H35 A;  4FNV A;  1WU5 A;  3SFY B;  1DOG A;  1LOH A;  1F1S A;  3ANJ A;  2I07 B;  5DHI A;  3D3I A;  1N20 A;  5IKA A;  4YCR A;  1N9A B;  2RGK A;  2RI8 A;  2WIN B;  1H3B A;  2F0Y B;  3K11 A;  3S4A A;  1N4S B;  5MEH A;  2AHG A;  2PMV A;  1H12 A;  3ACS A;  4C1S A;  1GA2 A;  1OJO A;  2GZ6 A;  5ILD A;  1RWF A;  1HMW A;  1UG9 A;  4L0G A;  3PZ3 B;  4WVC A;  4GTR B;  4BOJ A;  1IA7 A;  5C05 A;  3EU8 A;  1CEM A;  1L2A A;  1TNB B;  4YDO B;  3VSN A;  2E24 A;  1WU4 A;  4CE7 A;  1G6I A;  3Q7A B;  1J0N A;  3SDR A;  1C82 A;  3C72 B;  5ILH A;  3QSP A;  5IK9 A;  1KFG A;  2B4F A;  1LF6 A;  5JMD A;  1O1S B;  1F9G A;  2D8L A;  4GTS B;  2GOX A;  5IL8 A;  2XFG A;  3EU5 B;  2WY8 A;  4TF4 A;  3M72 A;  1FBO A;  3NFV A;  2B39 A;  3E6U A;  1OJM A;  2ZIS B;  1H36 A;  1H14 A;  5E2J A;  3SDV A;  2NVP A;  4OZW A;  3WUX A;  2G0D A;  1WZZ A;  1JCQ B;  3N0G A;  4KTP A;  3SDQ A;  4LIX A;  4FUS A;  2BED B;  1V7W A;  1VD5 A;  1KZO B;  1N1B A;  4OJZ A;  5M7Y A;  3QXQ A;  3DSW B;  2QNO A;  3OXU A;  5JPM B;  4CJ0 A;  2EAD A;  4MMH A;  1FAE A;  4WVA A;  5DGQ A;  1X1I A;  1KWF A;  1O6R A;  2XWJ B;  3W7W A;  3M7L A;  3DST B;  1KSD A;  1TNZ B;  1F9O A;  1FT1 B;  4JJJ A;  1CB8 A;  3E32 B;  1V7X A;  3RSY A;  5GW7 A;  1XWQ A;  3DRA B;  2JJB A;  4MU9 A;  3S4D A;  3ON6 A;  2BB6 A;  2BRV X;  3Q73 B;  4Z4L A;  4OK4 A;  1RW9 A;  4OK2 A;  1O79 A;  5CZL A;  2WYN A;  4EHM B;  2AHF A;  4ZG8 A;  1HXC A;  1SA5 B;  3E73 A;  1N95 B;  2E22 A;  2WII B;  4DOE A;  2X03 A;  3PMM A;  5IKH A;  5IL3 A;  4ZH1 A;  1N22 A;  3VW5 A;  1O1T B;  3M7B A;  1GXN A;  3DPY B;  1I8Q A;  3QXF A;  3QFY A;  1CLC A;  4V1R A;  1N23 A;  5JPN B;  4DOD A;  2WCO A;  1GHQ A;  1FBW A;  3GZK A;  3W5N A;  1NL4 B;  4ZRP A;  3PZ1 B;  4ONT A;  3W5M A;  1N94 B;  3CU7 A;  1V7V A;  3M7E A;  2ONG A;  5FO8 B;  1RWH A;  2AFA A;  1UT9 A;  1S64 B;  2D5J A;  2A8Z A;  5M7I A;  4FJQ A;  1N24 A;  5JMF A;  2ZZR A;  1X81 B;  3D5S A;  5DHK A;  3RX8 A;  3SDU A;  3WC3 A;  1D8D B;  3PZ2 B;  1RWG A;  2NOJ A;  1IA6 A;  1KRE A;  1W6K A;  2V8I A;  4AYP A;  5DGR A;  1H3A A;  5ILJ A;  3SDT A;  4D94 A;  3CIH A;  5GZK A;  5FOB B;  3KSL B;  2XQW A;  1O1R B;  3EUV B;  3RRS A;  3X17 A;  4GTM B;  1TNY B;  3PYB A;  2V8K A;  1FO2 A;  1TNO B;  2EAB A;  1HV6 A;  1H13 A;  1GSZ A;  3HXC B;  3K7X A;  1L1Y A;  3G4F A;  3M01 A;  4LNB B;  1W3Y A;  3WKH A;  1C3D A;  3PYA A;  2DRR A;  2FBA A;  1RWA A;  1RWC A;  5FO7 B;  1H3C A;  1N21 A;  1QSJ A;  1MZC B;  1H37 A;  1AGM A;  1H39 A;  1N4R B;  3A0O A;  5EAT A;  3P5P A;  4TXT A;  4WU0 A;  5EAU A;  1NC5 A;  4D4D A;  4GTT B;  4CJ1 A;  4EL8 A;  3M00 A;  1O5M B;  1D8E B;  5EAS A;  3S9V A;  4F13 A;  2FV0 A;  2XWB B;  1F9D A;  3G6J B;  1H54 A;  5CA3 A;  4RNQ A;  1N7N A;  4GTV B;  3SFX B;  3E34 B;  4KTR A;  2OKX A;  1JCR B;  3T33 A;  3Q7F B;  3WKG A;  3RX5 A;  4DI5 A;  5ILK A;  2FUQ A;  1UMP A;  2BBC A;  3E37 B;  3QRY A;  2DRS A;  3WIR A;  3Q78 B;  3N0F A;  1KS8 A;  1V5D A;  3KQ4 A;  4Q2B A;  4GAX A;  1FPP B;  5ILI A;  2EAE A;  1IS9 A;  1DCE B;  3W7X A;  1HN0 A;  1HZF A;  1JS4 A;  3WKI A;  3M7C A;  3RJ3 A;  3KLS A;  2FV1 A;  2DRQ A;  3OED A;  1NXC A;  3M74 A;  3M76 A;  4ZH5 A;  2WDA A;  3QFZ A;  3LZ9 A;  3M73 A;  1LXM A;  3QPF A;  4GTQ B;  1LXK A;  3QG0 A;  4D4A A;  3G4D A;  3H2W A;  4GTO B;  1N4Q B;  2A73 B;  1XWT A;  3WKF A;  5AGD A;  3QT3 A;  3NNB A;  1OJP A;  1N7O A;  1N7Q A;  3WIW A;  2IEJ B;  2VN7 A;  1GAI A;  1NI1 B;  3W7S A;  2R2L B;  2BB5 A;  3VXD A;  1AYX A;  2H6I B;  3DSS B;  3P5R A;  5ILY A;  3ACT A;  4F10 A;  2WY7 A;  5KKB A;  3SAE A;  4GTP B;  1OJN A;  1R76 A;  4KKJ A;  4ZRQ A;  3ANI A;  3H7L A;  1G87 A;  1N1Z A;  1W6J A;  2V8J A;  1HXG A;  2H6G B;  4Q88 A;  2Q1F A;  4D4C A;  3Q75 B;  4WVB A;  2JF4 A;  2ZBL A;  3VSM A;  4LNG B;  1TNU B;  3E30 B;  1TN6 B;  2VN4 A;  2BRP A;  1GAH A;  3E33 B;  1KZP B;  3W7T A;  1TN7 B;  3D5R A;  3RX7 A;  1LTX B;  1HM3 A;  1O6Q A;  2FUT A;  1K72 A;  2DRO A;  3M75 A;  4QT9 A;  4V1S A;  3DSX B;  3S4C A;  4AYQ A;  1FCE A;  2CQT A;  4FXG B;  1RQ5 A;  1KKT A;  1KSC A;  3GLY A;  3HXF B;  3HXE B;  2RI9 A;  1X9D A;  5IK0 A;  4KKI A;  1GLM A;  4OZV A;  4NEI A;  4XUV A;  4E1Y A;  5IM1 A;  1TN8 B;  2F6D A;  3M02 A;  3A3V A;  5IK6 A;  3GT5 A;  3QT9 A;  2J5C A;  3AFL A;  3EZ8 A;  3KSQ B;  4AYR A;  3E7J A;  3QWT A;  3P2C A;  3DSV B;  1QQF A;  3M71 A;  2EAC A;  1LD8 B;  2Z07 A;  1J0M A;  3W7U A;  1EGU A;  1SQC A;  1LD7 B;  1LF9 A;  4BOK A;  1FP3 A;  5ILZ A;  4YDE B;  1JCS B;  1SA4 B;  1DL2 A;  4D4B A;  4L9P B;  1FT2 B;  1O6H A;  2PN5 A;  1V5C A;  1FO3 A;  5CD2 A;  4MMI A;  3QDE A;  3E80 A;  2H6F B;  1G9G A;  1HMU A;  1N7R A;  1TF4 A;  1QAZ A;  5GY3 A;  3REN A;  4Z4J A;  1HM2 A;  2CQS A;  2H6H B;  4AYO A;  2FUZ A;  3M78 A;  1WU6 A;  3AFJ A;  2SQC A;  4L6X A;  2BRW A;  3HXB B;  1G9J A;  3M77 A;  3SQC A;  4FXK B;  2V3P A;  5FO9 B;  3TF4 A;  4M76 A;  1N4P B;  1HXA A;  3Q79 B;  4MBG B;  1HCU A;  3DSU B;  1X1J A;  3S4B A;  1X1H A;  2YIK A;  1N7P A;  3PZ4 B;  1ULV A;  1GXM A;  2P0V A;  2JG0 A;  3H3K A;  1KRF A;  1HX9 A;  3HXD B; 
#chains in the Genus database with same CATH homology
 4GL3 A;  2GH4 A;  2G02 A;  4J5T A;  4LNV A;  1XW2 A;  2V3N A;  1FMI A;  2ZIR B;  3WIQ A;  1QBQ B;  1S63 B;  3ANK A;  3EQA A;  1GXO A;  1H35 A;  1WU5 A;  3SFY B;  1DOG A;  3ANJ A;  2I07 B;  3D3I A;  4YCR A;  1N9A B;  2RGK A;  2RI8 A;  2WIN B;  1H3B A;  2F0Y B;  3K11 A;  3S4A A;  1N4S B;  5MEH A;  2AHG A;  2PMV A;  1H12 A;  3ACS A;  4C1S A;  1GA2 A;  2GZ6 A;  1UG9 A;  4L0G A;  3PZ3 B;  4WVC A;  4GTR B;  4BOJ A;  1IA7 A;  3EU8 A;  1CEM A;  1L2A A;  1TNB B;  4YDO B;  1WU4 A;  4CE7 A;  1G6I A;  3Q7A B;  3SDR A;  3C72 B;  3QSP A;  1KFG A;  2B4F A;  1LF6 A;  1O1S B;  2D8L A;  4GTS B;  2GOX A;  2XFG A;  3EU5 B;  2WY8 A;  4TF4 A;  3M72 A;  1FBO A;  2B39 A;  3E6U A;  2ZIS B;  1H36 A;  1H14 A;  5E2J A;  3SDV A;  2NVP A;  3WUX A;  2G0D A;  1WZZ A;  1JCQ B;  4KTP A;  3SDQ A;  4LIX A;  4FUS A;  2BED B;  1V7W A;  1VD5 A;  1KZO B;  5M7Y A;  3QXQ A;  3OXU A;  3DSW B;  2QNO A;  5JPM B;  4CJ0 A;  2EAD A;  1FAE A;  4WVA A;  5DGQ A;  1KWF A;  1O6R A;  2XWJ B;  3W7W A;  3M7L A;  3DST B;  1KSD A;  1TNZ B;  1F9O A;  1FT1 B;  4JJJ A;  3E32 B;  1V7X A;  3RSY A;  5GW7 A;  1XWQ A;  3DRA B;  2JJB A;  4MU9 A;  3S4D A;  3ON6 A;  2BB6 A;  3Q73 B;  4Z4L A;  1O79 A;  5CZL A;  2WYN A;  4EHM B;  2AHF A;  4ZG8 A;  1SA5 B;  3E73 A;  1N95 B;  2WII B;  4DOE A;  3PMM A;  4ZH1 A;  3VW5 A;  1O1T B;  3M7B A;  1GXN A;  3DPY B;  3QXF A;  3QFY A;  1CLC A;  4V1R A;  5JPN B;  4DOD A;  1GHQ A;  1FBW A;  3GZK A;  3W5N A;  1NL4 B;  4ZRP A;  3PZ1 B;  4ONT A;  3W5M A;  1N94 B;  3CU7 A;  1V7V A;  3M7E A;  5FO8 B;  2AFA A;  1UT9 A;  1S64 B;  2D5J A;  2A8Z A;  5M7I A;  2ZZR A;  1X81 B;  3D5S A;  3RX8 A;  3SDU A;  3WC3 A;  1D8D B;  3PZ2 B;  2NOJ A;  1IA6 A;  1KRE A;  1W6K A;  2V8I A;  4AYP A;  5DGR A;  1H3A A;  3SDT A;  4D94 A;  3CIH A;  5GZK A;  5FOB B;  3KSL B;  2XQW A;  1O1R B;  3EUV B;  3RRS A;  3X17 A;  4GTM B;  1TNY B;  3PYB A;  2V8K A;  1FO2 A;  1TNO B;  2EAB A;  3HXC B;  1H13 A;  1GSZ A;  3K7X A;  1L1Y A;  4LNB B;  3WKH A;  1C3D A;  3PYA A;  2DRR A;  2FBA A;  5FO7 B;  1H3C A;  1QSJ A;  1MZC B;  1H37 A;  1AGM A;  1H39 A;  1N4R B;  3P5P A;  4TXT A;  4WU0 A;  1NC5 A;  4D4D A;  4GTT B;  4CJ1 A;  4EL8 A;  1O5M B;  1D8E B;  3S9V A;  2FV0 A;  2XWB B;  1F9D A;  3G6J B;  1H54 A;  5CA3 A;  4GTV B;  3SFX B;  3E34 B;  4KTR A;  2OKX A;  1JCR B;  3T33 A;  3Q7F B;  3WKG A;  3RX5 A;  1UMP A;  2BBC A;  3E37 B;  3QRY A;  2DRS A;  3WIR A;  3Q78 B;  1KS8 A;  1V5D A;  3KQ4 A;  4Q2B A;  1FPP B;  2EAE A;  1IS9 A;  1DCE B;  3W7X A;  1HZF A;  1JS4 A;  3WKI A;  3M7C A;  3RJ3 A;  3KLS A;  2FV1 A;  2DRQ A;  3OED A;  1NXC A;  3M74 A;  3M76 A;  4ZH5 A;  3QFZ A;  3M73 A;  3QPF A;  4GTQ B;  3QG0 A;  4D4A A;  3H2W A;  4GTO B;  1N4Q B;  2A73 B;  1XWT A;  3WKF A;  5AGD A;  3QT3 A;  3WIW A;  2IEJ B;  2VN7 A;  1GAI A;  1NI1 B;  3W7S A;  2R2L B;  2BB5 A;  3VXD A;  1AYX A;  2H6I B;  3DSS B;  3P5R A;  3ACT A;  2WY7 A;  5KKB A;  3SAE A;  4GTP B;  1R76 A;  4KKJ A;  4ZRQ A;  3ANI A;  3H7L A;  1G87 A;  1W6J A;  2V8J A;  2H6G B;  4Q88 A;  4D4C A;  3Q75 B;  4WVB A;  2JF4 A;  2ZBL A;  4LNG B;  1TNU B;  3E30 B;  1TN6 B;  2VN4 A;  1GAH A;  3E33 B;  1KZP B;  3W7T A;  1TN7 B;  3D5R A;  3RX7 A;  1LTX B;  1O6Q A;  1K72 A;  2DRO A;  3M75 A;  4QT9 A;  4V1S A;  3DSX B;  3S4C A;  4AYQ A;  1FCE A;  2CQT A;  4FXG B;  1RQ5 A;  1KKT A;  1KSC A;  3GLY A;  3HXF B;  3HXE B;  2RI9 A;  1X9D A;  4KKI A;  1GLM A;  4XUV A;  1TN8 B;  2F6D A;  3A3V A;  3GT5 A;  3QT9 A;  3EZ8 A;  3KSQ B;  4AYR A;  3QWT A;  3P2C A;  3DSV B;  1QQF A;  3M71 A;  2EAC A;  1LD8 B;  2Z07 A;  3W7U A;  1SQC A;  1LD7 B;  1LF9 A;  4BOK A;  1FP3 A;  4YDE B;  1JCS B;  1SA4 B;  1DL2 A;  4D4B A;  4L9P B;  1FT2 B;  1O6H A;  2PN5 A;  1V5C A;  1FO3 A;  5CD2 A;  3QDE A;  2H6F B;  1G9G A;  1TF4 A;  5GY3 A;  3REN A;  4Z4J A;  2CQS A;  2H6H B;  4AYO A;  2FUZ A;  3M78 A;  1WU6 A;  3AFJ A;  2SQC A;  4L6X A;  3HXB B;  3M77 A;  1G9J A;  3SQC A;  4FXK B;  2V3P A;  5FO9 B;  3TF4 A;  4M76 A;  1N4P B;  3Q79 B;  4MBG B;  1HCU A;  3DSU B;  3S4B A;  2YIK A;  3PZ4 B;  1ULV A;  1GXM A;  2P0V A;  2JG0 A;  3H3K A;  1KRF A;  3HXD B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...