1IA6A

Crystal structure of the cellulase cel9m of c. cellulolyticum
Total Genus 164
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
164
sequence length
431
structure length
423
Chain Sequence
AGTHDYSTALKDSIIFFDANKCGPQAGENNVFDWRGACHTTDGSDVGVDLTGGYHDAGDHVKFGLPQGYSAAILGWSLYEFKESFDATGNTTKMLQQLKYFTDYFLKSHPNSTTFYYQVGEGNADHTYWGAPEEQTGQRPSLYKADPSSPASDILSETSAALTLMYLNYKNIDSAYATKCLNAAKELYAMGKANQGVGNGQSFYQATSFGDDLAWAATWLYTATNDSTYITDAEQFITLNKMQDKWTMCWDDMYVPAALRLAQITGKQIYKDAIEFNFNYWKTQVTTTPGGLKWLSNWGVLRYAAAESMVMLVYCKQNPDQSLLDLAKKQVDYILGDNPANMSYIIGYGSNWCIHPHHRAANGYTYADNAKPAKHLLTGALVGGPDQNDKFLDDANQYQYTEVALDYNAGLVGVLAGAIKFFG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CELLULASE CEL9M
publication title Crystal structure of the cellulase Cel9M enlightens structure/function relationships of the variable catalytic modules in glycoside hydrolases.
pubmed doi rcsb
source organism Clostridium cellulolyticum
molecule tags Hydrolase
total genus 164
structure length 423
sequence length 431
ec nomenclature ec 3.2.1.4: Cellulase.
pdb deposition date 2001-03-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00759 Glyco_hydro_9 Glycosyl hydrolase family 9
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.50.10.10 Mainly Alpha Alpha/alpha barrel Glycosyltransferase Glycosyltransferase 1ia6A00
1KS8A 4AYOA 2DRSA 3EZ8A 1H13A 3P2CA 1FO3A 3QWTA 1KKTA 2AHFA 3GZKA 3QFYA 1GA2A 1V5DA 3W7XA 1WZZA 5GW7A 3QG0A 1DL2A 1V5CA 3QXQA 3D3IA 1H12A 3TF4A 3ON6A 1KFGA 1K72A 1DOGA 2ZZRA 2D5JA 3RRSA 3W7TA 3WUXA 1WU6A 1KRFA 3W7WA 1UT9A 4AYQA 2XFGA 4JJJA 2P0VA 3ANKA 1FAEA 3E6UA 4EL8A 4KTPA 4TF4A 1G87A 3W5NA 1CEMA 1HCUA 4WVAA 1G6IA 3RX7A 3WKIA 1G9JA 5CZLA 3WKFA 4AYPA 1H54A 4CE7A 1XWQA 1CLCA 2DRRA 1GAIA 4KTRA 1FO2A 1GLMA 4AYRA 3QXFA 1WU4A 4Z4JA 5E2JA 3RSYA 2RI8A 3RX5A 4XUVA 1H14A 2DRQA 5MEHA 2VN4A 1AYXA 3EQAA 3H7LA 1FCEA 3QFZA 4Q2BA 1LF6A 2A8ZA 2FBAA 1IA7A 5DGQA 4ZH5A 1V7VA 1IS9A 1G9GA 3ACTA 3WIQA 3QRYA 3RENA 1F9OA 3W7UA 3QT9A 3GLYA 2DROA 3K11A 5KKBA 3VW5A 3QDEA 3PMMA 1KREA 3RX8A 2GZ6A 1VD5A 4DOEA 2VN7A 4Q88A 2FV0A 3CIHA 3W5MA 1LF9A 1XW2A 3T33A 2FUZA 2YIKA 2FV1A 1GAHA 2AFAA 3WKHA 1F9DA 4ZG8A 3S4DA 1NXCA 3VXDA 3W7SA 3QSPA 2JG0A 3QT3A 1KSCA 5GY3A 3GT5A 4Z4LA 1KSDA 4DODA 3S4CA 5CA3A 1RQ5A 3E73A 2ZBLA 5M7IA 3ANJA 3QPFA 3S4BA 5CD2A 4L0GA 1IA6A 2JF4A 4CJ0A 2EAEA 3A3VA 3ANIA 1V7XA 3WKGA 2AHGA 1TF4A 2F6DA 2EABA 1FMIA 2EACA 1ULVA 2QNOA 1V7WA 2D8LA 3WIWA 1L1YA 3H2WA 1L2AA 2RGKA 4WVCA 3WC3A 2CQSA 2Z07A 4TXTA 3WIRA 3H3KA 1X9DA 2NVPA 4L6XA 1FP3A 3S4AA 5DGRA 1AGMA 1KWFA 4CJ1A 3AFJA 1JS4A 1NC5A 1FBOA 1FBWA 5M7YA 1WU5A 4WVBA 3X17A 2RI9A 2GH4A 2OKXA 3ACSA 1UG9A 2B4FA 4J5TA 1XWTA 4FUSA 2EADA 2JJBA 2CQTA 4WU0A 2WYNA
chains in the Genus database with same CATH superfamily
4GTQB 4AYOA 2I07B 3M73A 1N4SB 3PYAA 3HXFB 3GZKA 2E24A 1EGUA 2WCOA 5IKAA 1W6JA 3Q78B 1N7NA 1O5MB 1N1BA 3QG0A 3QXQA 1MZCB 1KFGA 1RWFA 4GTOB 2ZZRA 2D5JA 3RRSA 4GTRB 3M71A 3W7WA 4JJJA 1HXAA 2P0VA 2H6GB 1G87A 2F0YB 2BEDB 1O1RB 2ZIRB 3Q75B 4AYPA 3D5SA 4CE7A 1R76A 2H6FB 2E22A 1GAIA 3CU7A 1FO2A 2A73B 5JPMB 3RSYA 1O6QA 1FT2B 2RI8A 2V8IA 1KZOB 4V1RA 4BOJA 2FUQA 1N7RA 3DSXB 3QFZA 4M76A 1LF6A 1RW9A 4FXKB 1NL4B 1H36A 2A8ZA 1IA7A 4F10A 1V7VA 1IS9A 3WIQA 3QRYA 4FXGB 1HZFA 1RWAA 1KREA 3AFLA 1LF9A 4E1YA 2YIKA 5IL8A 3WKHA 5EASA 4OK2A 1NXCA 3E32B 3QSPA 1D8EB 1KSCA 3N0GA 5GY3A 4DODA 1X1HA 4FNVA 2V8KA 3E7JA 1OJMA 3EU8A 2J5CA 3SFXB 1O6RA 1TF4A 1X1IA 1FMIA 3E80A 1ULVA 2D8LA 3WIWA 1H35A 2V3NA 4WVCA 3Q79B 3H3KA 1OJNA 1SA4B 3E30B 3SDRA 1H3BA 3SAEA 3AFJA 3SDVA 1NC5A 5C05A 5M7YA 1SA5B 3X17A 1HXCA 5IK9A 1UG9A 4F13A 3M78A 1OJOA 1XWTA 1NI1B 2EADA 3S9VA 2CQTA 3E34B 1S63B 3P5PA 2H6HB 3QWTA 1KKTA 3M00A 5FO9B 5FO8B 1WZZA 4EHMB 1N9AB 3D3IA 1H12A 3ON6A 5IKHA 4ZRPA 4ZH1A 3Q7FB 2XWBB 1DOGA 5ILJA 3G6JB 1KRFA 1N95B 3DSWB 4AYQA 1UMPA 2R2LB 3EUVB 1QSJA 1CEMA 1HXGA 4WVAA 1J0MA 2NOJA 2ONHA 3WKFA 3HXCB 4OK4A 1XWQA 3SQCA 2WY8A 2DRQA 4RNQA 5MEHA 1HM3A 1CB8A 3H7LA 1FCEA 4Q2BA 3KSQB 1H39A 4OJZA 3RENA 1F9OA 1RWCA 5DHKA 1TN6B 3QT9A 1FPPB 3PMMA 3RX8A 1VD5A 4DOEA 3W5MA 2G02A 3CIHA 4FJQA 1QAZA 3M02A 3T33A 1GAHA 2AFAA 5ILDA 3RJ3A 1JCRB 3M76A 3A0OA 2ONGA 1C3DA 3E73A 1OJPA 5EAUA 3PZ1B 5JPNB 4ZRQA 5CD2A 1N94B 2JF4A 2PN5A 4KKJA 4CJ0A 3VSMA 1GXNA 3NNBA 2EACA 4D94A 2QNOA 5JMDA 1HX9A 4QT9A 2CQSA 2Z07A 5IK0A 1X9DA 2NVPA 3K7XA 3S4AA 2ZISB 2WY7A 4MMHA 1F9GA 2BBCA 4CJ1A 4GTMB 1N24A 3P5RA 1HV6A 1JS4A 4LNGB 1LXKA 1WU5A 4WVBA 1W3YA 2GH4A 2OKXA 5FO7B 2B4FA 1GXOA 1TN8B 4DI5A 2WYNA 3OXUA 1KS8A 5ILHA 2DRSA 1H13A 5DHIA 3P2CA 4D4BA 5ILYA 1HMWA 3DSVB 2AHFA 1N4PB 3QFYA 1HMUA 3N0FA 1DL2A 1V5CA 5ILIA 3PYBA 4GTTB 3TF4A 1FT1B 3M74A 1N1ZA 4GAXA 1KZPB 3W7TA 3WUXA 1WU6A 4D4DA 1UT9A 3E33B 4NEIA 3M7CA 2V3PA 1FAEA 3E6UA 4TF4A 4MMIA 1N20A 3PZ2B 1O79A 1HCUA 3G4FA 2BRPA 2BB5A 2X03A 1LOHA 3WKIA 1G9JA 2Q1FA 5CZLA 1H54A 1H3CA 3E37B 3M01A 4L9PB 4BOKA 1JCSB 3QXFA 1WU4A 1HN0A 4MBGB 4Z4JA 5E2JA 4KKIA 3EQAA 1AYXA 1X1JA 2PMVA 2FBAA 5DGQA 3KSLB 2FUTA 3ACTA 4GTPB 5EATA 4YDOB 3C72B 3W7UA 3D5RA 1W6KA 2XQWA 3VW5A 3QDEA 3M7EA 1LD8B 2GZ6A 2VN7A 1XW2A 3Q7AB 3HXEB 2FV1A 1F9DA 4ZG8A 3S4DA 3VXDA 3W7SA 2JG0A 3QT3A 4Z4LA 5CA3A 1KSDA 1RQ5A 3LZ9A 3ANJA 4GTVB 3QPFA 2B39A 1O1TB 4L0GA 1IA6A 2EAEA 2WINB 3DSSB 1C82A 1LTXB 2WIIB 1QBQB 1HM2A 1V7WA 1L2AA 5GZKA 1H37A 4TXTA 1RWHA 4L6XA 2IEJB 4YDEB 1AGMA 2BB6A 1TNUB 1I8QA 3KLSA 1LXMA 1FBWA 1GXMA 3HXDB 1GSZA 2H6IB 3OEDA 4YCRA 4FUSA 4WU0A 3EZ8A 1FO3A 3SDUA 1GA2A 1V5DA 3W7XA 3DPYB 3M7LA 5GW7A 1J0NA 1N21A 4D4AA 2WDAA 1DCEB 1K72A 4C1SA 2G0DA 3DSTB 1N4RB 4LNBB 2BRVX 3M72A 3EU5B 2XFGA 3DSUB 3ANKA 4EL8A 4KTPA 1GHQA 1JCQB 5JMFA 5AGDA 4OZWA 3W5NA 4LNVA 4ONTA 2GOXA 1G6IA 3RX7A 5FOBB 3KQ4A 1CLCA 2DRRA 4MU9A 4KTRA 1GLMA 5IK6A 3Q73B 4AYRA 1S64B 1N7PA 1TNBB 3RX5A 4XUVA 1H14A 1D8DB 1QQFA 2VN4A 3M75A 5ILZA 1N23A 3NFVA 5IM1A 4ZH5A 1G9GA 3VSNA 3GLYA 2DROA 3K11A 5KKBA 1N22A 3M7BA 4OZVA 4Q88A 2FV0A 5ILKA 2FUZA 4LIXA 1X81B 1N7QA 3GT5A 4V1SA 3S4CA 1SQCA 4D4CA 2ZBLA 1TNYB 3SDQA 5M7IA 1TNZB 5IL3A 3S4BA 1N7OA 1LD7B 3A3VA 3ANIA 1V7XA 3WKGA 2AHGA 2F6DA 2EABA 1O6HA 3PZ4B 3G4DA 1L1YA 3H2WA 3WC3A 2RGKA 2BRWA 1O1SB 3WIRA 1F1SA 3HXBB 1FP3A 1H3AA 5DGRA 1KWFA 1TNOB 3DRAB 3SDTA 1TN7B 4GTSB 3SFYB 1RWGA 1FBOA 2XWJB 2RI9A 3PZ3B 3ACSA 2SQCA 4J5TA 2V8JA 1N4QB 2JJBA 3M77A 4GL3A
chains in the Genus database with same CATH topology
4GTQB 4AYOA 2I07B 3M73A 1N4SB 3PYAA 3HXFB 3GZKA 1W6JA 3Q78B 1O5MB 3QG0A 3QXQA 1MZCB 1KFGA 4GTOB 2ZZRA 2D5JA 3RRSA 4GTRB 3M71A 3W7WA 4JJJA 2P0VA 2H6GB 1G87A 2F0YB 2BEDB 1O1RB 2ZIRB 3Q75B 4AYPA 3D5SA 4CE7A 1R76A 2H6FB 1GAIA 3CU7A 1FO2A 2A73B 5JPMB 3RSYA 1O6QA 1FT2B 2RI8A 2V8IA 1KZOB 4V1RA 4BOJA 3QFZA 3DSXB 4M76A 1LF6A 4FXKB 1NL4B 1H36A 2A8ZA 1IA7A 1V7VA 1IS9A 3WIQA 3QRYA 4FXGB 1HZFA 1KREA 1LF9A 2YIKA 3WKHA 1NXCA 3E32B 3QSPA 1D8EB 1KSCA 5GY3A 4DODA 2V8KA 3EU8A 3SFXB 1O6RA 1TF4A 1FMIA 1ULVA 2D8LA 3WIWA 1H35A 2V3NA 4WVCA 3Q79B 3H3KA 1SA4B 3E30B 3SDRA 1H3BA 3SAEA 3AFJA 3SDVA 1NC5A 5M7YA 1SA5B 3X17A 1UG9A 3M78A 1XWTA 1NI1B 2EADA 3S9VA 2CQTA 3E34B 1S63B 3P5PA 2H6HB 3QWTA 1KKTA 5FO9B 5FO8B 1WZZA 4EHMB 1N9AB 3D3IA 1H12A 3ON6A 4ZRPA 4ZH1A 3Q7FB 2XWBB 1DOGA 3G6JB 1KRFA 1N95B 3DSWB 4AYQA 1UMPA 2R2LB 3EUVB 1QSJA 1CEMA 4WVAA 2NOJA 3WKFA 3HXCB 1XWQA 3SQCA 2WY8A 2DRQA 5MEHA 3H7LA 1FCEA 4Q2BA 3KSQB 1H39A 3RENA 1F9OA 1TN6B 3QT9A 3PMMA 1FPPB 3RX8A 1VD5A 4DOEA 3W5MA 2G02A 3CIHA 3T33A 1GAHA 2AFAA 3RJ3A 1JCRB 3M76A 1C3DA 3E73A 3PZ1B 5JPNB 4ZRQA 5CD2A 1N94B 2JF4A 2PN5A 4KKJA 4CJ0A 1GXNA 2EACA 4D94A 2QNOA 4QT9A 2CQSA 2Z07A 1X9DA 2NVPA 3K7XA 3S4AA 2ZISB 2WY7A 2BBCA 4CJ1A 4GTMB 3P5RA 1JS4A 4LNGB 1WU5A 4WVBA 2GH4A 2OKXA 5FO7B 2B4FA 1GXOA 1TN8B 2WYNA 3OXUA 1KS8A 2DRSA 1H13A 4D4BA 3P2CA 3DSVB 2AHFA 1N4PB 3QFYA 1DL2A 1V5CA 3PYBA 4GTTB 3TF4A 1FT1B 3M74A 1KZPB 3W7TA 3WUXA 1WU6A 4D4DA 1UT9A 3E33B 3M7CA 2V3PA 1FAEA 3E6UA 4TF4A 3PZ2B 1O79A 1HCUA 2BB5A 3WKIA 1G9JA 5CZLA 1H54A 1H3CA 3E37B 4L9PB 4BOKA 1JCSB 3QXFA 1WU4A 4MBGB 4Z4JA 5E2JA 4KKIA 2PMVA 1AYXA 3EQAA 2FBAA 5DGQA 3KSLB 3ACTA 4GTPB 4YDOB 3C72B 3W7UA 3D5RA 1W6KA 2XQWA 3VW5A 3QDEA 3M7EA 1LD8B 2GZ6A 2VN7A 1XW2A 3Q7AB 3HXEB 2FV1A 1F9DA 4ZG8A 3S4DA 3VXDA 3W7SA 2JG0A 3QT3A 4Z4LA 5CA3A 1KSDA 1RQ5A 3ANJA 4GTVB 3QPFA 2B39A 1O1TB 4L0GA 1IA6A 2EAEA 2WINB 3DSSB 1LTXB 2WIIB 1QBQB 1V7WA 1L2AA 5GZKA 1H37A 4TXTA 4L6XA 2IEJB 4YDEB 1AGMA 2BB6A 1TNUB 3KLSA 1FBWA 1GXMA 3HXDB 1GSZA 2H6IB 3OEDA 4YCRA 4FUSA 4WU0A 3EZ8A 1FO3A 3SDUA 1GA2A 1V5DA 3W7XA 3DPYB 3M7LA 5GW7A 4D4AA 1DCEB 1K72A 4C1SA 2G0DA 3DSTB 1N4RB 4LNBB 3M72A 3EU5B 2XFGA 3DSUB 3ANKA 4EL8A 4KTPA 1GHQA 1JCQB 5AGDA 3W5NA 4LNVA 4ONTA 2GOXA 1G6IA 3RX7A 5FOBB 3KQ4A 1CLCA 2DRRA 4MU9A 4KTRA 1GLMA 3Q73B 4AYRA 1S64B 1TNBB 3RX5A 4XUVA 1H14A 1D8DB 1QQFA 2VN4A 3M75A 4ZH5A 1G9GA 3GLYA 2DROA 3K11A 5KKBA 3M7BA 4Q88A 2FV0A 2FUZA 4LIXA 1X81B 3GT5A 4V1SA 3S4CA 1SQCA 4D4CA 2ZBLA 1TNYB 3SDQA 5M7IA 1TNZB 3S4BA 1LD7B 3A3VA 3ANIA 1V7XA 3WKGA 2AHGA 2F6DA 2EABA 1O6HA 3PZ4B 1L1YA 3H2WA 3WC3A 2RGKA 1O1SB 3WIRA 3HXBB 1FP3A 1H3AA 5DGRA 1KWFA 1TNOB 3DRAB 3SDTA 1TN7B 4GTSB 3SFYB 1FBOA 2XWJB 2RI9A 3PZ3B 3ACSA 2SQCA 4J5TA 2V8JA 1N4QB 2JJBA 3M77A 4GL3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1KS8 A;  4AYO A;  2DRS A;  3EZ8 A;  1H13 A;  3P2C A;  1FO3 A;  3QWT A;  1KKT A;  2AHF A;  3GZK A;  3QFY A;  1GA2 A;  1V5D A;  3W7X A;  1WZZ A;  5GW7 A;  3QG0 A;  1DL2 A;  1V5C A;  3QXQ A;  3D3I A;  1H12 A;  3TF4 A;  3ON6 A;  1KFG A;  1K72 A;  1DOG A;  2ZZR A;  2D5J A;  3RRS A;  3W7T A;  3WUX A;  1WU6 A;  1KRF A;  3W7W A;  1UT9 A;  4AYQ A;  2XFG A;  4JJJ A;  2P0V A;  3ANK A;  1FAE A;  3E6U A;  4EL8 A;  4KTP A;  4TF4 A;  1G87 A;  3W5N A;  1CEM A;  1HCU A;  4WVA A;  1G6I A;  3RX7 A;  3WKI A;  1G9J A;  5CZL A;  3WKF A;  4AYP A;  1H54 A;  4CE7 A;  1XWQ A;  1CLC A;  2DRR A;  1GAI A;  4KTR A;  1FO2 A;  1GLM A;  4AYR A;  3QXF A;  1WU4 A;  4Z4J A;  5E2J A;  3RSY A;  2RI8 A;  3RX5 A;  4XUV A;  1H14 A;  2DRQ A;  5MEH A;  2VN4 A;  1AYX A;  3EQA A;  3H7L A;  1FCE A;  3QFZ A;  4Q2B A;  1LF6 A;  2A8Z A;  2FBA A;  1IA7 A;  5DGQ A;  4ZH5 A;  1V7V A;  1IS9 A;  1G9G A;  3ACT A;  3WIQ A;  3QRY A;  3REN A;  1F9O A;  3W7U A;  3QT9 A;  3GLY A;  2DRO A;  3K11 A;  5KKB A;  3VW5 A;  3QDE A;  3PMM A;  1KRE A;  3RX8 A;  2GZ6 A;  1VD5 A;  4DOE A;  2VN7 A;  4Q88 A;  2FV0 A;  3CIH A;  3W5M A;  1LF9 A;  1XW2 A;  3T33 A;  2FUZ A;  2YIK A;  2FV1 A;  1GAH A;  2AFA A;  3WKH A;  1F9D A;  4ZG8 A;  3S4D A;  1NXC A;  3VXD A;  3W7S A;  3QSP A;  2JG0 A;  3QT3 A;  1KSC A;  5GY3 A;  3GT5 A;  4Z4L A;  1KSD A;  4DOD A;  3S4C A;  5CA3 A;  1RQ5 A;  3E73 A;  2ZBL A;  5M7I A;  3ANJ A;  3QPF A;  3S4B A;  5CD2 A;  4L0G A;  1IA6 A;  2JF4 A;  4CJ0 A;  2EAE A;  3A3V A;  3ANI A;  1V7X A;  3WKG A;  2AHG A;  1TF4 A;  2F6D A;  2EAB A;  1FMI A;  2EAC A;  1ULV A;  2QNO A;  1V7W A;  2D8L A;  3WIW A;  1L1Y A;  3H2W A;  1L2A A;  2RGK A;  4WVC A;  3WC3 A;  2CQS A;  2Z07 A;  4TXT A;  3WIR A;  3H3K A;  1X9D A;  2NVP A;  4L6X A;  1FP3 A;  3S4A A;  5DGR A;  1AGM A;  1KWF A;  4CJ1 A;  3AFJ A;  1JS4 A;  1NC5 A;  1FBO A;  1FBW A;  5M7Y A;  1WU5 A;  4WVB A;  3X17 A;  2RI9 A;  2GH4 A;  2OKX A;  3ACS A;  1UG9 A;  2B4F A;  4J5T A;  1XWT A;  4FUS A;  2EAD A;  2JJB A;  2CQT A;  4WU0 A;  2WYN A; 
#chains in the Genus database with same CATH topology
 4GTQ B;  4AYO A;  2I07 B;  3M73 A;  1N4S B;  3PYA A;  3HXF B;  3GZK A;  2E24 A;  1EGU A;  2WCO A;  5IKA A;  1W6J A;  3Q78 B;  1N7N A;  1O5M B;  1N1B A;  3QG0 A;  3QXQ A;  1MZC B;  1KFG A;  1RWF A;  4GTO B;  2ZZR A;  2D5J A;  3RRS A;  4GTR B;  3M71 A;  3W7W A;  4JJJ A;  1HXA A;  2P0V A;  2H6G B;  1G87 A;  2F0Y B;  2BED B;  1O1R B;  2ZIR B;  3Q75 B;  4AYP A;  3D5S A;  4CE7 A;  1R76 A;  2H6F B;  2E22 A;  1GAI A;  3CU7 A;  1FO2 A;  2A73 B;  5JPM B;  3RSY A;  1O6Q A;  1FT2 B;  2RI8 A;  2V8I A;  1KZO B;  4V1R A;  4BOJ A;  2FUQ A;  1N7R A;  3DSX B;  3QFZ A;  4M76 A;  1LF6 A;  1RW9 A;  4FXK B;  1NL4 B;  1H36 A;  2A8Z A;  1IA7 A;  4F10 A;  1V7V A;  1IS9 A;  3WIQ A;  3QRY A;  4FXG B;  1HZF A;  1RWA A;  1KRE A;  3AFL A;  1LF9 A;  4E1Y A;  2YIK A;  5IL8 A;  3WKH A;  5EAS A;  4OK2 A;  1NXC A;  3E32 B;  3QSP A;  1D8E B;  1KSC A;  3N0G A;  5GY3 A;  4DOD A;  1X1H A;  4FNV A;  2V8K A;  3E7J A;  1OJM A;  3EU8 A;  2J5C A;  3SFX B;  1O6R A;  1TF4 A;  1X1I A;  1FMI A;  3E80 A;  1ULV A;  2D8L A;  3WIW A;  1H35 A;  2V3N A;  4WVC A;  3Q79 B;  3H3K A;  1OJN A;  1SA4 B;  3E30 B;  3SDR A;  1H3B A;  3SAE A;  3AFJ A;  3SDV A;  1NC5 A;  5C05 A;  5M7Y A;  1SA5 B;  3X17 A;  1HXC A;  5IK9 A;  1UG9 A;  4F13 A;  3M78 A;  1OJO A;  1XWT A;  1NI1 B;  2EAD A;  3S9V A;  2CQT A;  3E34 B;  1S63 B;  3P5P A;  2H6H B;  3QWT A;  1KKT A;  3M00 A;  5FO9 B;  5FO8 B;  1WZZ A;  4EHM B;  1N9A B;  3D3I A;  1H12 A;  3ON6 A;  5IKH A;  4ZRP A;  4ZH1 A;  3Q7F B;  2XWB B;  1DOG A;  5ILJ A;  3G6J B;  1KRF A;  1N95 B;  3DSW B;  4AYQ A;  1UMP A;  2R2L B;  3EUV B;  1QSJ A;  1CEM A;  1HXG A;  4WVA A;  1J0M A;  2NOJ A;  2ONH A;  3WKF A;  3HXC B;  4OK4 A;  1XWQ A;  3SQC A;  2WY8 A;  2DRQ A;  4RNQ A;  5MEH A;  1HM3 A;  1CB8 A;  3H7L A;  1FCE A;  4Q2B A;  3KSQ B;  1H39 A;  4OJZ A;  3REN A;  1F9O A;  1RWC A;  5DHK A;  1TN6 B;  3QT9 A;  1FPP B;  3PMM A;  3RX8 A;  1VD5 A;  4DOE A;  3W5M A;  2G02 A;  3CIH A;  4FJQ A;  1QAZ A;  3M02 A;  3T33 A;  1GAH A;  2AFA A;  5ILD A;  3RJ3 A;  1JCR B;  3M76 A;  3A0O A;  2ONG A;  1C3D A;  3E73 A;  1OJP A;  5EAU A;  3PZ1 B;  5JPN B;  4ZRQ A;  5CD2 A;  1N94 B;  2JF4 A;  2PN5 A;  4KKJ A;  4CJ0 A;  3VSM A;  1GXN A;  3NNB A;  2EAC A;  4D94 A;  2QNO A;  5JMD A;  1HX9 A;  4QT9 A;  2CQS A;  2Z07 A;  5IK0 A;  1X9D A;  2NVP A;  3K7X A;  3S4A A;  2ZIS B;  2WY7 A;  4MMH A;  1F9G A;  2BBC A;  4CJ1 A;  4GTM B;  1N24 A;  3P5R A;  1HV6 A;  1JS4 A;  4LNG B;  1LXK A;  1WU5 A;  4WVB A;  1W3Y A;  2GH4 A;  2OKX A;  5FO7 B;  2B4F A;  1GXO A;  1TN8 B;  4DI5 A;  2WYN A;  3OXU A;  1KS8 A;  5ILH A;  2DRS A;  1H13 A;  5DHI A;  3P2C A;  4D4B A;  5ILY A;  1HMW A;  3DSV B;  2AHF A;  1N4P B;  3QFY A;  1HMU A;  3N0F A;  1DL2 A;  1V5C A;  5ILI A;  3PYB A;  4GTT B;  3TF4 A;  1FT1 B;  3M74 A;  1N1Z A;  4GAX A;  1KZP B;  3W7T A;  3WUX A;  1WU6 A;  4D4D A;  1UT9 A;  3E33 B;  4NEI A;  3M7C A;  2V3P A;  1FAE A;  3E6U A;  4TF4 A;  4MMI A;  1N20 A;  3PZ2 B;  1O79 A;  1HCU A;  3G4F A;  2BRP A;  2BB5 A;  2X03 A;  1LOH A;  3WKI A;  1G9J A;  2Q1F A;  5CZL A;  1H54 A;  1H3C A;  3E37 B;  3M01 A;  4L9P B;  4BOK A;  1JCS B;  3QXF A;  1WU4 A;  1HN0 A;  4MBG B;  4Z4J A;  5E2J A;  4KKI A;  3EQA A;  1AYX A;  1X1J A;  2PMV A;  2FBA A;  5DGQ A;  3KSL B;  2FUT A;  3ACT A;  4GTP B;  5EAT A;  4YDO B;  3C72 B;  3W7U A;  3D5R A;  1W6K A;  2XQW A;  3VW5 A;  3QDE A;  3M7E A;  1LD8 B;  2GZ6 A;  2VN7 A;  1XW2 A;  3Q7A B;  3HXE B;  2FV1 A;  1F9D A;  4ZG8 A;  3S4D A;  3VXD A;  3W7S A;  2JG0 A;  3QT3 A;  4Z4L A;  5CA3 A;  1KSD A;  1RQ5 A;  3LZ9 A;  3ANJ A;  4GTV B;  3QPF A;  2B39 A;  1O1T B;  4L0G A;  1IA6 A;  2EAE A;  2WIN B;  3DSS B;  1C82 A;  1LTX B;  2WII B;  1QBQ B;  1HM2 A;  1V7W A;  1L2A A;  5GZK A;  1H37 A;  4TXT A;  1RWH A;  4L6X A;  2IEJ B;  4YDE B;  1AGM A;  2BB6 A;  1TNU B;  1I8Q A;  3KLS A;  1LXM A;  1FBW A;  1GXM A;  3HXD B;  1GSZ A;  2H6I B;  3OED A;  4YCR A;  4FUS A;  4WU0 A;  3EZ8 A;  1FO3 A;  3SDU A;  1GA2 A;  1V5D A;  3W7X A;  3DPY B;  3M7L A;  5GW7 A;  1J0N A;  1N21 A;  4D4A A;  2WDA A;  1DCE B;  1K72 A;  4C1S A;  2G0D A;  3DST B;  1N4R B;  4LNB B;  2BRV X;  3M72 A;  3EU5 B;  2XFG A;  3DSU B;  3ANK A;  4EL8 A;  4KTP A;  1GHQ A;  1JCQ B;  5JMF A;  5AGD A;  4OZW A;  3W5N A;  4LNV A;  4ONT A;  2GOX A;  1G6I A;  3RX7 A;  5FOB B;  3KQ4 A;  1CLC A;  2DRR A;  4MU9 A;  4KTR A;  1GLM A;  5IK6 A;  3Q73 B;  4AYR A;  1S64 B;  1N7P A;  1TNB B;  3RX5 A;  4XUV A;  1H14 A;  1D8D B;  1QQF A;  2VN4 A;  3M75 A;  5ILZ A;  1N23 A;  3NFV A;  5IM1 A;  4ZH5 A;  1G9G A;  3VSN A;  3GLY A;  2DRO A;  3K11 A;  5KKB A;  1N22 A;  3M7B A;  4OZV A;  4Q88 A;  2FV0 A;  5ILK A;  2FUZ A;  4LIX A;  1X81 B;  1N7Q A;  3GT5 A;  4V1S A;  3S4C A;  1SQC A;  4D4C A;  2ZBL A;  1TNY B;  3SDQ A;  5M7I A;  1TNZ B;  5IL3 A;  3S4B A;  1N7O A;  1LD7 B;  3A3V A;  3ANI A;  1V7X A;  3WKG A;  2AHG A;  2F6D A;  2EAB A;  1O6H A;  3PZ4 B;  3G4D A;  1L1Y A;  3H2W A;  3WC3 A;  2RGK A;  2BRW A;  1O1S B;  3WIR A;  1F1S A;  3HXB B;  1FP3 A;  1H3A A;  5DGR A;  1KWF A;  1TNO B;  3DRA B;  3SDT A;  1TN7 B;  4GTS B;  3SFY B;  1RWG A;  1FBO A;  2XWJ B;  2RI9 A;  3PZ3 B;  3ACS A;  2SQC A;  4J5T A;  2V8J A;  1N4Q B;  2JJB A;  3M77 A;  4GL3 A; 
#chains in the Genus database with same CATH homology
 4GTQ B;  4AYO A;  2I07 B;  3M73 A;  1N4S B;  3PYA A;  3HXF B;  3GZK A;  1W6J A;  3Q78 B;  1O5M B;  3QG0 A;  3QXQ A;  1MZC B;  1KFG A;  4GTO B;  2ZZR A;  2D5J A;  3RRS A;  4GTR B;  3M71 A;  3W7W A;  4JJJ A;  2P0V A;  2H6G B;  1G87 A;  2F0Y B;  2BED B;  1O1R B;  2ZIR B;  3Q75 B;  4AYP A;  3D5S A;  4CE7 A;  1R76 A;  2H6F B;  1GAI A;  3CU7 A;  1FO2 A;  2A73 B;  5JPM B;  3RSY A;  1O6Q A;  1FT2 B;  2RI8 A;  2V8I A;  1KZO B;  4V1R A;  4BOJ A;  3QFZ A;  3DSX B;  4M76 A;  1LF6 A;  4FXK B;  1NL4 B;  1H36 A;  2A8Z A;  1IA7 A;  1V7V A;  1IS9 A;  3WIQ A;  3QRY A;  4FXG B;  1HZF A;  1KRE A;  1LF9 A;  2YIK A;  3WKH A;  1NXC A;  3E32 B;  3QSP A;  1D8E B;  1KSC A;  5GY3 A;  4DOD A;  2V8K A;  3EU8 A;  3SFX B;  1O6R A;  1TF4 A;  1FMI A;  1ULV A;  2D8L A;  3WIW A;  1H35 A;  2V3N A;  4WVC A;  3Q79 B;  3H3K A;  1SA4 B;  3E30 B;  3SDR A;  1H3B A;  3SAE A;  3AFJ A;  3SDV A;  1NC5 A;  5M7Y A;  1SA5 B;  3X17 A;  1UG9 A;  3M78 A;  1XWT A;  1NI1 B;  2EAD A;  3S9V A;  2CQT A;  3E34 B;  1S63 B;  3P5P A;  2H6H B;  3QWT A;  1KKT A;  5FO9 B;  5FO8 B;  1WZZ A;  4EHM B;  1N9A B;  3D3I A;  1H12 A;  3ON6 A;  4ZRP A;  4ZH1 A;  3Q7F B;  2XWB B;  1DOG A;  3G6J B;  1KRF A;  1N95 B;  3DSW B;  4AYQ A;  1UMP A;  2R2L B;  3EUV B;  1QSJ A;  1CEM A;  4WVA A;  2NOJ A;  3WKF A;  3HXC B;  1XWQ A;  3SQC A;  2WY8 A;  2DRQ A;  5MEH A;  3H7L A;  1FCE A;  4Q2B A;  3KSQ B;  1H39 A;  3REN A;  1F9O A;  1TN6 B;  3QT9 A;  3PMM A;  1FPP B;  3RX8 A;  1VD5 A;  4DOE A;  3W5M A;  2G02 A;  3CIH A;  3T33 A;  1GAH A;  2AFA A;  3RJ3 A;  1JCR B;  3M76 A;  1C3D A;  3E73 A;  3PZ1 B;  5JPN B;  4ZRQ A;  5CD2 A;  1N94 B;  2JF4 A;  2PN5 A;  4KKJ A;  4CJ0 A;  1GXN A;  2EAC A;  4D94 A;  2QNO A;  4QT9 A;  2CQS A;  2Z07 A;  1X9D A;  2NVP A;  3K7X A;  3S4A A;  2ZIS B;  2WY7 A;  2BBC A;  4CJ1 A;  4GTM B;  3P5R A;  1JS4 A;  4LNG B;  1WU5 A;  4WVB A;  2GH4 A;  2OKX A;  5FO7 B;  2B4F A;  1GXO A;  1TN8 B;  2WYN A;  3OXU A;  1KS8 A;  2DRS A;  1H13 A;  4D4B A;  3P2C A;  3DSV B;  2AHF A;  1N4P B;  3QFY A;  1DL2 A;  1V5C A;  3PYB A;  4GTT B;  3TF4 A;  1FT1 B;  3M74 A;  1KZP B;  3W7T A;  3WUX A;  1WU6 A;  4D4D A;  1UT9 A;  3E33 B;  3M7C A;  2V3P A;  1FAE A;  3E6U A;  4TF4 A;  3PZ2 B;  1O79 A;  1HCU A;  2BB5 A;  3WKI A;  1G9J A;  5CZL A;  1H54 A;  1H3C A;  3E37 B;  4L9P B;  4BOK A;  1JCS B;  3QXF A;  1WU4 A;  4MBG B;  4Z4J A;  5E2J A;  4KKI A;  2PMV A;  1AYX A;  3EQA A;  2FBA A;  5DGQ A;  3KSL B;  3ACT A;  4GTP B;  4YDO B;  3C72 B;  3W7U A;  3D5R A;  1W6K A;  2XQW A;  3VW5 A;  3QDE A;  3M7E A;  1LD8 B;  2GZ6 A;  2VN7 A;  1XW2 A;  3Q7A B;  3HXE B;  2FV1 A;  1F9D A;  4ZG8 A;  3S4D A;  3VXD A;  3W7S A;  2JG0 A;  3QT3 A;  4Z4L A;  5CA3 A;  1KSD A;  1RQ5 A;  3ANJ A;  4GTV B;  3QPF A;  2B39 A;  1O1T B;  4L0G A;  1IA6 A;  2EAE A;  2WIN B;  3DSS B;  1LTX B;  2WII B;  1QBQ B;  1V7W A;  1L2A A;  5GZK A;  1H37 A;  4TXT A;  4L6X A;  2IEJ B;  4YDE B;  1AGM A;  2BB6 A;  1TNU B;  3KLS A;  1FBW A;  1GXM A;  3HXD B;  1GSZ A;  2H6I B;  3OED A;  4YCR A;  4FUS A;  4WU0 A;  3EZ8 A;  1FO3 A;  3SDU A;  1GA2 A;  1V5D A;  3W7X A;  3DPY B;  3M7L A;  5GW7 A;  4D4A A;  1DCE B;  1K72 A;  4C1S A;  2G0D A;  3DST B;  1N4R B;  4LNB B;  3M72 A;  3EU5 B;  2XFG A;  3DSU B;  3ANK A;  4EL8 A;  4KTP A;  1GHQ A;  1JCQ B;  5AGD A;  3W5N A;  4LNV A;  4ONT A;  2GOX A;  1G6I A;  3RX7 A;  5FOB B;  3KQ4 A;  1CLC A;  2DRR A;  4MU9 A;  4KTR A;  1GLM A;  3Q73 B;  4AYR A;  1S64 B;  1TNB B;  3RX5 A;  4XUV A;  1H14 A;  1D8D B;  1QQF A;  2VN4 A;  3M75 A;  4ZH5 A;  1G9G A;  3GLY A;  2DRO A;  3K11 A;  5KKB A;  3M7B A;  4Q88 A;  2FV0 A;  2FUZ A;  4LIX A;  1X81 B;  3GT5 A;  4V1S A;  3S4C A;  1SQC A;  4D4C A;  2ZBL A;  1TNY B;  3SDQ A;  5M7I A;  1TNZ B;  3S4B A;  1LD7 B;  3A3V A;  3ANI A;  1V7X A;  3WKG A;  2AHG A;  2F6D A;  2EAB A;  1O6H A;  3PZ4 B;  1L1Y A;  3H2W A;  3WC3 A;  2RGK A;  1O1S B;  3WIR A;  3HXB B;  1FP3 A;  1H3A A;  5DGR A;  1KWF A;  1TNO B;  3DRA B;  3SDT A;  1TN7 B;  4GTS B;  3SFY B;  1FBO A;  2XWJ B;  2RI9 A;  3PZ3 B;  3ACS A;  2SQC A;  4J5T A;  2V8J A;  1N4Q B;  2JJB A;  3M77 A;  4GL3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...