1IAEA

Crystal structures, spectroscopic features, and catalytic properties of cobalt(ii), copper(ii), nickel(ii), and mercury(ii) derivatives of the zinc endopeptidase astacin. a correlation of structure and proteolytic activity
Total Genus 67
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
67
sequence length
200
structure length
200
Chain Sequence
AAILGDEYLWSGGVIPYTFAGVSGADQSAILSGMQELEEKTCIRFVPRTTESDYVEIFTSGSGCWSYVGRISGAQQVSLQANGCVYHGTIIHELMHAIGFYHEHTRMDRDNYVTINYQNVDPSMTSNFDIDTYSRYVGEDYQYYSIMHYGKYSFSIQWGVLETIVPLQNGIDLTDPYDKAHMLQTDANQINNLYTNECSL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ASTACIN
publication title Crystal structures, spectroscopic features, and catalytic properties of cobalt(II), copper(II), nickel(II), and mercury(II) derivatives of the zinc endopeptidase astacin. A correlation of structure and proteolytic activity.
pubmed rcsb
source organism Astacus astacus
molecule tags Zinc endopeptidase
total genus 67
structure length 200
sequence length 200
ec nomenclature ec 3.4.24.21: Astacin.
pdb deposition date 1994-05-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01400 Astacin Astacin (Peptidase family M12A)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.390.10 Alpha Beta 3-Layer(aba) Sandwich Collagenase (Catalytic Domain) Collagenase (Catalytic Domain) 1iaeA00
1K7QA 1BUDA 1UTTA 3F19A 1S4BP 1GO8P 2AYKA 3KEKA 4GQLA 1K7GA 3F17A 2WO8A 1Q3AA 1QJIA 4H30A 3B92A 2Y6DA 3LJTA 1XFUA 4L63A 1XUCA 3RTSA 1WNIA 1USNA 2XS3A 1JKYA 1JANA 1MMRA 3TVCA 1XFYA 3Q2HA 5JMYA 1JH1A 5CZMA 1UMTA 3E8RA 3HY7A 2J0TA 1R1HA 2MZHA 2POJA 4H49A 4JIJA 1IAAA 5I43A 1ZVXA 3ELMA 4IUWA 4CTHA 1HTDA 1Z3JA 3EDZA 4PKSA 1QICA 3HB2P 3TS4A 4HMAA 4L19A 4DF9A 1RMZA 2Z2DA 3KMCA 1C7KA 1ROSA 2KRJA 2ERPA 3LQBA 2JIHA 3L0VA 4JQGA 1GE7A 1K7IA 3LJZA 3DNGA 4PKQA 3O2XA 4A7BA 1QIBA 1SATA 1CIZA 4FU4A 3G42A 1BKCA 4DD8A 1BKCE 1BIWA 1HY7A 1GKDA 1CQRA 1CXVA 3LUNA 5D2BA 4WKIA 3LJGA 1A86A 4I03A 4H76A 3AIGA 1DMTA 1I73A 5I2ZA 4AXQA 2OVZA 1SLNA 4QKZA 4H84A 4AYKA 2OXUA 1QUAA 4DV8A 1BM6A 1SLMA 1FLSA 1GKCA 1YCMA 4GR8A 1O0QA 3G5CA 1BZSA 5BPAA 1MNCA 1AKLA 1PWQA 3KHIA 2OW2A 2X3CA 1YOUA 2RJQA 3VTGA 1HV5A 3DPEA 3ZVSA 1UEAA 3BA0A 1XFVA 5BOTA 1Y0VA 1HFCA 1GXDA 3RTTA 5L79A 3K7LA 4G0DA 1KAPP 3WV3A 2DDYA 1CGLA 3KRYA 2K9CA 5I3MA 1BUVM 2JT5A 4H1QA 3KEJA 3LIKA 1SMPA 4JPAA 4IJOA 1B3DA 1XFWA 3SHIA 2L0RA 1KUHA 3V96B 3I7IA 2I47A 1XUDA 3EDIA 1O0TA 4HX3A 4GWMA 1JIZA 2D1OA 5I4OA 2MZEA 1UTZA 3USNA 2O3EA 1A85A 2CKIA 3TSKA 1ZP5A 4FVLA 1FM1A 1ND1A 1L6JA 2X7MA 1XURA 4ZR5A 1DTHA 3LK8A 3HBUP 4JP4A 2OY4A 4IN9A 3DPFA 1HOVA 4FXQA 5CXAA 1OM7A 4AUOA 5H8XA 4GR0A 1ZXVA 2DW0A 3LUMA 4H2EA 2YIGA 3LMCA 1QJJA 2W13A 5L7FA 1CGFA 3NX7A 1Y8JA 1OO9A 3F1AA 1GO7P 1Y93A 2OW1A 3EHXA 1KUKA 5D1UA 2OXWA 1XFZA 1IACA 1PWUA 2K2GA 1ATLA 3P24A 1PWWA 3ZXHA 1C8TA 2AIGP 2EROA 3DWBA 3L0TA 4GUYA 4J4MA 1KBCA 2MLRA 2W12A 3Q2GA 4PKRA 1IADA 3P1VA 4ON1A 3UVCA 2O36A 4AIGA 5LABA 1IABA 2CLTA 1JJ9A 2OI0A 2X3BA 4PKUA 3EDGA 1ZS0A 2SRTA 3I7GA 1JAQA 2WOAA 3LKAA 1D7XA 2ERQA 3CKIA 1J7NA 4H3XA 1G05A 1R55A 1JAOA 3F15A 3EWJA 2DW1A 3KECA 2OVXA 1R1JA 1I1IP 3EDHA 1KUIA 2J83A 3K7NA 4PKTA 3GBOA 4XM8A 3F16A 1AYKA 1PWPA 5I0LA 1BKCI 966CA 2N8RA 1OM6A 1JK3A 4G9LA 4JA1A 2A8HA 1XFXA 2V4BA 2YB9A 1BQQM 3TT4A 2DW2A 5I12A 2MZIA 3OHOA 1UMSA 3HDBA 2W14A 5D7WA 1QIAA 4WKEA 4XBHA 3B8ZA 3LQ0A 1CAQA 2W0DA 1HFSA 4WZVA 2HU6A 4GWNA 2E2DA 1KUGA 3OHLA 2Y6CA 1OS9A 1EUBA 5D3CA 3HDAP 3LIRA 4H82A 4PKWA 3KMEA 3WV2A 1KUFA 3AYUA 1R1IA 3U1RA 1OMJA 1ZTQA 1D8MA 1OM8A 1FBLA 2JSDA 1JAPA 4I35A 4Q1LA 4XCTA 1SRPA 1YP1A 1OS2A 1RM8A 3LILA 3O64A 3WV1A 1IAGA 1SU3A 1EAKA 1B8YA 1JIWP 2PJTA 4L6TA 2OZRA 3F18A 1MMBA 2FV9A 2OY2A 2MLSA 5BOYA 4GF1A 1R54A 2W15A 456CA 1IAEA 2D1NA 4XM7A 1PWVA 3DL1A 3ZUKA 1H71P 1YQYA 3LE9A 1CGEA 1MMPA 2OW9A 2OXZA 3LEAA 1EB6A 2XS4A 1G12A 2USNA 2WO9A 3N2VA 3AYKA 4XM6A 5D1SA 1GE6A 2TCLA 1D8FA 3LGPA 4ILWD 1AF0A 3VI1A 2DDFA 1MMQA 1GE5A 2JT6A 5D1TA 4DPEA 5B5OA 1CK7A 2RJPA 1C3IA 5CUHA 1G9KA 3MA2A 3HY9A 3HBVP 4GR3A 2FV5A 1BQOA 3DSLA 4FXYP 4EFSA 4R3VA 2OW0A 830CA 2E3XA 4WF6A 3HYGA 1BSWA 2JNPA 3KWVC 5B5PA 1I76A 4WK7A 2QPJA 2X3AA 3B2ZA 1ZXCA 1G4KA 4A3WA 1D5JA 3N2UA 4PKVA 1G49A 1ASTA 3EHYA
chains in the Genus database with same CATH superfamily
1K7QA 1BUDA 1UTTA 3F19A 1S4BP 1GO8P 2AYKA 3KEKA 4GQLA 1K7GA 3F17A 2WO8A 1Q3AA 1QJIA 4H30A 3B92A 2Y6DA 3LJTA 1XFUA 4L63A 1XUCA 3RTSA 1WNIA 1USNA 2XS3A 1JKYA 1JANA 1MMRA 3TVCA 1XFYA 3Q2HA 5JMYA 1JH1A 5CZMA 1UMTA 3E8RA 3HY7A 2J0TA 1R1HA 2MZHA 2POJA 4H49A 4JIJA 1IAAA 5I43A 1ZVXA 3ELMA 4IUWA 4CTHA 1HTDA 1Z3JA 3EDZA 4PKSA 1QICA 3HB2P 3TS4A 4HMAA 4L19A 4DF9A 1RMZA 2Z2DA 3KMCA 1C7KA 1ROSA 2KRJA 2ERPA 3LQBA 2JIHA 3L0VA 4JQGA 1GE7A 1K7IA 3LJZA 3DNGA 4PKQA 3O2XA 4A7BA 1QIBA 3DTKA 1SATA 1CIZA 4FU4A 3G42A 1BKCA 4DD8A 1BKCE 1BIWA 1HY7A 1GKDA 1CQRA 1CXVA 3LUNA 5D2BA 4WKIA 1XAXA 3LJGA 1A86A 4I03A 4H76A 3AIGA 1DMTA 1I73A 5I2ZA 4AXQA 2OVZA 1SLNA 4QKZA 4H84A 4AYKA 2OXUA 1QUAA 4DV8A 1BM6A 1SLMA 1FLSA 1GKCA 1YCMA 4GR8A 1O0QA 3G5CA 1BZSA 5BPAA 1MNCA 1AKLA 1PWQA 3KHIA 2OW2A 4L7AA 2X3CA 1YOUA 2RJQA 3VTGA 1HV5A 3DPEA 3ZVSA 1UEAA 3BA0A 1XFVA 5BOTA 1Y0VA 1HFCA 1GXDA 3RTTA 5L79A 3K7LA 4G0DA 1KAPP 3WV3A 2DDYA 1CGLA 3KRYA 2K9CA 5I3MA 1BUVM 2JT5A 4H1QA 3KEJA 3LIKA 1SMPA 4JPAA 4IJOA 1B3DA 1XFWA 3SHIA 2L0RA 1KUHA 3V96B 3I7IA 2I47A 1XUDA 3EDIA 1O0TA 4HX3A 4GWMA 1JIZA 2D1OA 5I4OA 2MZEA 1UTZA 3USNA 2O3EA 1A85A 2CKIA 3TSKA 1ZP5A 4FVLA 1FM1A 1ND1A 1L6JA 2X7MA 1XURA 4ZR5A 1DTHA 3LK8A 3HBUP 4JP4A 2OY4A 4IN9A 3DPFA 1HOVA 4FXQA 5CXAA 1OM7A 4AUOA 5H8XA 4GR0A 1ZXVA 2DW0A 3LUMA 1XM5A 4H2EA 3DTIA 2YIGA 3LMCA 1QJJA 2W13A 5L7FA 1CGFA 3NX7A 1Y8JA 1OO9A 3F1AA 1GO7P 1Y93A 2OW1A 3EHXA 1KUKA 5D1UA 2OXWA 1XFZA 1IACA 1PWUA 2K2GA 1ATLA 3P24A 1PWWA 3ZXHA 1C8TA 2AIGP 2EROA 3DWBA 3L0TA 4GUYA 4J4MA 1KBCA 2MLRA 2W12A 3Q2GA 4PKRA 1IADA 3P1VA 4ON1A 3UVCA 2O36A 4AIGA 5LABA 1IABA 2CLTA 1JJ9A 2OI0A 2X3BA 4PKUA 3EDGA 1ZS0A 2SRTA 3I7GA 1JAQA 2WOAA 3LKAA 1D7XA 2ERQA 3CKIA 1J7NA 4H3XA 1G05A 1R55A 1JAOA 3F15A 3EWJA 2DW1A 1TVIA 3KECA 2OVXA 1R1JA 1I1IP 3EDHA 1KUIA 2J83A 3K7NA 4PKTA 3GBOA 4XM8A 3F16A 1AYKA 1PWPA 5I0LA 1BKCI 966CA 2N8RA 1OM6A 1JK3A 4G9LA 4JA1A 2A8HA 1XFXA 2V4BA 2YB9A 1BQQM 3TT4A 2DW2A 5I12A 2MZIA 3OHOA 1UMSA 3HDBA 2W14A 5D7WA 1QIAA 4WKEA 4XBHA 3B8ZA 3LQ0A 1CAQA 2W0DA 1HFSA 4WZVA 2HU6A 4GWNA 2E2DA 1KUGA 3OHLA 2Y6CA 1OS9A 1EUBA 5D3CA 3HDAP 3LIRA 4H82A 4PKWA 3KMEA 3WV2A 1KUFA 3AYUA 1R1IA 3U1RA 1OMJA 1ZTQA 1D8MA 1OM8A 1FBLA 2JSDA 1JAPA 4I35A 4Q1LA 4XCTA 1SRPA 1YP1A 1OS2A 1RM8A 3LILA 3O64A 3WV1A 1IAGA 1SU3A 1EAKA 1B8YA 1JIWP 2PJTA 4L6TA 2OZRA 3F18A 1MMBA 2FV9A 2OY2A 2MLSA 5BOYA 4GF1A 1R54A 2W15A 456CA 1IAEA 2D1NA 4XM7A 1PWVA 3DL1A 3ZUKA 1H71P 1YQYA 3LE9A 1CGEA 1MMPA 2OW9A 2OXZA 3LEAA 1EB6A 2XS4A 1G12A 2USNA 2WO9A 3N2VA 3AYKA 4XM6A 5D1SA 1GE6A 2TCLA 1D8FA 2YUFA 3LGPA 4ILWD 1AF0A 3VI1A 2DDFA 1MMQA 1GE5A 2JT6A 5D1TA 4DPEA 5B5OA 1OZ9A 1CK7A 2RJPA 1C3IA 5CUHA 1G9KA 3MA2A 3HY9A 3HBVP 4GR3A 2FV5A 1BQOA 3DSLA 4FXYP 4EFSA 3DTEA 4R3VA 2OW0A 830CA 2E3XA 4WF6A 3HYGA 1BSWA 2JNPA 3KWVC 5B5PA 1I76A 4WK7A 2QPJA 2X3AA 3B2ZA 1ZXCA 1G4KA 4A3WA 1D5JA 3N2UA 4PKVA 1G49A 1ASTA 3EHYA
chains in the Genus database with same CATH topology
1K7QA 1BUDA 1UTTA 3F19A 1S4BP 1GO8P 2AYKA 3KEKA 4GQLA 1K7GA 3F17A 2WO8A 1Q3AA 1QJIA 4H30A 3B92A 2Y6DA 3LJTA 1XFUA 4L63A 1XUCA 3RTSA 1WNIA 1USNA 2XS3A 1JKYA 1JANA 1MMRA 3TVCA 1XFYA 3Q2HA 5JMYA 1JH1A 5CZMA 1UMTA 3E8RA 3HY7A 2J0TA 1R1HA 2MZHA 2POJA 4H49A 4JIJA 1IAAA 5I43A 1ZVXA 3ELMA 4IUWA 4CTHA 1HTDA 1Z3JA 3EDZA 4PKSA 1QICA 3HB2P 3TS4A 4HMAA 4L19A 4DF9A 1RMZA 2Z2DA 3KMCA 1C7KA 1ROSA 2KRJA 2ERPA 3LQBA 2JIHA 3L0VA 4JQGA 1GE7A 1K7IA 3LJZA 3DNGA 4PKQA 3O2XA 4A7BA 1QIBA 3DTKA 1SATA 1CIZA 4FU4A 3G42A 1BKCA 4DD8A 1BKCE 1BIWA 1HY7A 1GKDA 1CQRA 1CXVA 3LUNA 5D2BA 4WKIA 3LJGA 1A86A 4I03A 4H76A 3AIGA 1DMTA 1I73A 5I2ZA 4AXQA 2OVZA 1SLNA 4QKZA 4H84A 4AYKA 2OXUA 1QUAA 4DV8A 1BM6A 1SLMA 1FLSA 1GKCA 1YCMA 4GR8A 1O0QA 3G5CA 1BZSA 5BPAA 1MNCA 1AKLA 1PWQA 3KHIA 2OW2A 4L7AA 2X3CA 1YOUA 2RJQA 3VTGA 1HV5A 3DPEA 3ZVSA 1UEAA 3BA0A 1XFVA 5BOTA 1Y0VA 1HFCA 1GXDA 3RTTA 5L79A 3K7LA 4G0DA 1KAPP 3WV3A 2DDYA 1CGLA 3KRYA 2K9CA 5I3MA 1BUVM 2JT5A 4H1QA 3KEJA 3LIKA 1SMPA 4JPAA 4IJOA 1B3DA 1XFWA 3SHIA 2L0RA 1KUHA 3V96B 3I7IA 2I47A 1XUDA 3EDIA 1O0TA 4HX3A 4GWMA 1JIZA 2D1OA 5I4OA 2MZEA 1UTZA 3USNA 2O3EA 1A85A 2CKIA 3TSKA 1ZP5A 4FVLA 1FM1A 1ND1A 1L6JA 2X7MA 1XURA 4ZR5A 1DTHA 3LK8A 3HBUP 4JP4A 2OY4A 4IN9A 3DPFA 1HOVA 4FXQA 5CXAA 1OM7A 4AUOA 5H8XA 4GR0A 1ZXVA 2DW0A 3LUMA 4H2EA 3DTIA 2YIGA 3LMCA 1QJJA 2W13A 5L7FA 1CGFA 3NX7A 1Y8JA 1OO9A 3F1AA 1GO7P 1Y93A 2OW1A 3EHXA 1KUKA 5D1UA 2OXWA 1XFZA 1IACA 1PWUA 2K2GA 1ATLA 3P24A 1PWWA 3ZXHA 1C8TA 2AIGP 2EROA 3DWBA 3L0TA 4GUYA 4J4MA 1KBCA 2MLRA 2W12A 3Q2GA 4PKRA 1IADA 3P1VA 4ON1A 3UVCA 2O36A 4AIGA 5LABA 1IABA 2CLTA 1JJ9A 2OI0A 2X3BA 4PKUA 3EDGA 1ZS0A 2SRTA 3I7GA 1JAQA 2WOAA 3LKAA 1D7XA 2ERQA 3CKIA 1J7NA 4H3XA 1G05A 1R55A 1JAOA 3F15A 3EWJA 2DW1A 3KECA 2OVXA 1R1JA 1I1IP 3EDHA 1KUIA 2J83A 3K7NA 4PKTA 3GBOA 4XM8A 3F16A 1AYKA 1PWPA 5I0LA 1BKCI 966CA 2N8RA 1OM6A 1JK3A 4G9LA 4JA1A 2A8HA 1XFXA 2V4BA 2YB9A 1BQQM 3TT4A 2DW2A 5I12A 2MZIA 3OHOA 1UMSA 3HDBA 2W14A 5D7WA 1QIAA 4WKEA 4XBHA 3B8ZA 3LQ0A 1CAQA 2W0DA 1HFSA 4WZVA 2HU6A 4GWNA 2E2DA 1KUGA 3OHLA 2Y6CA 1OS9A 1EUBA 5D3CA 3HDAP 3LIRA 4H82A 4PKWA 3KMEA 3WV2A 1KUFA 3AYUA 1R1IA 3U1RA 1OMJA 1ZTQA 1D8MA 1OM8A 1FBLA 2JSDA 1JAPA 4I35A 4Q1LA 4XCTA 1SRPA 1YP1A 1OS2A 1RM8A 3LILA 3O64A 3WV1A 1IAGA 1SU3A 1EAKA 1B8YA 1JIWP 2PJTA 4L6TA 2OZRA 3F18A 1MMBA 2FV9A 2OY2A 2MLSA 5BOYA 4GF1A 1R54A 2W15A 456CA 1IAEA 2D1NA 4XM7A 1PWVA 3DL1A 3ZUKA 1H71P 1YQYA 3LE9A 1CGEA 1MMPA 2OW9A 2OXZA 3LEAA 1EB6A 2XS4A 1G12A 2USNA 2WO9A 3N2VA 3AYKA 4XM6A 5D1SA 1GE6A 2TCLA 1D8FA 2YUFA 3LGPA 4ILWD 1AF0A 3VI1A 2DDFA 1MMQA 1GE5A 2JT6A 5D1TA 4DPEA 5B5OA 1CK7A 2RJPA 1C3IA 5CUHA 1G9KA 3MA2A 3HY9A 3HBVP 4GR3A 2FV5A 1BQOA 3DSLA 4FXYP 4EFSA 3DTEA 4R3VA 2OW0A 830CA 2E3XA 4WF6A 3HYGA 1BSWA 2JNPA 3KWVC 5B5PA 1I76A 4WK7A 2QPJA 2X3AA 3B2ZA 1ZXCA 1G4KA 4A3WA 1D5JA 3N2UA 4PKVA 1G49A 1ASTA 3EHYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1K7Q A;  1BUD A;  1UTT A;  3F19 A;  1S4B P;  1GO8 P;  2AYK A;  3KEK A;  4GQL A;  1K7G A;  3F17 A;  2WO8 A;  1Q3A A;  1QJI A;  4H30 A;  3B92 A;  2Y6D A;  3LJT A;  1XFU A;  4L63 A;  1XUC A;  3RTS A;  1WNI A;  1USN A;  2XS3 A;  1JKY A;  1JAN A;  1MMR A;  3TVC A;  1XFY A;  3Q2H A;  5JMY A;  1JH1 A;  5CZM A;  1UMT A;  3E8R A;  3HY7 A;  2J0T A;  1R1H A;  2MZH A;  2POJ A;  4H49 A;  4JIJ A;  1IAA A;  5I43 A;  1ZVX A;  3ELM A;  4IUW A;  4CTH A;  1HTD A;  1Z3J A;  3EDZ A;  4PKS A;  1QIC A;  3HB2 P;  3TS4 A;  4HMA A;  4L19 A;  4DF9 A;  1RMZ A;  2Z2D A;  3KMC A;  1C7K A;  1ROS A;  2KRJ A;  2ERP A;  3LQB A;  2JIH A;  3L0V A;  4JQG A;  1GE7 A;  1K7I A;  3LJZ A;  3DNG A;  4PKQ A;  3O2X A;  4A7B A;  1QIB A;  1SAT A;  1CIZ A;  4FU4 A;  3G42 A;  1BKC A;  4DD8 A;  1BKC E;  1BIW A;  1HY7 A;  1GKD A;  1CQR A;  1CXV A;  3LUN A;  5D2B A;  4WKI A;  3LJG A;  1A86 A;  4I03 A;  4H76 A;  3AIG A;  1DMT A;  1I73 A;  5I2Z A;  4AXQ A;  2OVZ A;  1SLN A;  4QKZ A;  4H84 A;  4AYK A;  2OXU A;  1QUA A;  4DV8 A;  1BM6 A;  1SLM A;  1FLS A;  1GKC A;  1YCM A;  4GR8 A;  1O0Q A;  3G5C A;  1BZS A;  5BPA A;  1MNC A;  1AKL A;  1PWQ A;  3KHI A;  2OW2 A;  2X3C A;  1YOU A;  2RJQ A;  3VTG A;  1HV5 A;  3DPE A;  3ZVS A;  1UEA A;  3BA0 A;  1XFV A;  5BOT A;  1Y0V A;  1HFC A;  1GXD A;  3RTT A;  5L79 A;  3K7L A;  4G0D A;  1KAP P;  3WV3 A;  2DDY A;  1CGL A;  3KRY A;  2K9C A;  5I3M A;  1BUV M;  2JT5 A;  4H1Q A;  3KEJ A;  3LIK A;  1SMP A;  4JPA A;  4IJO A;  1B3D A;  1XFW A;  3SHI A;  2L0R A;  1KUH A;  3V96 B;  3I7I A;  2I47 A;  1XUD A;  3EDI A;  1O0T A;  4HX3 A;  4GWM A;  1JIZ A;  2D1O A;  5I4O A;  2MZE A;  1UTZ A;  3USN A;  2O3E A;  1A85 A;  2CKI A;  3TSK A;  1ZP5 A;  4FVL A;  1FM1 A;  1ND1 A;  1L6J A;  2X7M A;  1XUR A;  4ZR5 A;  1DTH A;  3LK8 A;  3HBU P;  4JP4 A;  2OY4 A;  4IN9 A;  3DPF A;  1HOV A;  4FXQ A;  5CXA A;  1OM7 A;  4AUO A;  5H8X A;  4GR0 A;  1ZXV A;  2DW0 A;  3LUM A;  4H2E A;  2YIG A;  3LMC A;  1QJJ A;  2W13 A;  5L7F A;  1CGF A;  3NX7 A;  1Y8J A;  1OO9 A;  3F1A A;  1GO7 P;  1Y93 A;  2OW1 A;  3EHX A;  1KUK A;  5D1U A;  2OXW A;  1XFZ A;  1IAC A;  1PWU A;  2K2G A;  1ATL A;  3P24 A;  1PWW A;  3ZXH A;  1C8T A;  2AIG P;  2ERO A;  3DWB A;  3L0T A;  4GUY A;  4J4M A;  1KBC A;  2MLR A;  2W12 A;  3Q2G A;  4PKR A;  1IAD A;  3P1V A;  4ON1 A;  3UVC A;  2O36 A;  4AIG A;  5LAB A;  1IAB A;  2CLT A;  1JJ9 A;  2OI0 A;  2X3B A;  4PKU A;  3EDG A;  1ZS0 A;  2SRT A;  3I7G A;  1JAQ A;  2WOA A;  3LKA A;  1D7X A;  2ERQ A;  3CKI A;  1J7N A;  4H3X A;  1G05 A;  1R55 A;  1JAO A;  3F15 A;  3EWJ A;  2DW1 A;  3KEC A;  2OVX A;  1R1J A;  1I1I P;  3EDH A;  1KUI A;  2J83 A;  3K7N A;  4PKT A;  3GBO A;  4XM8 A;  3F16 A;  1AYK A;  1PWP A;  5I0L A;  1BKC I;  966C A;  2N8R A;  1OM6 A;  1JK3 A;  4G9L A;  4JA1 A;  2A8H A;  1XFX A;  2V4B A;  2YB9 A;  1BQQ M;  3TT4 A;  2DW2 A;  5I12 A;  2MZI A;  3OHO A;  1UMS A;  3HDB A;  2W14 A;  5D7W A;  1QIA A;  4WKE A;  4XBH A;  3B8Z A;  3LQ0 A;  1CAQ A;  2W0D A;  1HFS A;  4WZV A;  2HU6 A;  4GWN A;  2E2D A;  1KUG A;  3OHL A;  2Y6C A;  1OS9 A;  1EUB A;  5D3C A;  3HDA P;  3LIR A;  4H82 A;  4PKW A;  3KME A;  3WV2 A;  1KUF A;  3AYU A;  1R1I A;  3U1R A;  1OMJ A;  1ZTQ A;  1D8M A;  1OM8 A;  1FBL A;  2JSD A;  1JAP A;  4I35 A;  4Q1L A;  4XCT A;  1SRP A;  1YP1 A;  1OS2 A;  1RM8 A;  3LIL A;  3O64 A;  3WV1 A;  1IAG A;  1SU3 A;  1EAK A;  1B8Y A;  1JIW P;  2PJT A;  4L6T A;  2OZR A;  3F18 A;  1MMB A;  2FV9 A;  2OY2 A;  2MLS A;  5BOY A;  4GF1 A;  1R54 A;  2W15 A;  456C A;  1IAE A;  2D1N A;  4XM7 A;  1PWV A;  3DL1 A;  3ZUK A;  1H71 P;  1YQY A;  3LE9 A;  1CGE A;  1MMP A;  2OW9 A;  2OXZ A;  3LEA A;  1EB6 A;  2XS4 A;  1G12 A;  2USN A;  2WO9 A;  3N2V A;  3AYK A;  4XM6 A;  5D1S A;  1GE6 A;  2TCL A;  1D8F A;  3LGP A;  4ILW D;  1AF0 A;  3VI1 A;  2DDF A;  1MMQ A;  1GE5 A;  2JT6 A;  5D1T A;  4DPE A;  5B5O A;  1CK7 A;  2RJP A;  1C3I A;  5CUH A;  1G9K A;  3MA2 A;  3HY9 A;  3HBV P;  4GR3 A;  2FV5 A;  1BQO A;  3DSL A;  4FXY P;  4EFS A;  4R3V A;  2OW0 A;  830C A;  2E3X A;  4WF6 A;  3HYG A;  1BSW A;  2JNP A;  3KWV C;  5B5P A;  1I76 A;  4WK7 A;  2QPJ A;  2X3A A;  3B2Z A;  1ZXC A;  1G4K A;  4A3W A;  1D5J A;  3N2U A;  4PKV A;  1G49 A;  1AST A;  3EHY A; 
#chains in the Genus database with same CATH topology
 1K7Q A;  1BUD A;  1UTT A;  3F19 A;  1S4B P;  1GO8 P;  2AYK A;  3KEK A;  4GQL A;  1K7G A;  3F17 A;  2WO8 A;  1Q3A A;  1QJI A;  4H30 A;  3B92 A;  2Y6D A;  3LJT A;  1XFU A;  4L63 A;  1XUC A;  3RTS A;  1WNI A;  1USN A;  2XS3 A;  1JKY A;  1JAN A;  1MMR A;  3TVC A;  1XFY A;  3Q2H A;  5JMY A;  1JH1 A;  5CZM A;  1UMT A;  3E8R A;  3HY7 A;  2J0T A;  1R1H A;  2MZH A;  2POJ A;  4H49 A;  4JIJ A;  1IAA A;  5I43 A;  1ZVX A;  3ELM A;  4IUW A;  4CTH A;  1HTD A;  1Z3J A;  3EDZ A;  4PKS A;  1QIC A;  3HB2 P;  3TS4 A;  4HMA A;  4L19 A;  4DF9 A;  1RMZ A;  2Z2D A;  3KMC A;  1C7K A;  1ROS A;  2KRJ A;  2ERP A;  3LQB A;  2JIH A;  3L0V A;  4JQG A;  1GE7 A;  1K7I A;  3LJZ A;  3DNG A;  4PKQ A;  3O2X A;  4A7B A;  1QIB A;  3DTK A;  1SAT A;  1CIZ A;  4FU4 A;  3G42 A;  1BKC A;  4DD8 A;  1BKC E;  1BIW A;  1HY7 A;  1GKD A;  1CQR A;  1CXV A;  3LUN A;  5D2B A;  4WKI A;  1XAX A;  3LJG A;  1A86 A;  4I03 A;  4H76 A;  3AIG A;  1DMT A;  1I73 A;  5I2Z A;  4AXQ A;  2OVZ A;  1SLN A;  4QKZ A;  4H84 A;  4AYK A;  2OXU A;  1QUA A;  4DV8 A;  1BM6 A;  1SLM A;  1FLS A;  1GKC A;  1YCM A;  4GR8 A;  1O0Q A;  3G5C A;  1BZS A;  5BPA A;  1MNC A;  1AKL A;  1PWQ A;  3KHI A;  2OW2 A;  4L7A A;  2X3C A;  1YOU A;  2RJQ A;  3VTG A;  1HV5 A;  3DPE A;  3ZVS A;  1UEA A;  3BA0 A;  1XFV A;  5BOT A;  1Y0V A;  1HFC A;  1GXD A;  3RTT A;  5L79 A;  3K7L A;  4G0D A;  1KAP P;  3WV3 A;  2DDY A;  1CGL A;  3KRY A;  2K9C A;  5I3M A;  1BUV M;  2JT5 A;  4H1Q A;  3KEJ A;  3LIK A;  1SMP A;  4JPA A;  4IJO A;  1B3D A;  1XFW A;  3SHI A;  2L0R A;  1KUH A;  3V96 B;  3I7I A;  2I47 A;  1XUD A;  3EDI A;  1O0T A;  4HX3 A;  4GWM A;  1JIZ A;  2D1O A;  5I4O A;  2MZE A;  1UTZ A;  3USN A;  2O3E A;  1A85 A;  2CKI A;  3TSK A;  1ZP5 A;  4FVL A;  1FM1 A;  1ND1 A;  1L6J A;  2X7M A;  1XUR A;  4ZR5 A;  1DTH A;  3LK8 A;  3HBU P;  4JP4 A;  2OY4 A;  4IN9 A;  3DPF A;  1HOV A;  4FXQ A;  5CXA A;  1OM7 A;  4AUO A;  5H8X A;  4GR0 A;  1ZXV A;  2DW0 A;  3LUM A;  1XM5 A;  4H2E A;  3DTI A;  2YIG A;  3LMC A;  1QJJ A;  2W13 A;  5L7F A;  1CGF A;  3NX7 A;  1Y8J A;  1OO9 A;  3F1A A;  1GO7 P;  1Y93 A;  2OW1 A;  3EHX A;  1KUK A;  5D1U A;  2OXW A;  1XFZ A;  1IAC A;  1PWU A;  2K2G A;  1ATL A;  3P24 A;  1PWW A;  3ZXH A;  1C8T A;  2AIG P;  2ERO A;  3DWB A;  3L0T A;  4GUY A;  4J4M A;  1KBC A;  2MLR A;  2W12 A;  3Q2G A;  4PKR A;  1IAD A;  3P1V A;  4ON1 A;  3UVC A;  2O36 A;  4AIG A;  5LAB A;  1IAB A;  2CLT A;  1JJ9 A;  2OI0 A;  2X3B A;  4PKU A;  3EDG A;  1ZS0 A;  2SRT A;  3I7G A;  1JAQ A;  2WOA A;  3LKA A;  1D7X A;  2ERQ A;  3CKI A;  1J7N A;  4H3X A;  1G05 A;  1R55 A;  1JAO A;  3F15 A;  3EWJ A;  2DW1 A;  1TVI A;  3KEC A;  2OVX A;  1R1J A;  1I1I P;  3EDH A;  1KUI A;  2J83 A;  3K7N A;  4PKT A;  3GBO A;  4XM8 A;  3F16 A;  1AYK A;  1PWP A;  5I0L A;  1BKC I;  966C A;  2N8R A;  1OM6 A;  1JK3 A;  4G9L A;  4JA1 A;  2A8H A;  1XFX A;  2V4B A;  2YB9 A;  1BQQ M;  3TT4 A;  2DW2 A;  5I12 A;  2MZI A;  3OHO A;  1UMS A;  3HDB A;  2W14 A;  5D7W A;  1QIA A;  4WKE A;  4XBH A;  3B8Z A;  3LQ0 A;  1CAQ A;  2W0D A;  1HFS A;  4WZV A;  2HU6 A;  4GWN A;  2E2D A;  1KUG A;  3OHL A;  2Y6C A;  1OS9 A;  1EUB A;  5D3C A;  3HDA P;  3LIR A;  4H82 A;  4PKW A;  3KME A;  3WV2 A;  1KUF A;  3AYU A;  1R1I A;  3U1R A;  1OMJ A;  1ZTQ A;  1D8M A;  1OM8 A;  1FBL A;  2JSD A;  1JAP A;  4I35 A;  4Q1L A;  4XCT A;  1SRP A;  1YP1 A;  1OS2 A;  1RM8 A;  3LIL A;  3O64 A;  3WV1 A;  1IAG A;  1SU3 A;  1EAK A;  1B8Y A;  1JIW P;  2PJT A;  4L6T A;  2OZR A;  3F18 A;  1MMB A;  2FV9 A;  2OY2 A;  2MLS A;  5BOY A;  4GF1 A;  1R54 A;  2W15 A;  456C A;  1IAE A;  2D1N A;  4XM7 A;  1PWV A;  3DL1 A;  3ZUK A;  1H71 P;  1YQY A;  3LE9 A;  1CGE A;  1MMP A;  2OW9 A;  2OXZ A;  3LEA A;  1EB6 A;  2XS4 A;  1G12 A;  2USN A;  2WO9 A;  3N2V A;  3AYK A;  4XM6 A;  5D1S A;  1GE6 A;  2TCL A;  1D8F A;  2YUF A;  3LGP A;  4ILW D;  1AF0 A;  3VI1 A;  2DDF A;  1MMQ A;  1GE5 A;  2JT6 A;  5D1T A;  4DPE A;  5B5O A;  1OZ9 A;  1CK7 A;  2RJP A;  1C3I A;  5CUH A;  1G9K A;  3MA2 A;  3HY9 A;  3HBV P;  4GR3 A;  2FV5 A;  1BQO A;  3DSL A;  4FXY P;  4EFS A;  3DTE A;  4R3V A;  2OW0 A;  830C A;  2E3X A;  4WF6 A;  3HYG A;  1BSW A;  2JNP A;  3KWV C;  5B5P A;  1I76 A;  4WK7 A;  2QPJ A;  2X3A A;  3B2Z A;  1ZXC A;  1G4K A;  4A3W A;  1D5J A;  3N2U A;  4PKV A;  1G49 A;  1AST A;  3EHY A; 
#chains in the Genus database with same CATH homology
 1K7Q A;  1BUD A;  1UTT A;  3F19 A;  1S4B P;  1GO8 P;  2AYK A;  3KEK A;  4GQL A;  1K7G A;  3F17 A;  2WO8 A;  1Q3A A;  1QJI A;  4H30 A;  3B92 A;  2Y6D A;  3LJT A;  1XFU A;  4L63 A;  1XUC A;  3RTS A;  1WNI A;  1USN A;  2XS3 A;  1JKY A;  1JAN A;  1MMR A;  3TVC A;  1XFY A;  3Q2H A;  5JMY A;  1JH1 A;  5CZM A;  1UMT A;  3E8R A;  3HY7 A;  2J0T A;  1R1H A;  2MZH A;  2POJ A;  4H49 A;  4JIJ A;  1IAA A;  5I43 A;  1ZVX A;  3ELM A;  4IUW A;  4CTH A;  1HTD A;  1Z3J A;  3EDZ A;  4PKS A;  1QIC A;  3HB2 P;  3TS4 A;  4HMA A;  4L19 A;  4DF9 A;  1RMZ A;  2Z2D A;  3KMC A;  1C7K A;  1ROS A;  2KRJ A;  2ERP A;  3LQB A;  2JIH A;  3L0V A;  4JQG A;  1GE7 A;  1K7I A;  3LJZ A;  3DNG A;  4PKQ A;  3O2X A;  4A7B A;  1QIB A;  3DTK A;  1SAT A;  1CIZ A;  4FU4 A;  3G42 A;  1BKC A;  4DD8 A;  1BKC E;  1BIW A;  1HY7 A;  1GKD A;  1CQR A;  1CXV A;  3LUN A;  5D2B A;  4WKI A;  3LJG A;  1A86 A;  4I03 A;  4H76 A;  3AIG A;  1DMT A;  1I73 A;  5I2Z A;  4AXQ A;  2OVZ A;  1SLN A;  4QKZ A;  4H84 A;  4AYK A;  2OXU A;  1QUA A;  4DV8 A;  1BM6 A;  1SLM A;  1FLS A;  1GKC A;  1YCM A;  4GR8 A;  1O0Q A;  3G5C A;  1BZS A;  5BPA A;  1MNC A;  1AKL A;  1PWQ A;  3KHI A;  2OW2 A;  4L7A A;  2X3C A;  1YOU A;  2RJQ A;  3VTG A;  1HV5 A;  3DPE A;  3ZVS A;  1UEA A;  3BA0 A;  1XFV A;  5BOT A;  1Y0V A;  1HFC A;  1GXD A;  3RTT A;  5L79 A;  3K7L A;  4G0D A;  1KAP P;  3WV3 A;  2DDY A;  1CGL A;  3KRY A;  2K9C A;  5I3M A;  1BUV M;  2JT5 A;  4H1Q A;  3KEJ A;  3LIK A;  1SMP A;  4JPA A;  4IJO A;  1B3D A;  1XFW A;  3SHI A;  2L0R A;  1KUH A;  3V96 B;  3I7I A;  2I47 A;  1XUD A;  3EDI A;  1O0T A;  4HX3 A;  4GWM A;  1JIZ A;  2D1O A;  5I4O A;  2MZE A;  1UTZ A;  3USN A;  2O3E A;  1A85 A;  2CKI A;  3TSK A;  1ZP5 A;  4FVL A;  1FM1 A;  1ND1 A;  1L6J A;  2X7M A;  1XUR A;  4ZR5 A;  1DTH A;  3LK8 A;  3HBU P;  4JP4 A;  2OY4 A;  4IN9 A;  3DPF A;  1HOV A;  4FXQ A;  5CXA A;  1OM7 A;  4AUO A;  5H8X A;  4GR0 A;  1ZXV A;  2DW0 A;  3LUM A;  4H2E A;  3DTI A;  2YIG A;  3LMC A;  1QJJ A;  2W13 A;  5L7F A;  1CGF A;  3NX7 A;  1Y8J A;  1OO9 A;  3F1A A;  1GO7 P;  1Y93 A;  2OW1 A;  3EHX A;  1KUK A;  5D1U A;  2OXW A;  1XFZ A;  1IAC A;  1PWU A;  2K2G A;  1ATL A;  3P24 A;  1PWW A;  3ZXH A;  1C8T A;  2AIG P;  2ERO A;  3DWB A;  3L0T A;  4GUY A;  4J4M A;  1KBC A;  2MLR A;  2W12 A;  3Q2G A;  4PKR A;  1IAD A;  3P1V A;  4ON1 A;  3UVC A;  2O36 A;  4AIG A;  5LAB A;  1IAB A;  2CLT A;  1JJ9 A;  2OI0 A;  2X3B A;  4PKU A;  3EDG A;  1ZS0 A;  2SRT A;  3I7G A;  1JAQ A;  2WOA A;  3LKA A;  1D7X A;  2ERQ A;  3CKI A;  1J7N A;  4H3X A;  1G05 A;  1R55 A;  1JAO A;  3F15 A;  3EWJ A;  2DW1 A;  3KEC A;  2OVX A;  1R1J A;  1I1I P;  3EDH A;  1KUI A;  2J83 A;  3K7N A;  4PKT A;  3GBO A;  4XM8 A;  3F16 A;  1AYK A;  1PWP A;  5I0L A;  1BKC I;  966C A;  2N8R A;  1OM6 A;  1JK3 A;  4G9L A;  4JA1 A;  2A8H A;  1XFX A;  2V4B A;  2YB9 A;  1BQQ M;  3TT4 A;  2DW2 A;  5I12 A;  2MZI A;  3OHO A;  1UMS A;  3HDB A;  2W14 A;  5D7W A;  1QIA A;  4WKE A;  4XBH A;  3B8Z A;  3LQ0 A;  1CAQ A;  2W0D A;  1HFS A;  4WZV A;  2HU6 A;  4GWN A;  2E2D A;  1KUG A;  3OHL A;  2Y6C A;  1OS9 A;  1EUB A;  5D3C A;  3HDA P;  3LIR A;  4H82 A;  4PKW A;  3KME A;  3WV2 A;  1KUF A;  3AYU A;  1R1I A;  3U1R A;  1OMJ A;  1ZTQ A;  1D8M A;  1OM8 A;  1FBL A;  2JSD A;  1JAP A;  4I35 A;  4Q1L A;  4XCT A;  1SRP A;  1YP1 A;  1OS2 A;  1RM8 A;  3LIL A;  3O64 A;  3WV1 A;  1IAG A;  1SU3 A;  1EAK A;  1B8Y A;  1JIW P;  2PJT A;  4L6T A;  2OZR A;  3F18 A;  1MMB A;  2FV9 A;  2OY2 A;  2MLS A;  5BOY A;  4GF1 A;  1R54 A;  2W15 A;  456C A;  1IAE A;  2D1N A;  4XM7 A;  1PWV A;  3DL1 A;  3ZUK A;  1H71 P;  1YQY A;  3LE9 A;  1CGE A;  1MMP A;  2OW9 A;  2OXZ A;  3LEA A;  1EB6 A;  2XS4 A;  1G12 A;  2USN A;  2WO9 A;  3N2V A;  3AYK A;  4XM6 A;  5D1S A;  1GE6 A;  2TCL A;  1D8F A;  2YUF A;  3LGP A;  4ILW D;  1AF0 A;  3VI1 A;  2DDF A;  1MMQ A;  1GE5 A;  2JT6 A;  5D1T A;  4DPE A;  5B5O A;  1CK7 A;  2RJP A;  1C3I A;  5CUH A;  1G9K A;  3MA2 A;  3HY9 A;  3HBV P;  4GR3 A;  2FV5 A;  1BQO A;  3DSL A;  4FXY P;  4EFS A;  3DTE A;  4R3V A;  2OW0 A;  830C A;  2E3X A;  4WF6 A;  3HYG A;  1BSW A;  2JNP A;  3KWV C;  5B5P A;  1I76 A;  4WK7 A;  2QPJ A;  2X3A A;  3B2Z A;  1ZXC A;  1G4K A;  4A3W A;  1D5J A;  3N2U A;  4PKV A;  1G49 A;  1AST A;  3EHY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...