1IAIH

Idiotype-anti-idiotype fab complex
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
219
structure length
219
Chain Sequence
QIQLVQSGPELKKPGETVKISCKASGYTFTNYGMNWVKQAPGKGLKWMAWINTYTGEPTYADDFKGRFAFSLETSASTAYLQINNLKNEDTATYFCARDGYYENYYAMDYWGQGTSVTVSSAKTTAPSVYPLAPVCGDTTGSSVTLGCLVKGYFPEPVTLTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVTSSTTPSQSITCNVAHPASSTKVDKKID
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords IDIOTYPIC FAB 730.1.4 (IGG1) OF VIRUS NEUTRALIZING ANTIBODY
publication title Crystal structure of an idiotype-anti-idiotype Fab complex.
pubmed doi rcsb
molecule tags Complex (immunoglobulin igg1/igg2a)
total genus 35
structure length 219
sequence length 219
ec nomenclature
pdb deposition date 1993-12-28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1iaiH01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1iaiH02
3P11H 4NQCA 5GGVY 2QJDA 2AVGA 1DUYB 2ZUQB 4ZS7H 2X7LA 4ZUVA 2WQ8A 1KXQE 1ZT7B 2F54D 3TT1L 4U3HA 5DZNA 5C71A 3DLQR 1TJHL 5EO0B 1ZTXL 1KTDB 1A1NA 4OLUL 1IAIM 1HQRB 1MJ8H 4JE4B 3VFSA 4Y4HB 2X4PB 5DUPH 2C26A 5I30L 2MCPH 4OFVA 1NBQA 1YN7A 1DUZB 3GSQB 1WZMA 1LDSA 3DX7B 3P73A 4WW1B 2ZUXA 3TN0C 2XZAL 2X09A 1U8MA 4X9IA 3RTQA 4HWEH 4U6HA 4M7JL 1I1YB 4OT1L 5EULV 5ITFB 1J8HB 3EOYG 4XB7A 3PQYB 2ZG2A 4ELKB 1HEZB 4PUBL 1U3HD 3WKNA 3NABH 2K3TA 2NZIA 1UJTA 1HINL 4KXZI 1UWEL 1KC5L 2A1WL 1HI6B 4RZCA 1MCFA 3JXAA 5E6ID 3VFRB 1BMGA 3L3GB 5I17A 4KDTC 1BFVH 4OF5A 4PV9A 1UZ8A 3MRLB 3EO9L 5FA4B 2E3VA 4O58L 4AIXA 4OTXH 1K85A 1OD9A 1MY5A 1HQ4B 3IU3B 3LDBB 3QWOB 1TQCC 1VFUA 2IQ9L 3RWFA 3GMPB 1HKLH 4PJAB 3S5LG 4G43B 5GRVK 3Q3GA 4JR9H 1FH5L 4LLMB 2GITA 3JWDL 4E41B 4KJPC 3G6JA 1D3CA 3PQYE 3C6LA 4YEEA 1WK0A 4DQOL 3AU1B 5F89B 5CCKL 5L7XH 5JMRA 2G60L 3DSFL 3ZDYF 2OL3L 3TA3D 4XNUL 3BZEB 3GI9H 4HC1L 3C60A 5IVXB 4K9EL 5HVHB 5D1ZC 3ZKXC 3I2CL 4WI7A 5B3JE 3WFBH 1VPOH 2MWCA 3ZHKA 4NKOA 35C8H 1QVOB 3FN9A 3VA6A 3RBSA 4JFHD 4JRYD 4LSSH 1R5IA 4MS8D 4KKNA 4OQTA 1T21B 3KPOA 1X5ZA 1A7PL 1WIOA 4KROB 1H3VA 3QAZC 4LCUB 4ELMF 3N9GH 1MCEA 2NXZC 5DK3A 5EOCJ 4EDXB 3QCVH 3QHFH 3KPNB 3ZE1E 4DFHA 5KSAB 1CE6B 3FMGH 1INQB 3T0BA 4Y8AA 1BWWA 3JTSB 2XZCL 4XPHL 1QUNA 4M43H 1YEFH 1ZHBA 4Z77A 4JG0L 3MUGB 4FA8A 5J6GB 4FFWD 5HYQA 1FL6A 5C0ND 2YKLH 1MCQA 1RMFL 2D7NA 5IF0B 5I1AB 5C07A 1LMKA 5JLZB 1QSFB 5E56A 1CR9L 3RU8H 3RWIA 3I02A 2OSLA 4G8FB 3IDGB 4WWKD 2EYRA 3MLSL 4GT7A 4IOSD 5TE4H 3IF1A 1G0DA 1KCSH 2CMRL 4NJ9L 2QSCH 1BFSA 5GS0H 3ARTA 3ETBF 4HKBA 4U1GB 3SE8L 1KT2A 5F71A 1RIHL 3TWCL 2HVJB 5I1EH 4O9HL 1A4KA 4FFVD 4X5LA 3MYZA 1AI1L 1NBZA 3P0VH 5TQ2H 4IS6A 2Z91B 5L6YL 4N8CL 5D5MB 2P44B 2DIAA 4PJXA 4PLOB 4G8GE 5BV7B 5D7IE 1CFVL 3Q5TA 4FQPA 4YNYA 3DMMD 5I2IB 2DKMA 1I3GL 2B1HL 1QRNE 2GK2A 2BY2A 4IRJA 4FXKA 2AKRB 2Z93B 3MQIA 5KS9B 1CGYA 4WI4A 5EU3B 3UTPD 1LO3H 4R26H 5F9DC 3VFPB 1IC1A 3HI6L 1CK0L 1AE6H 1DBBL 1QBAA 1GOHA 4L5FL 3EW3B 2LAGB 4CN6A 2BNQB 4O5LL 1ZLSH 5T5FH 2Y7QA 4YXKL 1NMAL 3IVKA 4H1LA 3VD7A 2ED7A 3QNZA 5CWSB 1MJJB 1E4WH 2XACC 3VWJB 3QULA 4K94L 3HCVA 3WDIA 3JWOC 3LIZH 3KPPB 3KLHD 3FRUA 3MRFB 5D5ME 3RWJA 4XXCA 1SYVB 2FL5B 4QHMB 3WIIL 3MCLH 1AGDB 4DGIL 4R90L 3KXFE 3FB6A 4MA7H 3S9DB 2R0WL 4LRNL 2OTUA 5EH1A 1KXVC 4JHZA 1XF2B 3U36A 1NEZB 2KQNA 1IGFL 2Z31B 4JEGB 5LGHL 1VACB 4Q9QH 3FQWB 3NVQA 4QRRA 1RJYB 4P2RB 3VXOB 1KTLB 1EMTH 2Q6WA 2KZWA 4PG2A 3O3UN 4WY7H 3QO1B 2OCFD 1J1XL 1OTUD 3RP1A 1KCKA 1LGVA 4P99A 1YMMA 2ATPA 3QDGB 1G6RL 1W2KT 1JNHB 2GCYA 3I6KA 4G6KH 5L2KE 4OZFH 5EU5A 4BFGA 3O3AA 1OAZL 1BZ9B 2G2RB 3MRKB 1AKJB 3EGSA 3OZ9L 2AJXH 3UZQA 4NNYA 4OZIA 1S8DA 5C0AB 2BNRD 3RVTD 2XQYK 4R9HA 2IPKB 1U3HC 5IFHL 3SGDH 5KVGH 1XF1A 4L4JA 2F5BH 4HJ0D 5KN5B 3K8MA 3I6GA 4V2CB 4N0FA 2P45B 1FNSL 1JMZA 2E6QA 3IRPX 2R1YA 3MNZA 3WIHA 5MEND 5JPNA 3HG1E 3QUYB 1IC4H 3HC0A 4P2RE 1K5NB 1J0YA 2IH3A 3QQ9D 1VA9A 4JZJB 5E8OA 1SM3H 2YEZB 2V7NB 1BIIB 3OKKA 4CVZA 1OL0A 5FYKL 1WZLA 4HQQH 5GGTL 5FDYA 5DC4B 5HGAA 1NFDE 4TRPL 1FAIH 3STBA 4LCYA 3VXUE 4G5ZL 3UTZA 4M48L 5K9JH 4KU1A 3BXNB 4JN1L 3FQNA 1U8KA 2A6IB 3LN4B 4TYUA 3JWDC 5DVKA 15C8L 1S9WA 2CLZB 5I15L 3H7BA 4MA3A 4R4BB 5C0AE 3T0DA 3WKML 5FKAB 4XNMB 1BHGA 2FJHA 5JDSA 2LV4A 4XP1H 1ZT1B 3TJEH 3QIWD 5MEOB 5EORL 1C8PA 3BO8A 3DGCR 5E2TH 5LQBL 2EXYC 5MHSD 2EH7L 5EIVA 1KENH 1CWVA 2NW3A 1I3UA 1U93A 1S3KH 1HK6A 3IS0X 3PWUB 4WV1A 4N0YL 4Q9RH 4Y5XA 4LGPB 1HILB 2D0FA 1XCTA 1M4KA 2DQFA 4MS8C 3D85B 4H88L 2CLRB 3D25B 2OI9B 3GRWL 1OSZB 4N0UA 1NGZB 5IEKB 5BVPH 3B2UC 2A77H 4JO2L 1IL1B 1CFBA 1WC7A 4UV7H 1P1ZA 3F7VB 2WLYA 3JV4A 4YK4C 2ESVB 1KIPA 2OMBA 3A6BH 1KEGL 2ZNWA 1FFOA 3NACH 3NFNB 5DVOA 4OCYH 1EFXB 2X1QA 4ONOA 3RZCD 3B3IB 5DJZA 5HGBB 2ERJC 2JCCE 1UWGL 4FFYH 4I0PD 4OIBA 2JE8A 4FFWC 3V6BR 3MCG1 4ENEC 5C0NC 4LLQA 1JK8B 1JGEA 4ZUUA 5JQ6H 2DBLL 4PLNC 3FO0H 4WFFD 4S1SL 5I75C 1EHXA 4WWKC 3UP1A 2X42A 3KYMA 3EDEA 4TN9A 1M7XA 2E9IA 1A7BA 4PYGA 2VERN 3M1BB 1S9KC 4X9GA 5BV7L 1LE9B 4Y4KA 2UUDH 3QDJD 3MRIB 1U8NA 2ZJSH 3E3QE 1YA5A 1G7LB 2FH6A 3SOBL 1IAIH 2UZIL 2YN5A 4YHYC 4LMQE 1V5JA 4FFVC 4LNVA 4GRLD 1S78D 5ID1A 3VG9C 1PZ5B 4U1LA 1DLFL 3C5ZD 3CLFL 3TJHD 3DXAB 3IDMA 4GUPA 1YPZF 5J1AA 5ABDE 1KPUB 1BD2E 1QBLH 4C4KO 1IGML 3U79A 1FJ1A 3FO1B 3PNWA 4LLWB 2R9HD 1F6AB 3AB0C 4IJ3B 4D9RE 1YEIH 2WBJB 3K8KA 5IQ7H 4PRIE 3WLWD 5ISZA 2DN7A 4JGMA 2J5LB 2HP4A 3VFGH 4XCFL 3FO2B 1BBDL 3RVVC 4P5MB 2A2QT 5HYSB 1BJ8A 2R2HA 5D93C 1DVFB 4PREB 1UWXK 4X9FA 4JZNA 1C12A 3CCHB 3OKOB 4O4YL 4QGYA 1Y18B 3OGCA 3ZMRA 3VFMA 4KPHL 4YPGB 2FYYA 3SGKA 1HHHA 3MXVH 1QA9A 1PG7W 1ZLWH 4JDZB 5LWYL 5IHZA 3QBTB 4K94C 1GGYA 3MV9E 1U8JB 3OKEB 3WUWG 2NY3D 5CJXC 1RIUL 2WUBL 1U8HB 4IRSA 3KLHC 5GS2H 2GSGB 1CT8A 2VL4A 4HUWA 3LAFA 3O45B 1AXTL 2FEDC 4ZOAA 1DQQA 4M62L 2FB4L 3DHMA 4G3YL 4OLEA 4Z9KB 1ZWIB 3HNSL 4HFWB 4MSWB 4XVSH 3GBNH 3HZVA 3ZT7A 4MA8L 2OZ4L 2EYSB 5F6HI 1TITA 3QZWA 4WEBH 2XN9D 2NTFA 4PRPB 3Q2CA 3RVXD 3LPFA 1ORQB 5FECB 4R8WL 3TBTB 4ELMA 4DKDC 4NO5B 5FK9B 1OTUC 3OKMA 4ZFFB 4ZYKA 3PIQB 3IFPA 3VRJA 4K3EL 4B0MM 3V4PH 1GGBH 4ZXBA 5FGSA 1A9BA 1HDMA 1EEYB 1GGTA 4NOBA 4ZTOH 5KSBB 2EDNA 4U6XB 2X1OA 3O9WB 4NN5C 4OV6F 4ZQKA 4P46C 1ED3B 3O2WL 4H8WH 3RVTC 1A6WL 5DVNA 4HKXB 1NUNB 4ZDHB 1T5WA 1S9VA 4JPKH 4HJ0C 3KYKL 2P5WB 2YD9A 1YEKH 3MJ8A 1J8KA 2O26U 3REWA 3TFKD 1OGAB 4P3CH 1JBJA 3MBXH 4MJIA 1JIBA 2FJFA 3GMOB 4L8DA 3ULUE 3P2TA 4UDUB 4X6CE 3RI5K 1KTRL 5DMJB 5D1XA 3GSOA 5GS1B 2UVFA 2Z8SA 3BIKB 2VISB 1QSVA 5ICZB 1EX0A 1G9NL 5KSBE 1U8PA 2F53A 5CAYB 3GIZH 4QY8A 4ESKA 2YRZA 2D7TH 4OI8A 1KOAA 5C09D 1FE8L 5C0DA 3ZKMD 1QQDB 2VKXA 1C16B 3T4YA 1QSEA 5I74C 3SDXF 3D87B 3B6SB 2N7AA 4P9ML 4WU5B 3QIWC 2PUQT 3VXME 4OGXH 3MJ9A 5CZXC 5JXAH 4NWTH 3I84A 5L0QC 2BRQA 4P5TB 4QKXB 4L3EA 3PWJA 2L0DA 3W0WB 4F33B 2BVEA 3VGAB 5F88B 1FN4A 1UB5B 1G0XA 1GL4B 9CGTA 1K6QL 1XF4A 1GAFL 1N5AA 4WHCA 3EDKA 1Q8MA 1MFCL 3NPZB 1CLZL 3H9SB 3UZVB 3BRFA 2RB8A 2P8LA 5D6CA 5HHNA 1T22B 1HHGB 2R69H 1DQLH 4X6FA 4UUJB 3QUKA 1OGTA 2AJZB 4LBEB 3WJLA 3LMJL 4GRMB 5IGXH 5ITBL 2A6DB 1BJMA 1I7TB 3LD8B 4LSPL 4MQ7A 1UYWH 3RZCC 3ESUF 3MLXL 12E8H 4UT7L 1ACYL 1JNLH 4P59L 5EA0L 3MRCA 3T2PA 5GRJH 1KN2L 4I0PC 4M03A 2FX9L 2DYPA 1EA9C 1WF5A 4RSVA 1X3DA 3OSKA 5IKCA 5CILH 4ZUVB 2P24B 5IB5B 3CFCH 3VXRE 2DLGA 3FT2B 5I1DA 3MREA 4L4VD 5LG1A 1A7QL 1IFHH 4PJDA 1A1NB 4NZRL 5HHOA 3IYLW 4I13B 3V6ZA 4PLJD 1BQLH 1C5CH 4OSUL 2P5EB 4F7TB 5IR1A 4P48A 5BMFH 2J8UF 1UZ6E 1F8TH 4JFFD 1DZBA 4JVPA 5CJ8A 2EC9U 3K2MC 1FZKA 4AZ8A 2A9ML 1IGIL 5HGHA 1F4WH 3P73B 1MFBH 4FQLH 4F7MA 3QRFM 2VAAB 3IRZA 4LP5A 1S78C 4XBEL 3CU1A 1IGTA 4K3HA 4IHOB 3TJHC 1DDHB 4NQCE 3IFNH 1WITA 1T80A 4ODXA 3OAYK 1KB5L 4Z7UF 2YUZA 2FIKA 3F5WA 5EC2A 1CICD 4PRNA 4Y4FA 1B90A 1I7RA 1DQJA 3E8UH 5FCUL 1H3WM 3V4UL 4PJ9D 5ERWA 3WLWC 4N90E 3BHBA 4JG1L 5H8DA 5DGQA 1MCHA 3FFDB 2AV7A 3GBML 4JFEA 2MTPA 3B9KD 1W0WA 5CIPH 5IB1A 3GJFB 2W07A 3RNQA 3GKZA 1SMAA 4LEOA 2R4SL 3DX9A 4QF1A 4RRPG 4GKSB 5AWNL 5AAMA 3RWFB 5FGCB 4JZOA 2OXHA 2K1MA 5IB4A 3R8QA 4LSVL 4C56A 4GBXB 3RI5F 4N5ED 2LE9A 1LO0H 1NCBH 3UYOD 1H3TA 3JBG7 3OKLB 3JV6A 2NPLX 2GITB 2CSPA 3ULUL 2NY3C 1LILA 3G6JB 5C08B 1K4DB 5J0BA 2DWEB 2XA3A 3L9RA 4XCCL 3SGJA 5HHMB 4Z18A 5LAXA 5MERA 1D5MA 1F58H 2Y6SD 3MJ7B 3RFZC 4A2MA 1KJ2L 1FP5A 1WZ1L 2C7UB 2DIJA 4HK0A 3GJEB 4YBQC 3U9PL 3IJYA 4YHIA 1M7DB 1GZPB 2DQUH 5D96C 3C60B 2BMKB 3ESVF 2Q86A 4QCIB 1YEJH 1NCAL 3RVXC 4NKOB 4GS7B 3QHZH 5IWLC 1E4KA 4JVWA 2GT9A 5CJOH 1KELL 1KPRB 4NZDA 4EBQH 3HI5H 4NKIH 2NTSP 2IAMD 1OTSD 2G5RA 3KYNB 4LCWA 3I50L 2XQBH 4PJBB 2C1OA 2D7QA 5AG9A 3DVGA 1U3YA 1J05A 4JM2F 4MNQA 4MB5A 4Y5VC 3I3EA 3B5TA 1DN0A 5K9QG 5C2UB 1NDMB 3G6JE 2AJSH 5HHME 4F7EB 5C7XL 1ZHBB 3SGDI 3QDHA 4UILH 3DIFA 5HYQB 3PGDA 1JHTB 1G7HA 4DUVA 5C07B 5EDXA 1UCTA 1TCMA 2VXQH 3T3PF 4ZO7A 5F7HA 4MVBC 3RWIB 4UV4H 4XWGL 3I02B 5FUZH 4L8BB 4Z76A 1WT5C 3CVHB 2EYRB 2WZPD 2W9LA 5JIHA 1MRDL 2KKQA 4FQIH 4V1DE 3IF1B 5LXGL 1NH6A 4O2CB 1ZSDB 2CK0H 4RAVA 4ZAKA 2HFEA 4HKBB 5D72L 1JGVH 1KT2B 3BRDA 5GZNC 3VXRD 4CN1A 2Q20A 4PTUA 3CFBA 1YPZA 2AJVL 4YC2C 3O6KH 2D31A 5KVEL 2OS7A 2ATKB 4GAJL 4WCYH 4YGVA 5DJAB 1WFUA 4IS6B 2XRAH 3UTQA 2I60L 1ZGLP 3ZKMC 1MREL 3RIAK 2EZ0D 3HNVL 3LKRA 3G6DH 4KZEH 3V0VA 4ZUWA 4HCRH 5HYEA 4P23A 5J3HD 4B5EA 4YNYB 5C07E 3LEYH 1IJ9A 4GW5A 4J1UB 5DMYA 4FXKB 3X3FH 1A4JA 2ADGA 2VR4A 3OXRA 3MRGB 1EHNA 4Y7MA 3BD5A 2XA8H 4YQXL 1RZ8A 3NIGF 3GK8L 3LHPL 5CZVH 3GMQB 1G7MB 4JKLA 1Y6MR 4Z78A 1P7KA 4OI9A 5E4EC 1UG9A 4H26A 4FTVE 1INDL 2B5IB 3FAWA 3X3GH 4WO4D 4ZUTA 2Y7QB 2DQDL 4EDWL 3QCUL 4YHKL 2H32B 3IVKB 3BWAB 1C5BH 3BEWB 2P42B 2HJLA 4HJJL 4XXDB 4G6ML 4HLJA 4HH8A 1TJGH 2BVOA 5E6IB 2FJGA 1Z6JT 3I75A 3HCVB 3WFEH 4KMLB 2J6EH 2BXYA 3JTTA 4LU5H 4Y8DC 4PP2B 1CL7H 2BVYA 1NGXA 3HI1A 3V5HA 1N6UA 4PJXE 4JDTL 3FJTA 4KQ4H 2IPTH 2RCSL 3D39D 2PN5A 4LCCA 3U36B 1OAKH 4KFZC 5ESQA 4JFPA 4KJYA 1KJMB 1IGCH 4HS8H 5GS0D 4U4BA 3W9DA 1K2DB 5CMAB 4QYOA 1BVKB 4QRRB 2HLAA 3G04A 3BMVA 1AGFA 2FH8A 5IROC 1MHPL 1VFMA 2O93L 2Q6WB 1T3FA 5ANMA 3HE6A 4V2BA 3DBXB 4PLJC 5JW4M 1DQMH 1BEYH 2DQJL 1IAII 1WBXB 2B20A 5B39A 3GEWB 1N0XL 3TA3B 1YMMB 1V7MH 2ATPB 5IB2A 2MFNA 3I6KB 4W70A 5K9QI 5EU5B 1T20A 3HR6A 4MD4A 2FATL 3ZDXE 2CRIA 3BKYL 5CD3A 1JFQH 2J8HA 2NY7L 4Z0BL 4MNHA 1C1EH 4BZ2L 2ZCKH 4NNYB 4OZIB 4JRYB 1S8DB 5FUOL 3TO4D 1F4YL 4JM4H 4FQXC 4YPJA 4M3KB 3BP5A 5D70H 4X99A 1W72H 1X5KA 4ERSH 1CLOH 3T4AA 3I6GB 1CICC 2BHYA 1JMXA 4NZTH 1A3RL 1INEH 3CXDL 1JRHH 2R1YB 4MD5A 4O2FB 4C54A 3HAEB 4QRRE 3QH3A 3QA3A 5AAWA 4G9DA 3ALWA 2FO4A 3QIBA 5TFSH 1XR9A 2BC4A 3B9KC 5E8OB 3OR7A 5SWSA 1YY8B 4KGLA 2P8PA 1MIEL 2I26N 3T0ED 4WEUD 5HGAB 3SDDA 4LCYB 5T1LA 1GPOL 1TVHA 3NPSC 3QEQA 2PXYA 3L5JA 4EI5A 4Y5YA 4V1DD 1KCRH 3O3DA 3LKPB 3EYQD 4Y88A 3ES6B 2VZVA 4BQBA 4OQTL 5E9DD 1F4XL 2NY1B 3QSKB 5TPWH 4OZIE 1S9WB 1TNMA 1D5XA 2R0ZL 5INCB 1FL5A 4J8RA 1OTTC 3BJLA 4XGZB 3CH8A 3J8F7 2FJHB 2IPUK 2KBGA 4LRIA 3SCMA 4XX1E 3WIFA 1OPGL 3BO8B 3D3VA 4ONHA 4CVUA 2K7PA 4XPFL 2BNUB 2PR4L 3RIAF 4EKXA 2GJ6A 4WV1B 5C0BA 1JZ6A 4RAUA 4NCC2 5IB3B 3S88H 3QJFA 5C0GA 1UM6H 5CUSL 4I2XA 4D0BA 2IAMC 3DMMB 3CVHL 1WC7B 2PO6C 5C6WH 1LP9F 1FNGA 1MJ7L 3JV4B 1KIPB 5CKGA 4KKAD 3ULVE 1FFOB 2MPAH 3ARSA 3FQRB 1H0DA 3TBVB 4FTVD 1IQWH 3F62A 4OCWL 1XGQB 2BCKA 2V2WA 3P4OA 4XHQA 5C0CD 4JANA 3F7QA 1T83C 5E94B 3WO3B 4GG6A 1BQHG 4LLQB 4RGOL 1G9ML 4ZUUB 1YUHA 5CJQL 4KJWC 4NDMB 4LLYA 1GXEA 4DGYL 4QGTA 3KYMB 4X4YA 1FFNA 4NRYA 2FR4B 1ODAA 2DQTL 3HUJA 1QBBA 4KUCD 5D9SA 3UJTH 3EYVB 1WWBX 4Y4KB 1U8NB 4G6FB 4RMWA 2RBLA 5I8EB 3O6LL 1P69B 4N0UE 4N1CA 4FXGA 2AV1A 3UTTD 2WNGA 4TPRL 3DUHA 2M26A 3N85H 4XC1H 3BFOA 1UVQB 1YJDH 1A6ZB 4Z7UA 2HA1A 4U1LB 2AEPL 3QHTC 3V0WH 4G7YL 3STZB 1JNJA 4GUPB 3VXTA 5J1AB 1C5DB 4NT6A 2EZ0C 1Q72L 4U6YA 1MH5A 5J3HC 3T1FA 5E8NB 4X6DF 3SO3B 5DDHA 4XMPL 2AJYH 3BSZH 3FOLA 2R56L 3UCRA 5EOTB 4MDJB 2VUYA 3HMXH 5HHPA 1M1SA 4OZHF 2W9DH 1WJ3A 5IVZA 4KRMB 1IKFL 1SYSB 3WD5L 1R5WA 4HK3N 1RZKH 5IESL 4MXWH 1UXWA 3ARUA 4NM8L 3S37L 5E08H 4N0CC 5HD8D 4DEPC 3EYFA 3TV3L 2DQEH 2HH0H 4I18C 2R2HB 4F8TA 3LN5B 2BNRB 5FA3A 3KAAA 3P9LB 3O6FA 3QFJD 1AFVL 3AMKA 4OZ4A 3VFMB 2FYYB 1HHHB 1HHIB 1QA9B 1CDUA 1FLRH 2DLFL 4Q97A 2XNAA 1JP5A 3N1FC 2BY0A 4QOKD 3NCJL 1LDPL 3FCTA 2I9TB 1SBBA 3MO1A 3V4VL 2Q8AL 3GKWL 2ZP0T 4LHUG 3TM6A 3RQ3A 3BN9D 5SX4H 3DGGB 4OAWA 2IBBA 4M7LT 3PG2A 5HI4D 4UIKH 1UWXH 3CK0H 1QHOA 5DS8A 3QZWB 2WIIB 3RTQC 5ISZE 5GS0C 1B6DA 2NTFB 5FO7A 3L3KA 4Y19D 1OAQH 1EEUA 4OKVB 4EIZC 1OAYL 1URLA 2JJTC 4X6EB 2W0FA 4XTRC 3G5YA 1R5VA 4JM2A 1IAKA 1XT5A 5C6TL 3K0WA 1ULVA 1N8ZA 4ZYKB 5A1AA 3WIHL 4OIIL 4ZXBB 4UTBH 5KW9L 1A9BB 1HDMB 1WFTA 4QRSB 3SQOL 1BPVA 3PDOA 1WGOA 5BO1L 1Z9MA 1ZOXA 4ZD3L 3SDAD 1T0PB 4OLXH 3ZDYE 4U0RC 2EXWC 5F3BB 2NYYC 5ALBH 3I6LD 5FYLH 1ONQA 3DWTA 4Y2DD 2FCBA 4YIQA 3WN5B 4U1HA 3W81A 2BSRA 1EAPA 4JB9L 4R3SA 1KCVL 5ICXA 4D3CL 3C2AL 4JPIB 4LK4A 1S9VB 3SBWA 1GYAA 3ULVL 3MLZH 3MMEB 3MJ8B 4ORGA 1U36A 2IFFL 3REWB 3HMWH 1EHAA 4ELME 4IDJH 3EHBD 1ORSA 3C6LC 1G7PA 1QFPA 4NC0B 4Y1AD 2YXFA 2YR3A 4K7PH 2YPVL 2OM5A 4L1DA 4YHNB 3TNNB 1CGSL 5T1KA 32C2B 3T0EC 2GTWA 3GSOB 4XHJC 4OI7A 4UAOB 5GS2D 1SY6H 2WWKO 1AY1L 1U8PB 4LKXA 4XAWH 3X13B 1NBVH 4QY8B 1CXEA 1DFBH 1VB9A 1CXHA 1I7ZA 2Z9TA 5HTSA 3IXTA 4RGNE 5IHUH 3KYOA 1U8LA 5GISL 3WV0A 2FSEB 5C0DB 1KGCE 2DJ4A 3U0WH 4FZEH 1A6AA 2YPKA 4XPBH 4F9PA 5T3ZL 3QDJB 2MQCA 3MACH 3SE4C 1QSEB 3FOMB 5HYJA 4POZC 2JB5L 3I85A 5HJ3A 4K8RL 4MMZC 5JMOC 3P9MB 1NAMH 1QLEL 1OP5K 2WWKT 4TULH 3MV8A 1FORL 3VDBA 4L3EB 4QTHA 3QYCA 4OB5H 2VXVH 1HN1A 3L3HB 3L95A 1A2YA 3LQZA 4GRLB 4MJIE 2VDOH 1NEUA 1FN4B 2O5XL 4RFEA 4HT1H 3TC9A 3WO4C 5CEZE 5JW4R 3C5ZB 4LVHC 1N5AB 4PJEB 3OL2A 4IMKC 1AGEA 3VGBA 1A14H 1F45A 3FHQA 5JZ7C 1Q9KB 1ZVSB 3UC0H 1JTPA 3UJIL 3NIFF 1HSAA 4NM4L 4ZG1A 4LPTA 2AEWA 2P8LB 5D6CB 3WFCL 5HHNB 4X6FB 3QUKB 1OGTB 2F53E 5C0JA 1CLYL 3WLBA 2EDRA 5E99L 1P6AB 4X7SH 2AK1L 1IGJB 4RRPA 4MQXD 3QXDB 3S37X 4R2GC 4DAGH 4QWWD 2X4OA 4BFEA 4I48B 3TVMA 4MQ7B 1GGCH 3S5LB 4K7PY 5J6HA 5JOEA 4ZO6A 3MRCB 4NGHH 1QSEE 3G9VA 4Z7OF 3LRHA 2DYPB 3VD4A 2R0KL 2YMXL 3GIVB 1K4CA 1LVEA 1RFDL 5KVFL 2BDNL 4LCIH 4XCEA 3OG6B 3L5HA 2DM3A 2Z35A 5E6YA 5I1DB 2H3NA 4TSCL 4L3EE 4P2QA 2F15A 4JFXA 1S7WB 4YHMH 2VDQH 4PJDB 4UU9A 1NGQL 4JJ5B 2VLKE 4B41A 1UM5L 1KLFA 5IQ9B 4G9FA 3UTOA 5FB8A 4Q6IA 2CDEA 1E6OH 2BVQA 5HGHB 1RUAL 1D5BA 2H26A 1F3DJ 4U1NA 5D71L 4KJQD 2Q8BH 4L9LA 3H42H 3OKNA 4BSVA 4XVTH 2DQCH 3I3DA 3V5DA 5E7FA 4XC3L 4HMCA 3O41A 1OSPL 4AM0B 5EBGA 5DD3L 2DQGH 3D18A 2WM0A 5GRWA 1SEQL 3TBYA 4OLZL 4LSUH 3RX7A 4PRNB 4WI9A 5J4MA 2E9JA 3WXWH 1I7RB 5E2WL 3BUYA 5J13B 4JGJA 1ZHLB 3B5HA 3QDME 5BXFA 4LARL 1IEAA 2ADIA 2AV7B 4S2SB 4AJ0A 5EU4B 5HHOE 1W0WB 2UZXB 5F1NB 5HD8C 2RFXA 5IB1B 2GUOA 4IRZH 4LEOB 3VMPA 3BDYL 3WXVH 4JPWL 3DX9B 2OTPA 2M8XA 5IB4B 5IFAH 4OCRH 4OF6A 3GHBH 1CL7I 1VGEL 2AGJH 1W8OA 3JV6B 1I9EA 3QPQD 5GS3A 4NNPL 5LAXB 4HBCH 1D5MB 3MLYL 3FAXA 4LVNC 2BHZA 3BN9C 4OGYL 2BSTB 4HPYH 3MODL 5T33L 4HK0B 1IKNA 5DI8A 3QG6A 5F7EH 2ZSWA 1MJUH 1JNNH 4YHLL 3FT4B 4JFEE 1FNFA 1YC8A 2E8YA 3VMNA 1BM3L 1CD1A 2V7HA 2GT9B 1UM4L 2ZCHH 1I8KA 2V5TA 4QRPA 1WAAF 4NN7C 1MPAH 1PY9A 5DJ2B 3ZKND 2YPLA 4PP1D 4LCWB 5GRXG 4P9HC 3OWEA 4C56E 3DVGB 1J05B 4EN3D 2HYMA 4RGMB 4MNQB 5DURD 3EOBA 1R0AL 5CEZL 3LEXA 2ZCLH 3MJ6A 3U4AA 3SDAC 3KNBB 4L4TA 3L5WA 5FYKU 3Q5OA 3ARFA 4JRXD 4DKEH 5EUKB 1W0YT 3DIFB 3U7YL 4WTZA 5A2KH 1JPGA 1JRHI 3O6ML 1G7HB 2HRLA 4OJFL 4MNGA 3ECBB 2O61A 4Z76B 2APTA 3NFPA 5J12C 5JIKA 5M94B 3UO1L 3AM8C 3ULVC 1U95A 5DLMH 2IC2A 1KYOJ 1O0VA 4M6ML 4JQVA 1EXUB 2OJZL 4HZLA 1KB9J 3EHBC 5SWZA 1LEKA 4PB0L 5L8KB 1UA6H 4PG9A 2NX5D 3BI9X 3IDIA 1SVCP 3MJ9L 4M6NH 3GBLA 3KJ6H 3S96B 1Q0XH 5GGRY 4OFIA 3OF6A 4PTUB 4M00A 1FG9C 2X4QA 3MBED 3JVGA 3P0YH 3U1SH 5ICYA 2D31B 2CKBB 3REVA 1MQKL 2ADFH 4Y5XC 2VLKD 4PTTA 5KG9A 3M8OH 2BJMH 2BVPA 2A6KA 4X6DA 3UTQB 3ZKSD 3B8SA 4LFHG 3LKRB 2CQVA 1EGJH 1FBIH 3V0VB 1EZVY 4KUZH 3VFOA 4P23B 4JFFB 5DEFA 3SDYH 4K8RC 3FRPG 2HKFL 4GW5B 4R4NC 1NC2D 1ZGLB 1QHPA 5TF0A 1A4JB 2D7OA 3OXRB 2AJ3A 5FM5O 1RZ8B 2QADD 4GXVL 1QNZH 4BQCA 1MEXL 3EOTH 3VFUA 3O11A 4JO3H 5F7WC 1RIVH 2NY2B 2PYFB 4FXLA 2E5EA 4PJFB 4CVXB 1ZLVK 2NCMA 2R4RH 4ZUTB 4XI5D 1F6FB 1EJ6A 1OT2A 2UYLA 2ZPKL 2HJLB 3IDYC 4LHUD 1YPZE 3QDMD 1B4JL 2FJGB 3U7AA 1EV2E 4PJ9B 4BH7A 5EFIB 1K8IB 4JCMA 2A74A 2JIXA 4P4RA 4QWWC 2FD6L 2AI0H 4U05A 3AC0A 4ZOBA 4YDVA 1NGXB 4Z7WA 3U9UA 3V5HB 4OCXL 2CRYA 2OTWA 1VKXA 4YJZL 5EO9A 3RUGB 3ZSSA 3GMRA 1ZA6A 2Y36H 5TGBB 3S3SA 3NAAL 4JFPB 3O4OB 4KJYB 5ESQB 4PS4L 5ENWA 4DW2L 1RUML 2VXSL 3W9DB 4QYOB 1VFAA 1OOAA 4C55A 3G04B 3L1OH 3BH8A 1CLCA 2E6PA 1RQ5A 43CAA 1U2HA 3AS1A 4BZYA 4NO3A 3BISA 2ZUTA 3THMH 1U58A 4EUPG 5F44A 1LO4H 5EU6D 3HE7D 4Z5RA 1H8NA 3ARWA 1T20B 3LRSB 5L9DH 2GEEA 5JXEA 1Y6NR 3FB5A 5CD3B 5L2JB 2QHRL 1RZFH 3MOAH 1L7IL 1EJOL 5AZEL 1RVFH 5F7KC 2J2ZA 4GKNB 4HX1A 1T04A 2EH8L 1TZIA 3BYYA 1QBML 4LIQL 3QEUA 3MYJA 5JA8B 4BH8B 3BP5B 5IBLD 5J89A 5IVOA 5EO1B 3L7FB 1QO3B 3T4AB 3VXPA 3FO9A 1I8IA 3CXHK 2A0LD 1DEDA 1OARH 4MD5B 3V95A 1P4IL 2A6JA 1X7QB 4IRSC 3QH3B 3QA3B 3F12A 4G9DB 3UEZA 4M5YL 1VENA 2FO4B 4X5WA 1BREA 5ANME 3OR7B 5SWSB 1TXKA 1XF5A 3HB3D 1U8IB 4S1QL 1XIWD 3SDDB 1JL8A 1CVRA 5T1LB 1C08A 2H2PD 2JELL 4PB9H 3BDBA 4K3JL 2PXYB 5I1IH 4NKDA 2XFXB 4EI5B 5I76B 3RWGA 4OCNC 1OW0A 3QPQC 5SX4I 3HPLA 3U0PA 5HI3D 1D5XB 1FL5B 4J8RB 3U46B 5DQDL 3B9DA 3JUYA 1FGVL 3C6SB 3WIFB 5C0EA 4ONHB 2ICES 4M3JA 4KRPD 3OTTA 4NYLA 2F8XC 2J7LA 3G5XB 2NXYD 5BS0A 4LPVA 2GJ6B 2NY6D 4RGNC 3RL1A 4N8VG 4RAUB 5E2VL 5KSVA 1KBGH 3GMNA 4DN3H 1T1XA 4M7LL 5SWSE 3ZT6A 5LGJA 3QQ3A 4I2XB 2B2XH 3MOQA 4CGTA 3WFDH 1HYSD 4NFBA 4PP1C 3FQXA 5B3JF 1V3JA 1L7TL 1QFUL 3QEQE 3SDXE 3ARGA 3S35L 2W0KA 4EN3C 2Y07L 2VYRE 1U6AH 3EYSH 3PF2A 1H0DB 1M6OA 3TZVD 1ZE3C 3VWKD 3MV7A 4K23L 2P7TA 2BCKB 5C0RH 3P4OB 4RDQG 2ICWJ 4WO4B 2Z0BA 2W9EH 1RULL 4JANB 4PR5B 3I9GH 4YE4L 5D1XC 4PJAF 4GG6B 5T3XH 3D3VE 4RBPH 3KPRD 1BVZA 3P30H 3BGMB 4XAKD 1NUGA 4LLYB 1PLGH 2Z8VC 5TH2B 2GJ6E 4X4YB 1FFNB 1MFEH 1B0RA 5FCSH 1CQYA 5C0BE 3B9VA 3HUJB 4TVPE 5D9SB 3FN0H 1BIHA 3VFWA 5I19L 4DVRH 2WBKA 5ESVA 2OMNA 4I2XE 3DRQA 1TTUA 2OK0H 1NCCH 1OAXL 4YXLL 3MRBA 3IDXL 3D39B 2XKSA 2AV1B 2ITDA 5IVXF 3VFVA 1N5YH 4HW6A 1LNUA 2E7CA 4PRHA 3P4MB 2IG2L 1L4IA 2QQNH 4J3WA 1X9QA 3D0VB 1TQBB 1Z3GL 5CGMA 1BGXL 4L8CA 4M6OL 1TVDA 4JKKA 5I8OH 3MNVA 4EI6A 4HJGA 3WDHA 3VXTB 2F5AH 4YGAB 4TTDD 3U0TA 3V2AR 1EVTC 4NT6B 5IK3A 5FO8B 3LS4L 4GG6E 3CFEA 2O5YL 1C7SA 1CIUA 4JFOA 3LQAL 4M1DH 5DDHB 2V2TB 3TBSA 4KRNA 3FOLB 2Y5TA 3WJLC 2B4CL 2J8UE 3L3DB 5IVZB 1MWAA 1CG9B 2GSIA 3LEVH 1T66D 1MCBA 1R5WB 4WUUA 3VXNA 2HFGH 4QRTA 5FGBA 2DD8H 5AYUL 2HMIC 1QG3A 4HXBL 5ADPH 3TO4B 1VEPA 5ALCL 4HS3A 3KWWB 2GAZB 3RDTA 4RWHA 1RSFA 3PWLA 4JO4L 4OF7A 4LAQL 3IKCA 2H1PH 3TBWA 1AGBA 4ZS7L 3ZHLA 1FO0A 2XNAB 4HSQA 4PIRF 4Z7UE 3OJMB 3FCTB 3TYFA 3AREA 1IC7H 4GXUM 2Q76B 4ZS6D 5JW3H 1PKQB 2VTFA 5I1GH 1XR8A 4WJ5A 1PQZA 2NNAA 1BBJA 4AH2B 2ZSVA 1MHHA 4WTXA 5FOBB 1DN2A 3SJVA 2IANA 3TCLA 5DS8B 5DUPL 1FV1A 1WAAA 4JFDA 5D5MF 5FO7B 2VLJA 2WP3O 3UBXI 5L8JB 1N0LA 4R0LA 1HSBA 2W0FB 1R5VB 2HFFA 3G6AA 3RBGA 5DD0H 3RPIA 1I1CA 1D9KA 5EWIL 5J1TC 1SJEB 5CGYD 5KS9F 1N8ZB 2JJWA 4Y4FC 3A6CH 1I9JL 2G75B 3FQTA 4U7MA 4AG4L 4JY6B 3PDOB 3FN3A 1MY7A 5EZOL 2WP3T 1QSZA 3IDJA 2FNBA 1HIMH 1A3LH 1ONQB 1BFVL 4DOHB 4U1HB 2F8VA 1EAPB 1DE4B 4UZGA 4KQ3H 5FF6A 3QG7H 3QP3A 5ICXB 2FO1A 2DTSA 2RAMA 1F4HA 1NL0L 1QACA 2YSSA 4ORGB 2QV2A 3ILPA 3V6OA 5DJ0A 1J88A 3SGJC 3OAUL 3VGHA 1ORSB 1F11A 4QHKJ 3WNOA 5JA9A 1N6VA 1WICA 3CX5J 4TUOA 5C0CB 3P77A 5B8CC 4XP4L 5LBSL 1GHFL 3HB3C 5E24E 4LSRL 2GTWB 3PWNB 3SKMA 4WU7A 2IF7A 2V17L 1QKZL 2C4FT 4RIRA 4F7PA 5SV4A 4K3DL 1ZS8A 3H2WA 4NO0D 1NMCC 1F3DH 2LTQC 4NQEA 4NUGH 3T3PE 1U8LB 3DYMA 2Z92B 1WUNT 4MCZA 3RWCA 1DSFH 4F58H 1T5XA 3BKMH 5IOPB 4Y16A 3UTSD 2VDPH 1LO2L 3DETD 3CLEL 5BZWA 4NUJA 4U1KB 1MRCH 5JW4Q 1KF9B 4KRPC 3K8LA 3QIUD 1MI5D 4ODWA 1NLBL 4I5BA 1HXYA 4QTHB 4XWOC 3WS6A 2NXYC 4N9GA 3N9GL 4NQDD 3LQZB 3L95B 2NY6C 1A2YB 1J0KA 2XG4A 3RGVD 5HDQL 2WMPA 4QXWA 1QFHA 3QCVL 5GJTH 2VLLB 5DK0A 4BK5A 3LN9A 4XZUA 3CH1A 2ADJA 3FMGL 3GSUA 5GJSL 5A2JH 1AGEB 3EJZD 3SPVA 1UACH 4Y2OA 3W5MA 3TT1H 1J0IA 5IW6A 5FYLD 1TJHH 1ZTXH 1ADQA 5C0JB 4OLUH 4XBGB 4CU7A 3N1QC 1U91B 1U8QA 1OP5H 4ACPA 3RU8L 2X4OB 3TVMB 3VWKC 2HG5A 3NIGE 4ZAKC 5I30H 5HYJE 5TE4L 4NHUB 4TOYL 1KCSL 2EICA 3AUVA 5D1QA 4LQFL 4YO0B 1K4CB 3QFJB 4XP6L 3CDGA 3EBAA 2HWZL 3MRRA 5JHDD 1BQUA 3K4ZA 4O00A 3QEHA 3MV8E 4U6VL 4M7JH 2EO9A 3PL6A 4JFXB 2EYTA 1AO7E 1YYML 1P7QA 1YEDA 4IIQB 4HIJA 4UU9B 5FHAH 3WNLA 2QR0A 1T1ZB 2X4TB 3C5SA 1IQDB 2E7LC 3NMEA 1F5WA 1HINH 4Z7QF 1UWEH 5FB8B 4DK3A 5DSCA 2A1WH 4GAGH 4PJCA 3T8XA 2X4NA 2CDEB 4E0RA 3U83A 1NMBH 3BPLC 2BVQB 4HHAA 1D5BB 2H26B 4U1NB 5TE7L 4U3CA 3HR5B 1KCUH 4L9LB 4U2ZA 3OKNB 5GGUB 5K59E 2CKNA 1TFHA 2A83B 2ARJQ 3UYRL 1AD0A 5F9JB 3MC0A 3O41B 3R06A 4FS0A 4XP5L 1NBYA 2H45A 4Z7NF 5HHQB 3S97C 3ISWA 1AE6L 2IQ9H 4JLRA 3E6FA 4TTDC 2XWBA 3B4NA 3BVNA 4I77L 2B1AL 3LS5L 3VFTA 4NRXA 5I1CL 4MJ6A 1FH5H 3LQAC 3O81A 1I1FA 2VZ1A 3BUYB 1U8OA 2DWDA 3JWDH 3MRDB 1FSKC 4P2QE 1FG2B 5BXFB 1FYTD 2VDNL 1DR9A 2DDQL 5SWQB 2ADIB 5F6IC 1ZT7A 1KFAL 1T66C 4DQOH 1X5GA 5CCKH 4Y2DB 2G60H 4KK5D 5EO0A 4G9FE 4PJGA 2OL3H 1NCDH 4D9QD 1J87A 2NLJA 4LCCC 1HQRA 4HC1H 4K9EH 5E70A 3EIFA 2MMXA 3ORJA 2X4PA 4U1IB 5IMOA 1OT1A 1JTOA 2EIBA 4RMQA 3GSQA 3DX7A 4WW1A 1NAKL 3HE6C 3IETA 3VXSA 3MGOA 3DURA 1A7PH 5E4IA 2IBZX 4QHLB 4XH2B 1J8HA 1UT9A 4P2CG 1HEZA 2ZG1A 1SJXA 2W38A 1FNAA 1G1YA 1NLDL 3DROB 5DI8B 4KK6C 3QG6B 3R1GL 1SVZA 2X6MA 4XPTH 1G7QB 2XZCH 4XPHH 2IMNA 4DVBA 3MROB 1JGLL 3VFRA 4JG0H 3L3GA 5DD1L 3MRLA 1CD1B 2V7HB 3GB7A 5HHXL 2UWEA 1UC6A 1VSCA 1G6VK 1RMFH 1I8KB 1YQVL 4YFLF 4E42A 1CR9H 2YPLB 3KGRA 5C3LD 1P4BL 3MLSH 4ETQA 3QWOA 4HKZA 4C83A 1GRWA 3QI9D 5T1DL 2CMRH 3EOBB 2F5BL 4NJ9H 3LEXB 4NP4L 3QIBC 4G43A 4X7FC 4L4TB 4HWBA 3L5WB 1J1PL 4LLMA 4F15B 3SE8H 3DSNA 4E41A 1RIHH 3TWCH 3RKDC 2VDKL 3AU1A 5F89A 4MHHG 1AI1H 3R8BB 5FM4A 4Y5YC 1I3RB 3BZEA 4K07A 1U95B 4N8CH 3ARZA 3CFKB 1ZHNA 1FAIL 3JV0A 2EIZB 2KDGA 4J4PA 1NCWL 4DCQA 1CF8L 1LP9E 2Y4SA 5SWZB 3QCTL 5JOPE 5IJVA 4F37K 1I3GH 1QVOA 4QRPE 2B1HH 4LRIC 3SCMC 1W0VB 2VOTA 3ARQA 2G9HA 4DFIA 2X4QB 1AO7D 3HI6H 1CK0H 3KHOA 4LCUA 3T04D 5ICYB 4EUPA 5F7LB 5DFVC 5E2TL 1Q94A 4L5FH 4NHCL 3ULUF 5KG9B 4EDXA 4APQD 4L4TE 4F57L 2A6KB 4O5LH 1CE6A 4YXKH 1NMAH 4NZJA 5EIQA 4YFEA 3NGBC 4RCAA 3JTSA 4Q9RL 5IHLB 1S7QB 3VFOB 2XIDA 2VR9A 4DUXA 4K94H 5J6GA 3CDFA 3H8NA 4MNGE 5KSBF 2P43B 5E8PA 2AJ3B 1DBKL 5CD5D 3MRPA 1HYRC 1UKSA 5JLZA 1QSFA 3GRWA 1KULA 3WIIH 5CLWA 3GNMH 4G8FA 4UV7L 3IDGA 4DGIH 4R90H 2R0WH 5EOQL 4LRNH 5SWZE 4UDTA 3PHOB 3A6BL 1CQKA 5GIRA 4DN4L 3IDNB 2VLME 2UYLB 1IGFH 3GJFK 1FNLA 3EJZC 5LGHH 1A64A 2HT3C 43C9A 1RPQA 4XNZB 4BH7B 4E9LA 4ODSL 4X6DE 2JIXB 5HHVL 1ITCA 3QXVA 4PJ8D 5IJKA 1J1XH 4YDVB 3U9UB 4Z7WB 2E27L 1B0WA 1G6RH 1VKXB 4S1DD 1CN4A 2I24N 3MRQA 1E28B 4H5SB 1L9NA 4CDHA 4I3GA 1ZLVH 1OAZH 4LVOC 4P2OD 3BQUD 5I2IA 2I07A 4UT9L 3OZ9H 4YDLC 4KVNL 2VWEE 3BP4A 1VFAB 2Z93A 4WWID 1TETL 3SEPA 5KS9A 1TZGL 5E5RB 3AS3A 4JGUA 1JWUB 1H5BC 43CAB 4WTWA 1FHGA 4U1JA 3VFPA 2FBJH 3EO1B 5IFHH 1H3UA 1S5IL 3U4BL 3GMLB 3GM8A 4GRWB 4OUUA 2APFA 1U58B 1WCQA 2C5DC 2BNQA 4Z5RB 1PFCA 4CDGC 1A5FL 1QBLL 1WV7T 3FB5B 5CWSA 4C58B 5KAQG 5F3HB 3SE3A 3VWJA 1G9EA 4PJHB 4HX1B 4Z7WE 4CJ1A 4HPOH 3KPPA 3MRFA 4MHHI 5FUCE 3O6FC 1TIUA 1SYVA 3QEUB 4TRPH 4HV8B 1AGDA 1KPVA 4G5ZH 4M48H 1UJ3C 4U1SA 5E5MA 2DM4A 3O8XD 4JN1H 1DJSA 4CAGA 5AD0B 1BQHB 1R3IL 1D5IH 15C8H 1JZ4A 4XVUC 5I15H 4FABL 1P9MC 5I8KL 1VACA 2CLVB 3WKMH 3FQWA 1F3RB 1RJYA 4JRXB 1RHHB 3PHQA 4KK5C 5HSFA 2FDBP 4GRWE 1XF5B 4PJIA 5EORH 2I9LB 2EH7H 4HG4K 5MEPB 3NBNA 2DICA 5HYFA 2Q7YA 2XTJD 4BM7A 4JY4A 5CIPB 4N0YH 4P57B 4NKDB 1WWWX 1JNHA 4F37F 2W65A 3GBNL 3RWGB 4WVRA 1A6UL 5JOPD 4F80A 1N3NA 1UEYA 5BW7A 3FB7A 3MFFA 4XMKL 4J3OC 4JM2C 2CIIB 4PRBA 3MRKA 2OZ4A 3U0PB 1P4LA 1W8NA 2NX5B 2CO7B 4JO2H 2O5ZL 2APWA 4KK8D 3VH8G 5DK2A 3DJ9A 2IPKA 5C0EB 4TUJA 1WLHA 4UTAH 2X9WA 3MBEB 4NYLB 4HBQA 3RL1B 2XWTA 5KSVB 1K3IA 4ZTOL 3QUYA 1K5NA 3N1PC 5GGRA 3INUL 1IILE 5DZLA 5LGJB 1PBYA 3QQ3B 2EEDA 1I8LC 1LQSR 3ZHDA 3DV6A 2OP4L 2ARJA 2V7NA 1BIIA 4S1SH 4I1NB 2ORBL 3FQXB 1JWSA 5J7CC 1V7NH 1NC2B 1ZLUK 3BT2L 3LV3A 4JFZL 5D2NB 1CD8A 2QADB 3ARGB 4PJ5A 2HT4C 5BV7H 3QI9C 1REIA 2GQHA 5C0FB 4Q0XH 4HUVA 5D7JD 2C3VB 2J4WH 1M6OB 4X0KA 3MV7B 3BXNA 2P7TB 3GSXA 1CXFA 3H9HA 3O4LE 3SKJH 4HEME 2APVA 3LN4A 2FX7L 2EE9A 3DYOA 4RX4A 2CLZA 3QUXD 5FKAA 4DZ8A 5GSRB 4ALAL 4XNMA 4LHUB 3SDCD 1T89C 4J3SA 5BS0E 3G6JF 5MEOA 1DLFH 3CLFH 3CFIC 3MGTB 4RFNC 3NIFE 3H0TA 4XBPA 4F9PC 4FG6D 3PWUA 3GIZL 5ESVB 2D7TL 3RAJL 1IGMH 3TF7C 4X83A 4RMUA 4JCLA 3X12B 3D85A 3W2DL 1LNUB 3J7HA 3D25A 4BYHA 1CCZA 1OSZA 4JQXC 5IEKA 4XCFH 2NW2A 4OZGA 1BBDH 3VD5A 1IL1A 1JYVA 1L0YA 3F7VA 4OGXL 3MV7E 4APQC 2ESVA 1X5YA 3MNVB 4EI6B 4HJGB 3NFNA 4O4YH 3ZE2F 1IZJA 4EVNA 5ADOL 1EFXA 3GHEL 3U0TB 4PJBF 4KPHH 3EDDA 3CFEB 1WTGT 4TNVK 4CW1A 1EIBA 1A1OB 5EU6B 3HE7B 3P4NB 5LWYH 3A67L 5DR5L 3K1KC 1JK8A 1RIUH 2AXGA 1ZXQA 2CDGA 1T6WA 1IM3B 1B88A 2YUXA 2E6JA 1MWAB 2GSIB 5TF1H 1DBAH 3DVNB 5FV2A 2CDFB 4M62H 2FB4H 4G3YH 5IGXL 2EECA 2XY2A 2Y06H 2RIKA 3HNSH 2WUCL 2Q3AA 1UYWL 3RDTB 4LLDB 3PWLB 4PRHE 1NJ9B 3TBWB 3O3BA 1I9IL 1AGBB 2UY7A 4R8WH 3EUUA 1FO0B 2CJUH 3MX0A 5F1KC 3GSNH 5CILL 3DNKA 1M71B 3CFCL 3TYFB 5T3XD 1LEGA 1PQZB 4OFPA 4Q6IC 5DHXB 1T0MA 3FFCA 3DXAA 1KEML 4WFHE 2ZSVB 3D2UD 4FFZL 5JR1H 3RY6A 1C5CL 4P49A 3ARDA 1XIWB 3PUCA 4M93C 1KIQB 1DTUA 5HYIA 3ZYOA 4TUKL 1TPXC 3TCLB 3BQUC 2PW1A 5E8DL 2VZTA 1QLFA 5ETUB 1FV1B 1MFAL 3BPNB 3FO1A 4LLWA 5F7UA 1F6AA 4WUUE 1F4WL 2EKJA 2VQUA 3O2WH 5CSBA 3TPKA 4R0LB 1YMHB 1A6WH 3GI8L 3MZGB 1JPTL 5EOCL 3FO2A 4P5MA 3PGFH 4P4KA 3RPIB 5DEGA 4ZFOA 5HYSA 5IV2B 1D9KB 3KYKH 5CEYA 2AEQL 4PREA 5GPRA 3CCHA 3IFNL 3OKOA 4U2YA 3LPWA 1Y18A 2N7BA 1ZEAL 2V5YA 2YD7A 4FQ2L 1RUPL 4R97B 4F2MB 3E8UL 3C2SA 1QR4A 3X14B 2K7QA 4XMLH 1S7UB 1U8JA 1X4YA 2DQHL 4OCSL 1U8HA 1NGPL 3PWPE 1AP2B 2PYED 5FXCH 2FHCA 1G9NH 2CRMA 3O45A 3SJVE 2IANE 3H9YA 1KJ3L 1J7VR 3MCKB 2YSSB 3O8XC 1ZWIA 5D8JL 4HFWA 2X89D 1WAAE 3C9NA 1FE8H 3ILPB 4JFDE 4MSWA 1G1CA 5FM8A 5C9KA 2VLJE 5DJ0B 5I6XC 2W1NA 2EYSA 1PX4A 1YNKL 4MDIA 4OM1L 1EERB 3O4LD 4M61B 3TZVB 5DRZA 2NY5C 1FVEB 3G5ZA 4AEHL 1ORQA 7FABH 2X05A 4TUOB 1A6VH 3P77B 4P9MH 3MUZ1 4OM0L 4NO5A 1IKNC 1I1AA 3KPRB 2R23A 2AK4E 5D7LA 3SKMB 4ZNEA 4WU7B 3PIQA 4F7PB 2NXZD 4OLYL 5TDPA 2RR3A 3S3PA 1EEYA 1GAFH 2DQUL 4NQEB 1FPTL 4CKVX 1RUKL 4MCZB 5I9QB 3RWCB 1T5XB 1UB6B 4U6XA 1HZHL 1CLZH 3MLVL 4KY1L 3LKOB 3BPOB 2I27N 4H0GA 1EH9A 1ED3A 4KK8C 2LABA 4PD4K 3LMJH 2EE6A 4KDVA 5I1HH 4UIMB 4HKXA 5FOJA 4NKIL 3S34H 5ITBH 3ROOB 5A40E 3SKUD 3CPLB 3V6OE 3ARBD 4LSPH 4X7DC 3MLXH 1H3PL 4OZIF 1FC1A 1ACYH 4P59H 2EIEA 4TNVF 4UT7H 5EA0H 1KN2H 3ARFC 1A0QL 5DK0B 5DTFB 2DLHA 1OGAA 4XZUB 3TEUA 3CH1B 2ADJB 1E6JL 3GSUB 1T6VN 2YUVA 1KACB 4LAJH 3SPVB 3AROA 5J11B 4UDUA 4WFGE 3VXQA 3U30C 3CC5B 1A7QH 4NZRH 2F74A 3G5VB 3G08B 4HGMA 4JVUA 3BIKA 1IM9D 3KJ4C 4NQEE 5ICZA 4UINH 4HUMB 4HGWB 1GZQB 4OSUH 3BH9A 3R0MA 5D7JC 5T5NF 2HG5B 5D7KE 2A9MH 1IGIH 2W92A 1QQDA 2AXFB 1C16A 5EUOB 5D1QB 3VA2C 5MP6L 2CK0L 1CGXA 3MRRB 1EEZA 3BGFC 3SDCC 5DRWB 4XBEH 4WHYG 1BOYA 1P7QB 1YEDB 3TN0A 4HIJB 3E2HB 2QR0B 3O6KL 3W0WA 3PP4L 4F33A 3C5SB 4FG6C 1KB5H 2GJZA 5F88A 4MQTB 1UB5A 4WFHD 2P49B 2AAVA 3PP3H 5DSCB 2YUWA 1MAKA 2N1KA 5LCVH 3PHSA 4JHWL 4PJCB 3T8XB 3UZEA 3QQNA 2FX8L 3G6DL 1MWAL 2C3WA 4HHAB 5F9OL 4MWFB 2ZOKA 2VWEC 3H9SA 3MUY1 3GBMH 3LEYL 1T1WA 3OX8B 5DZOA 3X3FL 1T22A 1AD0B 4KDTA 1NC4A 4GRMA 3IJSA 5HVGB 1ND0A 1VFOA 4K2UH 2R4SH 3R06B 1NBYB 1I7TA 1MCOL 5ACZA 5AWNH 4JLRB 3E6FB 2XWBB 4KZDL 3BVNB 3PXJA 1N2RB 3VFTB 4NRXB 1FO0L 2W0LA 3MLRL 4MJ6B 3AVEA 2R8SH 2ZUYA 1I1FB 2ZKHL 3ULUH 1U8OB 2DWDB 4KGJA 1NKOA 2P24A 2LVEA 4XCCH 5IB5A 2XWJB 5KTEL 3FT2A 1RI8A 1TJGL 2EE3A 2OQJB 1KJ2H 1Z9SA 1WZ1H 3PWPD 2KL6A 5FUCC 4PJGB 2VLRD 3CSPA 1SJVA 3MLWL 4M7ZB 2NLJB 2UV3A 3MSPA 3PJSB 4PJCE 3U9PH 2KUTA 4WI8A 4WI5A 5DJCB 1MFDL 2P5EA 8FABA 4F7TA 1QFWM 5B3NA 5IMOB 1NCAH 1CXLA 3HN3A 4HMDA 1MCWM 3L5XL 2D0GA 4PGJA 3IETB 5D1ZA 1KELH 4I3RH 2QBWA 2XKNA 4HS8L 2VAAA 3VXSB 1FZOA 3QISA 3MGOB 3DURB 4CMMB 3I50H 1T4KA 1VADA 4OF3A 5IEHA 4IHOA 4XNYH 3KS0H 1DDHA 2AK4D 1DQML 1FVCA 4M7KH 4DVBB 5CINL 5BQ7A 5C7XH 3D1MC 2VDML 2IEPA 3KPSA 3FFDA 3GB7B 2UWEB 1JFQL 3CGTA 4D0CB 3TH4T 3UTSB 4B7LA 5JUEH 1BP3B 4E42B 4MJ5A 2JK5A 3GJFA 4NJAL 5GGSY 4JM4L 3SE9L 3QUZD 4ETQB 1MRDH 4HKZB 4C83B 4GKSA 2IQAA 1MI5B 3QIUB 5C9JA 2DI8A 2RGSA 4OLWH 1CLOL 3OKDA 4NQDB 3RGVB 4GBXA 2EC9T 5DHVA 2AABL 2V5MA 3VXSE 1N4XL 3OKLA 5D72H 3CD4A 1B4RA 5C08A 1K4DA 2ICWI 2DWEA 1BAFL 1J8HE 1P84J 5HBBA 3ZTNL 3RVUC 3NCYS 1YEGL 4GAFB 3T0VA 3MJ7A 2AJVH 4NKMA 5KVEH 4YBLC 2NY0D 4GAJH 5CBEB 4X6BA 2C7UA 2EXYD 1BFOA 3GJEA 4F3FA 1M7DA 1GZPA 1ZHNB 3WFHA 2BMKA 1MREH 1WTLA 4DCQB 3HNVH 2HTKD 4QCIA 4H20L 4FQJL 1KCRL 5IJVB 4BQ6A 5D2LB 3BP7A 4W81A 2JTDA 2DKSA 5BRZD 1QP1A 5TPWL 3HLAB 1N6QH 1OD7A 3IFLL 1F97A 1KPRA 4YQXH 3LKSB 2G9HB 3LHPH 5JHDB 2J1KA 3B2UD 4F9LA 3KYNA 3DRTA 4QXGL 4RISL 4N1EA 5F96L 4PJBA 4EUPB 4K7FB 4PJAE 1Q94B 2MJWA 1DBJL 4LHQB 3A0OA 3V6FB 2HLFC 3RVWC 2CO6B 4YDJA 2DQDH 3WE6B 3ARYA 2FWOB 1HH9A 1JTTA 1NDMA 3QCUH 4YHKH 4E41E 4EDWH 4MXVF 3QWRD 3EYOB 4G6MH 4F7EA 2V9TA 4ONFL 3BOVA 3VRLE 3S88L 1ADQL 4HIXH 4ENED 1MCJA 1JHTA 4PBVC 5E8PB 4CMHB 1J0JA 3MRPB 5FYKE 3ARBC 5IVXE 4ZSOB 4L8BA 3BMWA 4JDTH 3CVHA 4UDTB 1IEBB 2RCSH 3T0XA 2Z8WC 1NAMB 4IM8A 1T03H 3NCFB 5GIRB 3QXAA 5F21B 2DQIH 4FRWA 4O2CA 1IQWL 4NN6B 1ZSDA 4KKLC 4NFDA 43C9B 1AXIB 2QLVB 5EN2B 1YEEL 1UEMA 4M8QA 1AHWC 4WGWB 4OD3H 2DB8A 4UQ2B 4Z7VB 1X5JA 4DGVL 4TTGA 1FGNL 2F54A 3S36L 5HPMB 5DYOB 2ATKA 1JUFB 1WFOA 5DJAA 4W4NA 1N0XH 3SQBA 3MRQB 2FATH 3BKYH 1DANU 4CNIA 2BXZA 1XGTA 4Z0BH 2CGRL 2I07B 1HHKB 4J1UA 1QSFE 1Z9LA 3BP4B 3MRGA 1YNLL 2CUIA 4X98A 5FUOH 1F4YH 1IAOB 3N85L 4U1JB 3GMQA 1G7MA 3RVVD 1YJDL 4JPVL 4N8VB 4OUUB 3WUZA 1Z9OA 3WFZA 3CXDH 1RZ7H 2QQKL 3ULSA 3C8KB 1EO5A 4J3TA 1U3HA 4AEIH 1NSNL 1RJZB 2ZNXA 5C70A 1HNFA 1CDBA 3DI2B 2H32A 3BWAA 3BEWA 1CXKA 4J12A 4XXDA 4WW2B 3UYPA 4LF3B 4LSTL 5FGBC 3TT3L 5E6IA 4PJEF 1U0QA 2XT1B 2GK0B 5CKAA 1FNHA 1MIEH 5DQ9B 4ZO8A 3ZKQD 3FT3B 4PP2A 4Y4HD 1HHJA 1KPVB 1GPOH 4ODHL 2DQEL 2FEDD 1AH1A 1GJIA 4U1SB 5E5MB 2MOVA 4AQ1B 4YZFF 1CVSC 4YX2L 1OF2A 4OQTH 1F4XH 3AREC 5KS9E 1G84A 3BJ91 4YXHL 2R0ZH 1KJMA 1K2DA 4QHKI 5CMAA 1BVKA 4XRCB 2FRGP 1MCDA 3PHQB 3PQYD 4PJIB 3DBXA 4MAYC 2BNQE 4XPFH 5L8LB 4NZUH 2PR4H 2Q7YB 1KIRB 3PGCA 1GGUA 1WBXA 4JY4B 4PJDF 3TA3A 1S7TB 2LQRA 4PGCB 2W65B 4PGBB 1KXTB 1PY4A 1N3NB 3FB7B 3MFFB 5CUSH 3WJJA 2DLEA 2WW8A 1EO8L 4PRBB 5K93A 1R3HA 4JKWA 1P4LB 1JHKH 4L8SB 3U6RA 1G7JB 3LPGA 4P46D 4JRYA 5DK2B 1MJ7H 1EEQA 3BESR 4TUJB 5C0IA 4YDIH 4HWBL 4OCWH 1UCBL 2XWTB 4UTBL 1OP3K 4O2FA 4FMKA 2VH5L 3HAEA 3OAZK 5GGRB 2X9XA 1G9MH 4RGOH 4PJIE 5CJQH 5FYLL 3DV6B 4PY8J 2ARJB 4UNTA 3LH2L 1YY8A 4X8JB 1JWSB 2E7BA 3LV3B 4JKPL 3QUZC 3QDGE 2DQTH 4PJ5B 1FNEB 4HUVB 4BK4A 3MLZL 4WWKA 4X0KB 3O6LH 3GSXB 3H9HB 5I73B 3LKPA 4L3CA 4L29B 1Q38A 3ES6A 4PGZA 4G42A 4J6RL 4NQUA 4S10A 4G6JL 5INCA 1ZA3B 4MZ3A 4DZ8B 4TSBL 4MJ4A 3PV7A 4XGZA 2NY0C 2CD0A 2F9BT 1G7IB 2AEPH 5CZXD 4GXUN 5KSAD 3D5OF 3S36X 5EU7E 3H0TB 4H1LH 1NPUA 2BNUA 4XBPB 2DTML 4K9EC 4PJ8B 2HTKC 4LMQI 4Y16C 1Q72H 1DFBL 1CDHA 5DJDA 5IB3A 4QTIL 2PTTB 4XMPH 3C09B 4G8GD 4LASL 2R56H 3FQUB 4DJMA 4FQHB 3ZL4H 4WNQB 3STLA 2QKIB 4P2OB 1QRND 3U7WL 1IKFH 4I4WB 4LLVB 3BE1L 2NW2B 3DMMA 1FRGL 4ONGL 4OZGB 5IESH 4AIZB 3S37H 4NM8H 2LU7A 1NAML 3TV3H 4ZMAT 5ECJE 3Q48A 3FQRA 4EVNB 2VDOL 3TBVA 1AFVH 2PW2B 2E8ZA 1XGQA 1A02N 2ICCA 2VNCA 4CW1B 3HC4H 5I71C 5DEZA 3OHXB 3F7YA 1IBGH 1LDPH 5E94A 4Z7QE 2AXGB 5FKPA 4NC1E 3V4VH 2CDGB 3GSRA 2Q8AH 3GKWH 5ILTL 4NDMA 3IKKA 4OCMC 2AQ2A 2L4OA 4HFUL 2FR4A 4XP9L 1SEBB 3V7AE 3KXFD 1U41A 1GGCL 3EYVA 3U2SB 1WBYB 4LKCB 5I8EA 5EZLA 2FLBT 3PL6C 4Z7NE 3O3BB 3C8DA 1IGYB 3HS0B 1OAYH 5DO2D 1QFWH 4YFLI 1F02I 2ESVE 1UVQA 1A6ZA 4YHML 3TESA 1LEGB 2VDQL 1T0MB 4P9HH 3WIHH 3FFCB 3STZA 3EZJB 5IW3A 5KW9H 1L0XA 1XH3A 3SQOH 1J1OL 1C5DA 3ARDB 2XTJB 1WWAX 5L2KD 1ETZA 5IBTL 2PW1B 1QLFB 5E8NA 1RZIA 2R15A 3EFDL 5EOTA 4MDJA 5HXMA 4QT5A 4JB9H 4JREC 1SYSA 3LZFL 4L3AA 4XVTL 4D3CH 3C2AH 4P4KB 4ZFOB 5DEGB 1M05A 1EVUA 1R3JB 1EO7A 4Q2ZA 3EYUH 1AQDA 5CEYB 5MI0B 3ULVH 3QQ4A 2JB6B 3VD9A 2ZUQC 3LN5A 2BNRA 3OPZL 2ICEB 3Q6GH 2WSKA 3P9LA 2Z31D 4C4KT 2F8OA 4LSUL 5E2JA 5F1IA 3HG1D 4MA1B 1HHIA 3M07A 1DBMH 4KI5F 5C92A 4PJFF 4P2RD 1RV6X 5MENA 2A9NL 5HY9B 2I9TA 1EBPA 3AY4C 4UNVA 3RZWA 3DXAE 5LJYH 4Y4HC 5BZDB 1AY1H 2IMMA 3DGGA 2GHWB 4HIIA 3T0AA 1UQSA 2EDBA 2FGWH 1UGNA 3O2DA 5HDBF 3VXUD 3C9NB 4YBQD 5GISH 1CD0A 5CHNB 4MDIB 3WCYA 2WIIA 5T3ZH 1AKJD 5DRZB 1T0NB 5DD5L 4NWUL 2JB5H 3CFJA 3G5ZB 4K8RH 5GHWL 3RUGF 4AMKH 4OKVA 5C0AD 4X6EA 3RY5A 1AJ7L 3MA9H 1QLEH 1KLGA 3QUXB 4HBCL 1I1AB 1E27A 1FORH 1P5UA 4KAQL 4CBPA 2R23B 4LSQL 5D7LB 5F9WB 4XNQA 3QIWA 2O5XH 4GKOA 1CFTB 5BOZG 1MCSA 4H0HB 5TDPB 1ZKAA 4QRSA 1S9XB 3BYTA 2EDTA 2R2EB 4O02L 3MNWB 5F3BA 2DL2A 1MJUL 1JZ2A 2HAZA 5J57B 3EOAB 1MHEB 3WN5A 3WFCH 5D7IA 3LDBC 3F8UB 3NA9L 1CLYH 2CXGA 5E99H 1MPAL 2AK1H 1CFQB 4JPIA 2NY4B 4MVBD 3VDCA 1CGWA 3MMEA 3C08H 5I1KL 2RJMA 2Q7NA 4PRPE 1EK3A 1N26A 5DT1L 3FTGB 2R0KH 2YMXH 1RFDH 2BDNH 2X70B 3RZCA 1CS6A 4WFEE 3AXLA 4I0PA 3CSYB 3VXQB 4YHNA 3TNNA 2YD3A 4GAYA 3F7PC 4ZNEE 1BJ1H 4Z0XA 32C2A 5GZND 1OQXA 1EBAA 1NGQH 2F74B 1I7UA 5HVHC 3GSWA 1UM5H 3X17A 3BPCB 2ARWA 3BH9B 4XCNB 3X13A 1MFNA 3P9WB 1D6EA 2FSEA 1A8JH 3WHE0 4KTDL 4RWYL 2X44D 3QDJA 4FNLL 5D71H 3FOMA 3PV6B 4KROC 1EEZB 2A73A 5A2FA 1BFTA 4P3DA 4XC3H 1A7OL 3P9MA 2P5WE 4YHZL 1QTYT 1OSPH 4LLUA 3TN0B 3MLTB 5KSAC 3P0YL 3U1SL 3JWNC 1OGAE 1SEQH 4EOWH 3L3HA 4GRLA 5DJYA 1FAKT 4JAMA 2ADFL 2GJZB 4OLZH 1GC1L 4QXUH 1CFSB 3C5ZA 5E2WH 1T2QL 3D2UB 1BD2D 3NCEB 4PJEA 1JV5B 1N59A 4LARH 1Q9KA 4LDOB 3QO0B 4KUZL 1ZVSA 5DXWA 2ZOKB 4D9RD 1C7TA 1T1WB 4PRID 3IU4H 1QPXA 1R3KB 4OZFG 1NC4B 3IJSB 3LQMA 1ND0B 4HDIB 4KHXL 3BDYH 1IGJA 2JJUA 3OB0H 3U4EA 4KV5F 4JPWH 3QXDA 4M6AA 1OLZA 1PVHA 5ACZB 3OV6A 4I48A 1MCPL 1CZ8L 1QYGH 3S5LA 4R4FL 4U1GC 3OJ2C 4LP4A 1MLBB 4ZUSB 1BX2A 1VGEH 4U0QB 1TQCB 1MSPA 3CJJA 3GIVA 2H8PB 4NNPH 2B7DT 5I18H 1DQTA 3QJHA 3MV9D 1MIML 1BWMA 3MLYH 4NFCA 2DOCA 1RUQL 3W0WE 1S7WA 4GQPH 4OGYH 1YY9C 4GG6F 1CE1H 4D94A 4GKZA 2VN7A 4JJ5A 5T33H 4EXPX 1NFKA 5IQ9A 5BV7C 8FABB 1MRFL 5FYJE 4NQVA 2NR6D 5KZCD 1NFDA 3H9SE 3HUJF 1Y0LB 5IFJB 2P48B 5DO2C 1UM4H 5D1ZB 3ZKXB 2XKNB 2XN9A 4ZFOL 1FZOB 3HZKB 4Q74A 3IGAA 1T4KB 1VADB 1XFPA 2EDFA 1DVFD 5IEHB 3WMSA 3DUUB 4AM0A 4FQXD 5CS7A 4ZOEA 4HH9B 1FVCB 1RHFA 2D9QB 5CEZH 1R0AH 3QAZB 4UOW0 3HZYA 5DMGC 2V9QA 4LHJB 1IC5H 2NXZB 3VWJC 2QSTA 4R7DA 5BQ7B 1WIUA 1NANH 2VN4A 3P40A 1D5ZB 3VCLB 1JYWA 5F8RC 1ZHLA 3U7YH 3KPSB 4H1LG 3VJ6B 4S2SA 5EU4A 3O6MH 4EJ1C 4OJFH 5IMLA 5GGQL 5F1NA 1A7NL 2JK5B 2P5EE 4MJ5B 3UO1H 2VXUL 3RPKA 4KKCC 5IBUG 2HRPL 3IAPA 2Z31C 2IQAB 5C9JB 2OJZH 2ZUVA 4PRPD 3OKDB 5I1JH 1Z5LA 5DHVB 5EPMA 4UB0H 1HKFA 3MJ9H 5CP3H 5DMIH 3ULUD 4WFED 2JCCA 4GQ9H 4JY5L 1JGDA 2EIDA 4MQSB 1OTTD 3AS0A 4LEXL 4NKMB 3PABB 1MQKH 4GOSA 2BSTA 5GRZA 1NGYB 2C3XA 3RY4A 1AQKL 4X6BB 1BFOB 4F3FB 5BW7C 3WFHB 3ZE0F 1YN6A 3D9AL 3O9WD 4ODVL 3DECA 4FQCL 3C5JA 3FT4A 3BP7B 5C09A 4LQ1A 3KYAA 4RQQB 5DMKB 1A22B 5DJ2A 5TDOB 1MEXH 3VXMD 3DRTB 2P5WD 1KN4L 2PO6D 5FGCE 1S7XB 5DGRA 5EU7C 3QUYC 2UUDK 5DJ8B 4WUKL 2OJEA 4YDJB 3ROLA 1KTKE 1HH9B 3KNBA 4XX1G 5C08E 4JZJC 2WK2A 3RX8A 4NSKB 3QUMA 5EUKA 4A6YA 5D6DC 1B4JH 4I3SL 3CFDA 3MUHL 3Q1SH 3WFDL 2C9AA 4KJWD 3ECBA 3LSOA 2FD6H 1J0ZA 3UJJL 4OCXH 5JDJA 2IADA 3CX2A 4BA8A 1U3JA 3PDGA 1ZMYA 3FKUS 1SBSH 3EYSL 3CDCA 1EXUA 3QXAB 3BKJL 3H9ZA 3NAAH 4DW2H 1RUMH 1YC7A 2GYSA 2VXSH 3SHSA 3ZE2E 2W9EL 4M8QB 3S96A 3I9GL 4PJBE 5T3XL 1LD9B 4P5TD 2WLZA 3LKNA 3H7LA 2F54B 4XNXL 2CKBA 1G9NC 3VI4E 4L4VA 5IROA 4MZ2A 4DZBB 2VLRB 5FYJL 2EDKA 2XG5A 2OI9C 3E3QC 3KPTA 1FVDA 2QHRH 4CNIB 4JFFA 1L7IH 1EJOH 1XGTB 5AZEH 3O0RL 1PG7L 2ZWLT 1ZGLA 3VH8B 2EH8H 2PKDA 1JYNA 4X98B 1QBMH 1BLNA 3SKNA 2PCPB 3ARVA 4JFYB 4N0CD 4DKFL 2C4FU 4NQCD 3FB8B 2PYFA 3B9AA 4OF8A 4PJFA 3ULSB 4CVXA 1U3HB 1P4IH 4M02A 4PGEA 1RURL 2P4AB 4M5YH 1CICA 8CGTA 2N4IA 4J7RA 4N90D 5E03A 1H8OA 3K7UA 1V3MA 3QNYA 1MAMH 4PJ9A 5EFIA 2LU3A 5DUML 4ZODA 1K8IA 3RGHA 1DEEB 1VDGA 2DF3A 3B9KA 5DRNB 1HHJB 2HFGL 3KPLA 3VI3F 4XPAH 4PJ7A 4K3JH 5ADPL 5K59F 3RUGA 2XTLA 3BD4A 1JYXA 1A6TA 3L6FB 1OF2B 5TGBA 3CVIH 3NCYP 3RTQD 2DL9A 3H6JA 2WWMD 5DQDH 4OD2B 1FGVH 3RNKA 1OQOA 2Z8RA 4NRZA 3I3BA 4XTRD 4X6CA 2FECL 3RY6C 2D4DA 3CMOL 5JOFA 4U6TA 2R29L 4R96B 5DF0A 5E7BA 3PGCB 1QFWI 2NR6C 1MCNA 4IJ3C 3NCBB 5E2VH 1CXIA 2WBJC 5IVNA 3RRQA 3HFML 3ZYZA 4BUHA 5B22A 3LRSA 2J5LC 3V8CA 5L2JA 2EXWD 2NYYD 1R3HB 3VDAA 3HPJA 3WNMA 3U6RB 4GKNA 1DVFC 1L7TH 1QFUH 3B2VL 3BDXA 2UZYB 3S35H 5DD0L 2Y07H 4BH8A 2IAMA 5FHBL 5EO1A 3B8YA 5C0IB 3L7FA 5KANG 1QO3A 2W91A 1PDKA 4RNRB 1IARB 2VR5A 3WL9A 3PWVA 3V9FA 1CDGA 4YK4B 2HN7B 4FOMA 5JHLH 5C8JB 5HDOA 1X7QA 1RULH 2LVCA 5IT2L 2VABB 5HHMD 3C6LD 1XF3B 4BQ9A 1ZV5A 2ERJB 5IM7A 1R3LA 1OWRM 2YD5A 5KOMC 2X4UA 4XVJL 1U8IA 3VW3L 1YMME 2XY1A 4XHJD 3C60D 1IE5A 2DM7A 3KLDA 5I75B 4TQEL 5I19H 4WWKB 2XFXA 1OAXH 5I76A 4YEFA 4L3CB 3ULUC 4G42B 3QZWG 4G7VL 1FZJA 4JFHE 4JRYE 3OR6B 2XPGA 4POZD 2IG2H 3U46A 1Z3GH 5TQ0L 1RZJL 3C6SA 1BGXH 1F4AA 3VXRA 2L7UA 3EDFA 3V8OA 2DJUA 5I1LB 5B4MC 1GVIA 4YHYB 3G5XA 4OD1H 3O9WC 1FIEA 4Q7DA 3LS4H 3VG9B 2O5YH 2BOCA 5DJDB 3LQAH 2VRAA 1KNOB 1I3VA 5KJRL 3WHE1 2R0LL 4BFIB 2B4CH 5C07D 5JZ7D 3STLB 4W6XB 5BJTA 2VDPL 2GY7B 4KVCL 4OFDA 1PG7X 3JWOL 1VFBB 1PGRB 3AB0B 4KK9D 2YK1H 5AYUH 4FP8H 2X1PA 4HXBH 5DHYA 5ALCH 4XPGL 4R2GD 3EO0A 4JO4H 4LAQH 5GJTL 2VZUA 4I18A 5D93B 1YEHH 1MCCA 4WI2A 4QLRA 4UNUA 4WDIB 3WUWA 4WO4A 2A38A 4PR5A 3F7YB 5GS1C 3IS1X 5FKPB 1UACL 3ARXA 4HF5H 3GSRB 2R1XB 1MCRA 3BGMA 4KMTL 4UOJA 1EHLL 1G0YR 2JJSC 2IALA 2BFVL 5TH2A 2IH1B 2YXMA 7CGTA 1TTGA 4U1MA 1IT9L 5H94B 2Y9RT 3ARPA 2EKSA 4HWZB 3DX6B 3GO1L 1E4XH 5EZLB 3D39A 4IRJD 5TJWK 2IBGA 2C3GA 5T3ZE 4JFQA 1D6VL 1TLKA 4P5TC 3P4MA 5F7NC 1ROWA 1VHPA 3UTPE 3D0VA 3VGAC 4L9DA 4BZ1L 5EWIH 2ENSA 1GOFA 2JJTA 1I75A 5FHAL 1I9JH 2EO1A 4PY7B 1CDCA 1JN6A 5A16B 1FIGH 1XH3B 5KANI 3K46A 1I4FB 1HH6B 5DD6A 3T2NL 4AG4H 1A7RL 4GMSL 5FO8A 5EZOH 3W9EA 4ZTPL 1ETZB 2YD6A 4GAGL 4HKJB 2IGFH 1RZIB 2B0SH 1NMBL 2V2TA 1G6RB 5K33A 5E1HB 5GRUL 2HKHL 3VG0L 3WS3A 4QT5B 3L3DA 1KCUL 3W82A 1CG9A 4NN5B 3LD8C 5T1MB 4OCLC 1M05B 3BP6B 3MOBL 1NL0H 4Q2ZB 1AQDB 4P46B 3QQ4B 1DQDH 3TO4A 4XB8A 1AR1D 4BJLA 3KWWA 3LOWA 2GAZA 3MV11 3HA0A 3OAUH 2P47B 4UOW1 5F1IB 4PRAA 4ZOCA 4QRRD 5MENB 4XP4H 1WFNA 5LBSH 1GHFH 2HT2D 4LSRH 2Q76A 2Z4QB 1PKQA 3HRPA 3BKCL 3MRMB 4ZFGL 1OAUL 1QKZH 2V17H 4D2NA 1NCDL 1QLRA 1YMMD 5IMMA 4K3DH 4TVPH 4AH2A 4GMTL 4HIIB 3L5IA 1UQSB 1YZZA 5EC1B 3T0EA 5FOBA 4OLVH 1FL3B 4Z7WF 4KTEL 4GSDL 2ICWB 4V1DA 4EEEA 3EJYD 1LO2H 3CFJB 3O2VL 2YA0A 2WWMC 3CLEH 2GFBB 3NCCB 5E9DA 2CRZA 2FEEL 5CSZB 1KLGB 3SE4A 2BNRE 5I74B 1NLBH 1E27B 1SJEA 4LPCA 5HDQH 4LPWA 4XNQB 3QIWB 1GGIH 2G75A 5L0QB 4JY6A 3HHRB 5MENE 4M1GL 5GJSH 1BF8A 4GRWF 3BZFA 4XPTL 5F8QC 2VQ1B 4QNPF 3R4DA 1FFPA 2OR7A 5D7SH 1CI5A 4ZFZA 4OZFA 4G8GB 3GM0A 5D7IB 5GQBA 4TNWK 5I16A 4IMKA 1DE4A 1QRNB 2D2OA 4BUGA 1NANI 4PJHF 4GBXC 4O51B 3HNTL 3ULVD 1SQ2N 2IBZY 4TOYH 2VDRL 5FGRA 2NY1D 4LQFH 2CUMA 4XP6H 4FTVA 3RZCB 2HWZH 3AXLB 4U6VH 5DQJB 4I0PB 1RZGA 5C0CA 3CSGA 4GAYB 3L3IA 1YYMH 4Z0XB 4MLSA 4MXVE 5IMKB 2DLIA 5FIEA 4C59B 3PWNA 3C60C 3QRGL 5MHSE 1I7UB 3GSWB 1OB1B 4HIHA 5JORA 5EBMA 4GS7C 3NH7L 1D6EB 1Q0YH 4KC3B 2Z92A 1CU4L 3M17B 3KXFB 3OG4B 5ACMA 1I8MA 1OP9A 3T77B 4WHTB 5TE7H 5T3ZD 5IOPA 4F9LC 4YWGL 1BOGA 2A73B 4K8RD 3UYRH 4R4ND 4U1KA 4P3DB 3UTTA 4HWNA 1RZJC 1QD0A 4XP5H 3QPXL 4LLUB 2EDEA 1FQ9C 1YDPA 4Q9CA 1JPFB 1ZANH 2MHAB 2V5SA 5DJYB 4JAMB 3KLAA 3CIQA 4I77H 2B1AH 1B0GA 3LS5H 2VLLA 4TSAL 5I1CH 2QHLA 1SMOA 4YFDB 1N59B 5DA0B 3C8HA 4NO2B 2VDNH 2DDQH 3UX9B 5L2KB 2FIRT 1KFAH 3VGGA 2H2SC 4WFFE 1PD6A 3ELAT 5FDWB 1XGRA 4KK9C 5TE6L 1MNUL 4XBGA 3EAKA 1U91A 3UROR 1MCIA 3U4EB 4HXAL 1YECL 4Y4KD 3GNML 1XGYH 4G6FD 1CGUA 2YWZA 4MX7B 4Z8FL 3QDJE 2AJUL 3O3EB 3NFSH 4NHUA 1P7HL 1BX2B 4OUOA 4YO0A 1NAKH 3GSVA 3QFJA 2X9YA 1G9MC 3PXHA 3HG1B 3QJHB 3DVFA 1I9RL 4QOKA 5C2BH 3MA7A 5DRXB 2BVTA 4IIQA 2NY3B 4EIGB 4GKZB 1T1ZA 2X4TA 5C6PB 3BAEL 4IMLA 1IQDA 1NLDH 2DM2A 4FZ8L 4U31A 5F9AC 3R1GH 4PJEE 3T09A 1T7WA 4NQVB 1JGLH 1NFDB 3NIDF 4IRJC 3HRZB 4YBHA 1AGCB 2C4XA 3VXUB 5DD1H 2BRRL 1RU9L 5D96B 5ISZD 1VEOA 5HHXH 2XQYG 4PGDA 3HR5A 2XN9B 5GGUA 4Y19A 1YQVH 4OIAA 1MHCB 1UADC 4AK1A 3DO7B 2A83A 4YZFE 1PZUB 1QR1B 3IGAB 5F9JA 3T65A 4S1RL 4EQ2A 1P4BH 3K80A 1JGUL 3GSNB 2B5IC 2P46B 1J12A 5HHQA 2FBJL 3NZHL 5T1DH 4NP4H 3TYGL 4FQ1L 3HZYB 2ZOLB 3WSQL 5E6IC 4NNXB 4R7DB 1FDLH 1J1PH 3F65A 1JI1A 1B9ZA 3MRDA 4TNWF 4Y5VB 1FG2A 4NCDA 4IRSD 3SDAA 5SWQA 4PJDE 4XXCC 2VDKH 1S7VB 5DFTA 1CBVL 5IMLB 4FQQA 4Y2DA 4PY8I 3O2DL 4MXQD 1WEJL 1U42A 4HPOL 5EZIL 1BZQK 4KWUA 4PV8A 1AR1C 1OM3L 3HC3L 1NCWH 3X11A 4U1IA 1JZ3A 1CF8H 3QCTH 1DP0A 2I5YL 3OAYH 3AM8A 1Z5LB 2XN9E 5EPMB 1AC6A 4NQSB 1D5IL 2HT2C 5AZ2L 4NBZB 2JCCB 2J3SA 4PG2C 4U7KA 3BX7C 2R2BA 3T2QA 1JGDB 4Y1AA 2RHEA 3V52L 1IRAY 2DAVA 4QHLA 4XH2A 4URTB 3TA3C 1BVLB 4ZXBD 4NHCH 5JPMB 4GW4B 4RA3A 1PSKL 3Q6FA 4F57H 1WZKA 3DROA 3WJJC 1YN6B 3MRNB 4YC2B 2CK2A 4X9HA 1G7QA 4RGND 5B39G 1UXSB 3MROA 1KGCD 4MYWB 4P3WA 3EJYC 3C5JB 5C09B 4X8XA 3UDWA 2VL5A 2SEBB 1DBKH 1DL7L 4LIQE 5A3ID 5EOQH 4ODTH 1HWHB 5AUMA 4KHTH 25C8L 3WDJA 1A6PA 4ZPVB 1XGUA 1TENA 4UT6H 4UTAL 4MJID 4DN4H 3NZ8A 2OJEB 4MCYB</