1IAIH

Idiotype-anti-idiotype fab complex
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
219
structure length
219
Chain Sequence
b'QIQLVQSGPELKKPGETVKISCKASGYTFTNYGMNWVKQAPGKGLKWMAWINTYTGEPTYADDFKGRFAFSLETSASTAYLQINNLKNEDTATYFCARDGYYENYYAMDYWGQGTSVTVSSAKTTAPSVYPLAPVCGDTTGSSVTLGCLVKGYFPEPVTLTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVTSSTTPSQSITCNVAHPASSTKVDKKID'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords IDIOTYPIC FAB 730.1.4 (IGG1) OF VIRUS NEUTRALIZING ANTIBODY
molecule tags Complex (immunoglobulin igg1/igg2a)
publication title Crystal structure of an idiotype-anti-idiotype Fab complex.
pubmed doi rcsb
total genus 35
structure length 219
sequence length 219
ec nomenclature
pdb deposition date 1993-12-28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1iaiH01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1iaiH02
3PV6B 2ED9A 4KAQH 4ONFL 1BIHA 3SN6N 1PEZA 4WIQA 4JFXB 3OKLB 4KJYA 2O5YL 1BX2A 4XNQA 4JJHA 5DJXA 2AJZB 2JCCE 3IFPA 2XXMB 1E27A 2AEPH 5IVXA 2AK4B 2AJSL 4YHML 1P5UA 3BZFB 5E5MB 4PTUA 4HAFA 3MGOA 1J5OL 1C5DA 3ALXA 4Z5RA 4FOMA 5L2KD 1GGIL 4YXKH 1IGJB 3P73B 4G6JL 4BSVA 2EDQA 1HXYB 3BFOA 3O81A 2YEZA 3V5HA 4NKQB 4JFQB 2ZG1A 5J13C 2DLFL 4N1EA 2J8UB 1F3JA 3TBSB 1Z3GH 3TH3T 4JANB 1U2CA 3B2UC 2ZKHL 3DVGA 3KXFD 3L3GB 5C07D 5GGQL 2AEPL 3HZKA 4XNXL 1DBJH 1TJHL 2J2ZA 2ZCLL 5SX4I 1ORSA 1TQBC 4CN1A 4IRJB 4LLMA 1EEYA 3F7YB 4W68A 4HFUH 4I77L 4AQ1B 3CDYA 1A22B 3H3PH 2VLKD 5FA4B 1T2QH 5FV2A 5GQBA 1ND0B 5EU7C 4RMRA 1U91A 3K8LA 3IETB 1AGDA 5E7BA 1Z9MA 3HG1A 4OFPA 1X5KA 3F7QA 4LHUD 2CRYA 4DQOH 4M9PA 3T0BA 4XAWH 4LSVH 5FYJH 4J3UA 1D9KD 5I76A 2ICWJ 4P5TD 4FRWA 4XCFL 1FYTA 4N8PA 2YN3A 5FYJE 2OZ4L 4D0CA 2B5IC 1R3JA 5A2JH 4PREB 4NDMA 4XBPA 3RP1A 4LNRA 4TSBH 3FB6B 5HY9A 5M95B 2ICCA 4Y4FD 4APQC 2H3NA 3QUYC 5D6CA 5ISZD 3D48R 5HJ3B 1WK0A 4WHCA 5C2BH 1AGEB 1R3KB 2EC9U 4XVSL 3IB4A 1A0QL 1KYOK 2VISA 1M6OB 4JAMB 3CPLA 3VW3L 2UY7A 1JWSB 1CXIA 3E2HC 5JDJA 3QO1A 2AXJA 2K7PA 3ARFB 2FBJL 3M1BB 4OLEA 1DN2A 3PWLB 1MJ7H 1NSNH 4J6RH 3MFFB 1M05B 3D0LA 4JKPH 5K93A 4D9QD 3S35L 2FZ3A 1Q9OA 4G8FA 2IQAA 4AENA 2FO1A 4X7TA 3PNWA 1QSEB 4ONHB 1SHMA 1JNHA 3IVKB 1YMME 4UDTB 4M00A 1JGDA 1F11A 3ILQD 1QNZL 5CBAB 1QZ1A 2YEZB 1HHIB 1Z0MA 3WIHA 3L1OH 4LIQL 5HHME 3A67H 2RFXB 4M7JH 3ELAT 3B2VL 4JO1L 1I8KA 1RVFL 2IG2L 3AU1A 4MB4A 4PD4J 3PL6D 4X99B 5GZNC 2GITA 4CAGA 3IFPB 1NBVH 2G75A 5A2IH 1NC2D 5A2KH 1S7WB 4JHAH 1UJ3B 1X5JA 2XI9A 1NCWL 1X5HA 4XGZB 1F8TL 4IHOB 4NKIL 4JLRA 3MROB 2BVTA 3F7VA 3PWUA 4G6KL 1OM3L 1AE6L 1VA9A 3Q1SH 4M48H 2X70B 2V2XA 5MEND 4G7VH 1DP0A 5AD0B 5CP3H 1CTNA 5B39G 4NNPH 3GFUA 4YHIA 1J10A 2ZPKH 4MNHB 1T1WB 4NRXA 4F2MB 3JBG7 3ISWA 5JXAL 1FNEB 2D7PA 3BDYL 4LHUB 4LVHB 3VXRB 1KXTB 1W72A 3MBXH 4QRPA 2B1AH 3KLHC 1G1CA 3LKSA 4JRXA 1N8ZB 2NX5D 3KYMA 4O58H 5IFHL 1GGCH 3GHBL 4HW6A 4KJQD 4R7DA 2BSRB 3FFCA 4N0UE 4DZ8B 2VXQH 4L4VA 4WRLA 5LWYL 3U6RB 5CFHA 1OM3H 1NGXB 1RD6A 1RU9L 2HP4A 5B3JE 4R9HA 4WU7B 2KQNA 1FFPB 3GGWB 3U9PH 2VE6A 3LV3A 5TF0A 5JPNA 5CZXC 2D7TL 1NBYA 3DRQA 2P46B 4HUUB 4Q9BA 1L6XA 4J1UB 3V5DB 4YK4C 1VFAA 5IT2H 4D8PA 3NFNA 1UM6H 2FBJH 5T3ZE 4J4PA 4WFGE 1JPTL 3P0YH 2C4FT 4PRDB 2VXQL 5LWYH 1EMTH 5ALBH 3OX8A 2DF3A 3C6LC 1A4KB 2EICA 4MAUH 2Y6SD 1DE4A 4PJXF 2EE3A 3KDMB 3OKKB 1CFQB 4RGOL 1T5XB 1E0OB 3RAJL 1CFVH 3VFUB 4R4ND 4NNYA 3QIWA 1O7VA 1AKJB 1U8NA 2A77L 3T0AA 3FO0H 5EU6A 3QXAA 2XZAL 1IKNC 5J0BA 4E42B 2NY1C 4G8IA 3VXQB 1X5LA 1KXVC 3O4OB 4HWUA 4JPIB 3SDAC 1E4WH 3VXOA 2BOBB 1A7QH 4MZ2A 1DQJB 4NFBA 4H25B 3KDMA 3OKKA 4JRYD 5HYQB 1U58B 2AKRB 3UZEA 5HVGB 5F1SA 2ITDA 1MCQA 2O5XH 1IEBA 1CZ8H 2ZCKL 2AXFA 3O3DA 1ZT4B 1JZ4A 3EDEA 4M6MH 3U1SH 4RFEA 1U3HB 3SDDB 1A9BB 1T04A 3HAEB 3CC5B 4DN4H 5ILTH 3QFJE 4MCYA 3WBDA 4DFIA 4K55A 1KF9B 1YPZE 1UC6A 1Y6NR 1BP3B 1HH9A 1MWAB 5D7IE 4Q9CA 2W65B 1EGJL 2C1OB 3I75A 3B9KC 3QUXA 1UXWB 3DX8B 1ONQA 2NTSP 1KTDB 4HT1L 3IFNL 1V3KA 2VE6B 3LV3B 1P2CB 3I6KA 1FFPA 4PJIF 3WL9B 2J5LB 4OB5H 4OZGA 2IPTL 4AEIH 2ESVB 3HI6H 3R0MA 4WWKA 3UTSA 5E8PA 1T6VN 1WZ1H 4F37K 4KQ3H 4JRXB 4ACPA 1I9JH 4O2FA 1U8PA 3VFSA 2DQUL 1OW0C 3DVIA 3MLVH 2FJFB 1WSST 3OKDA 4JO2H 3ARDB 1YMMD 2AERT 3AFLA 1JGVL 5FGCB 1ZSDB 4U1HA 2NR6D 3QXVA 4Y4KA 5BZWA 2Q8AL 3RWEB 3FQUB 1I3RB 1V8HA 3TNMB 4TSBL 5A40E 3UYPA 3MLYH 1TENA 3IJYA 1QFWL 8FABB 4BQ8A 4YZFE 4L9DA 4RMUA 6FABH 4AT6B 1I7UA 3TJEL 4JLRB 2AGJL 4P2OD 4KKCC 2LVCA 3EHBC 1FL5A 4B41A 2P5EA 4OLVL 5CGTA 4FQIH 4NC1C 4E41E 3O6LL 4MVBC 1E28B 4EVNB 5HHQA 1BLNB 4GW1B 5D5MB 4X6DE 2OR9L 1FZMB 2NXYD 4ZPTB 5IBUB 1Y6MR 3ZLQC 2XQBH 1H3GA 3EOTH 1T03L 2FECI 3ESVF 5JPMA 3O2DH 3O2VL 1F2XK 2QKIB 1KC5L 3PJSB 5B3NA 1N7MH 3O6FD 2R8SH 3VFMB 5TE4H 2HJKA 2VNCA 3HNSH 2EDJA 3DXAD 1A7QL 3QH3A 5DFWH 2XWJB 1IGML 1SY6H 4G3YL 4XRCB 1WEJL 4HH9A 4HEPG 1CD1B 1I7ZB 2AJYH 3MXVL 3PF2A 3MRHB 2VWEE 2E27L 3T0EA 2NY2B 2GI7A 4KI1A 3VXQA 1WIOA 2NXZB 3D25A 4L5FL 1QEWA 5IROA 3M1BA 1F6FB 3C09B 3LD8B 3V6BR 4AH2B 1IAMA 3RZCC 4MB5A 2X4PA 1KPUB 4JPVL 4DVRH 5FECB 4LEOB 1J1PL 3CK0L 1ZHNB 1FL6B 3KNBA 4EI6A 3GHEL 4L4VD 3QB7C 3EKCA 2F74B 3L5XL 1YQVL 2AJUL 1JZ2A 1R3HB 5TDOA 2A6IB 4R4NC 3STLA 1DE4B 4UT6H 3CCHA 1NMAL 2YUXA 5SWQB 5LXGH 3BKYH 3QZWA 1L9MA 1F45A 4QHNA 5SV3A 4G43B 3LH2L 5DT1L 2BSTA 5JIKA 1E4JA 3S5LG 1MFDL 5IVNA 3BO8B 3NPZB 1I7TA 4PGDA 3IT8D 4PJ5A 3K80A 2VLRB 4NKOA 2OZ4A 3HTLX 1MNUL 3VXSB 3BN9D 4MA1C 5KVGH 4XPGL 3KPNB 4KKAC 5HHNB 3F62A 4LLMB 5F7KC 3MODL 2OTWA 3KPOB 3EYQD 3F65A 4XCYB 3S4SA 3GSUB 4XMPH 4WFGD 5JIPA 4RX4D 4ODTH 3FOMA 4P46A 1R24B 4NZJA 4JFDB 4ZUSB 1UENA 2H32H 3TA3C 1E6OL 3SKJH 4LPYA 3U9UA 4HWBA 5FHAL 3RWFA 3RIAK 1B0GA 1T1WA 2VXVH 4NRXB 4F2MA 3UPCA 2OL3H 1XZ0B 3DRTB 3O9WC 3IFOA 5FEBA 3EDKA 1FIGL 1IGJA 4IEFB 4X80H 3EDJA 1I1YA 1DSFL 3WKML 2A73A 2CSPA 5FGRA 1LQSR 1YUHB 3BPOC 2X9WA 3QUZA 5DJ2B 2R1WB 5IESH 1Q0YH 2J6EA 2X2YA 3IGAA 3F8UB 4GG6E 3EUUA 4JG0H 4NM4H 3RVXD 1HHJB 5KS9E 3GUTA 4UB0H 4IRSD 2XFXA 2VDKL 3IS0X 3SO3C 3K81A 1CFNA 4JKMA 4N5ED 3PV7A 3IDMA 4XNYL 4Y4HC 3DYPA 4Z76B 1JTPA 2B1HL 2R2HA 5ICYB 2DI9A 3VDBA 2WBJA 3BN3B 3HKFA 3PHQB 1MIML 2DKMA 4DKAA 4WWKD 1IL1A 3CXHK 1D5BA 1CXEA 4L3ED 2YC1B 4WHTA 5I9QB 4CVUA 2YBRA 4QRSB 3CU7A 4F9LC 1BOGA 5HVWA 1N6QL 4LCWB 5DFVC 3ULSB 5TQ0L 4X9FA 1S7TA 4L29B 4O4YH 2B4CH 3S5LB 1BGXH 4GMTL 2AXGA 2RGSA 5C6WH 1BREA 1RURH 3CH8A 3ULVL 2LE9A 4XWGL 2NY7L 5DUMH 4PRNA 4G9FD 1M6OA 4JAMA 4FFYH 5EUOF 2UVFA 4TVPD 1CQKA 2NY3C 3HPJB 2AABL 5D70H 3Q48A 3TPUB 4X5XA 3LMJH 2C3XA 4HX1A 4YDIH 1OP3H 2MQCA 2CRMA 2P5ED 4FQ1L 1WZLA 1L7TL 2Y7QA 3N0PB 4H1LB 4P5MA 2FH8A 2D4DA 5DD6B 4BZ2H 4Y4HB 3KWWB 1AP2A 4S1QH 1R3JB 1S9WB 4N0UA 5T33L 4QGYA 2H26B 2MOVA 4L4TB 2MSPA 2Z31B 5LBSL 3RL2B 5EO9B 2ZUWA 5JW4R 5E2UL 4WUKL 1AHWC 4DWHA 5HI3D 3DTXA 5GISL 2Z35A 1SYSB 2DAVA 4IIQA 1KOAA 1JMXA 1YEIL 4N1HB 4NRYB 1JYXA 4TNWF 4PR5B 5CGMA 1XF5B 2BMKB 1HYRC 2IF7A 1A02N 4JFEE 3MJ8A 3Q6FA 2UUDH 3TFKC 3ZE0E 5H94A 4NOBA 3S5LA 1PX3A 4Y19A 3ARBA 4Z7VF 3HZKB 5ESVB 2V5TA 4HJ0D 4MJ2A 1BQHG 2P5EE 3NIGF 4OKVB 5E6IA 5CSBA 5J57B 15C8H 1NQBA 3G04B 3SKMA 4F58H 3TYFA 5K33A 3MRMA 4ELMF 1JNNL 5ADOL 3B43A 2GYSA 4U1GC 1RHHA 3T77A 3H9SB 5I8CB 3PIQB 4PJ7F 1F58L 5JXED 3QUMH 1IGYB 5F89B 5EWIH 2FIKB 4M5YL 5J9PB 1SJHA 3R06B 1QKZL 1RIUL 1Q1JL 4HIJB 1KCSH 3PGCA 4N68A 3BE1H 3IDXL 3IKCB 2AJXL 4BQ6A 2CGRL 5DR5H 3O9WD 1HOCB 3OWEA 1T1YA 4OQTH 3L95A 1T6WA 4XP6H 4X6CF 1KCLA 4WI5A 5D1XD 3FOLB 4OV5B 1P53A 3QEHA 1A5FL 1N0XH 1FG2A 4JM2A 3RQ3A 2ESVE 4WCYL 4KUCD 2K1MA 5D96B 1G6RL 1F4WH 1VEMA 3E3QC 3ROOA 4PY7A 1BMGA 43CAB 3UPAA 1NBQA 4M43H 2NY2D 4PB0H 4U1SB 4RX4A 1XIWD 3MRJB 3EO9H 1IARB 1Z6JT 4QCIA 3C09C 4FMFA 1LILA 1DQDH 1YPZB 4Y2DD 2NXZC 5DURB 4QYOB 1IKFH 2AK4D 3C2SA 2R23A 1BD2D 4YNYB 3BD4A 4O51A 1IQDB 4OZIF 2YK1H 3OB0H 2R0WL 3RY6A 3H3PL 5JW4M 1R0AH 3BEWB 3C6LD 4MA7L 2OR8A 4H20H 5AZ2L 3MUGB 1LK3L 4XPAH 1QO3A 2J8UF 4I2XB 4KDTA 1FO0H 4Y8AA 4NCC2 4O02L 1ZK9A 4JDTH 3L5WA 1H5BA 1QHOA 1R6VA 3V6FA 3C9NB 3UP1A 4YX2H 4LASL 4MD4A 3VMPA 3OKOB 3WMSA 2UUDK 5SWQA 2DTSA 3T1FA 1A14L 3C5JB 5KZCB 1G6VK 1EHAA 2BOCA 1CFBA 1WCBA 2R29L 1U92B 3IU4H 4OGZA 5L2KA 3CDCA 1JGLL 4GW5A 4JFEA 4PJDE 4R0LA 4HULB 4EN3C 3ULUF 4YZFF 5C0EA 2D03H 1FV1B 1EAJA 3K2MC 2O61B 3L3IB 3MZTA 3D69B 5DHVH 5I1EL 3T0EB 4HK0A 1I8IB 5KVEH 3O4LB 3ZYIA 5I17B 4HJGB 2PO6B 4L3CA 3V6OA 3TNNA 1ZKAA 2WAHA 4RMSA 1TZHA 4ZFOL 5MHSE 2YPLD 4UV4L 5IF0A 3EYVB 5GRJL 1OSZA 5ID1B 1WBYB 1HK6A 3WFHB 2VYRE 1T7YA 3MYJB 2J5LC 4PJGE 3Q3GA 4LHQB 1EUTA 2I60L 4NWTL 4KVNH 4JO3H 4M7ZB 2O5YH 2YR3A 5F9JB 2EDYA 5ERWA 3UDWC 2XRAH 5I1IL 3H7BB 4RQQA 4XC3L 2VLKE 3GMRB 3W0WE 3RVTC 1OCWL 1ZLUH 4O9HL 4HUKB 1BVKA 1AI1L 2WANA 3TO2A 4HC1L 5EA0H 3TBVA 1DQDL 4Z0XA 5SX5K 4NQSA 3UMTA 2SEBB 5DO2C 3Q5YA 1OWWA 3MLRH 1A7OL 4RMWA 2HTLD 5EULV 4PLJC 1BM3H 4TSCL 3ARDA 2WW8A 3EHBD 3SKUD 2FJFA 2YPKA 3O4OC 1EEZA 2R0ZL 3HS0A 3K1DA 5IMKA 4DKEL 1MCOH 3EJJX 1UXSA 3DSNA 4NQXA 5EO0A 4LLYA 4U1MA 1QVOB 1RIVH 1OTSC 3PDOA 5JQ6H 1HHGB 5J4MA 3RWIA 4LLWB 4EUPH 1TTUA 1HI6B 1YNTA 4PJBB 2NLJA 3K2UL 1YMMB 1HKLH 2LQRA 2XTJC 1Q9WA 1NLBL 1JI1A 1RJYB 3DECA 4JY5H 5DTFA 3MXVH 1E4KC 2CMRH 2BNRD 2IALA 2XT1B 4OIBA 1VADA 3WJLA 3BGAA 1UZ8A 2NY4B 3BT2H 25C8H 3I75B 4JEGB 3V4UL 1G7LA 3GBMH 5FO8A 1XH3A 2W65A 1KPVB 1UB5A 2AEIT 1A1NA 3T4YA 4X6FA 3BVNA 4JPKH 1BVLB 3EOBA 1ZV5A 4FQPA 1G9NH 4Z78B 5HGAB 2AV7B 4G7YH 4U1KB 1MFAH 3T65B 3QDMA 2JF1A 5FGBC 2D7NA 4DUXA 1C5CH 1C5CL 2KBGA 1RFDH 4N5EC 5CHNB 3VRLE 3LKRA 1P4BH 4FXKB 1T2JA 5I1HH 1EBAA 1MRDL 2P5WA 4H26B 5HPMB 1WWAX 2NX5A 3OKNA 3F58L 4LVHC 2ZZUT 4ORGB 4UILH 4CMMA 1W8OA 2VC2H 4HHAA 3G9VA 1XGTB 4LPTA 5ID1A 4PJCA 1UWXK 1NL0L 3QQ4A 5IF0B 4FABL 7CGTA 3KS0H 5IM7A 3LZFL 4CNIA 1FGNL 2IANE 4GS7B 4UNUA 1CICB 4HF5H 1J05A 1GOFA 5DK0A 1ZLUK 2OK0H 2A0LD 4NT6B 2X9YA 4K94L 5D7SH 3E6HA 3H9ZA 1VKXB 4HS8L 2VDOL 2EEBA 3BDYH 5B39A 1G7JA 2IANA 1HSAB 4NWUL 1UM4H 2VLME 4KMTL 2PXYD 3RWHB 2JIXD 3WEXA 1HILA 1R5IB 2DJUA 1L7IH 1X7QA 4UDUA 3EAKA 3Q1SL 2QV2A 4M48L 4PV9B 4PY8I 1P7QA 2P7TA 4NZRH 4ELME 5H35B 5GHWH 3C8HA 3EJYC 2VH5H 3GKZA 2BY0A 2DYPB 1HSBA 4B0MM 4R7DB 5IHUH 1TXKA 5DGRA 2CXKA 5EU6D 3OAUH 5TE6L 1HEZB 2FATL 1OLLA 4LRIA 4F57L 4TOYH 3RI5F 3WO4B 4Q7DA 5F7NC 5F7UA 3SPVB 4YPGA 4RWHA 3EYFA 1DBBH 4PJ8C 3ARFC 1P7QB 4IJ3B 5C0ND 3E2HB 5FKPA 5DO2D 1W72L 1NCUA 5J12C 3O41A 3BH8A 3QQ9C 4C56A 2F54B 1YJDH 5F6IB 4IHOA 4Z7OF 1T20A 3JWOC 4I9WE 3BW9A 3C8KA 2A6DA 5GGTH 4OLVH 1VGEH 5L7XH 3GRWL 1KJ3L 4M8VA 4JY6A 1K8IA 4JCLA 2V17L 3LSOA 1CWVA 2B5IB 4PY7B 3TN0D 5C0CA 5E5UB 3P4NA 4X80L 2Y07L 2P44B 1NCAL 5D2LF 4NZTL 4N90E 4UIKH 2QHRH 4HPOH 1V7MH 5B8CC 1T0MB 1AGBB 1RJCA 1TJGH 1RK1B 3B8YA 3KPSB 3TN0B 4JHWL 3AM8A 2BFVH 1NL0H 3QNXA 4BQCA 4XP1H 5HBBA 4LL9A 3O4LE 3GIVB 3GK8L 2ICWB 3WN5A 4BUGA 2VXUL 3ARDD 1QRNE 1SJHB 3D9AH 3PWJB 2H6PB 4A2LA 1RUKL 2A6JA 2K7QA 2PTTA 3LRSA 3O6KL 4Y5YA 1K6QL 1OTUD 5FM4A 3NA9L 3EJZC 4WY7H 1NAMA 3JWOH 5E4EB 4X6CE 5LKNA 4PRAB 3D2UA 3QRGH 5MEQA 4QRQB 5BQ7B 5IJKA 4M6OH 2BNUB 1N5YL 3SE3C 1SEQH 4XNMB 1A1NB 4XVUC 1OAUH 4KMQA 4UT6L 2HH0L 2UY6A 1X6NA 2GTWA 1KN2H 4PP2A 3CLFH 1HIMH 2Y06H 3CDGB 4I8DA 2UV3A 1QUNA 3TYGH 4RAVB 5C0JB 1I1CA 4KZEL 1IGCL 3VRLF 5D8JH 2O93L 5F6IC 4H1LG 3MRNA 5HYJB 1A0QH 2ARJQ 4P4KA 4FFWD 2Q87A 5J12B 1GHFL 5MI0C 2FNBA 4IJ3C 3O3EB 4PJ8B 5L9DH 2KUTA 1U36A 4OFIA 4F33A 2VWEC 4FS0A 3RGHA 3AREA 4L8BA 1CXHA 3QR2A 4ZXBB 1DUZA 4GAGL 1D5MA 2E9IA 2P8LA 1OT1A 1EJ6A 4ZO9A 2NPLX 2IADA 5GJSL 5DZOA 5DK2A 3OTTA 2OQJB 4LF3B 4LSQL 1L0XA 3JTSA 1VFBA 5JLZB 4Z0BL 4F15B 3NZ8A 4AIOA 2GJZA 1NFKA 1MJJB 5I1LB 2DOCA 2HAZA 1F5WA 3SDYL 3K4DA 3BUYB 1UKTA 1NSNL 3GMRA 4P2YA 3O3AB 4PJAE 2DS4A 2XY2A 2ZOLB 3MRQA 1QKZH 3MRDB 1CU4L 3BP4A 5F7FA 3L5JA 4OV6F 3RWGA 3KPTA 4OF3A 2G5RA 3QEGL 2DIJA 4TTDC 3O6FB 5EUOA 4NN6C 2IAND 4FQ2L 3RBGA 4PJ5D 2GK0A 1B4RA 2VB5A 4POZD 4GS7C 1M1SA 1EGJA 5D2NC 5F96L 1U8HB 5FCUH 2JCCA 3DUSB 3OR6B 3O4LA 5DQDL 1CFNB 4N0CC 3VH8A 2V2WA 5I0DA 1ZA3A 5EUOB 1I1AD 2APBA 1YEEL 2JJWA 4ONFH 4BKLA 5E00B 3VJ6A 4Z7UB 5BV7L 4FTVA 3LH2H 4OZHE 1DFBH 5GRVK 4MNQB 3SE4A 1JV5A 3D39D 2O26U 3CXHJ 4OFVA 5I1GH 3BJ91 2XKUA 4YDKH 3ZDXF 4JFEB 5KSAC 4EDWL 4XAKE 1DQQA 4OFKA 5DJ0A 3LQAL 4LSSH 5D93C 1FE8H 2IH1A 4GKOA 4AMKH 1XZ0A 3ARBC 1MY7A 3AMLA 4C56D 3MLUH 1X4ZA 3D18A 2Q7NA 2YD9A 5J6GB 1MEXL 1UKQA 3FN3A 5K9QG 3HHRB 2QR0A 3C9NA 1IGIL 2GCYA 3FZUD 1HINH 3RVUC 2A6KA 5I15L 4IRSA 5L9DL 2GJ6D 2R9HD 1UJTA 4WHYH 4M1GL 4IRZH 3GSUA 2YOCA 2FJGB 3KPOA 4NO2B 3AS3A 3THMH 4DK6A 3WNOA 4FFVC 5C6TH 4U7MA 1AIFB 5KVDH 4IS6A 2XTJB 1TTGA 1GC1H 3P4OB 4P3DB 1ZLVH 3L3DB 4PGDB 1IE5A 4KKBC 5FUCC 1LGVA 1LO4H 4XWOD 5GRZA 2A77H 3HPLA 5IVZA 4LLQA 2BVUA 4CVZA 3H3BC 3P30H 1J0JA 1OT2A 4FQJH 4WEMB 4AM0B 4Y5VB 4OF5A 3U7YL 3H3KA 4I2XE 1AJ7L 4UOW0 3UXFA 4U6YB 4PFEA 3RVVD 3BX7C 4GQPH 1A7BA 1OGAD 4TULL 3EIFA 2DQJH 3FRUB 1T80A 5FYKH 2DQHL 3TJHC 4XNUL 3I2CH 1HYSD 4F7EB 5DHVB 5CEXA 1IEAA 2ZUTA 4JJ5B 4HHAB 4X6DA 5HHOA 1IRAY 4PTTB 1H3TA 2NW3A 1QFPA 4GKNA 4UOW1 4YC2B 5GS3A 4QRTA 4LLUB 1EMTL 5ALBL 1G7PA 4O5LH 5CHNA 5F7DB 4LOUC 4LSUL 4PJCE 1EX0A 2H2PC 1EHLH 5H8DA 4TNVK 2YN5A 1W0WB 2D31B 3ARSA 1KCRL 1XGQB 5I1LA 1ZVHA 4Y0GA 5E95B 5JQ6L 1S7XB 4GKZA 4DCQA 1UH3A 2KKQA 3F5WB 4YBQC 4G8GB 2OMBA 1HHHB 3FQXA 1G6RH 1JPFB 4DQOL 5DK2B 2E7CA 4N9GA 4NNPL 1CR9L 1PY9A 3T0EC 1WTLA 2VQUA 1UZ8B 1A3LH 2I25N 2DKUA 3EO0A 1FSKC 3VA2C 1WAAA 2NNAB 5EO1A 1QOKA 1F02I 1HIML 2EIEA 2I07A 4NQCE 4M3JA 1ZA6A 3HE7A 1DANT 3L9RB 3ARGD 4EN3B 3QIWC 4OLYL 2OXHA 3IYLW 4M61B 1IJ9A 5GJTH 2FL5A 1U8KA 1IT9H 4W81A 4Y4HD 4GXUM 1EEZB 4YBLC 5ADPH 2RR3A 1UADC 1WJ3A 4NO2A 4MDJA 1ZHKA 4HT1H 1X5AA 4GXUN 4XVTL 3WSQL 3BPNB 3C60D 1FVDB 4L9LC 3MJ9L 5A3ID 2YXFA 3G6JF 4XNMA 3O0RL 3P9MB 1DLFL 4LQ1A 5EC1B 2NYYD 5IMLA 3T2OA 4PJXA 4MA8H 4S1RH 4JFPA 3QT2A 3P2TA 5HYJD 5IB5B 1MI5B 3G6DH 1S7UB 2MKWA 4PUBL 5D1XA 4MQXD 3CFCL 5H35A 4AY0A 1QBLL 2EDHA 3V2AR 2YRLA 4OFDA 3DUUB 4A2MA 4L3EE 1JGEA 3DOSA 3CX5K 3MR9A 4RGNB 1OWRM 3NZHL 3S88H 4PD4K 5EN2B 3EYSH 4QY8A 4D0BB 3NVQA 3QJFA 4NGHL 3FT3B 1S7TB 3BP6B 4P57B 3BE1L 1AD0A 2NY3D 5GSRA 2FSEA 3EYOB 3VE0B 5TE4L 5HYSG 4KHTL 2IPKA 4TSAL 1EAPA 2CR6A 5F3HA 2X05A 3QCUH 4U1NA 4XWOC 5I1CH 3S88L 3NABL 3MUHL 3PL6C 5GZND 1Q72L 5D9SB 2WWMC 5GRWA 3TZVC 3WFDH 1XCQA 2VQ1A 2EXWC 1FYTE 3AXLA 2P5WB 1YN7A 4KUCF 5C09D 1CD8A 1BFOB 4MNGE 2XG5A 2GJ6A 2A6DB 1OPGH 3FAXA 4ODSH 1ETZB 4WHDA 4HUXA 3TT3H 1I8LA 1JUFA 3GMNB 3STZB 4O4YL 3KXFA 5C07A 1JF1A 4EI5D 1JGEB 1S9KC 4C83B 1J0KA 1YUHA 3GNMH 3BKCL 4U1GB 4D9LH 3PP3K 2XA8H 4HXBL 2VUYA 4NYLB 3WFEL 2BERA 2FJGA 3FL7A 1QQDA 1FZJB 3CMOH 4Y2OA 3HMWL 3BQUC 5SWZE 3HFMH 2HJLA 3RNKB 3U9UB 1I9JL 3EO9L 3MJGX 4D9RE 4OCXL 1FH5L 1T3FB 4IDJL 3D18B 5FHAH 1KYOJ 4XH2A 2BHZA 4R26H 4U6XB 3MLPA 3UROR 1IM9D 3C60B 1MRCH 1M7DA 4YGAB 5I74B 1FYTD 4HUNB 1BD2B 2EKSA 1U8KB 2H1PL 4KK5C 3U48A 2FL5B 4G7VL 1EIBA 4JE4B 4M61A 1EO8H 5IIEA 5HHOD 1EXUB 1FBIH 2Q3AA 5KN5A 5EO0B 3OHXA 2Q86B 2GJ6B 1ZTXL 2NNAA 4OD1H 2E7MA 4PJEE 3R1GL 3RUGE 1KEML 1CLZL 5I18H 1CG9A 2DTML 4POUB 4NUGH 1MQ8A 4U6VL 3PGDA 4C54A 1C8PA 3GI9H 1RUQL 1FHGA 1AHWA 3PWVB 3UTSE 5LCVH 3RL1B 3VG9C 1MIMH 1U95A 1MJ8L 3FONA 4PJ9A 1Q38A 5GSRB 3DI2B 3OBAA 2XZAH 4F9PC 1ZVSA 5DUPL 4OI8A 4PB9H 3R06A 2ZOLA 4Z7WF 3KYNB 3P0GB 3SE8L 2CDEB 1JHLL 1K5NA 1K9TA 3BZDA 1LK2A 2ZUQB 1I7ZA 5E8EA 4N0FA 4LARL 3RY6C 2OMNA 3TYFB 4U1KA 1JGDB 3LEYH 5JO5A 5L0QC 3EDFA 3P77A 5L6YH 1T1ZB 3AVEA 4LCIL 4P5TC 2VDRH 3WLWC 1NFDA 1EFXA 4G6AD 4YPJA 3LZFH 4JG1H 1RZ8B 5ESQB 3AUVA 4ZYKA 3STBA 3P4NB 3X12B 4NO0A 4HWEH 5E2TH 3OKEA 1ORQB 5DD3H 1LEKA 2EDFA 2VMFA 4S2SB 1RJYA 5EORH 3CFBA 3QNZA 3U36A 1BF8A 2FECL 5KN5B 5HDOA 4IIQB 4NKDB 3N1FC 4XP5L 1XGYL 3O41B 4Y88A 1A64A 2H2SC 4KMTH 3UJIH 2E7BA 1QYGH 5DVLA 2DMKA 2Z31D 1JMZA 4PJFB 1A9EA 1XCTB 5GIRB 2BOCB 5KBNC 4JFZL 3O9WB 4RZCA 1IEHA 3V7MA 5DXWA 4MD4B 1TPXC 4KJWC 4LCUB 4HMEA 4OCMC 5T3ZH 5T3ZL 5GS0C 3TBWA 1G9MH 1XR9B 1JPFA 1ZLVK 2WBJC 4B7IA 5C0NC 4M4PA 1IAIM 2YSSA 1KTRL 2KL6A 1NAMB 5LJYH 4AIZB 5T3XL 4J4PD 4FQXD 1IGFL 2CDFB 4OZFH 3K2UH 3P4LA 2CJUH 3FB7B 4UNVA 3DHJA 1WZMA 1MCCA 2IJ0C 1V3LA 3U4BL 2JB6A 5BJTB 3KYOB 3MV7B 3CGTA 1D5IL 3MV8E 5GZOC 1FFOB 3QDME 1P84J 3QCVH 3ZDXE 3S8WA 3QNXB 1OGTA 1ZEAH 5T1LA 3UEZA 4XX1G 2QQLL 4FFZL 1VKXA 2PF6A 1KG0B 1IQWL 2VZVA 1X3DA 1OF2A 4BSVB 4ZTOH 5D71H 3I50L 5BS0A 4NQEA 5CCKH 2JCCB 3DUSA 2P5WE 5K59F 1AD9A 5JXEC 4HWNA 5I1JH 5DVMA 4J6RL 3H6JA 4PJCB 1HZHL 2H2PD 5T1DH 1QHPA 5T1DL 1FDLH 2DM3A 3MLZH 4AEFA 1NBZB 5C08A 5L6YL 4LBEA 3BSZL 3RZCB 3MREB 1Z3GL 3N06B 2VZUA 3LD8C 4M8QA 4ZSOB 5TFSH 1SEQL 1WT5C 5CJQH 2Z8RA 4IMKA 1EO7A 4KMLB 3FT3A 4FQ2H 3LPGA 1IQWH 3DSFL 2R1WA 3SDAA 2DM4A 3ZDZE 1IGYA 3L3DA 1NJ9B 3DURA 1L9NA 2MTPA 1A6PA 5F21B 2CDFA 1MNUH 3O6KH 1A21A 3ULVH 5INDB 3SBWC 12E8L 5D8JL 2P8MA 2VXSH 4TPRL 4RGNE 5D1XB 2BZDA 5HGAA 4YIQB 3WFZA 3V6FB 4OAWA 1CE6B 2IADB 1H5BB 4QF1B 5TQ0H 2XACC 2P8LB 3BRDA 3C08L 2CKNA 4XCYA 2Z4QB 5I1GL 2DIAA 3OXRA 1CFTA 3Q6FB 3S36H 3D3VA 5IFAH 1CGSL 1AO7B 2F5BL 4DEPC 1I3GH 1YMMA 4NKOB 1U42A 1BFVH 1MCWM 1ETZA 2IPTH 4AEIL 1CLCA 2NY1D 4LQFH 3RL2A 1UB6A 3CFEB 1FVEA 5E00A 3VJ6B 2Q76A 4P2OA 1ZT1A 4GOSA 2GTWB 2W0PA 4UB0L 5TPWL 3U7YH 5DK0B 4JM2C 3MRRA 1NC2B 5BO1H 3AC0A 3LS4H 4F3FB 2QADB 4HX1B 1FNGB 4UV4H 1F8TH 2Q20A 1FG2B 3KPSE 4AK1A 1KNOB 1RV6X 1JF6A 1VEOA 3EYOA 4I4WB 4M6ML 2CK0H 4XXCC 4PP1D 2E9BA 3OQ3B 1T1YB 1SBSL 3LRSB 4GRMA 3RHWK 5DMYA 1S7WA 2PXYC 2CDEA 5DEGB 2Q8BH 1Z9OA 5JW5B 1BHGA 3B9KB 1ES0B 4R4BB 5E94B 5HHPB 1FLRH 1G84A 1EV2E 2UYLA 4WUUA 5F1KC 3BWAB 2FDBP 4WHTB 1HNGA 2B0SL 5FYKD 1KENL 1CGTA 4QT5A 4TVSa 1T5WA 3KYKH 2FB4H 3PJSA 4PTTA 4H0IA 2IPUG 3PWVA 1OSZB 3E8UH 3HUJA 4EDWH 5E6IB 3LVEA 4UUJA 2WQRA 3PHOB 4JVPA 4H20L 2OI9C 3LKQA 1X5XA 5IUSA 4WTZG 5C0DA 5MEPA 2OK0L 4EVNA 4WO4A 4Y16D 1G6RB 4L8BB 1CLYH 3WNMA 2I26N 4BM7A 2FD6H 1BQUA 4EDXA 2F54A 3HI6L 3QDHA 3S3SA 4U31A 1KCUH 1MCJA 1BIIA 5HGHA 4JGUA 3KS0J 5C0CE 3VFGL 3QNZB 4PJ7B 5JA9A 3QIBC 3FZUC 3PDGA 1M7DB 2B39A 1A6AA 4Q74A 3VFWA 4U3XA 4PGBA 3T3ME 1J0YA 2E8ZA 4FTVE 3OXRB 4P9ML 3WUWB 2OI9B 4NBZB 4E0RA 1NKRA 5DD6A 4WDIA 4A6YH 4OCYH 4OM1H 1RZ8A 5CINL 5E6IC 1QQDB 4GKZB 4DCQB 4EBQH 3HE6C 1ULVA 1QO3B 3LAFA 3TBVB 2D31A 4WU5A 5GJTL 4BUHA 2ICEB 1OAYH 1X7QB 4UDUB 5JQHC 2VXTH 3MJ9A 5DC9B 3DGCR 5F97E 3KXFB 5C07B 1B2WL 4PJGB 1UXWA 4JDZB 4JHZA 4HZLB 3VI4F 3UDWA 4HIIB 4XXDB 3G5VA 3W2DH 2PXYB 4YWGH 1UH2A 1GZPB 3AXLB 3L3GA 3BRFA 5GJSH 1BOGB 1I75A 4GKNB 1FNLA 4JANA 2H9GA 2YRZA 3SDAD 4PUBH 3NACH 5IBTL 2J4WL 5CEXB 4K3HA 3OKMA 4N9OB 4PRBA 3S97C 4MXWH 2ORBL 5EUOE 5FDWA 3GSWA 3D69A 5DWUH 2H9GB 1JK8A 1U3JA 2VRAA 2AJZA 3L7FA 2V5RA 3L95B 4WI3A 1AD0B 4NN7B 4P57A 4OTXL 2V6HA 4LCCB 3ZKNC 5IJVA 5FYLH 4GRWF 4U1JA 4CL7A 3PGCB 1UEMA 4ODXA 1Z9LA 5JW3H 4XNXH 4S10A 3MRQB 1KJ2B 3BKML 2WZPD 2FLBT 3EW3B 4N5UA 4DEPB 4PJFF 1A3QA 1WV7T 3D3VD 5TF1H 4O9HH 4NZUH 3I84A 1OAKH 4G9FE 5GGTA 1J8HB 4Y5XB 5E56A 2GJZB 3GMOA 5F7MC 1B0GB 3QHFL 1H5BC 2AABH 5D70L 4Q9QL 2I60H 3Q0HA 3O6LH 2CIKA 4ZUSA 4RSVA 5I6XB 3HNVL 3V5DA 5EU4B 3X17A 3DRQB 4R26L 3IAPA 3UBXB 1YEGL 1QBMH 1U8JB 4HGKC 5DTFB 4CMHC 1Q9WB 4DVBA 4MYWB 3CJJA 1DLFH 1KT2A 3O3EA 2R23B 4YNYA 4LRNL 2FO4B 3FFCB 4KJWD 2F19H 2B20A 3F12A 4QXUH 4LFHG 5JOEA 2XOTA 2BNRE 3JVGA 1K4CA 5D2LA 5FGSA 3RWDB 3H42L 4U1HB 4YEEA 1NMBL 2C26A 2OL3L 3CMGA 1NANI 3HC0B 4TRPH 3VU2A 3ULVC 2WINA 4KQ4L 1AC6A 3MV9A 1A1OA 1U8HA 5C0AB 5K9OA 3H0TA 4JY4A 3PQYD 4ISVA 3STLB 4QWWD 2DQJL 5TDOB 4X5WA 2J8HA 4OV5A 4JVUA 1IZJA 1CVSC 4P4KC 1MELA 3MROA 4EN3D 1WBXA 2RIKA 4AYFA 4XGZA 3W5NA 2EYRA 4XP4H 4KI5C 4GUPB 3AY4C 2X1PA 4EJ1C 1ZLWK 5E94A 2XG4A 5JMRA 2HG5B 5KSAD 5C3TA 1I8LC 2BY2A 3ECBB 4YHMH 2J1KA 4M5YH 1HH9B 5HHVL 3U4AA 5EOQH 4HFWB 3V5KB 3E6FA 3O2VH 1XGPA 4OTXH 2X1XR 4K9EL 2P4AB 2RQ8A 2P47B 4JKWA 3ZO0A 3WFHA 4ZFGH 4KHXL 1QRNB 4JHWH 3NZ8B 4PJ9B 4HUWA 3WDJA 4UDTA 3G04A 4DUVA 1TZHB 5ANME 2D03L 1NUNB 4LDOB 2WBJB 1BEYL 1S5IL 3FRUA 5IMLB 3FQTB 1IC5L 3V9FA 1YEFL 4LPCA 4HK0B 4DGVH 4FFVD 4Q9RL 2F53A 2WP3T 2ZJSH 3QFJD 4ODWA 4ZXBA 5H94B 3VGDA 1OB1B 5HYSB 4M43L 3UTTA 4LLQB 3KXFE 3E3QE 2DL9A 5C07E 4FNLL 1IC7L 4X4ME 4QKXB 1FH5H 5EU3B 5CWSB 1JE6A 3MNZB 5HYJA 4IIQC 2BDNL 2Z93B 1KGCD 3I3DA 1HH6B 4R7NA 2HYMA 4NN5C 1CCZA 3V6ZA 2DLTA 5EBWB 4XVUD 3SQBA 4NQXB 4OZHF 1A7OH 2JJTA 1BD2A 4X8JA 4U49A 2N4IA 4TNVF 5IMKB 1CYGA 3DRTA 3H7LA 2QQNH 3BKYL 1AFVL 1MHHB 2VLLA 4ZSOE 2XZQL 3QEUA 3FB8A 3U7WL 4QXUL 2GCYB 5EG6C 1NEZG 3TPUA 4XHJD 2HRPH 1OTSD 4LASH 4NQSB 4HD9A 4EI5B 4IRJD 4BK4A 2BC4B 5GS1C 3CFCH 3ZYZA 4YDJB 2JB5H 4PPTA 1NJ9A 3G5XA 4R4FH 4I1NB 5IHLB 3STZA 4ERSH 4L29A 3NH7L 1QG3A 1F6LL 3GIVA 4Z7UA 3LKSB 4BKLB 2GEEA 1X5FA 4S1SH 5FA3B 4R97B 2R0LH 5CJQL 4MCYB 1XCQB 4XVJL 3RIAF 5D9SA 5JR1H 3JUZA 5F3BB 1FCCA 4I0KA 4JJ5A 1J05B 3L3OB 4HCRH 5CILH 3HZVB 1AD9B 2WP3O 4V1DE 2ZNWA 3AB0C 1KFAL 4DJMA 4YXLH 4QHMB 3OKLA 4KJYB 2ITCB 1X44A 4Y2DC 4EIGB 1FC1A 4F7MB 1H3XA 3INUL 3LPWA 1I8MA 3JZ7A 4OLWH 1KCVH 3PV6A 4FFZH 1UG9A 4ZS7H 3EZ8A 2V2TA 1G9NC 4PJXE 2GSIB 2HTKC 3AMKA 5I1EH 2AJVL 2YWYA 5I8CA 5ETUA 5JTWA 5ANMA 3VGBA 3IFLH 5DJZB 5I74C 3C60C 3HI1A 4JN1L 1YMHA 5I30L 3VGEA 2W0LA 3VXNA 2HJKB 2BFVL 1DQMH 3QXDB 4U2ZA 4JZNB 4JFPB 4NQDB 2YUWA 4UBDD 2ADJB 3C6SA 4G8FB 4YHLL 2IBBA 4XP9L 3X11A 4LRIC 1FVDA 1T83A 2P8PB 2ZSWA 4LP4A 5FO8B 4ZAKC 4HIEB 5M7QA 1O0VA 5EU5A 5D5MA 1J1XH 4ETYA 1AGCA 4U1LA 2YA0A 2EH7H 5AYQA 4F33B 2P43B 5JPNB 1QR1B 3OV6A 1BQSA 1JGLH 5DUML 5IQ7L 1VFMA 4NQCD 3RX7A 1YNTB 3MRFA 5EZLA 4KK8D 3CFBB 5ILTL 4K7PL 2Z91A 4LSVL 5FYJL 2R9HC 4ODBD 5KG9A 4YX2L 1B90A 3BI9X 3TZVB 3B9DA 2PUQT 5DD5L 2M2DA 3RGVD 3CX5J 5DRZB 2BNRA 4I48A 4L1DA 3CXDH 2V2XB 2BNUA 2UZIH 4R6UA 5AZ2H 2WWMD 1UM5L 3TZVD 4KZDL 2PR4L 3GZKA 1FL6A 2AK1H 4EI6B 2WM0A 1H3UA 5B4MD 5AYUH 3BHBB 3WXWL 3O6FA 4YFLF 4MZ3A 3RIFK 2VDNL 2BY1A 5DD5H 3BIKA 3LRGA 4JB9H 2XZCH 3B9KA 4R4BA 5F7DA 3PWPD 5EDXA 4RGNC 5DJ6A 4Z95L 2P1YA 3SGEI 3PIQA 3QH3B 4LDLB 3RAJH 3BUYA 3I9GH 3T77B 4X7FC 4QHUA 4U05A 1QSFD 3MYJA 4RFEB 2BVOB 3SDDA 3QDJE 4GSDH 2X4OB 1AR2A 1LO2H 4X6DB 4ZUTA 1F11B 1QLFA 3IDJA 4M7LT 3ZDYF 1MJ7L 3TVMD 2OQJA 3MGOB 4LF3A 5DEZA 1BFSA 5FYJU 3MLXH 1OW0A 3MV8B 2IALB 5DD0H 3DYOA 4YBLB 1K8IB 2R69L 1DSFH 5GGRB 1P4BL 2YHGA 4APQA 1CS6A 1MVUB 2Z8SA 3X3FH 4AT6A 3KYKL 4ELKA 4PJEF 1QACA 2HFFB 3QHZH 3VFUA 5ADOH 4P2QD 5F9AC 5HJ3A 3EYFB 3LKPB 1F3RB 2R29H 2I27N 5D6CB 3C5ZB 4XAWL 1L7TH 1NUDA 1ZT7B 3CDGA 2YPKB 3BZ4A 3AROA 3FT2A 4HIHA 4JO2L 3EOAB 4DN3H 3C5JA 1QP1A 5DR5L 5LXGL 3RNKA 3CMOL 5I76B 4U3HA 3RJQB 5ACMA 5CZKA 1ITBB 5LVEA 4PJFE 5HYFA 2NXYB 3RWCB 1WZ1L 4LVOB 4BH8B 3HNTL 5K9JH 4OCRH 4OLUH 5FKAA 4OJFH 3QULA 3VRJA 5IR1A 1RJLB 4CVXB 1R5IA 3MCKB 1I85A 5K59E 1YECL 1K3ZA 1FPTL 1C16B 4WU7A 3TM6A 1MHPL 1EEYB 1RZIA 1FAIL 2XTLA 4F8QA 3ULVD 1Q9LB 2ZSWB 2DD8H 3X11B 1BFOA 3NH7H 5F9WC 5C71A 2E7LC 4Q2ZB 1RIVL 4YC2C 5FAAA 1U8IB 3WLWD 1SVZA 3ETBF 4KGLA 3BEVB 2DYPD 4BSJA 5J11C 1BZ9B 2YA1A 4G3YH 4LIQH 1HCFX 4Y4KC 5IGXH 1EHLL 1M71A 5DMGD 3QDGB 3QIUA 1JYVA 5JORB 5F3HB 4YBHA 1FAIH 1G9MC 3MSPA 5D1ZA 1OF2B 3FOLA 4QRRA 1A6TA 5HVHC 1JZ8A 4B5EA 1A3RL 2W9DH 4KK9C 2DLEA 3UTZA 1JVKA 4U4BA 1CF8H 3A6CH 1IAOA 3UJTL 1BZ7B 2GITB 4P3WA 2JB6B 3WYRA 2KDGA 3O3AA 3QHTC 3QDMB 1E6JH 1BZQK 5DQ9B 2X1QA 1LEGB 1K2DB 4P4RA 2A83B 2YZ8A 3U30C 3UPRB 2NY7H 3RWFB 2C3VB 3BVNB 4YFDB 4X6FB 5HI5C 2JELL 3BSZH 2HLFC 4FQCL 2RHEA 4J4PC 2GJ6E 3SOBH 5KS9B 3GKWL 1NBYB 4MGXA 5JW3L 3RGVA 4M9OA 3SDCA 3ARBB 5I8KL 1Y18B 1AXTH 2DTMH 1MAMH 5D93B 1MCPH 4H8WL 4BK5A 3IDNA 4K3JH 2X1WL 4OI9A 5LQBH 2VDML 4UT9L 4JPKL 3ZMRA 5KSAB 5L88H 1I3VA 5GZOD 1BD2E 2R1XB 3SGDH 4FN0A 1OY3B 2AJ3A 5DVOA 3ARBD 4NKDA 3CAFA 3CSYB 4M7KL 2VLJB 3JWDC 2Z35B 3ULUL 4KUZH 5SWSA 1OAYL 2BSTB 5E6ID 1NLBH 1HINL 2E5EA 4GBXB 4HCRA 3OPZL 1SM3L 1QSZA 5T5FL 1PD6A 3SE8H 1KLFA 3JWNC 5GGUA 3AS1A 3ARED 4B50A 3AB0B 5J1AB 3RZWA 4WUUD 5IMOB 1HHHA 3FQXB 3K74B 3WJJC 5CINH 1MF2H 5D2NB 2EC9T 2LU7A 1RUMH 1RQ5A 4L4TE 4R7NB 1KLGB 5IESL 2NW2B 3OXSB 5C70A 4XB8A 4ZO8A 1BVKB 3K46A 4AL8L 5LGJB 3QG7L 2FHCA 2N56A 5CJBA 4PRHD 1ZGLM 2AV1B 5H37G 4X0KA 2KZWA 1MQKH 1TETL 2X40A 5KSBF 3JWDH 5F89A 1ORSB 3RX8A 3FN0L 5E0QA 1OP9A 3IJHA 4OBSA 5KVDL 3TA3A 3U9PL 5KAQF 5MENA 1DBKH 2MHAA 3VWJC 1YY8A 4W70A 2HFGL 1D5BB 3NMEA 5HXMA 2BDNH 1U95B 4F15C 1HXYA 2MQ3A 2PYEA 2VSDA 3TNNB 3FO0L 4QRPD 3U2SA 3IJHB 1PLGL 2X9XA 1CDBA 3GM8A 4K71C 3TGXA 4OGXL 4P23D 2BVEA 1AY1H 1OVZA 5KZCD 1CU4H 5F88A 2B8OT 2ZPKL 5AAMA 5DJXB 3KAAA 3B8SA 3WUZA 4XB7A 5CEYA 5KTEL 1MCBA 5C8JB 4NNYB 5DA0B 3FCTB 2BNQA 3BW9B 1LO3H 3C8KB 5TFSL 3T0WA 2LU3A 1PVHA 4PJEB 3W82A 2Y5EA 3HMXA 1P4IL 5DHXB 1B0RA 5DJ2A 4EXPX 4X5WB 1AKJD 3ULVE 1JN6B 3MLTB 4P5KA 2BVQA 1AIFA 2ADIB 1CXFA 2VLJE 3BKCH 3TNMA 2AXHA 1R3LA 3CFDA 1F58H 3GI8H 5J7CC 4I18A 4JQXA 1NAML 3UO1H 1S9WA 4N0UB 4PLKC 5E7FA 4HLJA 4H88H 5BW7C 4ZOCA 1SBBA 4PB0L 3HCVB 5JXAH 1PQZB 3VFRB 4XPFL 1EZVX 2QR0B 1RPQA 1G7IB 3QUMB 4Z7QF 4KI5E 4ETQB 1SYVA 3SE4C 3GHBH 3BAEH 3ARGC 2DYPA 4PJ9C 4P48A 1QFUL 2FO4A 1ND0A 3QIWD 2AGJH 4WTWA 4U6VH 5EBMB 1P2CA 5BCAA 1NEZB 3BP7B 5JOPD 5D7LA 1WZKA 2P42B 1JGVH 3HFML 4JFED 1T7WA 4MXVE 3MFGB 3G5YA 5FDYA 2C3VA 4XVJH 3PHQA 3H9HB 1IKFL 3TN0C 1OGAE 5TPWH 3IF1B 2P49B 3ROLA 4S1DC 1VPOH 3V0WH 2WWKT 4JFZH 2PO6A 4L3CB 5JNYB 4H25A 3IKKA 1JNLL 5FO7B 2W9LA 5KW9H 2EIBA 3ZTJG 4KGJA 1MCOL 1B4JH 2V7HB 3JV4B 2C4XA 5BVJB 4B7LA 3AREC 5D4QA 5AZEL 1TVDA 5D6DA 3U0WH 1N64L 1G7MB 1QEWB 1RMFL 1KTLB 1KIPA 3ARWA 4QTHA 1HDMB 3QO0A 2CLRA 5E2TL 1P1ZA 3H9SA 4HWBL 5L2KB 2YD8A 1CDYA 1G0YR 4CMHB 2PYEB 1NFDF 4PJAF 1S3KL 1HHIA 5HDQH 3FRPA 3GMPA 1TNNA 4XXCA 3JTSB 1VGEL 1YEKL 3MRBA 4OKVA 4KH2A 4Z18A 3UYOD 4DKDC 4I0PB 4NUJA 4MD0A 1VFAB 2L4OA 4JFOA 1DBMH 1TVHB 1G7LB 1ZHKB 4X8XA 1Y0LB 1A3LL 4ODUB 3PWLA 4LAJH 3S96A 1UACL 4MXQD 4L1HA 1T66C 4YXKL 5HDBF 2PNDA 4K94C 5T1MA 4WU5B 5CS7A 5D5ME 3RWJB 1J8KA 2BP3A 2HMID 1FDLL 1JPGA 3BO8A 2D4FA 1J8HD 1UQSA 4EN3A 2N1KA 1HHGA 1GHFH 1ZS8B 4PJHA 4LCCC 2R2EA 3C2AL 4ZNCD 3LIZH 1CGUA 5JHLH 4XP9H 1J9CT 4WDIB 4NN7C 5GGQH 3SJVB 5F44A 4G9DA 4GRLB 4WNQA 4CU7A 3SE9H 3MLVL 2MMXA 1V5JA 3U82B 2XRAL 4H1LA 4PJBF 3PE9A 3FQNB 3TA3D 3TH2T 2CRZA 4RGND 1N6UA 5CGYC 1XAUA 5I66A 3MLUL 5E8PB 4LEOA 3BYTA 4HS3A 2X4UB 2XIDA 5DC4B 1N5YH 2OL3B 4LKXB 5AWNH 5AWNL 1O5DT 1KJ2H 3IDNB 4MJ6B 4OZHB 4G8GE 1G9EA 4IDJH 5FB8B 4LU5H 1PX4A 1IBGL 5MEPB 3SGDI 4P23A 3PABB 3QFJA 5DHYB 1UKSA 3S36L 1EVUA 5ENWA 5F6HI 3B2UD 2EO9A 3D9AL 3AU1B 1GAFL 2H41A 1BFVL 3HUJF 4IRSC 5SWZA 2F54E 3DXAA 1T89A 3QPQD 4ZUTB 2AK1L 3ZT5A 2BVOA 3HE6B 5J6HA 4MWFB 1T5WB 2XKNA 4OD3L 3MXWH 2Y4SA 3GB7B 3PXHA 4F7EA 1DDHA 4LSRH 5EIIB 3RFZC 3X3GL 2QQQA 3QDJA 5ENWB 2V17H 4EUPB 1F13A 4GW1A 4XPBH 2NY4C 3NTCL 4K7PX 3MOAH 4RBPK 4C59B 1KB5L 4RA3A 4AIXA 5IMMB 1IMHC 3HZMB 5ECJE 1J5OH 4E42A 4DKFH 3MJ8B 4FZ8H 5I15H 4RFNB 2NR6C 2X7LB 3NN8A 4QRRB 4G9FB 1T0NB 4DGIH 1VB9A 5JOPE 4X7CC 2XYCA 4KAQL 3RDTB 4MJIE 3LQAH 3MUY1 4YAQB 3MACH 3UBXI 4X6BA 5TH2A 1OP5K 3RVWD 3NIGE 1TDQA 2Q76B 4P5MB 3HRZB 3CU1A 4LSQH 2D7MA 2F9BT 4O2EB 2VC2L 4YEFA 4L8DA 4HUUA 3WFCH 5FFLA 5HYJE 3WL9A 3NGBC 4OF6A 4GXVH 1LEIB 2YD7A 2EXYD 4CKVX 3TO4D 5IEKA 2H8PA 1UWEH 5IWLA 2F53E 1HCVA 3RTQD 4YO0A 3DVGB 1SJEA 1T4KB 5I75B 1YNKL 2XWBA 1ADQA 2FX7H 4JZNA 4NQDA 3VXUD 5IHBA 4LSTH 4OCRL 3IRZA 3KPPB 4X6CB 3R0NA 4MNHA 2P8MB 2CRIA 2XV6B 5T3XH 4GAYB 1RZGB 3MRPA 5CILL 4PJIB 2BCKB 4NFCA 4UU9B 3VXOB 3BT2L 3V4UH 4DAGH 3QEHB 4JM2B 1ZANH 4JPIA 3DETC 1MOEA 1MRDH 2VL5A 2X44D 2XNAB 3BZEA 2XFXB 3E8UL 3KYAA 5HGDA 4YGVA 4XZUA 2YMXL 1R3IL 3TT3L 3BP4B 4JREC 1A2YA 1MJUL 2EIZA 2AJSH 2ENYA 5MP6H 1DDHB 1JWUA 2CJUL 2YD3A 2CLZB 1GGIH 2APVA 4NQEB 1UVQA 4DOHE 4UTAH 4D0DA 3GJFH 1BAFH 1KELL 3NCEB 4D9QE 1YEEH 2E6PA 2XWTA 5BMFL 1YQ2A 1YEKH 5FGBA 5HHMB 4CUCA 4BA8A 3A6CL 2IQAB 4JN2A 4TSAH 1INQA 4MQTB 2JK5A 4WW2C 1D5MB 1DUZB 1URLA 2HH0H 2DQFB 3G5XB 1E28A 4PRHB 2R56H 1FJ1B 1GGYA 2MCPL 7FABL 3C5SA 4AG4H 1KULA 1P6AB 1WAAF 1UACH 3CDFA 2Q6WB 5H2BA 3SQOH 5DRNA 3OGCA 1Q72H 2C7UB 4UQ2A 3B9AA 1X5GA 2VISB 5DJ8A 1LP9E 2VLKB 3ARXA 5E9DA 3QSKB 4I0PD 2OP4L 3DTXB 4O02H 4R3SB 3QDAA 4OZFA 4QHNB 3MCLH 4HJJH 4FQQB 4WW1B 2Z31A 3JUYA 4ZD3H 1B3JA 2X89A 2C1PB 4I18B 4JQIL 4WNQB 3FO1A 3VFOB 4O2FB 3CFDB 5D96C 5FYKU 1RZGA 2R0WH 1OAKL 1JYNA 3SGKC 5JXEA 4D3CH 4R2GC 1GC1L 2BHYA 4N0RA 5C9JB 2PTUA 4FQHA 2EYTA 3ZL4H 3VI4E 1QRKA 5MEQB 5IFJB 4Z0BH 2ERJC 4KY1L 3AM8C 1GIGH 4YR6B 1PKQA 2QL1A 1CGYA 3TVMA 5C0AD 4F9PA 3DO7A 4X99A 1JPST 4OD2B 1MPAL 2H6PA 3CVHL 3O6MH 3N1MC 2IFGA 3THML 3BH9B 3ARVA 4J3OC 4JFHE 2XQYG 3Q3GB 3QPXH 4APQD 4LKCA 1NFDB 2IMNA 5J8OA 4HUWB 3B9VA 4JG0L 5CJOL 1QRNA 1D3CA 1MEXH 4O2EA 5T1LD 4QXGH 4XCCL 5BZDB 4XMKH 3K0WA 5I17A 4M6NL 5DRXB 5FHBL 5HYQA 5I73C 2IEPA 1C5BL 1ZHLB 4ZQKB 5BS0D 5E5MA 4KRPC 3D39A 2D9QB 2AK4A 3W2DL 1EJOL 1EJOH 5DGQA 5EOQL 5T1KA 3GJFK 2MPAL 3CVHB 3ZT6A 4GLRI 5IEHB 5C08D 5BV7H 1H8OA 3ZTNL 5IFJA 2HT2D 3OXSA 2NW2A 3BAEL 4GW5B 4R0LB 2YD6A 4QXGL 3OL2A 4J23A 5HI5D 3T09A 2HLFD 2X4NB 1WF5A 1XR8B 2R15A 3RX5A 4H0HB 4JCMA 3TO4A 2X4RB 3WFDL 3MTRA 2DQDH 5FA3A 4D8PB 1TIUA 1KACB 4OZIE 1U6AH 3N1GC 3ZHKA 2NY3B 5C1MB 4M6AA 1F97A 1S5HB 1P4IH 2VABB 3REVA 3FJTA 3VFTB 3OGCB 2AJ3B 4PJAA 5FUCE 3ZYOA 5TF1L 3QEQD 3MOQA 1JHKL 4JDVB 4FZEL 5ITBL 3GI9L 1IAKB 1V3MA 1J8HE 5T33H 4OCWL 2HVKB 5D1ZD 1NBVL 4ERSL 2APWA 4XH2B 1S9XB 4HUVA 5DSCB 3EYSL 2CO7B 2XY1A 4JKKA 1CD9B 3BD3A 1OOAA 2EZ0C 3VWJA 1MHHA 1T21B 1BJ1J 1BFTA 5I19H 2ZG2A 3UAJD 3VG9B 3S37L 2FLRT 4WCYH 3CCHB 1DBBL 1R3LB 1QBLH 3VFGH 1J0IA 4ONGL 2E9WA 1BM3L 4TSCH 5DZNA 4PJHF 1Z0NA 1JF1B 3PWUB 1OGAA 2R2BB 1BZ7A 3NFSH 4PJIE 4QHLA 1CDUA 4GRLA 3GMLA 3L5HA 2AP2A 2F5AH 1VCAA 4KPHL 2VQ1B 3LKNA 1QFWI 4I3GA 5HYSA 4Z7OE 3KPMB 4WI8A 4W6WB 1VEPA 3QUXC 5J3HD 5JW4Q 4G8GD 3BPOB 2ZUVA 3GSWB 3S3JA 5JUEH 1RHHB 2QSVA 2AEWA 1RZFL 5EWIL 4ODHH 4PG2C 4S0TD 1FRGH 2NTFA 4JQXC 4BZYA 5BRZE 2W60B 1K85A 4X6CA 2R4SH 3BEVA 1UYWL 2IPKB 1FO0A 1MFEL 5IOPB 1DUYA 1FP5A 2M8XA 3DLQR 5B38G 4P46C 4V1DD 3MNVA 4HV8B 4FQXB 1QYGL 4MD0B 5I1HL 4X7TB 5IB2B 3MBEC 3RNQB 4F37F 3BQUB 5I8EB 3MNVB 3G5VB 3H9YA 3GI8L 4D0BA 3ARGA 3OF6D 3ZKMC 1XF1A 4CW1A 3JTTA 4F7PB 1U3HD 4PJDB 3QO1B 1BBJA 1WVZA 3KLDA 4J7RA 4HGWA 3LN5B 1XGUA 4QOKA 2IQ9H 3QWRA 3O11A 1HI6A 1S7QA 2HLAB 1JTTA 1EEQA 1I7UB 3KJ4C 5IB5A 2YZ1A 4XP1L 2BSRA 3FQWB 1QLRA 3HE7D 3JVGC 2F54D 4GRWE 5BVJA 5EO9A 5D2NA 2JELH 5F7WC 5C0AA 2WMPA 5DLML 4NBXB 5IQ9B 4GW4A 3PL6B 4KV5E 3L7EA 1J0ZA 4V2CB 3IJSA 4UV7H 1I9IH 5AD0A 5KVGL 4DKEH 3DGGA 1CXKA 2Z8WC 1K4CB 1GOHA 3ROLB 1NMCB 1QD0A 2YPVL 4HKZB 3I9GL 1L6ZA 3DMMC 4J2XA 4HXAH 3UTSB 3E1F1 4PG9A 1QRND 4IOIB 1N2RB 4PLOB 2X7LA 3VWKA 4EDXB 4P9HC 3DV4A 3ILQC 5JDSA 3SEPA 3F7YA 2PTVA 3AY4A 1VPOL 4MX7B 3V0WL 1SY6A 1QLEL 3EO0B 4KDWA 4MQ7A 5GXBB 5CIPB 3MV8A 4ENED 3LKQB 3VXMB 4ZFZB 3WIIH 5DK3A 3TYGL 1MWAA 3FN0H 1QTYT 2EDOA 1NGQL 4Z8FL 5GHWL 1RUAH 1KV3A 1H3VA 3CX2A 1ZGLB 3VWKB 1WFUA 4Y7MA 1F3DJ 5BS0E 4MJ4A 4TYUA 5I2IA 5D71L 5CCKL 4YHKH 2J7LA 4DGIL 2A83A 4XMLH 3NOIA 4ZPVA 3SE3A 3MJ7B 4Z76A 5EPMB 4MVBD 4TVPH 1T83C 4L9LB 1NDGA 1Q9OB 4AENB 5HHPA 4EQ3A 3MRIB 3S6CA 5J56B 1MHCA 4GMSH 3GJEB 4HLZG 4Z7VA 5D7JD 4JZOA 3VFPB 5IJVB 3QCTH 3LKOB 3ALPA 3UTZB 1P7QD 3T0EE 2UWEE 5SWSE 1FNFA 2VDLH 5GS2D 5FYLE 4DK3A 3NCJH 3QIWB 4I4WA 2R8SL 3KPQA 5FYKE 3HNSL 3S35X 3HR5B 5I66B 1J1XL 2BCKA 5IHZB 3CVHA 3G9AB 5IB1A 3OAYH 1M71B 4JG1L 3ZKSD 5I30H 2OR9H 1LMKA 1KIQB 4JHAL 5ESAA 1ACYH 4G9DB 1FYTB 4AJ0A 3WLBA 4HPOL 4NHUA 2VR5A 4MXQC 1R24A 1T66D 3WJJA 1GZPA 3EFFA 2PXYA 5F9OH 3NCJL 2GUOA 1NAKH 1NAKL 3GHEH 3SO5A 3QI9C 3L3KA 1P84K 1JPSL 4XP5H 2W60A 2ZP0T 4TN9A 4LSSL 2BVPB 1FLTX 1RJLA 1XEDA 5BVPL 1EBPA 2DM2A 4P46D 2EDRA 4NBYB 1B6DA 5EU5B 3VXSD 4E9LA 3B4NA 4Y1AD 4RWYL 4JDTL 2VLRD 1F4YL 4G43A 3DUHA 4JZJC 3Q2CA 4RIRB 5F7YC 5BRZB 4KRNA 4RRPG 1PKQB 1K8DA 2VUOA 2WQ8A 1U3HC 3SDDC 4E0RB 3LRHA 2C3GA 1ADQL 3CFJB 3VXNB 2E6QA 4TOYL 4U1SA 3SDCC 3WNKA 3BZ4B 1KEMH 1IZKA 4ORZC 4WO4C 5EFIB 3LB6C 1A6AB 3H9SD 3CXDL 3UCRA 4LNVA 1MI5E 3NZHH 3QWOA 4BQBA 4X4MA 2Y25A 2GT9B 3FO2B 3H8NA 1I1AB 2DLIA 1YEDB 1P4LA 4X6DF 2GHWB 3MPCA 3LKOA 2RJMA 5J89A 1NBZA 5C08B 4HS6B 1PZUB 3OF6A 3VH8B 5J9PA 4JFFB 2W91A 1KB5H 2HVJA 3W0WD 3KPRA 5KSAA 2UZIL 3KHOA 3MJ7A 1MHPH 3OAZH 4N8VB 5E99H 2IH3A 2RFXA 3MA7A 3C6LB 3GSQB 3VFTA 4BFIB 4NQCB 1OD9A 3RPIB 1BAFL 3IXAA 3H9SE 5IKCA 1UGNA 3P0VL 1J0HA 1A7RH 2OJEA 1BVZA 2BK8A 1HE7A 3LEVL 4WUUB 4GFTB 4YK4B 3KYOA 3G08B 3MV7A 3DX6A 2YD5A 4PB9L 3T3PF 2X4RA 3IU3A 4K7FB 1NEZA 3I50H 2FJHB 5MP6L 4HGMA 3SDXF 1DEEA 4FXGA 2P5EB 3HC4L 4M62L 5GRJH 5DQ9A 4NO0D 2VZTA 3UTTD 5T5NF 5F9OL 4HDIA 3BP5A 5KSUB 2YSSB 2AJXH 2MQ0A 4TNWK 1PQZA 3VFRA 1CI5A 4JQVA 1YEFH 5CSGA 3UTQB 2IFFL 4L8CA 1TETH 3VD9A 4KROB 1AXTL 3ZSTA 4MHHI 3WHXA 2P24B 4OCNC 2G60L 1JFQL 4PJHB 4WI9A 4WV1C 3W9DB 3ZL4L 5GISH 5F7LB 1I9RH 3I02A 3KPLB 4OZGB 2FX9L 4HKXB 3UYRH 4PRNB 2J3SA 5EU3A 2CO6B 1U91B 3O6FC 5DYOB 1IGIH 4RIRA 2WLYA 1CR9H 1EUUA 5TQ2L 2A9NL 1FAKT 4IRJA 3JV6B 3UAJC 1MREH 1KB9K 5FYLD 3TCLA 4OCYL 5DD3L 5ESQA 3S36X 4OT1H 3PG2A 5IB2A 2DLGA 4OCSL 4OAWB 5IFAL 4ZUUA 3HLAB 1DANU 4LSPH 3GMPB 1MJ8H 1YC7A 5GS0H 3LQZA 3KPLA 1YY8B 4MCZA 5B4MC 2EE2A 5E6YA 5IBLD 4LLVA 1I1FB 2OTUA 1I4FA 1S7SA 4YUEL 2FH6A 3MXWL 4FTVD 1WGOA 4L3AA 3U4EA 2CLRB 1K5NB 4NQED 1N3NA 4WI2A 1G7QB 5ACZA 2Y36L 4ZFFA 3GSOA 4ZXBC 4NGHH 5KVFH 4PLJD 1ZAGA 3I3EA 4P49A 3I2CL 5MI0B 4NKMA 4QHLB 1FL3B 1WBXB 1NEUA 3BP5B 2CLVB 1L0QA 3RL1A 2ADFL 3GRWA 5L2JB 4OUOA 1NLDH 3QUYB 4APQB 5BV7B 2E27H 4GG6B 3P30L 4CN4A 2YRPA 5GGRA 3U79A 5B38B 2JJTC 4K7FA 1KEGL 3HC0A 4JKPL 1KBGL 2ED8A 1DQLH 4XHJC 2VDOH 3GO1L 4GBXA 1KTKE 3GB7A 3LY6A 4E41B 4EZMA 4X4XA 3RUGA 2R0KH 4RAUB 5F8RC 5E4EC 4CADA 5IIEB 3GSVA 4PRHE 3BOVA 3C6LA 3V8OA 3S4SB 5FM5M 1TMCB 4G42B 5TJWK 3CVIL 2OTWB 4H8WH 3HC3L 2CLZA 3GNML 3FB7A 1ED3A 2AI0H 2QTEA 1A6UL 3KPRB 3IDIA 1RUML 3HN3A 4JN1H 4DW2H 3UBXA 4HS6A 1I7TB 4DTGL 5GGVY 3AAZB 3S4SG 3JSSA 2CUHA 3VXSE 2E7LA 3V7AE 3O0RH 4ZMAT 2VLRE 4ZUWB 5IFHH 4O58L 2OL3A 4LKXA 1MLBB 3LDBC 4XI5D 1MRCL 3VXRD 4XPGH 4PV8A 4WVRA 2XZZA 4YDLB 5B8CB 2X70A 2Z0BA 1XCTA 3CSBA 4UT7L 2BVQB 2DQUH 5ISZE 2CMRL 4J8RB 5E8DL 3GBNH 3LHPH 1IAOB 4HUXB 1RK0A 1HSAA 3D87B 1KIRA 3GBML 3IXTB 2X4PB 5HHMD 4XMKL 4S2SA 3WIHH 2DI7A 2Z91B 1YNKH 3CFKB 2HT4D 2QHLA 3RU8H 2H8PB 4GLRH 1A14H 2XPGA 3PWPE 2YPLA 3U0PA 2XZCL 4QOKB 4S1DD 5JORA 2I24N 4MNGA 5HHXH 3T1WA 3FQTA 1FN4B 4UI2A 2GFBB 4KDVA 1AGCB 4U1LB 1UA6L 1UA6H 3D85A 5KAQG 3WO4C 4LK4A 4F7CB 4L3EB 2IAMB 1U8IA 1OSPL 3BQUA 5HGGS 4I0PA 1KJVA 3KVQA 3ZKXC 3MRBB 2UWEA 3L6FB 1VGKB 4BYHA 3UTTE 1E4WL 5C0BA 1PG7X 2GFBA 5I1IH 2YWZA 2EDTA 5KTEH 2X09A 2CUMA 5IBLC 4XCEB 4TPRH 2NX5E 5K9QI 3CLEH 3TP4A 3KPQB 1ZHBA 2DLFH 4Q6IB 4Q9QH 4NWTH 4JZOB 3M17B 1C08B 2Y23A 3QI9D 5DZLA 3RY4A 1CICC 1MCNA 5E8NB 1IM9B 2W0KA 3BPLC 1NDGB 3TFKD 4OKDA 1N4XL 1AC0A 3HB3C 4QRRE 3NIDF 3VFSB 2O5ZL 2R56L 2WV3A 5I71C 3RVTD 3RVVC 3KJ6H 4OGYL 2B0SH 1QFWH 3TBTB 1BBDL 4LLWA 4M4RA 3U1SL 2VAJA 3PDOB 1C12B 5GRVL 1IGFH 5L8JB 3G5YB 4DUWA 2OX5A 2EKSB 1JIBA 1U0QA 2EKJA 3LQMA 2AK4E 2ATPA 3AAZA 3C60A 4U0RB 1INDH 1C1EH 4X7DC 5CIPA 3DX8A 4HC1A 1GXEA 4P23B 5DHYA 4BJLA 1N4XH 3LS4L 2CIKB 4PRIA 1JCKA 1FZOA 4GJTB 5A16B 4RISL 3D5OF 2BC4A 4D0DB 4IOIA 1A9BA 1T04B 2FX7L 1MCRA 4G6MH 3VXUE 5D7IB 5INCA 1H15A 4XMLL 1OTUC 4ZDHA 5TDNA 4MD5A 1LP9F 5C09A 4YHNB 4RGMB 1G7IA 3QUMA 4KTEH 4C83A 3BESR 3G6JE 3OJDB 2VIRB 3WNPA 1DQJA 1J88A 1GCFA 2V7NB 2EDNA 3WIIL 4X8JB 3V4PL 4X9GA 1P7HL 5KVFL 2ADIA 1RUQH 4HWZA 3L7FB 2RCSH 5C0BE 1KNOA 4WWKC 4XNZC 3FB5A 4ELMB 3IS1X 3O11B 3MNZA 1T5XA 4NHCL 5CEYB 4HH8A 3SJVE 3P40A 3MBED 3JTTB 4F7PA 4JO1H 5E1AB 5F88B 1RFDL 2GAZA 3L3IA 3P11H 4HKBB 3QXWA 2IBZY 3LQAC 1TVBB 1U8MB 3CZFB 3MLWH 2YUVA 2XWBB 1NCDL 4G6AC 5CUSL 1SJEB 1T4KA 2APXA 4MHHG 5A3IC 4G6FB 2LVEA 4HIIA 3OJ2C 4WGWB 4XXDA 1VENA 3HNVH 3NFPB 4ALAL 4ZAKD 3UJTH 1LDSA 1RZIB 4ZO7A 5D7JB 4NHCH 2EH7L 2NY0B 3MRLB 2FGWH 1T0PB 3E6FB 1PYWB 1CK0L 1IM3A 1IC5H 3WHE1 5IR1B 2A2QT 1FPTH 2ENSA 2FEDC 1JI2A 2KZ1B 3SDCD 1CFTB 2VKXA 4RMQA 5HI4C 5LG1A 4M7ZC 5IHUL 1RZJH 3SY0B 3EGSA 3L3JA 3VDCA 4IOSD 3PQYA 4OZ4A 5E2WH 3P9MA 2AV1A 4GUPA 5DYOA 1PJ9A 4LPUA 4OM0L 1KIRB 4ALAH 2HKHL 4XTRC 1FYHB 3GSNH 1UZ6F 3RGVC 1JPSH 3ZE2F 5C6TL 1MH5A 4U1IA 1ZT7A 1JRHL 5C6PB 1WFTA 2PO6C 3MV9D 5EB9A 1A1OB 2VSCA 3WSQH 1F6AB 4QXTB 2DD8L 3MJ9H 1KN4L 1JV5B 5GRXG 5DEFB 1ZA6B 3HE7B 5D7LE 2MCG1 1X5IA 2LV4A 3EO1A 3B6SB 5DRWA 2QLVB 3P3YA 4PRPD 1Y6KR 5I8OH 5I1AB 4TUKH 3WN5C 4OJFL 4QHMA 1RAMA 4TRPL 2MJWA 1CT8A 2WUBL 1CGSH 4QHKJ 5EIIA 2BNQE 2VLJD 1T7VA 5JOFB 1QA9A 1NGQH 3ABZA 4Z8FH 4TQEL 1IILE 5CP7B 5B21A 3HI5L 4ZXBD 1RZJC 1YNLL 3ARQA 5DMIL 1KG0A 2LFGA 3WE6B 1KJ2L 2OJEB 5DJ6B 4TVPL 2EDDA 5IW1A 3WHE0 2XKSA 2CQVA 3ARZA 1D5ZB 2VXUH 2NZ9D 2UVEA 2FIKA 2CKBB 1XR8A 1E6JL 4I3SH 4GMTH 4WI4A 3RA7H 4QRTB 1AO7D 3QA3A 4P4RB 5HD8D 1T7XA 3D2UD 5JIIA 5EOCL 2VOTA 4OQ1A 4V2BA 1EFXD 2YXMA 4KHXH 4KFZC 1C7SA 2FYYB 4Y1AE 4FP8L 5CJ8A 2BNQD 4PGCB 3W0WB 5FV1L 4LGSB 3V52H 2VL5B 2R0LL 4F80A 1TCRB 2D9CA 2Y6SC 4OSUL 4MMXC 1KJMB 4URTB 4PREA 3SGEH 1JHLH 4KRMB 4MJIA 1JP5A 4YHYC 3BGMA 4XPTL 1FVEB 4PJIA 3QIUB 2R2EB 1F4YH 5EFIA 5IVZB 1I1FA 5GGSY 2Y1VA 1BWWA 2EDLA 2WSKA 3QHFH 5E9DE 5E2JA 3D3VB 4Q6YA 1MY5A 3OKEB 4PYGA 2C5DC 3R8QA 1D6VH 2VR4A 3FO9B 3U4BH 3KR3H 4OD2A 4JFOB 4H88L 4RNRA 5GRUL 1U93A 2Y06L 3NCYS 4Y4FC 1HQRB 3WNLA 4XVSH 5D7IF 3TT1L 1QPXA 1S9YB 4AL8H 3KLHD 2W92A 3EFFB 5C9JA 4XCCH 4Z6AT 5GPRA 1M7IB 4JY5L 5HGBB 1FCGA 1JWMB 3R1GH 5DQJB 3MV11 2DBJA 4BFGA 5FF6A 2CH8A 4JPWH 3X13A 3VXMD 3IAGC 1MCWW 4LU5L 4WW2A 3KYNA 1RHFA 3VRIA 1CVRA 4LVNB 3NCMA 1MHEA 5BO1L 3UBXG 3U7AA 1GH7A 1OD7A 2R4RH 1I8MB 4PJHE 5IHZA 4M93C 3HE7C 5AEAA 3BMVA 1XIWC 5K9KA 1NFIB 3FT4B 3TWCL 1EO5A 3WFBH 4ELKB 2F58H 2Q3ZA 4LQFL 1AHWB 3QAZB 1A7PH 5GGSB 1C7TA 1QBBA 1B2WH 3HZVA 1MRFH 3V0VB 2J6EL 3HZMA 1MPAH 2EEAA 1WLHA 3IF1A 2Z31C 4R90L 3IDMB 3RGVB 4JRWA 1D5ZA 3WCYA 5CD5D 4U3CA 5HHVH 3G08A 4P59L 4Y1AA 3ARUA 2ZUUA 1CDCA 1YEHL 4TTDD 3RWGB 4K3GA 1U41A 5DC0A 4N8VG 5D6DC 4NQCA 5B3JF 3BH8B 4C56B 3A67L 5MEOB 2PYFB 3DXAB 5F1IB 5IK3B 4MXWL 4C4KO 1AXSB 5E8OB 1SEBB 4GT7A 4P2RE 2NY0C 3NABH 2NCMA 1AY1L 3ZT7A 3SKJL 3SQOL 1YEJH 3ZYJA 4HWEL 4U6XA 3OR7A 35C8L 1I7RA 1MCEA 5JW5A 3S3PA 4AQOA 4ETQA 3W9EA 1XR9A 2DBLL 4WTZA 1CF8L 4NIKB 1NMBH 5I9QC 1P4LB 1S9VB 1CE1H 1XFPA 2X6MA 5DLMH 1O7SA 1IAII 4PBVC 1F3DH 5JHDE 1J1OL 1QFWM 1YY9D 4NZDA 3RI5K 3O3BA 1CLOH 2G60H 3QJHB 4KI5F 1A9EB 4ZODA 4I48B 5IGXL 5DURD 2DJSA 3QG6A 2M1KA 3GMNA 3HG1E 4N8CH 4XNZB 4ZS6D 4NSKB 4JM4L 1R5WA 2IANB 3SO3B 4QRUB 3TZVA 1X5ZA 1CL7H 2DWEA 3CFEA 4P3CL 1NCNA 3RVUD 2HN7B 5AZEH 3K3QA 4IRZL 4FQJL 4M1DH 2RB8A 4Z7WA 3HZYA 4IDLA 4G5ZH 1RJZA 2IPUK 2G2RA 5CD3B 4ZYKB 1WC7A 2X42A 5DDHB 4NJ9L 1AO7A 1BBJB 4NO3A 2ATKA 4HPYH 3PWPA 5ADPL 4LEXL 2AAVA 1U8QA 2R4SL 2YD4A 4MNQD 3VE0A 4U7KA 3DETD 2W1NA 3EJZD 2I9TB 4Y5YB 3TA3B 2PTTB 3TH4T 1A7RL 5ESAB 2GTZB 4P23C 4P9HH 4P0DA 3DVNA 4U0RC 2EE6A 4HIHB 4JDZA 3UZVB 1MF2L 3DWTA 3MRCB 2OS7A 1MAML 3LS5L 5ISZB 4MA1B 2ICEA 2PETA 3B5HA 5LGJA 1BQHA 1S7UA 3VFMA 1T0NA 2A38A 3BKJH 2QKIA 4WGVB 2E8YA 1D9KB 1WUNT 3QEQB 1F4XL 4ISVB 1D7FA 4PJBE 5C92A 4JZJA 5D1QA 4WO4D 4PGZA 1NAMH 2QEJA 3UO1L 4Z7VB 3LB6D 4PLKD 5DFTA 4MDJB 4NQTA 4LCWE 5A2FA 5JNYA 4UQ3A 4Q6IC 4K9EH 2YD2A 5SWSB 4UTBL 1KLUA 2J12B 4XPTH 2Q86A 4MD5B 4MDIB 5TGBB 1RUAL 1HKFA 2W0FB 3DX7B 2EO1A 2LAGB 5CEZL 1IFHL 1IFHH 4JGJA 1CXLA 3HNTH 1QVOA 2OTPA 2EDWA 5EH1A 3DPBA 1A7NL 4X83A 1RUPL 3VCLA 1KCKA 2J8OA 2JJVA 2PW1A 2N7BA 5ITFA 1LE5B 4JR9L 1FORL 4I3RL 4R4FL 3VXMA 3FN9A 2ZUSA 4QXWA 2NY2C 1UCBL 2ICWI 1I9IL 1P9MA 3QPQC 1HEZA 5DVNA 4DGYL 4JDVA 3ZKXB 2OM5A 3VD4A 3QIUD 5DI8A 4IBLT 4Z7UF 5E24E 3CUPA 3RTQA 1FZJA 4OIIL 2FB4L 2NXZD 2EYSB 2NY5L 1A4JB 3T3PE 4QT5B 3VXME 5C7XH 4LCYA 3VFNB 2R1YA 1K2DA 1OAXH 5IB3A 3OAUL 4PV9A 3H42H 2Z8VC 3WEXB 4UIMB 3X3GH 1MQKL 1NKOA 2D7TH 5DMKB 4EIZC 4LMQE 5E8NA 1INDL 1C1EL 1ONQB 2ID5A 5F9JA 3T8XB 1G7PB 5GIRA 2V5YA 5EBWA 1CDHA 1WWCA 4Y16C 2A0LC 2PKDA 1LO2L 3QUKB 2E9JA 5EU6E 4BH7B 2IBZX 4D2NA 3UZQA 1FNGA 1INEH 3CSPA 4CNIB 1U58A 2AKRA 4FG6D 3ZKQD 5JA8B 1ORQA 3ARDC 4GRWB 2OCFD 5ICXA 5CKAA 4KRPD 4HIEA 3NPSB 5F71A 1J7VR 1ZT1B 4K3EH 4ORGA 3C5ZD 4KU1A 5SX5H 5BOZG 3RZCD 4YHLH 4YFEA 2DDQH 1MFDH 2HKHH 1U9KA 1BQHB 1GGTA 1HHKA 1NCCL 4N0FB 5SWSD 3IDYC 5IG7B 4J3VA 5ICZB 3GMQB 4HFWA 3V5KA 2XA8L 4XAKD 1PY4A 2VDMH 4UT9H 5L88L 2EECA 3WFEH 3QWQB 1IVLA 3MRGB 1X5YA 2GSIA 1KIPB 3OKOA 1IC4H 2JJUA 1DN0B 3FRPG 2BVYA 4ODTL 3ZHLA 5C0IB 1ZVSB 4X4YB 3HB3D 43C9B 3VD7A 3TVMB 4LARH 4X5LA 2EYRB 3M8OH 2AQ1A 4AEEA 3DBXB 5KSBE 4PJGF 1J1PH 3CK0H 3QHZL 1RK0B 1RSFA 2DQIL 4OQTA 1HXMA 3SKNA 5JZ7D 2DMBA 3HC3H 2Q8AH 4PJ7A 3RHWF 4G8EA 2I5YL 5IMOA 3PGDB 1MLCA 1Z5LB 2Y5TB 3VGAB 3HZYB 1H9VA 5CGYD 1W72H 3O8XA 1ZANL 4LGPB 3TCXA 3H9HA 3SDAB 1HYSC 1Q0YL 2JJSC 2NY1B 3GJFA 3LCYA 4MNQA 1I9RL 4EUPG 2XZQH 4XPAL 3BQUD 4LLYB 1G9ML 1IKNA 4LSRL 3BDBA 2F5AL 5DSCA 1QLEH 4NSKA 1OP3K 1CBVH 5C0BD 4LHUG 1CLZH 4YHIB 5I18L 4IMLA 3PHOA 4PRPB 5KOVC 2XQBL 4KVCL 5JHDD 4KK5D 2JB5L 5CZVH 2Q1EA 4ONGH 3ZE1E 2X4OA 2GK0B 3I6GB 1H3PH 3F7VB 4Q58C 4JFFE 3OSKA 5EZJB 3RVXC 3DBXA 4QGTA 4J3WA 1I85C 1KCVL 4RQQB 3FB8B 5ID0A 3WIHL 2AJYL 2J4WH 3BUTA 3FQRB 5KSVA 1X4YA 1AGFB 3QI9A 3OPZH 1EVTC 2NY4D 4OLXH 3TO4B 2HT3C 3G6AA 1GYAA 2B4CL 1GC1C 3EJYD 4NNXA 2K3TA 2VLMD 4OZIA 3QEQE 1WFNA 1U3YA 1S7VB 5IG7A 3VH8G 3ORJA 2DQTH 5T3XE 2EIZB 4AIZA 5CD5C 3VMNA 1IEAB 1MFBL 3EYVA 2F53D 5EZOL 4S1SL 3N85L 5DFVD 2QQLH 3MRRB 4OLXL 1OB1A 3MFFA 4XNYH 3D39B 2DICA 1OARL 4K8RL 1F2QA 2B2XL 2G5BB 3D0VA 3ZKMD 1ZHLA 4ZQKA 4OI7A 5DS8A 4DKFL 4LCWD 3MRPB 4PRID 4UV7L 2BMKA 5EUKA 3L3HA 3DYMA 1GSMA 1T22A 3AS0A 1B9ZA 4OF8A 3WS6A 4LAQL 2NYYC 1U2HA 4NO5B 4P3DA 2Q7YA 1LE9A 2MKLC 1U92A 1UJ3C 3BH9