1IAIH

Idiotype-anti-idiotype fab complex
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
219
structure length
219
Chain Sequence
QIQLVQSGPELKKPGETVKISCKASGYTFTNYGMNWVKQAPGKGLKWMAWINTYTGEPTYADDFKGRFAFSLETSASTAYLQINNLKNEDTATYFCARDGYYENYYAMDYWGQGTSVTVSSAKTTAPSVYPLAPVCGDTTGSSVTLGCLVKGYFPEPVTLTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVTSSTTPSQSITCNVAHPASSTKVDKKID
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords IDIOTYPIC FAB 730.1.4 (IGG1) OF VIRUS NEUTRALIZING ANTIBODY
publication title Crystal structure of an idiotype-anti-idiotype Fab complex.
pubmed doi rcsb
molecule tags Complex (immunoglobulin igg1/igg2a)
total genus 35
structure length 219
sequence length 219
ec nomenclature
pdb deposition date 1993-12-28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1iaiH01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1iaiH02
1U2CA 5JTWA 5KOVC 2GK0B 4EUPB 4M61A 1A7OH 1N3NB 5ITBH 3LRHA 3FT4A 3TBSA 4OQTL 3QZWG 4YFDB 5JXEC 1Y0LB 2DM7A 4PY7A 4G9FA 4WO4C 1AQDA 4MGXA 4LASL 3TH2T 5LXGH 3T0VA 2DM2A 1G1CA 3QRGL 4A2MA 1ETZA 1U0QA 5TQ0H 1ZE3C 1KF9B 4K9EH 4KV5F 3KPPB 1ZTXL 4XPBH 2X4PA 1F4XH 1J1XH 2P4AB 1IC5H 3S3SA 4CVXB 3GSXB 2P8MB 4L4TB 4XBEL 5DD0L 4YC2B 2BJMH 1Q9OA 5F97E 1YEEH 5EU3B 1F58H 4DKEL 2Z8SA 1S7RB 4ACPA 3MRHB 1DLFH 4QGYA 5GGSY 2X1OA 4RBPK 2DI7A 15C8H 5C6PB 4O4YH 2MCPH 2EH8L 2NZ9D 4Y5VA 2XKSA 2MPAH 4W6WB 4XC1H 1EJ6A 4PR5B 4PBWD 3WXWH 1UFUA 1WC7A 4MX7B 1P7KA 4LVOB 2EDHA 5HJ3A 1EV2E 4MNGB 4WEBL 5HYSA 5FM4A 3UBXA 4R2GB 1OF2B 3UTQA 4LLVA 4Y16A 4UT9L 3NIGE 1DQML 2BC4B 1UENA 5T1DH 3HI5L 1NJ9A 4FNLL 5EUOA 1E27B 2CKBB 3B9VA 3QG7H 4K9EC 2Z8RA 1L0XA 1CL7I 1WK0A 3TBWA 1NGZB 2XY2A 3TCLA 3I50L 4LEXH 1R5VA 4LCUB 1P53A 2B20A 3TGXA 3ZHKA 2J4WH 4XPHL 5D2LB 2W0PA 3TJEL 4GKSB 5IWLA 2AJYH 4QTIL 1A7PL 3OGOE 3E8UL 1JCKA 2D7MA 4H5SB 5LKNA 4JO3L 1MI5A 4M5ZH 4QEGA 4JKKA 2RQ8A 3DUHA 1S78C 1DN0A 3L3IA 4XAKE 1AO7E 2ZNWA 4LLYA 4MZ3A 2QADC 3D9AH 3P4LA 1F8TH 2OTUB 4KTYA 5I73C 3U0TB 4X6BA 43CAB 5IFHH 4RFOH 3PJSB 4HFUL 2IQ9L 4QXTB 1DUZA 4Q9BA 4KFZC 4JO1H 1W8OA 2NMSA 5C0IA 4M6MH 4KUZL 5HGDA 2ZG1A 1UVQA 1KFAL 1I8IA 1SBSH 5C0NC 2E8YA 1CD9B 1MRCH 2ICWJ 4MNQE 5HD8D 4AG4H 1M1SA 1AKJB 4QCIB 4YGVB 1EMTL 5CUSL 4POYA 2XN9D 1NQBA 4J23A 5EORL 1U8PA 4Z0BL 2NR6D 4KY1L 2RIKA 4N8VA 4DZBA 4CU6A 3O11B 2H1PL 1QRND 4PJEB 5SX5H 2YZ8A 4E42B 5CIPH 3SE8H 3QAZC 1A6PA 3T0ED 3OPZL 3TNMA 1L4IA 1GC1L 4NCDA 4FQ1H 4RA0C 1PYWB 1K4CB 4MHHG 1CD8A 3EW3B 1A6AB 4WI5A 2I07B 1HHKB 4O5LH 3I84A 2CLZB 4F2MA 5CP3A 1IM3A 1ZS8B 4JFHE 4YHLH 3RY5A 3DYMA 2IAMD 1CD1A 4YHIA 2FJGB 2PW1B 4UTBH 2A0LC 1J05B 4ZFOA 3D39E 1LK3L 1JNHB 5FYKH 3TJHD 1DDHA 5ENWA 3RZWA 3IU4L 5FV2A 4FTVB 2QL1A 4KAQL 4FXGB 3QZWB 4LKXB 4MNHB 4QRSA 2D4FA 2NYYC 4DVBA 5E2VL 4LRNL 3WO4B 5DGRA 5EPMA 1S9VB 5HHPB 3LZFL 1QSED 4FZ8L 3I02A 3MLUH 4X8JB 2AK4D 1FZKB 1HDMB 2GSGB 5J57B 2WUBL 4JO2H 1HE7A 4POUB 4XCYA 5LGJA 2X05A 1KB5H 3SGJC 4XNMB 3L7EB 3G5XA 5DJCA 3QDJB 4OZIF 5E4IA 1CDIA 2AAVA 4TQEL 1AGDB 2QSTA 3CFJA 3ZHLA 4JZNA 1OT2A 3QA3A 1IC4H 4PB9L 1WICA 3TO2B 1XZ0B 1E6JL 2VLKE 1X6NA 1VA9A 3MLVL 1K4DA 4G8EA 1AE6L 1U8KA 1HXMB 4OAWB 2G75A 1FLRL 25C8L 2R2CA 5LCVH 3VD5A 2J6EH 1QQDB 3S36L 3QPQD 2B5IC 3DX9B 1WSST 4QXWA 5EB9A 4IM8A 4WY7L 4XVSL 2VC2H 4NN5C 4X5WA 1DSFH 4JVPA 3BPLC 4D0CB 5BZWA 1Z9SA 4LLAA 4FABH 2EDDA 4B53A 1KLFA 4G42A 3KYNB 1J5OL 2VAAA 4HBCH 3BWAB 3MJ7B 4KRPB 4R8WH 1RUML 3U9PH 5EN2B 1D9KD 1LO4H 4LCWA 3G6JB 1J1PL 4M9PA 4TNVF 5D5ME 1S3KH 3ORJA 2ZG3A 1UEYA 2LU7A 2NTFB 3DSFL 2NXZC 1T5WB 3IS0X 3TH4T 4YEFA 2HRPH 3QO1A 1WZ1H 2FX8H 5K93A 1KJVB 2GAZB 3IJHA 4OLVH 2O5XL 5H8DA 5C08E 4QHLA 2EXWD 1JGVH 3TT3H 1CS6A 1AGBB 4XPGH 1HSBB 2YWYA 4EXPX 1S7XA 4G9DB 5DJXB 3HC4H 4YX2H 1ZAGA 1MCSA 1QBLL 4YDKL 1U8JA 5CCKH 4XNYL 2AQ1A 5MERA 2GJ6B 3QI9D 4ZSOA 2VLJA 3RBSA 2XZAL 3WHE1 3OR7B 4OD2A 3EDKA 1CQYA 4JREC 1P7QB 5IEKB 1ZGLB 3QIWA 5C0JB 1KENL 2IANB 5L9DH 2X1WL 3FRUB 5EZJB 1OD7A 2VDPL 4MD0B 3KXFA 4XVUC 1AC0A 5F1IB 3BESR 4Q6IA 3V6OA 2QKIA 1EDQA 1N59A 1G7MA 3QUKA 4FQIL 3THMH 3SDCC 4WO4A 3WHXB 1UM4H 4M7JL 1W8NA 4HULB 3F12A 4EN3B 5E7BA 1IAOA 4XMPH 3VI3E 4JO4H 2PO6C 2AKRB 4XX1G 4XVJL 3LMJH 1I4FA 4ZXBC 5IV2B 2F54B 1IAIL 4GAFB 2H2SC 3IJSA 2DDQH 2ADJB 4M02A 1J0ZA 1JPGB 1TZHB 3L5XL 1NDGB 3OHXA 1KSRA 1QVOA 1YEHL 4JFOA 3X3GL 1WZMA 2ZOKB 2YRPA 4NKQB 4BH8B 5IB5A 2IBZX 1OAXH 3PP3H 5HHOA 3FO9B 5T1LD 2EC8A 3O3DA 4BSVB 4Q2ZA 2VXSL 1EBPA 1FNEB 2BVQA 2EYSA 4QT5A 4RAUB 1AQKL 4OZGA 3MOBL 1NCCL 1CE1H 4BK5A 3C9NA 3AS1A 3TVMD 1BF2A 1UA6L 3WN5B 5CFHA 3MRGB 5FKAB 3BH9B 3DMMB 1I3GH 2R15A 3NIFF 3WS3A 4UT6L 2FX7H 4LIQL 2YBRA 4TSBH 5SX4H 4OV5B 2YXFA 3VXSB 1A22B 4QYOB 4BH7A 5CJ5A 3WDIA 4PRHA 5DD5H 3HI6H 3HMXA 1N0XL 5EBMA 5JDJA 2GUOA 1HYSC 2NXYD 2HT2D 1UWXH 4JHZA 3PWVA 5T3XD 2CXKA 4WU5B 1BBJB 1MIEH 2XPGA 1LNUA 3PWPA 3ZE2E 3GO1L 4JANA 4PJIE 1K8DA 2XG5A 3QUYB 4FP8L 3FMGH 4MA7L 5E8PA 1QR4A 1QYGH 3WFDH 1BD2E 3QWOB 1AP2B 5I1AA 3SE3A 1VGEH 1P1ZB 1U92B 3X12A 3QXAA 5DJ6A 1NPUA 2R23A 1L6XA 2Z92A 4HK0B 5FV1L 2VLME 3L3OA 2DLFL 3NCEB 5B39G 1JGLH 3CVHA 5JLZB 3WS6C 4JPKL 1KLGA 2Y5TA 5B8CC 4F7CB 2YXMA 2J88H 2VDOH 3TBYB 5KVGH 2BOBB 1HI6A 1CK0L 5I9QB 1IQDA 1W0WA 4KI5F 3T0EA 4XCFH 5IOPB 3L3HB 4PB0H 3IJYB 1RJYB 2XWBB 1EVUA 5CJXA 1UWGL 3W0WA 4WI7A 5DS8A 3ULVC 1IM9B 2VWEE 3EKCA 4U33A 3FQRA 4Y1AA 1UXSA 4I0PD 1RUQL 5A2FA 5JR1L 3TA3C 4UV4H 4Y4FD 3UPRB 3ET9F 1JNJA 3U7AA 3RY6C 3VWKD 2AQ3A 1TVBB 4TNWK 4YR6B 2ZCHL 1WT5C 4RX4D 2ZP0T 5AAWA 1VACA 4O02H 3PWLB 1VFOA 5DI8B 5DUBA 3QISA 5DHYA 3WMSA 1NC2B 1F13A 3ULSA 1OP3K 5TF1L 2EEDA 4P2RD 2B2XL 3BVNA 3OZ9L 1U8OA 4P23B 2N4IA 3MV8E 4JFQA 5CJOH 4HG4J 3LN5B 2RJMA 3RL1A 3IDYB 3QCUH 3I2CL 3P40A 1FZMB 3PV7A 4OLWH 4HIHB 5GJSH 1NAMA 4JPWL 5I1DA 2DKUA 3VW3H 4TTDD 3BH8A 5DMGC 2XFXA 3KPSA 4TUOB 2P5WD 5JORA 3NAAL 4IIQC 1X5FA 2BRRH 3QNZA 1XF3B 3CUPA 4PV8A 4WCYL 2Y6SC 3EJYD 5AD0A 5HSFA 4HF5H 4QRTB 3HMXL 1F11A 1A3RH 3SGJA 1JWUB 3IU3B 2OP4H 4OUUA 5LXGL 2EDRA 1B4JH 4ZAKD 1OSZA 2DM4A 3TYFA 5ANMB 4LFHG 1NEUA 3V6ZB 4K9EL 2EE9A 4HV8A 4GXUM 3G08B 2ORBH 3QNYB 3TBTA 5D8JL 4KI5D 2BNUB 2PTTA 2BJML 1IQWH 1YEEL 3ZT5A 2CR6A 4PRIB 1SYVA 3HE6C 3L3DA 3E2HB 3TBVA 4XP4L 2R0ZH 5FO9B 1QKZH 3DUUB 5T1MB 1U93A 4Z5RB 5CEZH 2ZUQB 4PTTA 15C8L 4OLZH 5A16A 4O4YL 1N2RB 1HXYA 2NY1C 5EZIL 4L1HA 4XC1L 2BXYA 2GJZA 1NGYA 2W38A 2J8UA 2Y07H 3MRCA 3GJFH 1JYNA 4XX1E 1BLNB 3STLB 3FQWB 4EOWL 2O26U 2HVJA 3FO1B 3MREA 5CWSA 3ZDZE 4PREB 5I0DA 5D7JC 5D7IF 4XWGH 1QHPA 3FT2B 4PJBB 1Z9LA 2Q6WA 1LEGB 1R3IL 3N1GC 3DV6A 1OGTA 4S2SB 3TZVC 5F7FA 2YD5A 1MCEA 2WAHA 5HVHC 3IFPA 3CLFH 1QO3B 1MAJA 2X42A 4POZC 2Z8WC 4OZHE 1KG0A 4YHNB 3QRFM 4Q0XH 1VFMA 1DQJA 3O6FC 4OLEA 5IHLB 3HAEG 2X89D 4Y19A 1KPVA 3GB7A 4GXVL 3PIQB 4HMEA 4BKLB 5BVJA 3B43A 3BEWA 3MRRB 3QCVH 4H88H 3NZ8A 4TYUA 3OJVC 4Z7UB 4K8RH 2FBOJ 3UTZA 3D9AL 5JZ7C 1GXEA 1SYSB 5J1SC 5DZLA 1SVCP 2F15A 2AW2A 3BPOB 4MJID 2E9JA 4MQXD 5IFHL 4OZFH 3PHSA 4RFOL 3QEUB 3NGBC 3FZUD 1NAML 1KN2H 4JO1L 5DUMH 2E3VA 3NCYS 3NCJL 4Y2DC 4KJPD 4NRXA 4NJAL 1YUHB 1F90H 3A67L 5C71A 4AG4L 2EYRA 1A1NB 3EOYG 4V2CB 2OTWA 3OX8B 2PO6A 1CF8H 1BFOA 4L8BA 4ZXBA 3GMLA 3AY4A 3ZYJA 1ULVA 2IH3B 3AB0B 3JBG7 4PGBA 5EU4B 1AD0B 5E00A 1LO2L 4FMKA 3SE8L 2G60H 5KN5B 3W9DA 2F74B 4ELMB 2ZJSH 4LVNB 5SWSE 3MRBB 2DIAA 2A83B 5C0CA 4KK5D 1H3WM 4O5LL 4X7TB 1KXTB 3B8SA 5AZEL 3TT1L 1RUAH 4YHLL 4K8RC 5KVMC 4NM4L 4OLUL 4JFXB 1U58B 4NQUA 1AJ7L 2JTDA 2EC9T 1JE6A 4NQEE 4MWFB 3CGTA 3SDXE 3MNWA 1MCWM 2XZZA 3O6KH 1YPZF 4NQXA 3P4MB 4YPJA 3WNNA 4PPTA 2DS4A 4Z7VA 2EE6A 4UILH 4JAMB 5ICZB 4LPWA 5IFJB 2LAGB 5BS0E 2KDGA 4JFFE 4O58L 5BMFH 5J9PB 4RAVB 1X4YA 4JO2L 4RIRA 5D1QB 1K8IB 4N0FB 4N8PA 4PV9B 1GGIH 3VFOB 2DAVA 3GIVA 3QH3A 1KB5L 2DWEB 5IHUL 1ORSA 3ROOA 3DGGA 1NMBL 4S11A 2O5ZH 2RBLA 1ZHKA 2AXGA 2AP2A 5DJ2B 4F7EA 5BRZE 2DQJL 3CMGA 1SJEA 3BQUB 3FQTA 4NN6C 1TMCB 3R8BB 1F6AB 4CDHA 2G5BB 1BAFH 2DQGH 3WS6A 5DRXA 2V5SA 1XGYL 5EA0L 4HWEH 5B8CA 4J3WA 2E7HA 4HWBH 1UJTA 3H0TA 3BHBA 4HX1A 3CXDL 1OAUH 4BM7A 2J6EL 1JHTB 5DRWA 2XQYG 4MZ2A 4HLJA 1GJIA 1UWEH 1DUYB 3UJJH 3OQ3B 1U91A 5DMKA 1T5XA 4ZUTB 4AEIL 3BAEH 3Q3GA 4LVEA 3MRQA 1A4KB 4FABL 2AEPL 3HS0A 4HBCL 3TA3A 2LTQC 2XG4A 3HG1B 2A6IA 1OAKH 1E4KC 3PWNB 5CHNA 3RY6A 4D9RD 5BJTA 1IGYA 1OTUC 3BN9D 5HTSA 1WT5A 3MZTA 3JVGC 2FWOA 2CIKA 4XGZB 3V4VH 1S3KL 2VZTA 3MUGA 1DVFC 1FC1A 3ARFB 3TO4D 2ESVB 1KV3A 2BNQB 4NQDE 1IRAY 1T20A 2HRPL 1ZLWK 4K3EL 2FX8L 4TOYL 2WLZA 3VXUB 3P4NB 1HHGA 4OLVL 3MGAA 2XXCB 3F62A 3KNBB 3TT3L 4OTXH 2EYTA 5I8CB 2VDRL 4PY8J 4XPGL 3T8XA 3WKMH 5HPMA 5SWZB 3SJVE 1NGQH 3SKOA 5KOMC 3HC4L 1T66D 4YPGB 5D7SL 1JNNH 1BQHG 3T2NH 2XNAB 4MB5A 5KSVB 1MCHA 4XMKH 3EDJA 1INEL 1XH3B 3MRLA 2HJFB 2VH5H 3PGDB 3BKMH 5GS2H 4JKPH 4LMQI 3KG5A 3D85D 5HHMD 4QRRA 1MFCH 3V5DA 4G6MH 1JZ2A 4I3SH 4IIQA 1LEIB 2NY4B 1S5IH 4XTRD 1NGXA 2HFGH 3ARDB 3S88H 3RNQA 1XR8B 2QR0B 2X9YA 5F7DB 5C0DB 5DGQA 1P4LA 4WHTB 2R9HC 3ARUA 1F4AA 4J3UA 5E8EA 3SDAD 1A4JB 4IJ3B 3EHBD 4JO4L 3LMJL 1WBXB 3QQNA 5DZNA 1CGTA 5ISZB 2AXFA 3UTTA 4ODUA 5TDOB 3NACH 3E6HB 3DTXB 1Q1JH 2XV6B 4KK6C 5JPNA 4QWWC 4P4RA 4D9LH 1IKNC 3EYVB 3PP4L 4IS6A 1G0DA 3F6IA 5C09D 2C4XA 2WWKO 3HE6A 1OAXL 4WHCA 3CVIL 3VI4F 3C87A 4HH9A 3ARTA 1ND0B 5DA4A 1XGQB 4WV1C 1CE1L 1YQVH 3HC0B 1XF5B 2I9TA 4CBPA 3RVVC 5EU6A 1MHPH 3OKLA 1I3GL 3MJ9H 3Q5YA 5DHVA 4K71C 2PTUA 5DSCA 2HN7A 5D7JA 3DO7B 3GUTB 3HI6L 1E4XI 1ZA3B 3C5SB 4YNYB 3HLAB 12E8H 4JM2F 4P4KD 4GRWB 1PG7X 2ZUVA 5IQ7L 5CJQL 1AGFB 3CXHJ 4PJ8D 3ZLQC 3ULVL 3VMNA 1MIEL 4U6HA 1YNTA 1U95A 4J12A 5DF0A 3VXRD 4D0DA 1FSKC 2Z31B 4N90E 5E4EB 3MNVB 4RMRA 5EDXA 4JRYE 5HXMA 2CQVA 3C5ZA 4PGEB 1SEQH 1VB9A 5E8OA 5FYKE 1YDPA 3C5JA 4BK4A 3H9SB 3W82A 2B0SL 2K7PA 4XH2A 4GUPB 4I3RH 4EXKA 3I6KB 1ERNA 1VGEL 1HH9B 1L9NA 3UAJC 4EQ2A 1K3ZA 3FB5A 4ZO6A 3N1MC 2AV1B 3GSQA 5L8JB 4MS8D 5FOBB 2CDGA 3GKWH 2B39A 4YWGH 3P9LB 3MRPB 3O41A 5HGBB 1TJHH 1QBML 2P47B 3GJFA 1BGXH 3T0XA 2F53D 2E7LC 1ZLVK 1FIGH 2Y36H 5F93C 1GL4B 3OMZA 1WITA 4XCFL 3X13A 1LO5B 3LKSB 4PB0L 3IFNH 3SDYL 4IMLA 3MGTA 6FABL 1U2HA 3ZDXE 5JIIA 4Y2DA 4QXGH 2HH0H 1NCUA 4JHAH 2CLVB 4NQCD 1NBYB 4FQCL 3S8WA 2J5LB 4U1NB 1AR1D 4M1CD 4PJ9C 4ZO9A 4UV4L 1T0NB 1T83A 2R4RH 3LKQB 4HPOH 1U3HD 4CW1A 1BVLB 4D9QE 4ORGB 3IKCB 4YIQB 4JZOA 3P0YH 5AYQA 2ADGA 1JIBA 3VXMD 2APBA 3HZYA 4O02L 5EOTB 3CSPA 2I60L 2H9GA 2LV4A 2B1AL 4NHCH 3LEVL 1TNNA 3GJFK 1BZ9A 1FVDA 5DO2C 2C7UB 4J8RA 4HWZB 4GS7B 4JM2B 4DUWA 1X5GA 4IRSC 3B3IB 3BP7A 3QCUL 4K3JL 1E28A 5IW1A 4Q9QL 3B4NA 4JHWH 5K9OB 1F6LL 3SPVA 1YMMA 4PJXB 1I7RA 3AGVA 3P9MB 2E8ZA 1BREA 3ZKMC 3QDMB 1UACL 5I74C 1KCKA 2Q87A 2OYPA 1XEDA 4EVNA 3NIGF 3H8NA 3HZVA 4N0CD 2BRRL 4NSKA 2V5MA 5FHBH 2VDKH 3OB0K 3G9AB 2P8PA 2AJXL 4NHUB 5D6CA 5EO1A 4LAQH 3VD9A 2BVPB 4PJAE 5TE6L 2XWJA 1A3RL 4W6XB 5GRJH 1B2WH 1TLKA 2LE9A 1OM3H 4OSUH 2A9MH 1B4JL 5L2KB 1EZVY 4Z0XB 1MUJA 3WIHH 1R0AH 3QEQD 3EGSB 2E9BA 1IC7L 1FO0H 4LHQB 5IHZA 2EDXA 3INUL 5D7LE 1IQWL 3MZGB 4PRBA 1CL7H 1Q9LA 3OG4B 3SO3B 3GI9H 3EOBA 2W92A 4J4PD 5DQ9B 4HJJL 4ALAH 1A02N 5IBTL 1YN7A 1JZ4A 1VADA 2DQDH 3DX7A 5IW6B 4GRLD 2ADIA 1G7HB 3OKEA 4HIXH 4LF3A 3RGHA 2FIKA 4U3HA 2P24A 2Z8VC 3ARGB 3N06B 3UTSE 4L4VA 2P5EE 1KLUA 1ED3B 1Q8MA 1FL5B 3VE0A 3ARPA 4I2XE 5C3LD 4R90L 4DGIH 1CBVH 4EI5B 5E2JA 5CSZB 1DBKL 5HI5D 1IAKA 1IGTB 1KC5H 3JVGA 3B9KB 1OP9A 2C9AA 1DVFA 3GIZH 2C4FU 2F5BL 1KIPB 4ZTPH 4P5TA 3K4ZA 3VFUB 1NBZA 1K3IA 5GRVK 3CLFL 1QHOA 1S9YA 3DV4A 1FNGB 4LHUG 4NKDB 1W72H 5CINL 1T7YA 1JYWA 2P42B 5EO0B 5MEPA 2NZ9C 1BJ1J 2WMPA 2UWEA 4NZUH 1XGRB 4G6KH 4LOUC 1D5MA 1J8HA 2V2WB 3BGMA 2EH7H 4GSDH 5ETUB 4AMKL 2C3VB 4H88L 3T1FA 5MEQB 4X9IA 1I8MB 4K8RL 4JG1H 1I8LA 4RGNC 4QRQA 2MWCA 3BKJH 4MA8H 4D8PB 4P3DA 1C5CL 2OI9C 1EFXD 2R1XA 1KEML 4BZ2H 5TDPB 4WFHD 5KTEL 3T3PF 1C1EH 2DMCA 4FHBD 1QR1B 1DBMH 2LAAA 5ERWA 1T7VA 5C0EB 5E24E 1KN2L 5FGBA 1F42A 5DUML 1A9BB 3B6SB 3CFEB 4LNRB 1F90L 4F3FA 2VDQL 4JLRB 4XAKD 4L5FH 3GBMH 1D5BA 4OFIA 4RWYL 4TTGA 1KTRL 4GW4A 2BY1A 3GSWA 1QEWB 2A6KB 4APQB 3LY6A 1QFWM 5L2JA 3Q2CA 1KCUH 1IKNA 2G60L 4F33A 1YNKL 3FFDB 4NO3B 4R2GD 4P4KA 3O0RH 2WW8A 4RFEB 4PRPA 4XB8A 4PJ8A 4LU5H 1OGAB 1RUAL 3QJHB 1FYTE 4GAYA 5GRVL 3F7QA 1PY4A 3NBNA 3WYRA 3T4AB 5I15H 4PJDE 2VXVL 3QWRA 2R1WA 3U30B 2ERJC 2DKMA 3DVIA 4OFPA 4M5YH 1J88A 4JM4H 1FE8L 2ATKB 5AWNH 4UILL 3LSOB 1EBAA 1MPAL 5D5MF 5E5UB 5E1AA 4WFGE 1CXIA 2CUIA 3LS4L 3EO1B 5B38A 5BMFL 1EEYB 5IB1B 2ADFH 1NCWH 1MQKH 1RZKC 3D39D 1GOFA 3VXQB 2Q8BH 5DLMH 3RBGA 5I71C 1FDLH 2PW2A 3Q1SH 4UIMA 4JQXA 3OKMB 3TIDB 3PV6A 4DOHE 3MFGB 3UJTL 1OOAA 3CU1A 2V9RA 3C8KB 1NCBH 1AKJD 4XWOD 2BFVL 3GSVA 5GGRA 1BAFL 2DQGL 5BO1H 2ITDA 5L0QC 4YO0A 3PQYD 1BVZA 5A2LH 3RWDB 2R8SL 1XF4B 4HWBL 4NZRH 2EZ0C 4Y5YC 1PEWA 4DGYL 3GMRA 2E7LA 3LKOB 1OAUL 5F8RC 1LDPH 1TJGH 1IGJB 1YY8B 1WIUA 2VJXA 3MXVL 2JCCE 1M71A 2VLKD 4MAYB 2LFGA 2I24N 4PJ7E 1E4XL 4PJ9A 3VI3F 5E2UH 2I5YH 2ID5A 1WBYB 2Q76A 2CK2A 4JRXB 5CEZE 4YAQA 2DQCH 3J7HA 4HIJB 4KQ3H 1UB5A 3V4VL 1JYVA 1PQZA 3OKNA 5IT2H 5D2NB 4FFVD 5H2BA 5C0BB 4KKBC 3H7LA 4ELKA 4OBRA 5HYSG 3UBXG 3QG6B 4NO2B 3MLXH 3D0VA 4M1DL 5DJYA 2CR3A 1KIQB 4Y4KB 3QPQC 4KXZI 2VZOA 1JGDA 1D6EB 3KGRA 2ATPA 4UT7H 4X7CC 3WKML 5HDQL 3CMOH 1NGQL 2OTPA 4L3EB 1G7LA 1I3RA 5IGXH 4MLSA 1JNNL 3T2NL 5DYOA 2YUWA 5FOJA 3RUGE 1CU4L 4F80A 2NY0C 1OL0A 3HE7A 2XTJB 3QXVA 4UMGA 2F8VA 3RWCA 4PJCA 2ARJA 1I7ZB 5C08B 4P57A 2VH5L 4PJ5E 3QDGE 1PY9A 2DQFB 1G7QB 2WIIA 1PVHA 3QIBA 4LSRH 5KSBB 4X5XB 2NW3A 4G6ML 1D9KC 4U6XA 3MJGX 2HFGL 4U6TA 5IR1A 3CD4A 3LRSA 3C8HA 3VGAB 4JFYA 3S88L 2M8XA 2PYFB 3ZE2F 5GGUA 1J0YA 3G6DH 4PJIF 3WHE0 5I1EH 3NTCH 5LWYL 3WLBB 1QSFA 2AQ2A 3AREB 2AS5M 2BVOA 3ARBD 2V5RA 5IB4A 2EXWC 3RP1A 1ES0A 4GRLA 5I1JH 2VUYA 2IH1A 4I9WD 4KQ4H 4X98A 4NNPL 1JF1B 3CLEH 4X6CE 3GMQA 3GRWH 1XMWA 3NACL 3QXDA 3VFRA 3C09B 1CT8A 3LRGA 1NC4B 2GEEA 2CMRL 2GYSA 4D9LL 4HS6B 4R96A 3HUJE 2CK0H 2BP3A 3EOTH 2ZSWB 4FG6D 2WUCH 5E9DB 5HYJB 4MQTB 4N8VG 4LBEB 4LLMA 4M6NH 4D0BA 4XHJD 1YECH 4P2YA 3ZTNL 5DRZA 4YXHL 3EFFB 2C3HA 5T3ZE 3MJ9L 1JWMA 3IXTA 2RGSA 2GK0A 4P46C 4ODVH 3HZMA 4EUPA 4CRPA 2WV3A 4HT1H 5T3XH 5IMLA 2PN5A 5IVXB 3FTGB 4FQ2L 4Z7NE 12E8L 3UDWA 1JTOA 2PYEE 1CDHA 2E6QA 2W9DL 1HIMH 3CZFB 1JN6B 3DGCR 1G0YR 3KPPA 5MENE 3FT4B 4LSQH 3TBSB 1AY1H 4YK4B 3HMWL 4G9FB 3ABZA 3GSXA 4L4TA 5DJAA 1K85A 4YHKH 2IAND 2EEBA 3BWUC 4RMTA 4I3RL 3QUXC 5F9OH 2BSED 1EK3A 1KELL 5HVGB 4QY8B 3RDTB 1MJ7H 5IMMB 2KKQA 1NAKH 5C0AA 3MBEC 1Q9OB 3GNMH 1REIA 4EN3D 2F8XC 1U9KA 1DBAH 3SY0B 1ZHNA 2MTPA 5FYLL 2F54D 5E70A 5GSVB 4U1JB 4MVBC 1KGCD 1MJUL 4QF1B 1CDBA 1YC7A 2NXYC 3ARXA 1I1RA 1BD2D 4XRCB 2Y36L 2HT2C 2GHWB 2Q8AL 1OF2A 2NCMA 4K07A 4RISL 1IAMA 2BC4A 4PG2A 1MRFH 4WTWA 3QEHA 2OSLB 2NY3B 1KCLA 1T7ZA 4QXGL 4IRJB 4WUUE 1RU9H 2F5AH 5HYSB 2PR4L 3H9HA 3S5LB 3UTQB 2D7TL 2DBLL 4Y16B 1NGZA 4MDIB 2R4RL 4MDJB 4P2OC 2Q86B 2IJ0C 3DMMD 4ZMAT 2X4UA 2OJZL 3HN3A 1NJ9B 1E0OB 5D2LA 3VXSD 3P4OB 3UPCA 2P48B 3TBWB 1EPFA 3TCLB 1EEQA 4H5SA 5I8EA 1IT9H 4U1GC 2E7CA 2CRMA 1J1OH 3BJ91 3D3VB 2Q3AA 3IB4A 3LKNA 4E0RB 4OI7A 2OTUA 5L7XH 2MFNA 1TNMA 3QJFA 2V17L 3PJSA 1X4XA 4CMHB 3IDMB 4IDJL 4JHWL 3L3IB 1RVFH 3LHPL 4QXTA 3NABL 4U0RC 4LLYB 3ZDZF 3QO0B 1IEBB 1HWHB 1FBIL 4R4FL 1KULA 2R0KH 4Y4FC 1AR2A 2E6PA 5J12B 2FD6H 3VWKC 4RA3A 1FVCB 1RIVH 3O8XD 4YGVA 3TFKD 3WV0A 1UYWH 2C5DC 3RI5K 4YE4H 2VDKL 5DTFA 1BECA 4FN0A 3SGKA 5HGDB 3UTOA 4UV7H 1UVQB 3O11A 5D1ZC 5AEAA 4XNUH 1BQUA 3I3DA 4E42A 5EUOE 1QNZH 1JRHI 3DXAA 3TPUA 2UZIH 5GRJL 1B2WL 4ORZC 4OZHF 4WHYH 5FF6B 1OM3L 1PYWA 1W2KT 4X5LA 4HZLA 1K4CA 1A6AA 3ZSTA 2I07A 1HHKA 4KJWD 3UTPD 4ONFL 1MVUA 3WXVL 2IPTH 1IM9D 2FJGA 4UUJB 1NDMB 3SE9L 3EYFB 3TEUA 1J05A 1FFQA 3BIKB 4TUJA 3X17A 5IESL 3HFMH 1EHLL 5GRZA 1JNHA 2QJDA 1CICB 4TTDC 5E2TH 4BUHA 1MI5E 4Y5YA 4ONHA 4FTVA 5GRXG 5MI0C 3PHOB 4FXGA 4C56A 4LKXA 4MNHA 1CD1B 3P11L 1H3TA 2MCG1 4W4OA 3ECBA 1MCNA 2YPLB 3P0GB 2Y9RT 1DDHB 5ENWB 5E94B 4X8JA 5CKGA 1FZKA 4UU9B 3R1GL 1KEGL 5T33H 1GGUA 4IOFC 5B3NA 3O9WD 4XNMA 3L7EA 4DGIL 4P5MA 3QDJA 4JN1H 1LD9B 4NWUH 1BFTA 4XT1C 4MYWB 2HLFC 1AGDA 4KI5C 1FFPA 1KC5L 3KJ4B 1K6QL 4LAJH 5A3ID 5D4QA 4ZTPL 2OXGA 3TO2A 1XZ0A 3MLPA 3ETBF 1FNAA 2AJUH 3G5XB 1SJVA 1Z0NA 4XBPB 2DKSA 4C59B 3I6LD 3CFJB 5I1IH 3OBAA 1HCFX 5A2JH 1U6AL 2N7AA 2YA1A 1QQDA 3MV7B 3SDXF 4DN3H 1D5ZA 1K4DB 4G8EB 3V4UL 2EH7L 4A6YH 4PP2A 4D0CA 1LMKA 1T2JA 1A6TB 4KHTL 4KUCD 3BKJL 2K7QA 3BWAA 1PKQA 2DD8H 3OAYK 3K1KC 3IDUA 1DBML 4X6DE 1XGTB 2D03L 1UM6L 4G42B 1Q0YL 3G6JA 5DFVD 3RZCC 2FGWL 1WCQA 1KXVC 4MA1C 4E41A 2NTFA 1T5WA 5GGSB 3GBML 3BZFA 1NBQA 4WU7B 1I7TA 3MNZA 1KJVA 5F21B 1YEJL 4LCWB 4DKFL 1NL0H 3SCMD 3L3KB 3K74B 4HBQA 1AGBA 5IKCB 1RZKL 4WHDA 5HI3C 4EDXA 1TCMA 4G9DA 5DJXA 1I9IL 3BPCB 3BP4A 4R7DB 3IDXH 3R06B 2AEIT 4X0KB 3PNWB 4NZTL 1RJCA 5KS9B 3P3YA 3DYOA 4DZ8B 2GJ6A 5LJYH 3RVUD 1HEZB 3OR7A 4JGMA 1S7XB 4G6JH 3FZUC 5C6TL 1P7QA 2VLRE 1OWWA 4IHOB 1DE4B 3FQNA 1QFWH 5C0JA 2IANA 3BSZH 1RZ8B 3FRUA 4OF5A 3D18B 5DRNB 5EZJA 4K3HA 5I15L 4ZSOB 5IIEA 2EE2A 5SWSB 3KHOA 5L6YH 4NC1E 4P46A 4XB7A 3M45A 1HYRC 3KYKH 2HTKD 4JM4L 5HDBE 5HY9A 4M93C 3QIWB 3WHXA 5IBUB 2JIXB 4EN3A 3KXFB 1UH3A 2AKRA 2CRZA 4PS4H 4XXDB 1QA9A 2ADJA 2JK5B 1JPGA 1J0KA 1TZHA 3M8OH 4HWUA 1NDGA 2GY7B 4N0UE 2H26B 1NCWL 4V1DA 3T77B 3A6OA 4NQED 4WO4B 3F12B 4KK5C 4HG4K 2FEEL 4N8CH 5DLML 2R39A 2YD8A 2X70A 4BH8A 3QUXA 3SQOH 2V6HA 3FO9A 3Q1SL 3NCBB 3ME0A 2BNRB 2EICA 2A74A 3OHXB 3D1MC 4RAUA 1XCQA 3QUZC 1NCBL 4OGAC 4JFOB 3MBEA 5BS0D 4PY8I 3SGEI 3FB7B 3FRPA 3IYLW 4JFFD 1TCRA 1MAKA 2FYYB 3WN5A 5FKAA 4WJ5B 3O3DB 4Z95L 4EI6B 5HHXH 4OLXH 3ZO0A 3B5GA 4NZRL 4OV5A 1OVZA 1UADC 2WBWB 3D2UD 4OZGB 2VLJE 3VXSA 1OAQL 4QYOA 4UTAH 2H32A 1KN4L 4R4NC 1LDPL 1TJGL 1I85C 5DEFA 4HKJB 3REWA 1AHWC 2W60A 5BRZD 3SGDI 3EZ8A 4GKZA 4WU5A 2KZWA 1BZ7B 1BBJA 1ZK9A 3V6OE 3A6CL 2XYCA 3MCLH 4R26H 3DOSA 4WDIB 5INCB 2GUOB 1WEJH 3QUYA 1LEKB 4P2OA 1RK0B 1X5ZA 5E8DL 1ZXQA 4JKMA 1AP2A 4ZS7H 5C9JB 3ZT7A 1FGNH 4NFDA 2XPGB 4HH8A 3EYQC 3VXPB 1BOGB 5E8PB 2WP3T 3AUVA 3V5KB 4LFHD 5JLZA 3VMOA 3MLXL 5I1AB 3IDIB 1NANI 4RGOL 1VFBA 4UDTA 4F7CA 2MQ0A 2KZ1B 5HHOE 1OAYH 3TBYA 4LKCA 5D1QD 2BOBA 2Z92B 4QRPB 4U7KA 3L3OB 1IBGH 1A0QH 3CSYA 3BKYH 5IGXL 2CUHA 3L3HA 5F8QC 4MMXC 5I1CH 5K9JL 1NFIB 1KLGB 2VABB 5LBSH 4XNQA 2QADB 5I73B 3QULA 4NQDD 4LCIL 1TVDA 1WF5A 4I0CC 1W0WB 2R2EA 1IGIL 2DQEH 3BN9C 3UPRA 4F9LA 4R6UA 2JJWA 3SJVD 3SKJH 4H1LH 5D1ZA 4YR6A 1AIFA 3TO4C 3G6DL 4G5ZL 5I1EL 4Y1AB 2DLHA 5GS0C 2WP3O 1N7MH 3EYSH 2EDKA 4X4ZA 2XQBH 5DI8A 4K55A 3PWPE 4R97C 1WWAX 1NC2A 5I1JL 3VRLF 3JTTA 4JDVA 1TFHA 3QAZB 4P23A 5DC4B 3LN5A 4YHPB 5B22A 1T89C 1RMFH 2CK0L 4N9GB 1RHFA 3ULSB 4HIHA 2CH8A 1B90A 4PRNA 3JV5A 2WUCL 4WGVB 1EERB 4JFQB 3RL1B 1JWSB 2FGZA 1LP9F 1QRNE 8CGTA 1DTUA 3ARFD 1GHFH 5HYIA 4LSTL 1GOGA 2ESVD 5LQBH 4TUOA 1ZGLM 3ZDXF 3IKKA 2PXYC 1I9EA 3T0EE 2NY4C 4RRPA 3VXUD 5J13C 1NAMB 2JJTC 1RSFA 5I1DB 1PDKA 5A2IH 1XF3A 3W0WE 3BH8B 5F6IC 3QUMH 3S37X 3QXWA 3MLTA 4PYGA 4QRTA 5T5FH 4HT1L 4OD3L 5T3XL 3SDAC 4C58B 5JORB 2XT1B 3IU3A 4K3GA 3V0WH 1E4WH 2Q20A 4JG0L 3QNZB 4X6FB 4S1SH 5ANMA 4B7IA 4PV8B 1FC2D 2DMKA 5AD0B 4XP1L 1FG2A 1TZIA 3G08A 2DLIA 1F11B 4LSQL 3QNYA 2ZKHH 4RSVA 1V7ML 2O5YH 1OSZB 2OZ4A 5CZVH 3BN3B 2XKUA 3ARDD 4PRIA 4LLUB 5FO9A 3DUUA 5CAYB 2EDWA 4Z5RA 1II4E 2JB5H 2W65B 4OF8A 1YNLL 1MCOH 2FH6A 4NT6B 3TBTB 1BJ1H 2PTTB 3VA2C 1N2RA 3GNML 1SYVB 5HI4D 3K4DA 4Z7OF 5E56A 4NBZB 3FQWA 3MPCA 4JRYD 4BYHA 2MOVA 4PREA 5A16B 2B5IB 3C08H 2CJUH 3RWJA 4PJGB 1HXYB 2Q1EA 1F4WH 1V5JA 3FT2A 4NN5B 3KPSE 1NGYB 3MRCB 3BPLB 4XP5H 1LEGA 3T3ME 4J3OC 1JMZA 1YEFH 4FFWD 3U4EB 3ZKXC 2YD6A 3UEZA 5I1KH 3GMMB 4H20H 3MREB 1NGPH 3RZCA 5DURB 2F5AL 5M95B 5JXAH 1KB5B 2Q6WB 3U36A 5DMIL 1LP9B 1HKLH 3DV6B 2YUVA 4FXLA 1OGTB 4JVUA 4YQXH 4HGKC 4YHNA 2AVGA 4MS8C 2NXZB 3FONA 3IAQA 43C9B 2HVKB 4U6VH 2BK8A 3PIQA 3RTQB 1HH6B 3MRRA 1IT9L 5CD5D 1KG0B 3G5YB 1DQJB 1J1OL 1VENA 4PLJC 1EXUA 4ZPTA 4Y4HD 3RWIB 2Z31D 4EDWL 3B2UD 4MD4B 4FMFA 4D9QD 4FZEH 1WGOA 1Q9KB 3QEUA 2FO1A 3NZ8B 1AH1A 3WNLA 1JF6A 2HMIC 3QQ9C 2J8UE 5SWQB 4OCXH 5D71H 1YUHA 4JREB 3QHTC 4F57H 5IEHA 3TN0D 5JMRA 3MACH 1A1NA 4L1DA 4UIKL 1S7VB 1UYWL 2DI8A 3EDDA 1NGWA 4NRXB 4UV7L 2QSCL 2BY0A 2IH3A 3ZYZA 3EIFA 1OCWH 4OB5H 3SDCB 2A9NH 1QNZL 2EYRB 3V5HB 5C7XH 2OTWB 2UZIL 2PO6B 4ELMA 3SDDD 5DUPH 4ZXBB 3MRBA 5EIQA 4JY6A 2Y25A 3RA7H 4OM0L 4X7TA 3V6BR 3UC0H 2IPTL 3BXNA 2J7LA 3OF6D 3QUZA 3W9DB 2DQIH 1U58A 4YUEH 4XPAH 4LPTA 3L1OL 1V3JA 1A7RL 4Y19E 2GT9B 3RHWK 3HFML 2FIRT 1CDYA 4YHZH 1L0QA 4WI9A 3MCG1 5EOQL 1SHMA 3P4MA 1MHCB 3FFCA 3KPMA 5F1NB 1S9XB 1WTGT 1I85A 4JAMA 4LRIA 5ACMA 1AHWA 3IGAA 3DRQA 5EWIL 5ICZA 1NCDL 2OM5A 5IFJA 1B4RA 4M3KB 3NOIA 3H9YA 3ES6B 1BEYH 2R1YA 1AI1H 4J3TA 1FG9C 5T33L 5J9PA 4Z9KB 1N26A 5AYUL 3O2WH 4Z7VB 4PP1C 4BFBD 2DWEA 1CR9H 5MHSD 3CK0H 4KJQC 4NDMB 5DDHB 1FLTX 4N0RA 4EBQH 4RIRB 2UY7A 4QOKA 3BQUA 3JWNC 4HLZG 1MRDH 2AJUL 4CMMB 3L5HA 1F6AA 2G5BA 2P5ED 2BXZA 3QB7C 4M6AA 4PJFE 2R0WH 5C0CE 1SJEB 1QLRB 4KPHL 3OAZK 4Q6YA 1U41A 2HFEB 1TETL 4NRZB 4PJDF 4DN3L 1I9JL 1DUYA 3B9DA 5DRXB 3N9GL 4ZUTA 5FUOH 2W0KA 3BHBB 3HNTL 1A4KA 4P9HH 4PYHA 3E6FB 1I1YA 3CXHK 4CN1A 4JQVA 2ZWLT 5HYQB 3HG1A 3WNMA 3SOBH 5DFWH 1A7QH 4NO0D 3PWNA 3REVB 5IBLC 1IEAB 1IKFL 4KKLC 1AGEA 1JGUH 3W5MA 3HS0B 4N1HB 4U1SA 3TA3B 1EHAA 3U1SH 3GBLA 4ZS6C 3IFLL 4JFZH 4RGMC 1M05B 2A6IB 2BNQA 1OP5H 2W9LA 5F1OB 1VHPA 5CHNB 3RKDD 3U4BH 5BOPA 2D7QA 2HTLC 3P4NA 1DBJL 4FS0A 1NL0L 3KNBA 1FAIH 2ED9A 5H94B 2BDNL 5EU5B 5I8CA 3MUGB 1FFNB 2DL2A 5SWZA 1JTPA 1T89A 2FATH 5FYJE 4JHBA 4DVRH 1YEGL 2NY2D 5DJZB 4YPGA 1CGYA 3GHBH 3IAPA 1HHGB 2XNAA 1D5XA 4LNVA 1MAMH 4GH7B 2F58L 2WBJD 4NC0B 1OLLA 2EYTB 5F6HI 5TJWK 3T8XB 1U8NA 3B9KD 5HPMB 2HJFA 3WJLC 4G6JL 3PGDA 5BOZG 4P9HC 1KB9K 1T1YB 2UVEA 5GGTA 4YH6A 1LEIA 1QFWL 3BSZL 5ILTH 2JCCF 1JJUA 2FECL 2CLRA 3B9AA 5L6YL 3MRLB 4PJ7F 1XR8A 2QR0A 5E0QA 2FJHB 4ZOEA 2VAJA 3SQBA 5F7DA 2A1WL 3KYKL 4D2NA 1OLZA 4WW2F 3V5DB 4IIQB 3ILPB 1SEBA 1EGJA 1R3LA 1NFDE 1NGXB 4BFIB 4OD1H 2DQUH 1A4JA 4ZUVA 2EXYC 3K8KA 1WAAA 4KVCH 5ISZA 3OJDA 4APQC 1I1AD 2XZCH 3FHAA 1P4LB 1NMAL 4O2CB 3M8OL 3E6HA 5TDOA 3DTXA 2OK0H 4G7YH 4KROD 3CH1A 3EYVA 1U8IB 2WNGA 2JJSC 2V2XB 3F5WA 3MX0A 3O45B 3UTTB 4PGCB 1I8KB 2IFFL 4WI4A 3DNKA 4LARH 3RUGF 1XF5A 3OR6B 3NFPB 4ETQB 3PL6D 3HE6B 3ARVA 5FUZH 4WWID 4HH9B 4OLXL 3TWCH 3W81A 3DO7A 4UTAL 1P9MA 4P49A 3GUTA 2I9TB 3C5SA 4YNYA 1PG7H 4PJHF 3HLAA 2DF3A 3OKLB 4QRRE 5CZKA 4PRDA 4QXUL 1PD6A 4YFLF 1AGFA 3ZT6A 2H41A 4XPTL 4KKAC 3VXOB 2HN7B 4AEEA 32C2A 5JW4R 1OGAD 1RUPH 4M7LL 1CFVH 3JV6A 4R26L 3MCLL 3QXUA 2VZSA 1PZUB 4PGEA 3T08A 3H9SA 3AS0A 4LPCA 4X6CF 5D1XB 1UKTA 3VFGL 3UJIL 4GUPA 3I6KA 5GS0L 2L4OA 1FORH 1HH9A 4U6HB 3TZVB 1YNTB 4D0DB 2FLBT 1BFSA 5B3JE 1EO8L 1QPPA 4GKOA 2AV1A 1YZZA 4CNIB 1CCZA 5HVHB 3WSQL 1T1ZA 3C5JB 5FOBA 5JIKA 2FBJL 3MLSL 2YOCA 1ZLSH 3P9LA 1KTKE 4J3SA 3MRPA 5HGBA 3ULUD 3O6FB 4ZO8A 3EFDH 4KC3B 1G9NH 4JDZB 2VR9A 1A0QL 1RIHL 4WFFD 6CGTA 3U4AA 1LO5A 3LKSA 5I1CL 5FECB 2QHRH 3O41B 4KWUA 3GJFB 3TIEB 5EU6E 2X40A 3DARA 5E6ZA 1UG9A 4LGPB 4LSVH 1U3YA 2X9WA 4L9LC 3HC3L 1RJLB 1TTGA 1NBYA 4Z7NF 1FH5L 4KK9D 3X13B 2Y1VA 4EIZC 3NGBB 4AENA 1RZJH 1T0NA 4IMLB 4WFEE 4JFEB 4YHMH 3FB8B 3MA9H 5F7WC 3RRQA 4S1DD 3IKCA 4Y2DB 4YIQA 4KVNL 3NN8B 1JHKH 4JY5L 3EYSL 3F7YB 3OTTA 5EOTA 1EGJL 1BF8A 4R0LC 4CW1B 3QCTH 4N1EA 5TE4H 1RK1B 3O3BB 4M3JA 2ADGB 2C7UA 3BD3A 5AUMB 4PJHB 3VFTA 5EFIB 4ZG1A 4MAYD 4JM2A 2O61B 2V9QA 5KVEL 2W0FB 4LHUD 3B3IA 5I66A 2H9GB 4JFDA 3MRMA 5FGRA 3RPKA 5K9OA 1KYOJ 2ILLA 4PJXA 1N6VA 4LEOB 4JRXD 1FVDB 3QDMA 4M1GL 3AFLA 1P4IH 2H6PB 2QEJA 1E28B 5IW1B 4Q9RH 5C0BD 5J3HD 1YMMB 2VZVA 5CBAA 3I85A 1IL1A 4GAGH 1MEXL 1JI1A 2ZUUA 4GG6E 3ARBC 3MV9B 2AJVH 5J6GB 4OJFH 3MTRA 2BVPA 2DTMH 4L3ED 3CPLB 2IGFH 1E4WL 4Q9CA 5L2KA 4S1SL 2X44D 2VXUL 4Z0XA 3FAWA 3UPAA 5EO1B 1VKXB 5KSAD 3EGSA 2ZKHL 1MFDL 5T3ZD 3VJ6A 3BYYA 5BV7C 4CDGC 1S7WB 1MUJB 4PGZA 4HCRA 1I9RL 4QO1A 4WUKH 4XHJC 5E2WH 1JVKA 2HFTA 5B38G 1QLFB 4NN6B 5IMKB 5DJDA 4QLRA 1OW0C 1L9MA 4FQJH 4Q74A 2NQCA 4PRBB 1G7HA 1JV5B 1ZEAH 2X4TA 3ARGA 5EH1A 1GIGL 4WWKD 3C2SA 1ED3A 1FL5A 4OFYD 1VADB 1F4WL 4HFWA 2ADIB 3OKEB 1WFTA 4JPVL 4LF3B 3OKKB 4EJ1C 4XP5L 4EI5A 4U1LB 3C6LC 1QFUL 2FIKB 1XF2B 5AZ2H 1IGFH 1UXWA 5E9DD 2QQLH 3MLYH 5EUOF 1IGTA 3RKPA 5HYJD 5I1KL 5F9JB 4OCYH 3DECA 2LTQB 3SO5A 3VE0B 3NVQA 1KIPA 1RZGB 3U9UB 1IVLA 5JOFA 1H3VA 2X4NB 5DVMA 5JXAL 4PFEA 2BHZA 4NKDA 1IAKB 1HKLL 3MRFB 4RQQA 1TQCC 5EO0A 4YQXL 1DVFB 1X5IA 1QFHA 4PRAB 3ZYIA 3SHSA 3RDTC 1XGRA 4RZCA 3DV4B 2V2WA 1JRHH 1N6UA 1NMCC 5ETUA 5MEQA 1J8KA 5F88A 4D9RE 3S96A 3Q6GL 1IGCH 4D8PA 1G9MC 2I25N 5C2BH 3KLHD 3GSOA 4LGRB 1LO0H 3BGMB 3FHQA 4G9FD 5TDPA 4FZEL 3U0PB 3EO9L 1NBVH 4U05A 3T4YA 3ZZ1A 1GGTA 3T0AA 4O9HL 3QEGH 2J1KA 3DHJA 1A9BA 3B6SA 3CFEA 4LNRA 1AO7A 4XC3H 4P2QB 4IRJC 4MJ5A 4ENEC 4L4VE 3ZTJG 5M94B 1AFVL 4IOSD 4XPFH 3MACL 4HXBH 1S7QA 5HDLA 1T21A 4JB9H 4U2ZA 3EYUH 3GSNA 4X4YB 1JYXA 1J18A 5I2IB 1QEWA 2A6KA 4APQA 3LQAH 4F3FB 4JCLA 1A9EB 1JPSL 4FQLH 1A5FH 3VGBA 1ZANL 5C7XL 5TH2B 1ZLUH 5LAXA 2JJSA 3L9RA 1UB6A 1WV7T 3FFDA 2VWEC 3DURA 4GBXB 1FNSH 2IG2H 3DVNB 4NWTH 4S10A 3RU8H 4RFEA 3R0MA 4O2EB 2NY3D 5L2JB 2APFA 2MNUA 1NFKA 5DVKA 3UC0L 1KJ3H 4PLKD 1QFPA 2JLLA 3VWJC 1VESA 2QSQA 3KLSA 4NQVA 2UWEE 4XPAL 4Y16D 4YGAB 1BWWA 2BX5A 2R69L 1QBAA 3QIUC 2W91A 4DFIA 3CJJA 1J8HE 3T4AA 4PRPB 3KJ6L 3OXSA 4Y8DC 1LO3L 3D87B 4WV1B 3TFKC 1PX3A 2DQTL 1ADQH 2P7TA 2A73B 4X6DF 2ATKA 3PE9A 3LSOA 2APVA 4K71B 1BVKB 4CN6A 1Q72L 1CI5A 2FEDD 1EEYA 5GGVH 2APWA 3T1WA 3MUJA 4XMLL 2PETA 3O2WL 2VXQH 3LQAC 1X3DA 5DD1H 4L4JA 1MI5D 2B4CC 1W0YT 3CK0L 5E1AB 5GS1C 3RJQB 2CRYA 5FA3B 3OKMA 5B38B 2N56A 1FSKB 1BP3B 4NBXB 3C8KA 4EUPG 3QFJB 5ICYA 1MRDL 2CIIB 3HKFA 1G0XA 1MH5A 4QHKI 2PW2B 3ZE0E 4UIMB 4L8SC 3PV6B 1X5KA 3P77A 2EKSB 1XF4A 3L7FB 2R0WL 2ZOLB 3NCFB 5KG9A 3LKOA 5ALBH 5JQHC 1ITBB 5JUEH 5GGRB 3MRNB 3SKNA 4U3XA 2VDMH 1IGJA 1H3GA 4HQQL 1YY8A 4YO0B 2AJSH 3O6MH 3QDAA 3VD4A 5F7EH 5HDBF 4L9LA 3GMRB 4P9HL 5FUCC 3O9WC 1JNLL 2HKHH 3BRFA 3DETD 3RGVC 4OQTA 4DUXA 5CGYC 4GRMB 4KZEH 1A7QL 3DHMA 3MLZH 1CD0A 1C5DB 2MQ3A 3FB6B 4G8GB 3NPSB 1CICD 4DUVA 5TQ2H 2W9EL 1I3VA 4Z6AT 1INQB 4HIJA 1L0YA 2VDNH 4PJ9B 3U1SL 1M7IB 3U7WH 3V6FA 3R4DA 1G84A 3G5VB 3GSNL 3MXWL 3QG6A 4NO2A 4Z7WF 5HBBA 3ESUF 4WEUD 5DD3H 1FAIL 1RZIB 1KIQA 4Y4KA 1UB5B 3JZ7A 4MD5B 3RVXD 1D6EA 1PQZB 5F9AC 1QLEH 4U7SA 1U3ZA 2FATL 2X4SA 4F58H 3HCVB 5I8KH 1PSKL 2NX5B 3BMVA 2FDBP 2A6DB 5HHVH 4X9FA 3D0VB 5IUSA 1A1OB 1TIUA 3BW9B 4HMCA 3EJZD 1JGDB 2LQRA 2ATPB 1I7ZA 3ZKND 5C08A 2DQFA 1G7QA 4IRSB 5KSBA 1KIRB 4Y5XC 4X5XA 1SMOA 1UH2A 3RAJH 1QSVA 5DYOB 3VXME 1NH6A 2XWTB 5K33A 5DFVC 3L95B 5I74B 4M62L 3RWCB 5K9QI 2PYFA 1FL3B 4ZQKB 2WIIB 5DXWA 5C9KA 3WLBA 3AREA 1EVTC 2ICWB 4IMKA 1GCFA 1RAMA 3SCMC 2P49B 5IR1B 1CXEA 2DQUL 4M7KL 1JF1A 1IAII 5KAQF 4WTXA 3O4LB 1QSFB 3BT2L 3LN9A 2BVOB 3VA6A 1NC4A 1G1YA 4G7YL 4HS6A 1ES0B 1KCSH 2Z4QB 3BOVA 4HUUA 1JHLL 4WI6A 3RVUC 1G6RA 2ZSWA 3RJDA 5GGVY 1HSAB 1MHHB 1GPOL 3VFRB 5ESQA 1SMAA 3PGCA 4HAGA 5IVZA 1FFOA 1OQOA 1P6FA 3D69B 4HKZA 4KDTA 2OL3H 5J7CC 4LCWD 2O93L 4LLMB 3S98A 5ABDE 3WD5H 3TWCL 4Z7WB 2BCKB 4PJCE 2HKFH 4FFYH 2VZUA 3QEQE 2E9WA 4KZDH 5DRZB 1CTNA 1PG7L 1MOEA 3RWGB 5CMAA 3C6LA 1KTDA 3U6RA 1N64H 5ID1B 2BSTA 4YJZL 4XXCC 2QV2A 3CZFA 1JN6A 4DN4H 3HZMB 4DQOL 1FVEA 1C5BL 3H2WA 1RUPL 5IMLB 1GGBH 3WUWA 4FQQA 4OCSH 5JQ6H 1EJOH 3L5WB 5F7MC 3FQXB 3W11D 5A1AA 4TNWF 2NW2B 2VLJD 1MLCA 1D6VL 1L7TH 4OZ4B 3MFFB 2XOTA 1G7IB 5I17B 2VIRA 2FR4B 1E6OH 5LGKA 4QY8A 3RDTA 1LE5B 1UCBH 5IMMA 4Z18A 2D7PA 1YJDH 3AVEA 5DJAB 3IRZA 5CILH 3QIWD 2H8PA 4J7RA 4H25B 3AS3A 1XR9B 3MCKA 2JIXD 4PJIA 2A77H 2HG5B 3KXFD 5ALCH 3SY0A 5DT1L 1DQDL 5IP4A 4M8QA 5I75C 5GSVA 1XIWC 4U1JA 3EFDL 3BPNB 4WGWB 4QF1A 5C0AB 4XRCA 4WO4D 1OTSC 5ESVB 3UXFA 5E5RB 2YKLH 4TULL 3VH8B 1ZHNB 5C07B 4XHQA 5JHLH 4RGNB 2OSLA 2BNRD 4NUGH 1MLBB 2OI9B 4IRJA 2YR3A 4JFPB 2DOCA 3S5LA 4MDIA 4YHML 4MDJA 5HHOD 3IDNA 2Q86A 3QEHB 1EH9A 1Z3GH 5IB3A 1JHKL 1Z0MA 3P4OA 3H9HB 1YYLL 2EDFA 1YJDC 3B9EA 4LK4A 4L4TE 3KLDA 2X4UB 4WFHE 5IROC 1NSNL 5TE4L 3MLRH 2D2OA 2YHGA 4B5EA 3D3VA 5CS7A 4E0RA 5KJRH 2EDOA 3VWJA 4PRHD 1DBBH 5I8EB 5BV7L 4FQHB 1G6RL 3HAEH 3QIUA 5JO5B 1RURL 3IDMA 4UQ3B 1HOCA 3SE4A 2EDQA 3QO0A 1IEBA 4HC1H 3LKNB 2M26A 4YXLL 2VN7A 3S6CA 5TF0A 3I9GL 3PWPD 2KQMA 3QJFB 1R5IB 3MV8A 5GGQH 1FVCA 3T3MF 4MNGE 1ZT7A 5JOPE 1ROWA 1Q0XH 1M7DB 1MREH 2ERJB 1RIUL 2KQNA 2XN9B 4CKVX 5ADOH 3H3PH 3U7YH 4ZOBA 4OJFL 3AS2A 5B4MD 4U7MA 3TYGH 3JSSA 5FF6A 2H2PC 4A2LA 1OAZH 5DTFB 1KJ2H 4GW1A 3UYPA 4JN2A 1IFHH 2IMNA 3V7AG 1ZHLB 4IOIB 4P3WA 3DXAB 5FM5O 3TPUB 3BIBX 5EUKB 5D2LE 4UUJA 1NDMA 4ODSL 3EYFA 1EHNA 5I71B 2ZPKL 3BIKA 4HZLB 4NOBA 3W0WD 1C7SA 3G9VA 3MUZ1 5EBLA 1CICA 4LSDA 1MVUB 1A21A 5C0ND 1ZT4B 1GGYA 3QYCA 4K7FB 4S1QH 1OB1B 5E2WL 3H42H 3PHOA 1TZGL 4Y1AD 4ZFFA 3W5NA 2AABH 2D31A 5E95B 4TUJB 5L0QB 4FFZH 2J8UF 2YPLA 5E94A 1HZHH 4Y5YB 4ONHB 4UU9A 1ZEAL 5EZOL 3TP4A 4C56B 1G9ML 1QSEB 5E08H 1CIDA 3RGVA 2AK4B 3QHFH 4WNQB 3ECBB 3LB6C 4QTHB 4BZ1H 4XAWL 3FRPG 1LD9A 2V7NB 3BISA 3OAUH 3MOAH 2QQLL 2FL5B 3PQYE 4U1HB 2NY6D 1EAPA 4GMTH 4PJEE 2A0LD 4M4PA 4P5MB 2XKNB 2YK1H 1MWAH 3CAFA 4NCC2 4XBPA 3V95A 3FO0H 1FZOB 1FFPB 1DQLL 4AYFA 4NJ9L 1HKFA 5EOCH 2GK2A 4GRWH 5ACZB 3KPSD 4TRPL 4GMSH 4M43L 5HI4C 3MV7A 1RJZA 1CLOH 2BSRB 3ZSSA 2V7HB 1T7XA 4HHAB 5D93B 3SEPA 1A6TA 5JW3H 4FTVE 2HT3C 5EBWA 5C2BL 1QP1A 1D5ZB 2OR9H 3MYJA 4AT6B 4FFWC 1V7NH 2NY0B 1NBVL 2FSEB 4PP2B 1XGTA 3WJJC 1J12A 2X4RB 1KTLB 2NZIA 3MV01 4AIXA 4XC3L 1PKQB 1D9KB 5GGSA 3B5HA 2UUDK 4XPFL 2WK2A 4HXBL 3VGGA 4JB9L 5DVNA 4WU7A 4MXQD 2DI9A 8FABB 3QDJE 5T5NF 3L3KA 3MJ8A 5IKCA 3LQAL 1FQ9C 4E41B 4FQLL 1A5FL 2ZCLH 1A14H 3BPCA 4R7DA 5CD5C 3R06A 4N1CA 2B4CL 4X0KA 3BZFB 4PJFF 2IG2L 3RTQC 3PNWA 1I7TB 3MNZB 1HINH 5KS9A 4NWTL 3DVFA 4Y4HC 3RU8L 4DZ8A 4ZD3H 1HEZA 4UINH 3B2UC 2C26A 4X7EC 4EDXB 4N5UA 3QNXB 1B9ZA 2NY7L 3BP4B 1FGVH 2I26N 5J11C 2DQHL 2IADB 1RULH 4IHOA 4DKAA 1DE4A 3QWQB 3G5ZB 4G7VL 5JIHA 1WVZA 2BHUA 1RZ8A 4OM1H 3D18A 5DRNA 5SWSA 2J2ZA 4OUOA 1MCPH 1INDL 4I9WE 3TN0C 1DFBH 4OZIB 3UO1L 3LH2H 2NXZD 3GM8A 2IC2A 2Y7QB 1TJIH 3FQNB 3L5JA 2XRAL 5JW4N 3HI1B 4GG8A 1XGPB 1T2QH 2JIXA 5IIEB 1CXHA 4LVHC 4XXCA 4P46B 3SDXA 4XXDA 3QHZL 5GGVL 2JK5A 5ICXB 3GHEH 3SDDC 1SY6H 5HY9B 4Y19D 2H26A 3G6JE 2VXQL 3O2DA 3SN6N 3T77A 5JXEA 1EHXA 2FB4H 5EC2B 3L3GB 3RFZC 4HJ0C 1YQ2A 4RRPG 1FCCA 1QA9B 2BNRA 4V1DB 5D96C 2NNAB 5J0BA 1P69B 3FT3B 4TSAL 3TCXA 2AGJL 3FB7A 3U46B 2X70B 1CGWA 2FYYA 3AMKA 4XVUD 3BKCH 2QQKH 3QUXB 4WVRA 4NNXA 2GCYA 4WJ5A 4EI6A 1MY7A 2A74B 3MBXL 3TVMB 1XIWA 4ODTL 2GJ6E 4Z77B 1XCQB 2IEPA 1G7JB 5BVPH 3MBEB 1R3KB 5JUEL 1T3FB 4O51B 1TCRB 2PO6D 4HKJA 4ZXBD 1DZBA 2H2SD 2IANE 1BZ7A 5I1LB 4WRLA 4ETYA 2NXYB 2H32B 3RX5A 4E5XB 4AM0A 1Z5LB 1NFDF 4G8IA 3BE1H 4WDIA 1B0RB 5INCA 5DEFB 3K80A 3REWB 1LEKA 1RK0A 2W60B 2X4QA 1BMGA 5C0CD 1YA5A 4GKZB 5C9JA 1Y6NR 3SBWC 1IAIM 5FYKU 1P4BL 5TQ2L 3VXPA 2VDNL 3I75B 2F54E 5DMJB 4OCRH 1BOGA 1KGCE 1R5WB 4OIIH 3U7WL 4P2OB 1YY9D 4HS3B 3V5KA 1T6VN 4NKIH 3U2SA 3IDIA 4XCCL 2YUZA 4R9HA 3LCYA 4JJ5B 1VCAA 5I1HH 4QRPA 4QHNA 4TVPL 1DCLA 4F58L 4P99A 2VQTA 2P8LA 5FK9A 1HYSD 5DQDH 5EU7E 2LU4A 4U1GB 1NFIA 4K23H 4FQXC 2VABA 1VFBB 3MLWH 4UDTB 5E1HB 2OMBA 1TVHB 4LKCB 1WBZB 2V5YA 3S35H 3CSYB 3VXSE 3LS5H 4U0RB 5D7KD 2ZCKL 4XNQB 4N0YL 4AEHL 3MROB 5FYJD 4Y4FB 3QULB 5F7HA 1MJJB 4D3CL 3VWKB 2R2EB 4X7SH 2HLAB 4GO6B 1T1WA 3QDHA 2CKNA 4TPRL 5JDSA 1T04B 3K2UL 5B3JF 5D1ZB 5I1GL 1AIFB 1F3RB 2E27H 5JW5B 4YHOL 3JUZA 3O2DL 4NGHH 4YHPA 3VFWB 5FKPA 2WBJC 4P2RB 2MKWA 4N9GA 3JTTB 4JDVB 2YPVH 1YEIL 1JPTH 3B2VL 3ULVD 4R3SB 4QHUB 3TA3D 5LVEA 1JWSA 2X4OA 4S0SD 4GKNA 1T03H 1P5UA 3D25B 2BRQA 4P2CG 2HJLB 1MHEA 4RNRB 4AEFA 3UYRL 1MCJA 2EIZB 2XI9A 4PRNB 1BBDH 2OL3L 1EA9C 5MI0B 4XNZC 1UJ3C 2P5WB 2UZYB 1JK8B 1JMXA 3O6LL 3S37H 2OR7A 2JELL 2AK1H 5SX4I 3WD5L 3OSKA 3UTPE 5TFSH 4GQ9L 1LQSR 1RZ7L 1I1AC 4X6FA 4G3YH 4I8DA 4KK8C 3ZHDA 5JMOC 5ADPH 1A7OL 4J3VA 4KROC 1ORQB 1N8ZB 3MLTB 5ITBL 1K5NA 4OF7A 5CIPA 1LK2A 3FJTA 4HIIB 4U1IA 1GGBL 4Z78B 5JQ6L 5JOEA 4LQ1A 5DMYA 1LHZA 5TQ0L 1KNOB 4LLUA 1L7TL 4XPBL 1F4XL 1FG2B 1J1XL 1TZIB 1IC5L 5DMGD 3TNNB 2GI7A 1E6OL 4PBVC 2W65A 4NT6A 3MR9A 5C8JB 3PL6C 4QRRD 3WDHA 4KMQA 5HVWA 1YJDL 1JTTA 5CJ8A 4XCNA 1F58L 5ALCL 1U8MB 2DM3A 1DLFL 1X5LA 1ACYH 4RDQF 1BM3H 1JFQH 4PJGA 2MCPL 2DB8A 3CX5J 2MPAL 1MELA 3WXWL 4R4BA 4GG6F 3WJJA 1ZVSA 3U4EA 3UTTD 5JHLL 1GGCH 3GMMA 2UYLA 3KPRB 4NUGL 3RWJB 3I6LE 5SX5K 2C1OB 4LPXA 3STBA 1B0GA 5FCUH 1Q38A 1KB5A 3HE6D 3L6FB 1JGEB 5T1DL 1LP9A 5D1XC 5JHDB 3RZCB 2HAZA 1HN1A 2D3VA 3QG7L 4Y7MA 4MA1B 4YBQC 5ANME 5F89B 2NY1D 1T80A 4X6EA 2HVKA 3MUHL 3U36B 43C9A 2VITB 4N5EC 2YN3A 4LEXL 5EU6D 3RTQA 1HH6A 3IDJB 2J4WL 4WW2C 3G5YA 4M00A 4LASH 4PRIE 1C8PA 5D7JD 5KJRL 2AJYL 3FONB 4WFED 2J6EA 3RWIA 2YD2A 4MD4A 1DBBL 2C1PA 1Q9KA 3OJMB 4M5ZL 4DGVH 5F9DC 1GAFH 4A6YB 5EIIB 1XAUA 4MJIB 5DD0H 5IJVA 4KK9C 5SWQA 1EXUB 4ZPTB 1F8TL 4EIGB 2J8OA 3C5ZD 4O00A 2AJ3A 4CJ1A 4L9DA 4MSWA 4POZD 1S7VA 2H45A 4JGJA 1Q0XL 4PJBE 2E7BA 4K94H 4M6ML 2YWZA 5J6HB 1SBSL 1PBYA 1MRCL 5ADOL 3U7YL 4M93B 3SDCA 3VD7A 5IEHB 3V5HA 1VFAB 3UX9B 2ZSVA 1QRKA 1OAZL 4I48A 1NGWB 1KJ2L 3S97C 5T3ZH 3Q0HA 4YEEA 1PG7W 3O2VH 4UT9H 1IFHL 1CFNB 3QSKB 3WCYA 3HI5H 2GFBB 2GW5A 4FNLH 4PG9A 2GSIB 4FQ1L 2GT9A 4JY6B 5D7IB 4Y2DD 1BQLH 1DL7H 3CCHA 5BCAA 3BXNB 3I50H 3QUZB 3HHRB 4Z7UE 5J3HC 1H9VA 1MHCA 1F2QA 2HRLA 3S4SA 5F1NA 2AABL 4UTBL 1S9XA 3CZJA 2HYMA 1EEZA 4GLRI 3TJEH 4QTIH 5FYKL 1A7PH 2Z93A 1HZHL 3ES6A 3E8UH 4CU7A 3FL7A 4K94C 4JO3H 3FFCB 3PWUA 3LKPB 4MAUH 5E08L 5IJKC 3KPMB 5EZLA 3DROB 1J0HA 1AHWB 3IGAB 3DRQB 5ECJE 3MLUL 5GZNC 4NDMA 5DDHA 2Z91B 2R1YB 4LPVA 3MOAL 5KSAC 3DX6B 1BX2A 3MC0A 3VFVB 3VRJA 1P2CB 4K8RD 4HFUH 2IQ9H 2YRLA 3UTSA 3EDEA 4RBPH 3RIAF 1YC8A 4KUZH 4CMMA 2YK1L 1KFAH 1YMMD 3RL2B 3F58H 4I2XA 3FO0L 1MCBA 4ELME 1MCFA 2BSSA 4QOKB 1IC4L 5CUSH 1R3JA 5EORH 2UWEF 1QLRA 4Z0BH 1DANU 4PGDA 4KY1H 2HFEA 3MUY1 4YFLI 4NRZA 1EO5A 1CLOL 4FQXA 3ZDYE 4H26B 4P59H 3DBXB 4MJ2A 3QQ3B 2KPNA 5LCVL 3E6FA 2ICEA 3NH7H 4HK3N 5HYQA 1AC6A 2VC2L 3REVA 1DSFL 5CBEA 1IEAA 3LN4B 1LE9A 1MCCA 5A43C 3R0NA 1I1YB 1UKQA 1CFQA 1FYHB 3IU4H 3O81A 5GHWH 1M05A 1GRWA 1A6VH 4R8WL 3BX7C 3U9PL 5DJ0B 5BW7C 5E2VH 3TO4B 4LRNH 1LO4L 3PP3K 1AGEB 5H94A 5EU5A 4U1SB 3EZJB 4FZ8H 4NQSB 4J2XA 1FFNA 3RQ3A 3ZE0F 2VMFA 4R97B 5DJZA 1X5YA 4M9OA 1WZ1L 3C2AH 1A7BA 1YPZB 4K2UH 4ZYKB 4F9PC 1HINL 5CZXD 3KYMB 1JGVL 4L4VD 4ZD3L 3E3QE 4ZO7A 4ZUWB 4CN4A 1FCGA 2R2HB 4TQEH 1T1YA 5FM5M 4YX2L 4OCLC 1D5XB 2ITCB 1G9EA 5CCKL 4PB9H 1MCDA 3MQIA 4OM1L 3E1F1 5HHMB 1UJ3A 1UWXK 3KPOA 1YMHB 1U8NB 4GAJH 2FJHA 3MLVH 1DFBL 1DVFD 5I8OH 1AE6H 4P5TD 3LD8C 2PXYB 4OIAA 1UM5H 3CH8A 3ILPA 1FLRH 5J13B 1FYTA 25C8H 5L9DL 4HDIB 4BFIA 1T2QL 4ZDHA 2CLRB 3HG1E 2A6JA 4N68A 3LAFA 1ZV5A 5F6IB 4Y5VC 2IF7A 3F7VA 4ZPVA 3MRJA 4H1LB 4PJDA 3X14A 5ELIA 4AH2B 3SDAB 4O2CA 3THML 1SEBB 2FB4L 1J8HD 1G7PA 1R3LB 1UM4L 4NRYB 1U8IA 1WIPA 3OGCA 4XMPL 2V2XA 1Q9WA 4ZUVB 2ESVE 2BNQE 4GBXC 1J5OH 4PLKC 3O45A 3VXUE 3OJDB 4PGCA 1I8KA 4F8TA 2DDQL 1KYOK 4NPYB 1RUMH 5C09B 3C60C 3SKMB 3P73A 2MHAB 3CH1B 5SWZE 3OR6A 1J1PH 3NFPA 4ETQA 3F5WB 1CGXA 4X99B 3DSFH 3HPJB 4OKVB 5H37G 4BFEA 5DVLA 1UEMA 1DQTA 2WQ8A 4XP9H 5BVPL 2O5XH 4D94A 5KZCD 4W81A 5IM7A 2FEDC 3LDBC 2EDYA 2XA3A 5IWLC 2CDEB 1HWGB 1CFSB 2FX7L 5FFLA 4TSBL 1QBLH 3VXOA 4YDKH 3JV4A 4I4WB 1JZ3A 4KK6D 4MJ6A 4XNYH 3BE1L 5DD5L 5KVFH 5CP3H 3P2TA 4XZUA 4L29A 4PRDB 3ZKXB 3VXRB 4PRPD 5D1XA 3LEYH 3BD4A 2VB5A 32C2B 3BYTA 3MGOA 3TZVA 1KENH 4DTGH 4HUVA 3JV6B 1WAAE 5ISZE 3EOAA 4CNIA 2JCCA 3RVVD 3FMGL 4PJ7A 3F8UB 1QYGL 3WFDL 3HNSH 3QWRD 4NKIL 4FQIH 4MCZB 5FO7B 3O6FA 3J8F7 4M7JH 2FJFB 3OG6B 4RWHA 4JDZA 4HGWA 1QTYT 4ZUUB 4NBYB 1T1ZB 1IAIH 1JGLL 3IF1B 5DQDL 3CFBB 5FECA 2F53B 3ILQC 5EG6C 4PUBH 3TIEA 3DETC 1YEHH 2J88L 2VDOL 5KVGL 4KKCC 1RJLA 4YXKH 1NLBH 3T65A 2VXSH 5GJTH 2DYPA 4JFEA 5M7QA 3FB8A 1V8HA 4NQCB 1AQKH 3ZMRA 3MOBH 1NCCH 35C8H 3NPSC 3NN8A 4GRWE 3RUGA 1UA6H 1U3HB 3F7YA 4AENB 4UT6H 4LIQH 3QDGA 2VERN 1FJ1B 3WNKA 5FGCB 1RK1A 1VERA 3O3BA 3H9SE 2OJEA 5AUMA 4PJHA 5EFIA 5KBNC 1BZQK 2O61A 2W0FA 1IARB 1X9QA 4C55A 3ZKNC 4HEME 4LEOA 1JPTL 5L8LB 3VFTB 4MQ7A 5CJOL 1WCBB 4NP4H 1AD9B 2YEZB 4PJ9D 2H6PA 4X6CA 1KACB 5I66B 3WO3B 4JFDB 3MRMB 4OLWL 5GJSL 4OZFA 2W59A 1UZ6E 1BBDL 4LGSB 4ZUSA 2DLFH 1YEDB 4W70A 3S37L 3VW3L 3MV9A 1H8SA 3KYOB 5J6GA 4JPKH 1HHIB 4M03A 3CPLA 5F7YC 5CBAB 1CK0H 2L0DA 1IL1B 4CVZB 5FYLD 4YFEA 4G43B 5ADPL 1TITA 1VKXA 4HF5L 4NC1C 1UWGH 4UI2A 4IRSD 1UH4A 1I3UA 5J8OA 4KGJA 3U48A 2OP4L 5I30H 4LL9A 5E6IC 3HE7D 1S7WA 5JR1H 3ZKMD 4KKNA 1F45A 3HR5B 2PYEA 4JRWA 4WTZG 1NUDA 3QIBD 2ORBL 1QLFA 5IMKA 3UCRA 3VJ6B 2ZCHH 1OTTD 1JV5A 2R0ZL 5MHSE 3LV3A 1QKZL 4PJXE 5CEZL 1P5VA 1QSFD 5DJDB 2ZUTA 3QDME 3NIDE 4OLZL 3MYZA 1JFQL 1MVFA 2B2XH 1WWWX 3OZ9H 3OKKA 2Y07L 4U1LA 1XF2A 1CVRA 2X4TB 1OD9A 3I2CH 1XCTB 3MMEB 5F9JA 2XACC 3RY4A 4XWGL 5FCUL 3ROLB 1RZGA 3U9UA 4HFWB 3W11C 1E4KA 4JPWH 4X8XA 2X4NA 2ICWI 5BW7A 1GSMA 4P5KB 1UXWB 3LQZB 3BUTA 4M7ZC 5DHXB 5IMOB 4I5BB 4NNYB 2OMNA 3MRFA 3ELAT 5L2KE 3NAAH 3EDFA 3KAAA 1MIMH 4DAGH 1KBGH 4PRAA 4RGMB 5JOFB 1XF1A 4WUUA 4Q6IC 3V6OC 2AEQH 4WCYH 5E6YA 4F9PA 4B41A 2M2DA 3HMXH 4RQQB 2XIDA 5I19H 4JE4B 4Q0XL 4HWBA 3M17B 1NUGA 1JUFA 1L6ZA 3BPNC 4BJLA 4HUKB 3X11B 3OKDB 1BJ8A 4RZCB 3U0PA 3QCVL 1YYMH 4ODHH 4U6YB 4DGVL 4DEPC 5D8JH 3WIFA 1GAFL 5F88B 3S96B 1EFXB 1A2YA 1S8DA 4P2QA 4W6YB 3GSOB 4L4TD 4XP4H 3A0OA 1I1FA 3T4YB 2YD7A 4X4YA 4K94L 4P9MH 3CVHH 3DX8A 4Z7QE 4PJEF 5EZIH 5I2IA 1KPRA 1AO7B 4OF0A 4MJ5B 3DI3B 1OP3H 3VDAA 1DEEB 4LOUD 1A9EA 5C0AD 5TH2A 1S7QB 4EOWH 1T21B 4YDLC 4OBSA 4GBXA 3DVNA 3GSNB 1CF8L 1CG9B 1NCNA 1X5HA 5C07D 4O2EA 4RGND 5T3ZL 2BMKB 3ZKQD 3C60A 3O2VL 2RHEA 4JY4A 5JOPD 5LAXB 1R3IH 1UB6B 3L9RB 4MNQB 3DURB 2IALA 2ZJSL 1V05A 4KGLA 2PCPB 1YN6A 3UYOD 1NEZB 4O2FA 1BQLL 1DL7L 4KJYB 3BZ4A 3OWEA 4WV1A 1S7TB 2VR4A 4I18C 4NQVB 3VG9B 2A73A 4PGJA 3DRTB 3SE3C 4WI3A 4LLQB 1YEKH 3MODH 5HYFA 1U8QA 3OXSB 1ZVHA 1BVKA 5HD8C 3Q6FB 4GXVH 3WFHB 5B4MC 3LPWA 3O6KL 3PABA 5HGAB 2IFGA 4BELD 3O3EA 4MAUL 2P7TB 2FZ3B 2Z9TA 2NR6C 3VFPB 1RI8A 3D39B 3Q5TA 5FA3A 3T0EC 4XCEA 1ACZA 1XFPA 1NAMH 1GGIL 3RWEA 5CJXC 3QFJA 3NCJH 2CIIA 4NJAH 2O5ZL 1EAJA 3A67H 3F58L 2IAMC 2EKSA 5ID0A 3TLRA 3U79A 5GISH 3L7FA 2ZOLA 3VXTB 1PZ5B 1Z9OA 5ICYB 3PQYB 1U8LA 1OGAE 2Z35B 3TJHC 3WUWG 2YD1A 3MRNA 1MH5B 1FL6A 1S7UB 1TENA 4NFBA 1LO2H 1U42A 5DZOA 4HWEL 3P77B 4P59L 2OBGA 3MJ9A 1T4KB 5KG9B 3NH7L 3DXAD 3SKNB 2ZUXA 1UWEL 5AZEH 3TT1H 3UJJL 4GRMA 2VLKB 3VFNB 2XTLA 3KPTA 4NM4H 4OLUH 3BAEL 1C5DA 3IT8D 2NY6C 3FB6A 4G8GA 4L9LB 1AJ7H 2LABA 4HUXB 3G6JF 2APXA 2DMBA 4MB3A 1INQA 3ULUE 2EIEA 3L5IA 2DLTA 1M7IA 5GHWL 1A6VL 1OAKL 4WFFE 4UOW1 3G5VA 4JZJC 5I6XC 3FOLB 2EZ0D 4KDWA 4FTVD 4X6DA 1RZIA 4C56D 3CDYA 4MD5A 1E4JA 1WFOA 3T3PE 4R0LB 3HCVA 4O58H 3V6FB 2YD9A 3C2AL 3AU1B 2KUTA 3GGWB 3S5LG 4DFHA 1MFNA 2NX5A 4JPIB 1KXQE 4K2UL 1F97A 2A6DA 3EO0B 1A1OA 2E5EA 3T0WA 3TF7C 3BW9A 5IHUH 3F7PC 1M6OB 4OTXL 1X7QB 5D93C 1NMBH 1P6AB 2X4SB 2ENSA 5D5MB 4IRSA 1A1MA 1KIRA 4Q97A 5K59E 3QDJD 7FABH 1F4YH 2XWTA 2DQJH 4XMKL 4WI8A 2E7MA 3L95A 3N0PB 3F7RA 4GAJL 1FL3A 4ZQKA 3BKML 2FHCA 4JKPL 2VL4A 4LLWA 4MCYA 1XGYH 5DC9B 5I8OL 5EA0H 2UZXB 4KKBD 1MFCL 5HPOA 4I3SL 1UM5L 2ICWA 4MXQC 1S5IL 4QHMA 5C0GB 2VLRA 3CXDH 1OHQA 3ARBB 3GMOB 3KYAA 4L3CA 3RPIB 4JRXE 5TDNA 3JXAA 3O4LA 5J4MA 4AEIH 1IZJA 1ZT1A 1ZA6A 2Z4QA 5D2NE 2NY0D 5E6IA 2PKDA 2AEPH 2FEEI 2X41A 4ZFZB 1O7VA 5C0BE 1J9CT 4YBHA 1HSAA 1MHHA 1MFAH 3H7BA 3V4PH 1TTUA 3DUSA 1Q1JL 5A2KH 3D69A 4CADB 2VL5B 4KRPD 3QI9C 4HUUB 5BV7B 4N0UA 1G6RB 4P0DA 4L3EE 4GXUN 3NPZB 2OS7A 1KCRH 1X6LA 4MQSB 4OCWH 5I16B 4K3EH 5ESQB 3PGCB 5IVZB 2XTJE 1FFOB 4TOYH 4XP9L 2BCKA 3LIZH 4HKZB 4Z7WA 4E41D 4E9LA 1YQVL 3FKUS 4X80H 5LG1A 3MRDA 5KSBE 2VDRH 4LDEB 1MHPL 3RWGA 3BFOA 2R2BA 5ID1A 5D7SH 1N4XH 2DTSA 3WL9B 2EKJA 3HRPA 4CJ0A 4F7MB 1INEH 2WWMD 5CLWA 5KVFL 5CP7A 5CMAB 3C6LB 5FXCH 1KTDB 1XGUB 3L5WA 1H3UA 3U6RB 2BSTB 2GJ6D 3FQXA 3LEYL 2F19H 2NW2A 2R29H 1FVEB 4OZ4A 4ZFOL 3MFFA 5K9QG 2FX9H 1ZWIB 1G7IA 4DTGL 3WIHA 5I17A 2FR4A 3D0LB 3WUWB 4FQQB 1P7QD 1LE5A 2GITB 2HJKB 1FO0A 1SEQL 4H25A 2RFXB 1XR9A 5JPMA 1I75A 1HHHB 2HG5A 1JPFB 1MLCB 3HNSL 1TQCB 4L8DB 4P46D 3OXRB 2VIRB 4LCYA 3TVMC 5E9DE 5ACLA 5HYJE 2H8PB 5ESVA 3AY4C 1NMCB 3MCKB 4PJIB 1XT5A 3GKWL 2RAMA 4YWGL 3VH8A 4M8QB 5E8NB 1BD2B 1TJHL 2DBJA 4PUBL 5C07A 3IVKB 3A6BH 3PP4H 2EIDA 2GTZB 3MRIB 1BGXL 1MQ8A 4V1DD 1MLBA 3NFSH 2D7OA 1RPQA 3CDFA 1FIGL 3DWTA 4HEPG 4JFPA 4YXKL 1NLBL 5FYJH 3WKNA 3CVIH 5J56B 5GJTL 3IFNL 1BIIA 2Y4SA 3QUXD 5IVXE 1ZLWH 35C8L 1S5HA 2HH0L 4KRLB 4JHAL 1YY9C 3NA9H 4UDUA 3DLQR 3MBED 4JVWA 2X9XA 3AAZB 3KWWB 4HPOL 3IDNB 4G9FE 5IB3B 3V79C 3P0YL 1W72A 3V9FA 2ARJQ 4MVBD 3VFMB 2HFFB 1DP0A 5IQ7H 5CJQH 2LVCA 3ULVH 4FQHA 1S7SB 5JO5A 2X7LB 5F44A 4UQ3A 4NHCL 1PFCA 4RMQA 2SEBA 3VWJB 5DD6B 4NP4L 2B0SH 2VSCA 3N85H 4I18A 3PWJA 3QUYD 1R5IA 3QIUB 4YDVB 5IHBA 4P2OD 1HOCB 1M7DA 4I0PC 3O8XB 2VO5A 2XN9A 4LDLB 1HHJB 3MV8B 1QBMH 2VQ1B 1ZT7B 1QRNA 4BQCA 1IEHA 1MJ8H 5FHBL 4MLIA 5FDWB 3NA4A 2AXHA 3GK8H 4LAQL 3SDYH 4KUCF 2R0LH 6FABH 1ZHLA 2PUQT 4IOIA 3LVEA 5EUKA 1H3PH 4XP6H 1MCKA 5I30L 4OSUL 2A9ML 5GS1B 3BZEA 2OR8A 1AXSB 1DN2A 4FQCH 4GW1B 5IBUG 2IAMA 5BQ7A 3HPLB 4JN2B 4AZ8A 1KPUB 1R3HB 3WIHL 1R0AL 1ZT4A 4K7FA 1OB1A 4UAOC 4OF3A 4C83B 1FO0L 3D3VE 1UKSA 4LSSH 3HZKB 4L8SB 3V2AR 1CL7L 5EBLB 5HGGS 3BDBA 5D1ZD 5HGHB 1H8OA 3GI9L 2I60H 4X7FC 1LILA 4ZFFB 1QSEA 2CGRH 2B1AH 4ALAL 2D31B 2AK4A 4WNQA 3LEVH 2VUOA 4QTHA 5IK3B 4PJBF 1M7XA</