1IAOA

Class ii mhc i-ad in complex with ovalbumin peptide 323-339
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
178
structure length
178
Chain Sequence
EADHVGFYGTTVYQSPGDIGQYTHEFDGDELFYVDLDKKKTVWRLPEFGQLILFEPQGGLQNIAAEKHNLGILTKRSNFTPATNEAPQATVFPKSPVLLGQPNTLICFVDNIFPPVINITWLRNSKSVTDGVYETSFLVNRDHSFHKLSYLTFIPSDDDIYDCKVEHWGLEEPVLKHW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords MHC CLASS II I-AD
publication title Crystal structures of two I-Ad-peptide complexes reveal that high affinity can be achieved without large anchor residues.
pubmed doi rcsb
source organism Mus musculus
molecule tags Mhc ii
total genus 33
structure length 178
sequence length 178
ec nomenclature
pdb deposition date 1998-03-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00993 MHC_II_alpha Class II histocompatibility antigen, alpha domain
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1iaoA02
3.10.320.10 Alpha Beta Roll Class II Histocompatibility Antigen, M Beta Chain; Chain B, domain 1 Class II Histocompatibility Antigen, M Beta Chain; Chain B, domain 1 1iaoA01
1AQDB 2FJHA 3G6DH 4JKPL 4U1JB 4KKBD 5B3JE 2MCPH 1ZHBB 5I18L 3EFDH 1CG9B 3IDGA 5FB8B 1KEGH 2J88L 1FORH 4U1LB 1FE8H 1NAML 3P73A 1OD9A 2NY0D 5MERA 2J4WL 4PJAF 3WEXB 4Y2DC 3MJ8A 1EAPA 3N85L 3LN4A 3H0TA 3V6ZA 1QVOA 3SDXA 2VOTA 2DQHL 3QEQD 3MRNA 1G0DA 5H37H 1PQZA 2BNQD 4CMMB 4M7JL 5L2JB 3K3QA 5BV7B 3TVMB 1RV6X 2M26A 1S3KH 2E9WA 3RWFA 4YHNA 3C2SA 4XPBL 4KTEL 4LHJB 4YHOL 4LCYA 4JM2A 3BOVA 5IJKC 4G8EA 4PY7B 4P2RB 4GW4B 3BAEL 5IHZA 4Y4KD 1CGTA 2OR9L 2BVOB 4JFFB 1RHFA 4Z95H 1GYAA 3U0PB 3EUUA 3ZMRA 5FA4B 2EH7L 3AM8C 3T0EB 2Z93A 3ARXA 2H1PL 4K2UH 1P84K 5FO7A 5JORA 2I9TB 4Z0XB 1QBAA 3BXNA 1BZ9A 1OWRM 5AZEH 2LTQB 4LASH 1A6TA 4Z78B 8FABA 1U2CA 1KTKE 2HT4C 2AQ2A 3D3VE 5BO1L 4MMXC 1AKJD 2IH3B 1D5ZB 3B43A 4RISL 4Q9QH 1FGVH 3SDCD 1T6WA 4P5TA 2P5EE 1MPAL 3BQUA 4RIRB 3ZHLA 4XPAL 2G2RB 4IDJH 3ZDXF 1IM9D 3IFNL 5BJTB 4G8GE 3D0LA 1BECA 1MCKA 5IVXB 1K2DA 3P4OA 3EYFB 5D1ZD 3O4LA 4GAJH 3TNNA 2GTWA 3TBWB 5TQ2L 4LCIL 1F58L 4D0CA 2AJZB 3QDAA 1DEDA 4HH8A 4X4XA 4YLQT 3IAGC 2MOVA 4KUZL 2YPLE 4A6YB 2C9AA 2OXHA 2VZUA 3MFFA 4K9EL 1EZVX 1MI5A 5TE7L 4OLVH 3X13A 3D39E 4GW1B 1VFOA 5FUZH 4JPIB 3DECA 4G8IA 3FT2B 4L3EA 1Y6NR 4PJEA 1JL8A 1MCPH 4X8JB 3PNWB 1LO5B 1N7ML 1HIML 4UB0H 4GBXC 1FIEA 2EDHA 4LNVA 4L8SA 2DQDH 1NGWA 2RCSL 3ARFC 3B3IA 1N4XL 1D5BA 4PJ7E 2Z92B 4X7FC 1XF3B 4P5MB 3L1OL 2IPKB 3VCLA 4F33A 4WHYH 4DKFH 4Z7OE 1RZ7L 1BX2B 2F74A 1G7LB 4JE4B 3MV8E 5HGHB 1CFTA 5BVPH 3DROA 1Z9OA 1KIRB 3H7BA 1LMKA 4OI7A 5KZCB 2DYPA 1GGIL 5I8EB 1XF5B 4CJ0A 5I8KH 3WN5C 5I6XB 4CMHC 3QDMA 3SJVB 5DDHA 2AGJH 3TIDA 3L3OB 3U36A 3WE6B 1G6RH 4MQTB 4QHLA 3VFOB 4PRPE 4QNPE 3PQYB 4WFHE 2VL5A 3HFMH 4OCRL 1MEXL 3TV3L 3EHBD 4PJ5A 4TRPL 4KQ4L 1ZLSH 1XGQB 3BKMH 4JGMA 3QZWB 4M7ZB 2D4FA 2Y36H 3EDDA 3QEQA 5HD8D 3EYUH 5D7KE 3FB5A 4J6RL 4UILL 1QZ1A 4MJ5B 1IEBB 3CFDB 4FXGB 3QHZL 3VXUD 5JR1L 4BSVA 3AY4A 1GC1H 4JFEB 3ZE2E 2PXYD 2FWOA 4TSCH 5IMOB 1T0NB 4MD5B 1G7HA 4LPTA 4OD1L 3GO1L 4ZO8A 4M6NH 1HOCB 3TA3C 2FX8H 1F13A 1Y18B 3BN9D 4AT6B 2OL3A 3RWGB 2VAAA 5MENE 1I1YA 4P2YA 3MLZH 4MA7L 3GMRA 4Y4KA 5D8JH 2VE6A 3T08A 3NIDE 1JVKA 3SN6N 1GPOH 4M1CD 3QDHA 4B53A 1A6ZB 3MPCA 5FAAA 1QSFB 2VITA 3EO1A 4XTRC 3KPSE 1IAIM 3OJ2C 3WIFB 1JZ8A 4FQHA 2AXJA 5IVZA 4HFUH 3BWAA 4ELMF 1AGEB 5GGTH 1XIWD 1ZGLA 2YD2A 1UJTA 2Y07H 4ZTPL 4Q0XL 3VH8A 5TF1L 1AKJA 5MP6H 3MV7D 3B83A 4Z5RA 3WFHB 4L9LA 1HHIB 4K8RH 2W60B 1DEEB 3CX5J 3P4NA 5JW4N 4QRRA 1Q9WB 4KROB 3ULUE 1IM9A 4NNXA 4KI5D 1UZ8B 1IC7H 1JHKL 2NXYC 4M48H 4P57B 1QA9B 3DO7A 1KIQA 3PWLB 2BVEA 4WW1B 3ARPA 5D1ZA 5HDBF 5BS0E 2VIRA 4NQTA 4XXCA 3VGDA 1U8LB 4PJHA 4C4KT 5IQ9B 4OSUH 1TCMA 1FVCB 5EZIH 1JV5A 2XQYG 1E6JH 2IWGA 1U93A 3GSWA 5EORL 4OT1H 2AI0H 3WFZA 4ZMAT 1RZGA 4BZ2H 3QEHB 4XMKH 3JZ7A 5F7EH 1QUNA 3EDEA 5JO5A 3REWA 5HHME 5CEZD 1X7QA 3EKCA 4X9FA 4PIRF 3ULVE 2SEBA 1FFNB 4QCIB 1BGXL 1VGKB 2YEZB 3IT8D 3BMVA 1VPOH 1EX0A 4PYGA 4MAYA 1CR9H 5ICYA 4EZMA 1I8KA 2O5ZL 2H8PA 4X7SH 4Z0BH 1DQLL 5DF0A 5ERWA 4JFDD 3FQWB 1DE4B 1BQLH 3EYSH 1FAIH 1HXMB 4NNYB 3PV6A 4YC2B 3ZL4L 4MXQC 3B5HA 1A9BA 1QFWI 4Z8FL 1H15B 1XZ0A 3IXTB 5EFIA 5I9QB 4GXUN 4N9GB 4XP1L 1Q72H 1K9TA 3KVQA 4FQJL 4Y5VB 3IDYB 3ALXA 1JRHI 3MNZA 3GSXB 3TBTA 2GK0A 3PP3H 1VESA 2P8PA 4X6CA 4NJ9L 1YYLH 3TBSB 3F7VA 4W68A 1R24A 2K7QA 3VDAA 2HJFB 4EI5C 4MXVF 5B3NA 4PGCA 2YKLH 3NAAL 3B2VH 3C6SB 2RFXB 3FQXB 3MLRH 3O6KH 3MRFA 5CJOL 3JSSA 3QWRD 3UJIL 1EEZA 3D3VB 1MCOH 2EYSB 3VJ6B 3CNKA 2C3VA 4O58L 4NN6C 4CUCA 4KTDH 3GMMB 3VXUA 5IHUL 4ZAKD 4KMTL 2VXUL 5KANG 1RFDL 4FTVB 2CIIB 5GRXG 1T7VA 1KGCD 4PJGF 3VFPB 1HHJB 2PXYA 3DMMB 4FFZH 3D9AL 1A14H 4MA8H 4RAVB 1SVZA 2ZSVB 1OAZL 1GC1C 4LKCB 4CVXA 2YRPA 3GBNL 3TBYA 3HZKA 1E4WL 2X7LB 2G5RA 3RY4A 5CMAB 5ESAA 2E7LC 4M1DH 2I26N 3FT3B 1OHQA 1IT9L 2DS4A 3DI2B 2PO6B 4LLWA 1TITA 4MQSB 1BVKB 2G5BA 1GZPB 2YPLB 1F3JB 1U3HB 1UACH 5FEBA 1OAXH 4TNVK 2F53B 3NIGE 3GFUA 5AYUH 3WL9A 1KJ2B 4RA3A 1XIWA 3WIIH 1IKNC 4N5ED 5CEXA 2VL4A 3H3KA 1RK0B 3MV7A 3QDMD 2A6IA 4YDKH 4YAQA 4PJ9C 3HG1B 2VB5A 3SKJL 1X3DA 5D7SL 2X4OB 3PP3K 3KYNB 3V5HB 1C08B 2HVJB 2VLLB 4NRYA 2WBJB 3PIQA 4K8RC 4PJ7B 4CU7A 4F8TA 2QQKL 4X99B 2AEPH 2ADGA 5CIPA 5GS2D 4GMTL 5J6GA 1LO4L 1FNEB 2DB8A 4PG2A 3MV8B 2CK0L 2JCCF 3MBEC 3SDXF 4ZD3L 4JDTH 4H1LH 3STZA 5DUBB 5IF0B 3GIZL 1ACYH 1KB9K 1ZKAA 3H9HB 2OS7A 1EFXD 5TJWK 4NN5B 5J1TC 2ICES 2NY2D 4JFZH 1XCTB 2V2XB 5KJRH 4QHUB 3T0DA 3I50L 3HUJF 3TJHC 4POZD 4LCWD 1IGMH 4PRPB 4YE4L 3U9PH 3AU1A 4JM2F 2Y6SD 4KDTA 2DWDA 5TDPB 2H3NB 3OKMA 3OKLA 1FV1A 3V0WL 4PB9L 4U1MA 5C0RL 2NYYD 3VFVB 4JFDA 1W8OA 1N5YH 1NMBL 2JK5B 3CSBA 1ITBB 3D85B 1WAAE 4PGZA 5L8LB 3BISA 5D2NC 5E00B 1S9YB 3F12B 4UIMA 1QFHA 4GG6F 1W72H 3M1BA 2HWZH 4XP9L 2G60L 4OCYH 2YBRA 2BVPB 4QYOA 5B8CC 3GRWH 1I1AB 3JUYA 2R23B 4NZTL 4PREA 5DK0A 5TPWL 4A6YL 5GS3A 1JZ3A 3Q6GL 2ILLA 5LGJB 5I1CH 3C60B 3IS1X 3T3PE 3H3PL 5SWZD 4ODVL 1CL7I 5ALCL 1KLGB 3KPSB 1F4WH 3K8MA 5C0CB 4Z9KB 1UADC 2BSRA 3VXRD 3W9DB 4WCYL 3ULSA 3RDTC 2XN9E 1SEQH 3FFCD 3QWRA 5H37G 3WDIA 1A1OA 4BK4A 5FFLA 1XGUA 2OTUB 2VN7A 3TCXA 1NDMB 4BH8B 3PL6C 4HX1B 2DI9A 4ZAKA 1F6AA 4U1GB 1A6AB 3L5XH 1OGTB 2Q76B 2GCYA 4BQBA 3LZFL 4IMKC 5DFVC 3A67L 3VG0H 3RUGB 1U6AL 4R7DB 5JW3H 3K2UL 4MD0B 1NGQL 2D7NA 1JWSB 2HN7B 4NGHH 4XBPA 5TFSH 3EDKA 2QEJA 5HHXL 3MLUH 2C1PB 5C0BD 5CGMA 5BS0B 1R5VB 4P0DA 3LN5A 1AC6A 4XC3H 2Q86B 4HXBL 1FH5L 4MDIB 1AXTH 1CTOA 3GM0A 2I5YH 3BO8B 5HHMB 5J1SC 3PWPE 5TQ0L 2FDBP 5F71A 5DLML 2A1WL 2CXKA 3KLHD 4PS4H 5EIVA 4CDHA 3RAJH 3WSQH 4WHTB 4X7TB 1FFOB 1NGXA 1A2YB 5AYQA 3L9RB 4OLXH 7CGTA 2H2PC 1FLRH 4OLZH 4HGWB 1TQBC 3LB6D 3RWHA 1RJYB 4M02A 4KZEH 2OP4L 2UVFA 4Z7NF 4KV5E 4N8VA 3UJTL 2EXWC 1DTUA 3PF2A 4R0LC 5C6TL 1HSAB 2JTDA 3KXFD 3QUZD 1ADQL 2GAZA 4P3DA 5E24E 3VXPB 3U6RA 2R0ZH 4FQXB 5DS8B 2H6PA 1OAQH 3BP6B 1VA9A 1RUAL 4ELKB 4D9RE 3DVIA 1NMCB 4ZTOL 3MLTA 3ROOB 4P23B 1OTUD 5DMKB 4Q2ZA 4ZSOB 4XH2B 3MGOA 4LCWA 1VACB 2VDKH 4NZRH 1RUPH 5F9OH 3PWVA 5INCB 5DMYA 4M62L 4KVCH 1RMFL 5DO2C 2C1OA 5C7XH 1L7IL 4F58H 1NFKA 2Y7QB 4X0KA 2R39A 3GI8H 1MRDL 1S7TA 3LPWA 2APWA 1CGSL 4QRUB 4GUPA 2JLLA 3TH3T 3VD7A 3L3HA 3RRQA 3GSVB 5DC0A 3LRGA 4WHYG 4ODWB 5JTWA 2IFFH 2FD6L 4UT9L 5I8CA 1BLNB 1IC4H 1OQOA 4TUKL 5IQ7H 1G9ML 1FNFA 3IRPX 2XY1A 4HEPG 3RIFK 2VLJE 3AVEA 2OK0H 3NN8B 1U91A 4UV7L 1S8DA 3F7QA 3V4VL 5FCUH 4RFNB 3FRUB 5EBLB 2DRUA 3EJYC 5SWZA 2DF3A 4UINL 4XC1L 3T4YB 4J12A 4YDLB 2D7TL 1A3LH 2EDXA 2CMRH 2BJML 3MMEA 3MRLA 3VFGH 3VDBA 4I48A 2GI7A 1DUZB 4WV1B 3FFCA 1JNHA 3L95A 2OR7A 5K9KB 4Z7QF 2HFFB 4XPFH 4FQCH 5IBUG 1T7ZA 4HIXH 4MQ7A 3LEVL 3RGVC 1I3UA 2E7BA 1HHHB 3DVNB 1KCSH 1OARH 4C57C 4NFBA 2HT2C 1HINL 4YFDB 5D7IF 4XT1C 5C0BA 5IIEB 1CDYA 5IT2H 1LO0L 1S78D 4JFPA 5EA0H 1HKFA 3MV9E 5J1AB 5D7JB 3QQ4A 5EU7E 4BFEA 1Z9LA 3N50A 5JOPD 4GRWE 4DGIL 1AGCB 3IF1B 1J1OH 1ZLUH 3NCFB 3DV6A 3TT3L 4WWKC 4ONFH 4NM4L 5JNYA 3BH9A 2XPGB 1QEWA 4HSQA 1K4CB 2P8MA 1SJEA 1U8HB 1CLOH 1BFTA 3R8QA 3B8YA 4RFEA 2VLKB 4YFEA 2AERT 2ZUSA 2Z4QA 3BP5B 4KZDL 4TVPE 3L5IA 4C56B 4NCC2 1ND0B 2BNRE 3QH3B 2IQAB 1KJMA 3N9GH 5FM4A 1CD8A 2UWEA 3ZKXC 3MACH 3OKOB 3HMWH 3D69A 1ZE3C 3NVQA 1DQQA 3KXFA 3QUZA 1EVUA 1EEQA 5DYOA 4NQXB 5DUMH 2UYLB 4LEXL 5HYJD 1EO7A 2MQ3A 4ODTH 2P24B 4QOKE 1I7RA 2IQ9H 3QDGA 5F3HB 2DTSA 4OLUL 1SQ2N 4PJDA 4XCYA 1KJ2L 3FOLB 5HVHB 2BY2A 4TSBH 2E7MA 3LS5L 3B9AA 1AI1H 2AXGB 2Z9TA 1TXKA 4MVBD 3BIBX 2IFGA 3CMOH 4L1HA 3RL1B 4KK6C 4HK3J 2X4QB 1VGEH 3MA7A 2Y06H 4HK3N 4HLJA 4KRMB 1TVBB 4R4FH 4I4WB 4ERSH 2DMKA 3WJLA 2AXFA 5JW5B 4NSKA 2IAMB 4YDVA 5D2LA 5IR1A 4QHNB 15C8L 1A5FL 1WWCA 1T20B 5H2BB 2V17H 4XPGL 1J1XL 5DVLA 5E2TH 3OR6B 3W0WE 1L0YA 2J8UA 1M7IB 4IOFC 5GJSH 1MFEL 3UC0H 1FDLH 1T2XA 5I30L 1T22B 1KPRA 5IM7B 1TTGA 2F5BL 3CDGB 1HH9B 3SQBA 5B39G 1WVZA 2A0LD 1JWMA 4ZFFB 1S5HB 2HLAB 2D31B 4HPOH 2PTVA 1GGYA 2OL3H 1MCQA 2Q8BH 3IVKA 1D5IL 1FZJA 2QADB 3KPRD 1KPUB 5IEHB 3AS0A 1A7QH 3C5JA 1DBAH 3FQNB 4OZGB 2GW5A 4JM2C 3LRHA 2X09A 5FYLE 3ZKMD 2NW2B 4Y2DB 1INDL 4YXKH 2YPKB 1OAUL 4R2GB 3DVFA 5GJTL 2VC2H 5D72H 3DV4A 4LHUD 4UUJB 4GQPH 5KVMC 4QT5A 5L7XL 4NO5A 2NTFB 5KSAD 3BKYH 2Z91B 4U6YB 3ALWA 2VR5A 4WFFD 1J8HB 3MROB 1DP0A 1RIVL 4P46B 2BFVL 4OTXH 4HXAH 4N5UA 3BDBA 2IANE 2A6KB 4JDVA 3BW9A 1K4DA 3OTTA 4P5TC 3BQUC 2VZ3A 5MEOA 4QRPD 2UZIL 5EUOA 4HF5H 1ITCA 5AD0A 5DJYB 3DIFA 1BFSA 2L7JA 3VFMB 3D18A 5T5NF 5E8PB 5E1AA 1H3GA 5H35B 3MRDA 3VGEA 3OAUH 2CSPA 4PV8A 4JLRA 5JQHC 4R97C 3G6JE 1DQMH 1V7NH 3LMJL 4G5ZL 4ZPVB 3U4BL 5ACMA 3ULUL 4QNPF 2KPNA 3MLSL 4Q58C 3F6IA 1TJHL 2ERJC 2UY6A 3MR9A 3QWQB 4G7YH 2HJKB 3BIKB 3MRHA 2C7UB 3BEVB 3EIFA 5GGRA 4YHLL 5CFHA 3CSYB 2VDNL 5F89A 1NJ9A 4XNUL 43CAA 3S3PA 5A2LH 3HNVL 1CXFA 1UB5A 2EKJA 3C87A 1GHFH 4HULB 3NCEB 2APTA 5GRZA 3SE8L 4L4VA 2CIKB 2ZUQB 2DLEA 3PWNB 5F7DA 2AK4D 4H1LG 1KFAH 4NWUL 2IG2L 5EOCH 5HYJA 1BFOA 4LPXA 4O5LL 2AW2A 4PRIE 5EU6D 4KJWD 1ZHKB 2W9DH 5F9AC 1TJIL 4X9GA 4JRWA 4L8SC 4YDJA 1HEZB 4PRBB 3ULVL 3OKNA 3VRLE 3SKUD 1BQHG 2VLRE 3ETBF 5F9WB 4EBQH 3QIBB 1X5FA 5DQJB 2NLJA 1G7IB 2NZ9C 4I0PD 1ZWIB 3V5DA 1XGYL 5ESVB 3F6LA 3OKEB 1MCNA 4JANA 5EO1A 4L3CB 4APQB 5IMLA 2NXZC 1LP9A 1UCBH 3S37X 3AGVA 7FABL 3NGBB 5EWIL 3DX7B 1ONQA 3MUJA 4P9ML 3VG9B 1VADA 5FYKE 5GHWL 1NBVH 1OP5H 1YJDC 4KKBC 5IJVB 3G5XB 2FJFA 3DOSA 5DT1H 3FN0H 1NBYB 1B2WH 1WWBX 2D9CA 3LPGA 3G5VA 2BXZA 4WU7A 3HC3L 1R6VA 1I9JL 3QNYB 3ES6A 1I7UA 3MRRB 1CGVA 3ARGD 3MV9B 4NHCH 2E27L 4HUUB 3MNVA 3GKWL 2ITCB 3VXOA 1CVSC 4GRWB 5I2IA 1GSMA 4PJBE 4LFHD 2ADJB 1UWGL 3TVMD 4JZNB 1FFPB 2AKRA 3AY4C 1WBXA 5JXAL 4U6VL 3FO0H 4R96A 4JCLA 1YN6B 3O9WD 4LLAA 3HR5B 2BRRH 2BY3A 2BOCB 3VXQA 4IHOA 3KJ6H 3TZVD 1KCRH 3QXWA 4MQXC 4Y4KC 4MZ3A 1EGJL 3O11B 3JTTA 3RPKA 2DD8L 5CBAB 2YUXA 2E7HA 3FTGA 4OF8A 3P2TA 1EUTA 4K94H 4LHUA 3T0ED 4Y5YB 1D6VL 3GSQB 4GKZA 4NQSA 1KG0B 4JRXD 2ARJQ 1VSCA 3G5ZA 1NLDL 4LDLB 3HI6H 3LRSB 4ZFGH 2AQ1A 4ETYA 4S1QL 1CK0L 3LQAL 2ITDA 5JLZB 1YN7A 1R3HA 5AEAA 3EOTH 3MRKA 3T2PA 3BPOC 5DUPH 3Q6FA 4LARH 5DJ2B 4HLZH 1XR9A 4K3HA 4HC1L 2EDWA 3NCYP 3BRFA 5CJQL 1D5MA 1DBJL 3CLEL 4FABH 5M94B 3OF6D 1OW0C 2ZUVA 5I17B 3NH7H 1AO7D 4L9LC 4NBYB 3VWJD 5C0AB 4BSJA 4QOKB 4JM4H 4QRPA 5CIPH 4Y5XA 3PHOB 3FJTA 1IAOB 1IAKB 3KYOA 4UAOB 2X4PB 5HVFB 3NFSL 1OP5K 3GI9H 4PD4J 3TM6A 4HFWB 4FQ2L 4ORGB 4YHKL 5T33L 5D1ZC 1MCLA 1CLZL 4XXCC 3WMSA 1B0GA 2ICEB 4HIJB 5BXFA 5DR5H 1JF5A 3OZ9L 4AEHL 5I1LA 1GVIA 1YPZA 5CEZH 5C3LD 5H8DA 4LIQH 3V5KB 3CFJA 2AJXH 4DQOH 1WBZA 2BX5A 1QHPA 2G9HA 1J1PL 4EKXA 5F8RC 3W0WB 3X11A 5FF6B 1G6VK 4WU5B 5CUSL 4YHYB 1NUFA 1JPGA 3KG5A 4YHIA 5DJ8B 2AK4A 4LCCA 4XZUA 3SBWA 2DWEB 4QRSB 4J3UA 4MAYC 3SDAA 2FX7L 5EU6A 4CW1A 3CJJA 1MRFH 1X6LA 3RPIB 4K3JH 4B0MM 4ZODA 1QFWH 4E0RB 4YBLB 5SWQB 1DL7L 4HW6A 3T0BA 1A4KA 4N0UE 3GJFK 4QHMA 4PRHE 1GGBH 1XGTB 2XFXB 3C5ZB 4G3YH 5JA8B 1JRHH 1FNAA 1JCKA 5F3BA 4I0PA 5HGBA 4PGJA 3HPJA 3CD4A 4AENB 1CFQB 3ZYZA 5KZCD 4RBPH 4ZYKA 1YEEL 5L2KB 2V2TB 5ABDE 1IGIH 3SPVA 5DJXA 3SJVD 3NPSC 4PJ8B 3CK0H 3HNSH 3CZFB 5CLTA 4U1JA 1RZIB 1ZHBA 1AR2A 3NABH 3PQYD 1CG9A 5FB8A 3FB7B 5JIIA 4JFQB 1IGFL 4KVNL 4UDTB 3LEXB 4Y2OA 3SOBL 3WEXA 2CK2A 1ZHLA 2X4RB 5L9DL 4W4NA 1T1WA 4GMSL 3O3DA 2ED8A 3JV6A 3ARGA 1JPFB 4RGND 3L5HA 4KKCD 2AJSL 1DBBL 3B9KB 5L2JA 1MF2H 3OQ3B 3L5JA 2DM7A 1OGAD 3TVMA 1ZANH 5EZOL 4J3OC 4F57L 2PXYC 2C4FU 4H25B 3WNNA 3O3UN 3R0MA 2ZUUA 4Z7UB 4PY7A 1S7QB 4JB9L 3S7GA 5F9JB 3TZVA 4HGMA 4R4BB 2BVOA 4JFFA 1JE6A 4XNZC 5ILTH 3HI5L 3STBA 1W0VB 3G6JB 4C59B 1JFQL 1P53A 3U0PA 3RI5F 5FA4A 4QEGA 4NN6B 3T0EA 3LH2H 4KC3B 1QSFD 1UJ3B 5D1QD 2I9TA 1U36A 4JRXA 4Z0XA 4NQDD 5F1OB 4M93B 4M8QB 4K94C 5DD5L 1K5NB 4KJYA 1OTSC 4Q7DA 2N1KA 4Z78A 3L3GA 1EO8L 1XIWC 3J7HA 5I1DB 5IBUB 4MHHG 3TYGL 3WS3B 2IH3A 1D5ZA 2FH6A 1CCZA 1YNTA 3S35L 1TJGL 4PRIB 4IBLT 3UTSE 1G7PB 3KHQA 5EBWB 3CDFA 4MB5A 1S7RB 1ED3B 3K46A 5D2LF 2CDEB 5ANME 5GS2H 5FV2A 3ZLQC 1YQVL 2EE3A 4KI5C 1MNUH 3LY6A 5JHDE 2ZCHL 2GJJA 4DUWA 2VLRB 4ZS7L 5IVXA 5KVFH 1HQ4A 3EYFA 1HI6B 3U4EB 1TZGH 2MQCA 3ARBD 2AV7B 4PG2C 5KSBE 1PG7H 1ERNA 4BQCA 2AJZA 5E8OB 4YDIH 1INEH 3L3IA 5DGRA 1RSFA 1YEGL 3DYPA 3P11L 3QWOB 4A6YA 1IZJA 4G43B 5TDOA 4BFIB 3UJJL 2X44D 2R4SH 4GW1A 1GH7A 1A6VH 3QI9B 3Q1SH 3UBXI 2XACC 2GKIA 4IRSD 2CGRH 4KDTC 3SE9H 3VFNB 4KFZC 3AS3A 3GSRB 1YUHB 3IDJB 4X8JA 4OJFL 4ENED 1S7VA 1JHLL 2FNBA 4PJBB 2LV4A 1A1MB 4HPYL 3AMLA 2FATL 2Z92A 1XF3A 3LHPL 4L3AA 5GGUB 2NY5H 2HT3C 4OZHA 4M4PA 3O0RH 4YJZL 5HGHA 3I75B 2PW2B 1I4FB 5FHAL 1NCBL 1KIRA 3IXAB 3H9SE 4ZXBB 2VXTL 3VD9A 1CQYA 3GSNL 3LDBC 5I8EA 1XF5A 1CL7H 1Z3GL 3SJVA 4K71B 1CICD 1SHMA 3WE6A 4CN4A 3GNML 3D48R 4M4RA 1WEJH 3VFOA 1AQKH 1A21A 3PQYA 5D2NB 2DBLH 3QCTL 2BVTA 1U92B 1NCAL 1PKQB 3QZWA 3WBDA 1OP3H 4AIXA 1WCQA 3MLPA 1QYGL 4HIIB 2CRYA 1EV2E 1XF4B 4IIQB 1K8IB 3RFZC 1MIEH 3MRMA 2GITB 1IEBA 5B8CB 4FXGA 1Q0YH 3KDMB 2XWBB 2V7NB 4LOUD 5B21A 5IFJB 1I1RA 5IESL 4ZAKC 2P5ED 5IMOA 5EPMB 4YHMH 2DTMH 4GKNB 5SV3A 4G8GD 2YSSB 3QA3B 4MD5A 3KNBB 3SKMB 4KQ3H 5IGXH 2FJGA 1U58B 4AT6A 2X70B 2XI9A 4M5ZH 1WCBB 1OM3L 1IEAB 3X3GL 5INDB 1ADQA 2ZNXA 4KK8D 4MLSA 1A6ZA 1WUNT 2DQIH 3OWEA 1QSFA 1I9IL 2PO6D 5D1QA 2CJUH 2YPLD 4YUEH 3VH8G 4NQDA 5DJZB 2BY1A 3ALPA 1AGEA 12E8H 1FL3A 3D39D 3DX8A 2QKIB 5ALBH 3T0WA 4N5EC 1BPVA 5C0FB 3BWUC 5GRJH 3T2NL 4I5BB 3WFHA 1HHIA 2W60A 3KR3L 4BSWB 1YDPB 1T3FB 5KVEL 5K33A 1Q9WA 2X1WL 4JKPH 1LNUB 3TH4T 3NFNB 1NKRA 3F62A 4JVWA 2WBJD 1UZ8A 5I18H 2J88H 1SJHB 2FO4B 3BZEB 2J4WH 4P57A 4JHWH 1Z5LB 1QA9A 4PRHB 4F7TB 2CDFB 3N85H 3PWLA 1YEIL 4WW1A 1FCCA 4GS7B 5E8EA 1PY4A 4X4MA 3MV8D 2DQHH 1BAFL 1U8LA 4FQPA 2EC9U 4M6ML 4TVPL 1QBBA 4RFOL 5JMRA 4PJCF 1FVCA 4YPGB 1OP3K 3UPCA 1P6AB 5I1AB 1PD6A 2D7MA 4NO2B 5KVDL 3FL7A 1M6OB 4XPBH 3WFCL 4POZC 1TQBB 4PRPD 3X14B 4YHOH 3MOAL 4WFHD 1J05B 3BAEH 4XAWL 3VFUB 1FFNA 3NZHL 2Y6SC 2OR9H 4IRSA 4QCIA 2P5WE 1VGKA 5FO9B 1PJ9A 2C4FT 1ZTXL 5IW1A 2EH7H 5D7KD 2P43B 4XVJL 3FQWA 2NYYC 2H1PH 1DE4A 3CFCL 4AQ1B 3VRIB 1HXMA 3D85D 1B9ZA 4JHZA 3I3BA 3MUGB 1H15A 4H1LB 3IXTA 4LF3B 1NFIB 3KWWA 1UXWB 2VQUA 3FQUB 4N9GA 2Z0BA 3QIWB 5BO1H 4G6KL 2YPVL 5MEND 1S5IL 2VR9A 3GSXA 4RISH 2NY5C 3S34L 2E8ZA 1BVLB 4DEPC 4D9QE 2VDRL 3BI9X 3CX5K 1MPAH 2IEPA 3EO9L 4XPAH 3TBSA 3IFNH 2NY1C 3BPNB 1BQHB 3C60D 3G08A 3DUSB 5DRNB 4WI8A 2HJFA 3KPSD 2UV3A 4NQEE 4DCQB 1X6NA 4N1EA 2F8OA 1YEDB 4ONHB 2RFXA 3UX9B 3FQXA 5TQ2H 4I77L 4LCIH 5DZLA 1F58H 3VJ6A 3D3VA 1OQXA 1G0YR 1J11A 3SKNA 4MS8C 1MJJB 3UROR 1AGFB 3RVVC 2EH8L 5D5MB 4KUZH 4MA3B 3P77B 4FTVA 2CIIA 2P5EA 3UTSB 4O51B 3VFPA 3ULUD 1HHJA 1W72B 4K9EH 5TE7H 5FUCC 2NQCA 4YWGL 3EYVB 5T1LB 3VXSB 2NNAB 5FYLL 4RAVA 2ZSVA 4LKCA 5DRZB 1INQB 3VWKB 2X7LA 1MQKL 2K9UA 5BS0D 1GXEA 5KSBB 3CLFL 5CMAA 1TPXC 1N7MH 1E27B 1HIMH 1WQVT 5HJ3B 3FT3A 4FFVC 4NZDA 1IGCH 4Y4FD 2PO6A 2RCSH 3MSPA 3RNKB 1N4XH 1BVKA 1GZPA 2YPLA 1F3JA 1U3HA 3L1OH 1I85A 1RZ7H 1H8OA 1KJ2A 4RMTA 3VU2A 5HHMD 4HEME 2LFGA 4F9LA 3QYCA 1MRCL 1HNFA 3ULVD 4HLZG 3MXVL 2DQGL 2AXHA 1T66D 3E2HB 3OKKB 3GKZA 1RK0A 4MJIE 4R90L 3HG1A 5DI8B 5DMGD 4H0GA 2LQRA 1A9EA 2X4OA 3KYNA 3V5HA 3VGGA 2W0LA 2HVJA 4E42B 2AP2A 2VLLA 3LB6C 2WBJA 4QTHB 3OAZH 4OCSL 5FM5O 5KS9B 4PJ7A 5T1KD 1MEXH 2XXMB 3TV3H 4X99A 4TRPH 4KRPD 4KQ4H 4UV4L 3MO1B 3QUZC 4MXWL 3MV8A 1AIFB 1WIPA 4FQXD 1RIHL 2D4DA 5ID1A 4J6RH 4UILH 1I1FB 3H9SB 2X5PA 3QHZH 3H9HA 5JR1H 4NHUA 4TN9A 4NQVB 4P23D 4NP4L 1PG7W 1XCTA 2VR4A 3OR7A 4QHUA 1OTUC 4OD1H 4K3DL 4PRPA 4RDQF 1DQDL 3WO4B 1QBMH 4ETQB 3QQ3B 2R0WL 2W0FB 4MA7H 5TDPA 2XOTA 1MAJA 1KTLB 4YPJA 2FR4B 5HDLA 5HYSB 4L4JA 4LSUL 3MODL 2JK5A 4Y16B 1A47A 3WJLC 3D85A 1G84A 5E00A 1S9YA 1JUFA 2HVKA 2DJSA 3F12A 1E28B 1ZVSB 3LD8C 2BMKA 4ZTPH 4Q0XH 1C16B 5CGTA 1NFDF 2OMNA 5TF1H 1L6XA 2XKNB 2BVPA 5GGSY 1I1AA 2R23A 5AG9A 3R06B 2VJXA 1QO3B 1PVHA 1WWAX 4LKXB 1L7TL 5FYKL 5KTEL 5LGJA 3WS6A 3C60A 2D03L 4DKEL 1W2KT 1KLGA 1JHKH 2BC4B 3KPSA 5C0CA 3GMOA 3OAZK 1A0QL 5E99H 5FKAB 3S3JA 2J12B 3P73B 5EOQL 4WUUE 1TQCC 3MJ8B 5GSRB 3LN4B 3V6ZB 3LVEA 2OTUA 4BH8A 1NDMA 5EORH 5IVOA 4HX1A 5HI4C 4GFTB 1YC7A 1D9KD 3BDXA 3UTTB 1A6AA 2M1KA 4DOHE 3OHXA 2Q76A 5J4MA 1X4YA 2EC9T 4R7DA 4MD0A 1GOFA 1FIGL 4G9FE 4R4ND 4WO4B 1CXHA 3RJDA 2C1PA 1BGXH 4K9EC 5BS0A 1S78C 4K7PL 4X9IA 4NKQB 1R5VA 3PGFL 4LCYB 5CZXD 4BJLA 2O5ZH 4G8EB 1DQLH 5DURD 3UPRB 1I1CA 4OM0L 5IHZB 4X98B 2HJLA 2OBGA 1I9RL 2J5LB 2Y72A 3FQRB 3SO3C 2WZPD 1TLKA 2Z93B 4Z8FH 4LSDA 4PLKD 5DSCB 3BO8A 5IHBA 5EUKB 1IC5H 1B0WA 4F7EB 4JZJB 1KXQE 4G42B 3OX8A 2D9QB 5E2WL 2P5WB 1I3GL 3TJEL 1F2XK 1A6TB 3KS0J 4WHTA 1FFOA 1A2YA 3FO2B 2MCG1 3ZT6A 5ICXA 4AL8L 4HGWA 4QKXB 1RJYA 1XMWA 3QUYD 3HB3D 5A2IH 2ORBL 3PDDA 4P5TB 1J7VR 3BQUB 3OXRB 5KSVA 3P4LA 1ZV5A 3NAAH 5H94B 1HSAA 2VERN 3CSPA 4EN3B 3O6FD 1CS6A 1E4KA 5CJOH 2AAVA 3UJIH 4X9BA 3VXPA 4ZS6D 4O58H 2NY6D 3S9DB 3P4OB 4FQXA 5DS8A 4AH2B 4AZ8A 5IBTL 3BP6A 4TOYL 2GTWB 3IFPB 4AMKL 1NAKL 4ELKA 5IHUH 5DFWH 4KMTH 1RFDH 3GMQB 3QP3A 1LGVA 4P23A 1URLA 4OCNC 1UM5L 3RHWK 5DMKA 4ZSOA 4XH2A 1AP2B 4ZO9A 3D9AH 1VACA 4EXPX 1QFPA 4XPHL 1OAZH 2C5DC 3GBNH 4OF3A 1E4WH 3T2OA 3NA4A 1MI5B 4NZUL 4NC1E 2XN9D 2DM2A 1VB9A 4HKBB 3JWNC 1IT9H 1GAFL 2Y7QA 3HHRB 3BUTA 2IF7A 4G8IB 6CGTA 1F45A 3ZTNH 4MJ6B 4LVEA 4OM1L 1NCWL 1EGJA 1UVQB 4L3EB 4QRUA 3MBXL 3GSVA 4UOJA 3JVGC 4TTDD 2E6JA 3HAEG 4ODWA 3CIQA 1BLNA 1NGWB 5F21B 3B3IB 5I1KL 3QBTB 2B1AL 3ISWA 1M7DB 5GQBA 3NN8A 1CDHA 1EIBA 1R3KA 3P0YL 3SKJH 5D7SH 3K2MC 4L29A 1CFTB 3DROB 4HC1A 2OM5A 3H7BB 5EBLA 4LK4A 1RZJL 3KLAA 3T4YA 5DDHB 1QP1A 2QADD 3U36B 1PGRB 4CN6A 5FCSH 3M8OL 35C8L 4YH6A 4GMTH 1LO4H 4QHLB 4NUGL 2CK0H 5LG1A 3PWPD 4WV1A 2VL5B 2NY0B 4ZD3H 4LLVA 3ZKMC 1CFVL 3GIZH 3OXSB 5K9KA 4R2GD 2HFFA 3B9DA 3ZSSA 5IWLA 3KJ4C 3FAXA 2BNQB 3M07A 4JJ5B 3I50H 2W9LA 4LGRB 1HHHA 3DVNA 5EBGA 3PDGA 2ZPKL 4YE4H 4FQ1L 4N8CL 4WENB 1UM6L 5E4IA 4P46D 4BH7A 4PB9H 2QHRL 5J1AA 5D7JA 2FX9L 5C0RH 4ZPTB 3QXAB 4CADB 1I1YB 2A38A 1MHEB 2YD3A 1AGCA 1NMBH 3IF1A 3MLXL 5KBNC 4D9RD 1GRWA 2LU7A 3I6KB 5I1EH 5KAQG 1T04A 1DQJB 4Y5XC 2X9XA 3MRIA 3QHFL 3S6CA 2XPGA 4IRJB 1U8HA 4RGMB 4XP9H 2G60H 3W81A 4X6DF 4NZTH 1ZGLB 5TPWH 5FUOL 2NCMA 4QTIL 4A6YH 2K7PA 3Q6GH 2OX5A 3BP5A 3VH8B 5DJAB 2YXFA 1A6UH 1AKJB 4C56A 5HHOE 1VEPA 3AC0A 5FA3A 3CDCA 3QH3A 4ODVH 1CI5A 2IQAA 5ALCH 2JB6B 3QUYA 2FHCA 4L9LB 3T2QA 1WAAA 5F7LB 3SDCB 5FOBB 3OKOA 5A1AA 3P4NB 4JN2A 1F4YL 5IUSA 4X80L 4XNXL 5J11B 3BKJL 4WCYH 4YIQB 4GG8B 1MH5A 3O6FA 1A22B 4NQXA 3GMPB 2VLJD 3T4AA 2UYLA 4LCCC 3SBWC 4LSPL 4U1KB 4MCYB 4PJFF 3SDAC 4PLOB 4PJHB 1U8JB 5F3HA 2R2BB 5FDWB 3LZFH 3S98A 3A67H 5BOZG 1U6AH 3QXVA 3FOLA 3ROLB 3K2UH 1NGQH 2I25N 3SHSA 2ZUWA 5E2VL 1RZGB 1FJ1B 2AXGA 4NT6B 4XCEB 5JXED 2XG5A 3RL1A 4AEEA 3REWB 2X4QA 4I0PC 2XN9A 1TVBA 4WUUB 4APQD 4I4WA 3W82A 3P30L 3U30C 5ICYB 2IAMA 3QFDB 4HXBH 1I8KB 2H8PB 1FH5H 1HQRA 4YEEA 5ERWB 4DOHB 3LKOB 4WFGD 1T20A 3OR6A 2P42B 4G9FB 2ZUYA 3PV6B 3ZDZE 5TQ0H 1M7IA 3DSFL 2N56A 5DLMH 2EYRA 2A1WH 4S1RL 4JGUA 4FRWA 5IM7A 3MV9D 3C8DA 4UBDD 3CDGA 1HH9A 3BH8A 3ARGC 5ECJE 1TNNA 4FHBD 1S5HA 3TC9A 2CKNA 2HLAA 3UYRL 3TBTB 4J3TA 2D31A 3STLA 3TVMC 2OP4H 1LILA 3UJTH 3NFPB 3F7VB 1OCWL 1KPUA 3QJHB 5C6TH 5IEHA 4OZGA 1ZEAL 2EYTB 4WNQA 2CR6A 1R24B 1ADQH 1B6UA 5EC1B 3TZVC 4B41A 5BZDB 2YPKA 4NPYB 1RUAH 3S3SA 1U8NA 1DUYB 4NBXB 2WBWB 3O4OB 3BPCB 4ZTOH 2RGSA 1EEZB 4TVPD 3P4MA 4UUJA 1UWEL 3T0EC 2BNRD 3MOBL 2NTFA 1KB9J 2UVEA 3VXUB 4YGVB 1OAKL 3BZ4A 2Z91A 4U6YA 5BVJB 4LL9A 5I75B 4M62H 1RMFH 2LTQC 4W81A 3MROA 5HDQL 5C86A 4P46A 2PF6A 4HS6B 2YRLA 1L7IH 4OI9A 1IQWL 4KU1A 4CVXB 3TBYB 4NKOB 3HZKB 4M9PA 1MRDH 1UT9A 1CGSH 4M61B 4LLMA 3ME0A 5ESAB 3W2DH 1IM3B 3PHSA 4HWZA 1I75A 2BDNL 4UT9H 4LLWB 4TUKH 5DJYA 5B22A 1G9MH 2EE2A 3VFMA 3L3DB 3HLAB 3A6CH 2Z8WC 5E8PA 2GSGB 5HHNB 3NIFE 3V0VA 3GJFB 3WL9B 2HKFL 4OGAD 2MNUA 1KBGL 1WT5A 4UV7H 4ZPVA 3UAJD 3V4VH 5E6ZA 4X6FB 1NKOA 3JXAA 2HJKA 3Q5YA 2A6IB 1RQ5A 2C7UA 3BEVA 4S0TD 4UT6L 3C08L 3GSNA 3IFLL 4UINH 4MNHA 3CSYA 4IM8A 4P99A 1A7RL 2D7TH 1FYTE 4EIZC 2BJMH 4DGYL 4NRYB 2CIKA 3U82B 2VN4A 3HC0B 3PWNA 2IADB 3T1WA 2VLJA 3BYTA 2P1YA 4M7LT 2ZUXA 2DQTL 4KI1A 4S1SL 2FECL 2QSCL 1CDUA 1FG2B 1P7HL 3LEVH 1ZHKA 1RK1B 4LSTL 3ARRA 1HINH 3WHE1 4PRBA 3RUGF 2VUOA 4ZUTB 3T0VA 2V2WA 3C5ZD 3QIBA 1AC0A 4KPHL 1LO0H 5F1IB 1NLBL 1ZWIA 5HYQB 4E41E 5FYLD 4MA1B 2A83A 3V7AG 4DGIH 4L3CA 4APQA 3OKLB 1FV1B 2WMPA 3TT3H 4U1MB 4PJ8D 5I6XC 5E8NB 3DX7A 2D7PA 3RX8A 3BP7B 4PJIF 4JFDB 2YK1L 4NC2B 5IJVA 4NM4H 2YZ8A 3RWEB 3RTQD 5IFHL 1NBYA 5CD5D 1S7UB 5F96L 1NC4B 3QNYA 2YD5A 4UIMB 3MV9A 3ZDXE 3JV0A 4TULL 4HUUA 4KZDH 4KTYA 2IAND 3O45B 4QYOB 1JTPA 3H2WA 4AIOA 1CXKA 2ADJA 3VW3L 3IAQA 4HMDA 3HE6D 4PB0L 2GFBB 4P49A 4RAUB 3L7EA 3E8UL 5EOTB 4XCCH 5IV2B 2BOCA 2LAGB 4D0DA 1IE5A 4LHUG 1PAMA 3N0PB 5JUEL 4LEXH 2BSRB 2Y9RT 3ULSB 5LKNA 3O11A 5C09E 2G75B 4HS8L 1L9MA 2IBGA 3C6LD 1AD0B 4OLUH 4Y5YA 4CL7A 1AGBB 3GSQA 4Z7VE 5HHOB 1R3JA 1KJ2H 2BNRA 1XGUB 1KG0A 5ESQB 3LS5H 3LRSA 2R4RL 3OPZL 4KJQC 1QR1A 1RUKL 3K4DA 5JLZA 3ZKNC 2GCYB 1BBDL 2BZDA 5DJ2A 3FO9B 3RVUD 5L0QB 3DHMA 1W8NA 4GSDL 2JB5L 3UTZB 4AEFA 1RULL 4AEIL 3LN5B 4OGZA 5C0AA 4PRID 4QOKA 2X4SB 5FOJA 2P45B 1N6UA 4LPYA 15C8H 4KROC 4XPGH 1J1XH 3PHOA 2HG5A 5DVKA 5F1SA 1IAOA 1IAKA 3VI3F 4FS0A 2VLRD 1MFEH 1KB5L 3CXHJ 4HFWA 5I30H 3G5YB 4Q6IB 3I3EA 4OGXL 1BOGB 2QV2A 5KW9L 2F5BH 1HDMB 3NACL 4O9HH 5F9DC 4OBSA 1G9MC 2QL1A 4JQVA 3H8NA 1S9WB 1D5IH 3QEUB 5FYKD 4RSVA 4U2YA 3WFBL 3W0WA 3RWHB 3CC5B 5FF6A 4L8DB 1INDH 5DJ8A 4IRSC 1D7FA 1OAUH 3I85A 5IMMB 2DWEA 4F9PA 2PYEE 3AS1A 5GJTH 4FQQB 4P3DB 1H0DB 2KBGA 4ENEC 3RPIA 3W5MA 2H6PB 1PZUB 4YFLF 5L7XH 1OT1A 2P7TA 4N0RA 5B38A 3AB0B 4P4RB 3KPOB 1EFXB 1NBZB 2OI9C 4P2QE 4YC2C 1FL6B 4OIBA 5JW4Q 1Y6KR 2NY2B 1XGTA 2XFXA 3C5ZA 4OKVA 4Q2ZB 1KF9B 1U95A 3PXHA 2BSTB 2N7BA 2BFVH 4LCWB 1CDJA 3QHTC 3PWVB 4X7CC 3IDYC 1CFQA 4ZXBD 1RZKH 4Z76B 1JJUA 4PJ8A 2Q87A 3CZFA 4ELME 2X4UB 3DRTA 3FB7A 1CGXA 4JFQA 1O7SA 3RTQA 4UDTA 4PD4K 3LEXA 2EECA 1NANH 4H8WL 1T80A 2WP3O 2X4RA 4MB4A 4LFHG 4FQIH 1J8KA 5I8CB 3LMJH 4G5ZH 3U4BH 5CJ5A 3ULUH 1MFBL 2DQEL 2IANA 3MLSH 3B9KA 1MHPL 5C71A 3BGMB 4YHLH 3WNKA 3HAEB 4LOUC 2XA3A 1U91B 4G6AD 2VDNH 1QRNE 5HDBE 4HDIA 3O8XB 4XNUH 3HNVH 4H25A 1QR4A 1NCNA 3SE8H 3Q0HA 5HHVL 1S7QA 5F9JA 3TPUA 4NWUH 2IG2H 4R4BA 3MMEB 4O5LH 3MRLB 3VXRB 5DD1H 1FVEB 5JDSA 1W0VA 3G6JA 4I48B 3J8F7 4KK8C 3LAFA 3C6LA 3N1QC 1TJIH 3L95B 5C07E 1UJ3A 2PO6C 4PJAB 1GOGA 3KAAA 5I74C 3ULVH 1U3HC 3F7RA 1BIHA 3I02B 4M8QA 1FYTB 1I85C 1K5NA 2XKSA 5GZND 4F9LC 5I1DA 1XGYH 3WCYA 3WS3A 2JIXD 1HNGA 5C0BB 1RI8A 3TGXA 4JFPB 3KGRA 4BFBD 2EDDA 1EH9A 4EEEA 7FABH 5FK9A 5CILL 5EWIH 4PRIA 4P9MH 2J7LA 3SO5A 1G7PA 4C55A 5EBWA 5GHWH 3QCUL 1ED3A 2CDEA 4IS6B 1ACZA 2J6EL 2WBJC 1QACA 3O2VH 4PRHD 5GGSB 2VLRA 1X4ZA 2FB4L 3HC3H 1I9JH 5F72S 3BH9B 4E41B 2E27H 1DR9A 2ADIB 4ZFOL 5T5FL 4LBEB 3GGWB 5E8OA 3K7UA 4KMQA 1EO5A 4MXVE 2Y5TB 2J8OA 2RHEA 2A77L 1A7NL 5JXAH 4U6VH 2Q7NA 4BFIA 4X83A 4Z77B 1FNGB 1AR1D 2P4AB 3JWDL 3KYAA 1C12B 2WWKO 4S2SB 4TQEL 3QI9A 3WLWC 3D69B 4E5XA 3VFNA 3NPZB 1OB1B 3GSRA 1EGJH 2AJVH 3KXFB 3QUZB 4PJGE 2DD8H 4OLYL 4K3EL 3IDJA 1PSKL 1NAMB 1Q9KB 1D6VH 2WQRA 4PJBA 2BOBA 3DXAE 3K1KC 2GQHA 3I9GL 1NLDH 1ZGLP 2XZCL 1FZKA 5DTFB 4KK5C 4IMLB 4S1QH 1CK0H 3LQAH 5GGUA 5GS0L 1CE1L 4PJDB 5EH1A 5L8JB 2OSLA 4K07A 5T3XE 3I75A 1QBLL 3IDNB 4HC1H 3V9FA 1I4FA 4ZXBA 1DBJH 2VXSL 1LDPH 3CLEH 2V5YA 1I1AC 4EI6A 4HAGA 1CIUA 2F8VA 1N0LA 5EO9A 3WS6C 3C60C 3HZMB 3QZWG 1RZKC 3BGFB 2XICA 1NCUA 1TFHA 3NFSH 2W59A 3BHBB 1HHKB 4PBWD 3V4UL 1U8OB 4FQ2H 1BBJB 4YHKH 5T33H 1AH1A 1CLZH 2EE6A 1U92A 2J8UB 5I16B 5K59F 3OZ9H 4AEHH 4IIQA 1K8IA 1DFBL 2A9ML 2B0SL 2GITA 5AAWA 3RIAK 3KDMA 2XWBA 2V7NA 3CXDL 1M7XA 5KG9B 5IFJA 4EXKA 4LRNL 4FXLA 3UTSD 1MLCA 4WDIB 1J1PH 4GKNA 5J0BA 3ULUC 1I3VA 2YSSA 1JWMB 1UWXH 3ARVA 3KNBA 3SDXE 4WW2A 5JHDD 3SKMA 3ZDYF 1U58A 5CUSH 1NGYB 4IDLA 4FFWC 2X70A 2VDOH 2E9IA 2DQFB 1IEAA 4FXKA 5INDA 2GHWB 3HUJE 2FX7H 2H2SD 2ZOKB 3DVGB 2CUMA 3L7FB 5LVEA 2JJWA 3QFJE 3UTOA 1DL7H 4Y89A 2B1HL 3P0GB 4ZUWA 1HHGB 3SCMD 4QT5B 4WJ5A 1JYXA 2QKIA 3ULVC 1T66C 3MJ9L 1OLLA 1YEEH 1Y6MR 4I5BA 3BDYH 5DMGC 4MNQE 4NOFA 1YDPA 4HK0B 1LNUA 5C0NC 4GG6E 3NFNA 1BZQK 4JDVB 5IW6B 3DJ9A 3NOIA 1SJHA 5SWSE 1IGFH 4KVNH 3BZEA 3EYOB 3SOBH 1Z5LA 4PRHA 1JF6A 4F7TA 5D70L 2CDFA 4JRYE 1T5WB 5L9DH 5EUOB 4KRPC 4GMSH 1E4KC 3VGHA 1RAMA 4LSSL 2AJSH 4FQXC 1GOHA 4LVHC 4Y1AE 3H9SD 1DBBH 3MRDB 4EOWL 4KRLB 3SDDB 5FGSA 5I1AA 1NMCC 4KY1L 2R1WB 5EZOH 3U0TB 1QPPA 4P23C 4ELMB 4NO2A 4F57H 5DHXB 5DC4B 1M6OA 3O4LE 1IGTB 3UBXG 3X14A 1DBML 2ENYA 1O5DT 1L0XA 2Q8AL 5GGRB 4C54A 1N8ZA 2CH8A 1DDHA 4JB9H 43CAB 3VFUA 4J3XA 4HMCA 5FO9A 2E6QA 3BVNA 3HI5H 2OTWA 1JFQH 1EJOL 5CAYB 5GGQL 4U31A 3RWIA 2ZG1A 1MCWW 1YMME 4YX2L 4OFPA 4Y16D 2PUQT 3VRIA 4P5KA 1UENA 1NCCL 4J3VA 3GUTA 3VI4F 4LF3A 1NFIA 1EO8H 4LPCA 3T0XA 3E6HB 3FKUS 2VZOA 4PJXF 3TYGH 3OKNB 4H5SB 2MMXA 2IC2A 3LQAC 4P59L 2NLJB 5JDJA 3S35H 1BVLA 1TJGH 2OCFD 2W92A 4RFNC 1BQHA 5IMLB 3DUSA 4TSAL 1LP9B 1YQVH 4LHQB 4WEUD 5C07B 4DAGL 2ZCHH 3SGDI 2NR6D 4YDLC 4DCQA 4ZS7H 2R2CA 1Q1JL 3D0VB 1VADB 4NOBA 1YEDA 4ONHA 2X9YA 3RBGA 1WBYA 3IDXL 1WFOA 2FJFB 5ETUB 4ZUVA 2K3TA 2RQ8A 3FN3A 4WV1C 1MJJA 5F97E 4NFCA 4WU7B 4Z7NE 1XH3B 1YEGH 3ESVF 3DYMA 3P11H 5D5MA 5HVGB 4BK5A 2DQDL 1I7UB 4MA3A 3VFRA 3P77A 5IWLC 4DFIA 4JY6B 3UTSA 4WEMB 3VXOB 3UJJH 5ANMA 4PJ5E 5I2IB 2V5SA 3UZVB 5JHDA 3EYVA 1B6DA 4WO4D 3VXSA 4OZIF 1H3XA 2AKRB 2HTKD 2NNAA 1WBXB 2B4CL 1EZVY 4WY7L 3TO2B 5DRZA 5J3HD 3KPRB 4BFGA 2AK1H 4NYLB 5D7JC 5CZXC 4IHOB 4ZUSB 5KSBA 1E27A 4OJFH 1CFBA 1JHLH 4N1HB 1QSVA 3CFEB 4GRLB 2FECI 2GYSA 3RNKA 4HPYH 3RBSA 2FATH 3LHPH 4R26L 4W6XB 5KN5B 2KZ1B 1U8PB 4PLKC 4PPTA 5KSAB 5FHAH 4D2NA 1NCBH 3LKNB 5SX5H 2P5WD 3OKKA 2VXTH 2VNCA 3DYOA 3GSNH 2X2YA 1Z3GH 4XVTL 3BESR 3GNMH 3GDBA 3IJSA 4E42A 4QTHA 1MELA 3QUYC 1OGAE 4RGOL 3QCTH 4EN3D 5T5NG 1NCAH 3MO1A 5FM5M 5ADOL 1QYGH 1AIFA 3CDYA 2XWJB 4QRRE 2NY6C 3C9NB 3DETD 5F6IB 1I1FA 3TCLB 3H9SA 4ZOBA 3ZE0F 4D9QD 2Z31B 3TLRA 5IESH 3PP4L 5HVHC 4DWHA 1YPZB 1WV7T 3KHOA 3CFBB 4NQED 5D71L 4ETQA 4OUOA 1T5XB 1C1EL 2W0FA 4Z7UF 1RZ8B 2OXGA 1OM3H 2KKQA 3VFTB 3X3GH 3X11B 3MXWL 1X5JA 4U1IB 2R29L 2H32B 2FR4A 5D7IE 5HYSA 1I9IH 4Y16A 2WWMD 4C83B 3HNTL 5JIKA 2IAMC 4JQXC 4GLRH 4CW1B 3RKDD 4YBQD 3T3ME 2JCCB 1A4JB 4TTDC 5HI3D 4EIGB 1E28A 1ZVSA 2AEIT 1C16A 1A4KB 1X5ZA 2XKNA 4GRWH 4XXDB 5ID0A 1UM4L 2YXMA 3DX9B 3T2NH 1KCVL 4HT1L 1E6JL 1BHGA 3R06A 1T4KA 3MJ6A 4OT1L 1QO3A 2AEWA 3KR3H 5HGBB 5KVEH 2COQA 1WFNA 4A2MA 3QFJB 4ZYKB 3UDWA 4F7PB 1F00I 3SPVB 2BC4A 4LP4A 2WBKA 3QDJE 1YNLL 2NW3A 1GGCL 2QADC 1YEIH 2W07A 3BZFB 3HS0B 4YHZL 5FKAA 4FQLL 1BAFH 3QQ9D 1LEGB 3QUKB 3DSNA 1DBKL 4M6MH 4O4YL 4TVPH 3TBVB 3RWCB 4RFOH 1ZHLB 5GSRA 4NJAL 4MJID 4R2GC 1T1WB 3O3DB 4PRDB 4XP6L 3JV6B 1OAYL 4MNQB 3UTTA 3ARGB 1CU4L 4LGSB 4HJ0D 5KVDH 2QSQA 3QEGL 2BRQA 3ARDD 3V95A 3PXJA 3MOAH 3V2AR 4WO4A 2EDOA 4H0HB 3V6FB 4XAWH 3NZHH 2V5TA 4DGVL 4JRYB 3JWOC 5CJ8A 3O9WB 4P46C 4CGTA 4XRCB 1ZTXH 3U1SL 4M6OL 1P1ZA 3DTXB 1YYLL 4XVJH 3UPRA 1W0WB 3GHEH 3TZVB 1LDSA 2HRPL 4OCMC 3CFCH 4X98A 1M71A 5DVMA 1J86A 1UGNA 3VMNA 1RIUH 4U0RC 5E7FA 3TP4A 1W0YT 3FQRA 1H3TA 2J8HA 3CMGA 3A6BL 2BVYA 2YKLL 2JF1A 1F3DJ 3S4SA 5FYKU 5DJ6B 5DSCA 5EUKA 4F7EA 4JRXB 4IRJD 3TWCL 4JZJA 4G6KH 4G42A 1MCOL 3KS0H 1S5IH 1T1XA 4LU5L 2P5WA 4KJYB 1AE6L 3S34H 3UTPE 1ZLWH 2VDRH 3L3GB 4IRZL 1WT5C 2F58L 3EO9H 3FO2A 3GMLB 3RQ3A 3LKPB 1K3IA 1YNTB 1XFPA 2IPTL 1AO7B 1PG7X 4G6FD 3VWJB 3OXRA 1YY9D 2CRIA 3U83A 5H94A 2DLIA 1AHWB 5HGDB 4I77H 4EN3A 1KLUB 2VUYA 3HE7D 2ZUQC 4HQQL 4AH2A 1HQ4B 1ETZB 1JZ5A 4W6WB 4N90E 2EH8H 3IFPA 4GAGL 4M7KL 3GMQA 2CD0A 4AG4L 4AY0A 3HRPA 2FLBT 3L3IB 1C8PA 1AP2A 1NGPL 2ENSA 4YWGH 2BNUB 1RU9L 3ZYIA 3DLQR 5F9WC 3QIBC 1IAIL 1KYOK 1MQKH 5TDOB 3DNKA 2EC8A 2ZUTA 3CLFH 4Z7VF 2WW8A 4HKBA 2D0HA 4WUUD 2CR3A 1BFVL 4APQC 2BCKB 3PGDB 4WI3A 4MJ6A 1MCIA 1LVEA 3NGBC 1UVQA 3QAZB 1VERA 4JPWL 3VG9C 4FMFA 1S7VB 4PLNC 3ZTJH 25C8L 1TENA 4G9FD 1U9KA 4V1DE 5EIQA 1MRCH 5DEGB 1FHGA 1ZT7A 1HZHL 2DQGH 1HYSD 3L6FB 1XF2B 2ZOLB 4OZHB 3MLYL 1FL5B 1M7DA 4R90H 1R0AL 4GXVL 4BQ8A 1V5JA 3MLWL 2DM3A 4OLEA 4OFYD 1BM3H 1ZLWK 3HRZA 1E4XL 5D7LE 4OCSH 5CP3A 3U9PL 4WIQA 3I6GB 4UV4H 4MXWH 1SEBB 3RWJA 4R6UA 1C5BL 4PYHA 1RIHH 3UXFA 5DHYA 1KB5A 4OCWL 3OXSA 1BP3B 3S36L 4XP4L 4NP4H 2FL5B 4RGNB 2BNQA 4JJ5A 4Y5YC 1WK0A 1HWGB 5LWYL 3MRMB 4K3DH 3NTCL 4M43L 3MLVL 1DQDH 4HJGB 2H26B 4WI7A 1OGAB 3IETB 3G6AA 2R0WH 5CINL 2ZP0T 3MUY1 4BZYA 1SYSB 4NUJB 2FJGB 4XNMA 2DKUA 3EJZD 4ZOEA 4ZPTA 1EDQA 4PV9B 1H3PL 3QXAA 4CADA 1MHEA 3MODH 3WJJA 3I6KA 4NO0B 1QLFB 2PYFB 1DQJA 1JF1B 1MVUB 1O7VA 5D1QB 4UAOC 4I0KA 1DANU 1I7TB 4TUOA 1YZZA 1B4RA 4IRJA 4NQDB 5GS0D 3DBXB 1X9QA 5DD0L 1FL3B 3DX8B 1LE9A 3UAJC 5DJAA 1L7TH 5FYKH 5KTEH 5LXGL 2D03H 5D7IB 4DKEH 3EOBA 3VG0L 1CGUA 3UO1L 5JW3L 2JB6A 4JQVC 3SDCA 5FOBA 1YECL 3HZYA 4NGHL 2R56L 1HN1A 3MRBA 4WHDA 2HAZA 4UQ2B 4F7CB 1A0QH 4YIQA 1NL0H 4GG8A 3MRQA 4XPTL 3ORJA 5EOQH 3LCYA 4YHYC 4BELD 3GMPA 5I19L 4XGZB 5D9SB 4GBXD 1J5OH 4F2MB 4F9PC 2VQ1B 3OKDB 5E8EB 4U1KA 3ARBB 4MCYA 1H3WM 1U8JA 5FDWA 2R2BA 3FMGL 5KOMC 3ROLA 2C3GA 4YBLC 5JPMB 1FIGH 4CJ1A 4K3GA 1FJ1A 3QDJB 4NT6A 1MHCA 2VLME 3C5ZC 4XCEA 4K7PH 3PGFH 3RZWA 4UT7L 3DURB 3EFFB 2J1KA 4OM0H 4WUUA 5D4QA 1F8TL 4IRSB 1FLRL 4Z7WF 3U0WL 3UBXB 1I9RH 3E3QE 1JZ6A 3OB0K 2ZKHL 2BP3A 5IW1B 4PJ8C 3GJEA 1QRKA 3QFDA 3LKOA 2VISB 2KQNA 4G9FA 5T3XL 1EXUB 2OI9B 3RTQC 1KN4L 5IMKA 3ZT7A 5BZWB 5CD5C 5E2WH 1BIIA 1A8JH 1I3GH 1HILA 3TJEH 5CD3B 1NC4D 3IDUA 3KWWB 3O81A 1JGUL 1KELL 4PTUB 5J8OA 1TTFA 5C0IB 4OFYA 4WGVB 3B9KC 5I73B 4G7VL 2LE9A 4LRIC 1KPVA 4U05A 2ORBH 5IJKA 2APFA 5HY9B 5MI0B 2YA0A 1CICB 1X5HA 3NFPA 5KS9F 3G08B 3QJHA 2KUTA 2EYTA 5T1DL 2J6EA 5EC1A 1WLHA 5IBTH 4TOYH 5BZDA 2EIZA 4NPYA 5E5RB 4ZOAA 1DUYA 1NAKH 4AMKH 3DO3A 4LMQE 3BUYA 4JREB 3BPCA 1V3KA 1AFVH 2YN3A 1UM5H 2ZSWB 3C6LC 3SKNB 4ZFOA 3RIFF 5HHOD 2VXVL 1GIGL 1BD2E 1YC8A 1UJ3C 1SY6L 4OCXL 3O3AB 4XPHH 4YGVA 4WI4A 3QQNA 2P5EB 5BVJA 1I3RB 1UQSB 1MUJB 4M93C 4G8GB 1F90L 4NZUH 3BKCL 3DUUB 1M1SA 4DVRL 4GKOA 4HS6A 3IU3B 3RVUC 5HYEA 1GAFH 4NKOA 5E4EB 3B8SA 4ODHL 3MRPB 3W11C 4OM1H 1NCWH 4M61A 1KOAA 2VO5A 3MBXH 4X9HA 1JTOA 5J56B 1IM3A 5KVGL 4HG4J 1RPQA 2EXYD 2A9NL 2PETA 3T77B 1AXSB 3EZ8A 5I74B 5I1KH 3HLAA 3L3DA 3PV7A 1T0PB 2GSGA 2B1AH 5HHNA 3N1FC 3GJFA 5GISL 3D39B 3P0YH 2XZAL 5E94A 4UU9B 3Q3GB 4X6FA 2EDNA 4LQFL 4P3CL 1RZJH 5F1NB 1JN6B 4JN1L 1RJZB 5K9OB 1A9EB 5I1IL 3M8OH 2XV6B 4LSRL 35C8H 5EA0L 2FHBA 2HYMA 3FONA 4QO1A 4DZ8A 4NRZB 4NUGH 1XAUA 3OMZA 1IQDB 1FGNL 3QI9C 3NCJL 3HC0A 2IADA 3RNQB 5C1MB 1CFVH 5E7BA 2GSIA 1D6EB 2UWEE 2DIBA 4BZ1H 3ARED 4MXQD 1FG2A 1OLZA 1RK1A 5ID1B 2F54E 3F65A 2H41A 1LD9B 1JHTB 2ZPKH 3PE9A 3B2UC 4NHUB 5F70A 1C5CL 4ZUTA 4FQ1H 4N8CH 1O0VA 1UM6H 3OR7B 4P48A 5F1IA 2YMXL 2QHRH 4TTGA 5E0QA 5HYQA 2FX9H 3QDGE 2EIEA 2ZCLL 1PYWB 4KJPC 5AWNL 4ZXBC 3N1MC 4EI5D 1YNKL 5GRYA 5E8NA 4K71C 1IVLA 3BP7A 4UIKL 3EDJA 3VXME 5M95B 3QHFH 2XQBL 2CLRB 3RWEA 1QLEL 2E9BA 4HCRL 1S7UA 1JUFB 3BJ91 2HVKB 5FUOH 1NC4A 4QTIH 5F7KC 2BMKB 3KPPA 5D2LE 2IQ9L 4JCMA 4IIQC 1BQSA 1DANT 3O45A 5MENB 3QXUA 1A7OL 3R8BB 1DVFD 3MJ9A 5FHBL 2DMBA 2VYRE 3O8XD 2C3HA 4G6AC 1F4YH 4X80H 3BKJH 2GFBA 4RAUA 3WXVL 1CGYA 1V3LA 4WW2C 4F15B 5EOTA 3FHQA 5IV2A 2O5YL 1H5BA 2Y06L 1KCUL 1YJDL 4LVOC 1K8DB 3GMOB 1T03L 4PLJD 4LSPH 4NWTL 4U7SA 2G75A 1AD0A 4HUMB 2MJWA 3BP4B 1AGBA 5HHOA 4JZOB 3LIZL 4GRMB 1EMTL 5ESQA 3LKQB 3GK8L 1EBPA 3NCCB 3ZKQD 1WITA 1FYTD 3OHXB 1QD0A 4GKSA 5GZNC 3D2UD 5D6CB 3FO9A 1Z9SA 1RZFL 4JPKL 1CBVH 3UTZA 3WXWL 5J6HA 1PDKA 4K8RD 4CVZB 2X4SA 1QLRB 5FXCH 5DWUH 4PJEF 1N6VA 2HJLB 1P6FA 4Y4FB 1XR8A 3MBED 5C08E 2XZQL 4AQOA 4K7PY 4S1RH 1JI2A 2A6DB 3G5YA 4Q6IA 2WM0A 4GS7C 2ZWLT 1BOGA 2F9BT 4KKLC 3FO1B 1HDMA 4E41D 1N26A 4PP2B 3OX8B 5ITFB 1U8QB 3TJHD 5CZVL 2ESVE 3UYRH 4I3GA 2FSEA 3PJSB 2ADFL 2GUOB 4GH7B 4OUUB 1S9WA 1QFUL 2W38A 3QEUA 1OCWH 1MCFA 2IALA 5ICXB 1ZEAH 2A74A 3BEWB 2QLVB 1G7MB 4NKIH 1AR1C 1MQ8A 5T1MB 3CC5A 1RZJC 4L8DA 4X6BB 5KSVB 5T1KB 2EO1A 1DQTA 4N68A 5B38G 5IMMA 1ZS8B 5CS7A 3WFEL 4KRPB 5EZLB 4XWGH 4FQQA 4ZQKB 3AREA 1KJ3L 1H0DA 1UWEH 1BOYA 3MOBH 4LVHB 4P4RA 4L4VE 3KPOA 1EFXA 1NBZA 4ALAH 1FL6A 1J87A 4M7LL 2ZZUT 4OLWL 4NCDA 3LPFA 3VD5A 1ZVHA 5HDQH 2BSTA 4I2XE 5IB2B 4YR6A 3QIWC 1IQWH 2E9JA 2ARJA 2GY5A 3IKCA 2E8YA 1QSEE 4XNQB 2F5AH 4Z76A 4EI5A 2W9EL 1MJ7L 4LP5A 5C09D 5A2KH 3BPNC 2X4UA 3ZTJG 3RDTD 2BDNH 1CLYL 5GRUL 1WIUA 5JOEA 3CXHK 3A6OA 4HGKC 3QG6A 1B0RB 1U41A 5EOCL 2HKFH 4HBQA 1KBGH 5E9DD 4PY8J 4RX4D 1G0XA 2E5EA 4UT6H 3BGMA 1DVFA 4WI2A 3C08H 3HAEA 3IFLH 1PEZA 1R3KB 2AJYL 3O8XA 4U1NA 4L29B 2FO1A 4ZDHA 4DGYH 4UOW1 5BRZE 4PJCE 4ZO7A 3KLAB 4K23L 1XEDA 5EC2B 5HI5C 1F6LL 1PKOA 4PGDB 3ZKSD 3VWKC 5EBMB 3VXRA 1N6QL 2DQTH 1FVEA 4S1SH 2CQVA 3SY0B 1IL1B 1ZGLM 2H2SC 1S7WB 4UTAL 2DQUL 4LLVB 2O5XL 4PJHF 2I60L 4PJAA 2JELL 1P4IL 1D9KB 3BN3B 4IEFB 3I02A 1FYTA 4WFGE 1NLBH 2XKUA 1PX4A 1Q0XL 3D2UA 1IAII 5JHLL 1J9CT 2R2HB 3E2HC 2PYED 3BSZL 2NY3B 4XMPL 4BH7B 1KN2L 3WD5L 3I6LE 3T3MF 3L5WA 1EAJA 4OCLC 5DURB 5IFAL 2YK1H 5J12B 1Z0MA 4IS6A 2O61A 4WTZA 4P2QD 5IFHH 2CO6B 3MBEA 5GGSA 3PHQB 5BOPA 1ORSA 1T04B 3KJ6L 1FFQA 5F96H 5GZOD 5E5UB 1L6ZA 3MRIB 3QUXB 4TULH 4E41A 5D93C 2ADIA 4LBEA 3GGWA 5DHVA 3CU7A 4L9DA 1V7ML 4W6YB 1UB6A 2Y5TA 1RUQL 4LPUA 3VW3H 3SDDD 2QBWA 1UXSB 1MY7A 2ZCKL 3AFLA 3RVTD 4PB0H 4MD4B 1S7SB 1E4XI 5DO2D 4X6CF 5GS1A 1MSPA 5HHQB 4Z77A 1FNGA 3VXMB 5FA3B 3E8UH 4CBPA 1C12A 3QUYB 4S2SA 1VEOA 3ARTA 3WO4C 3UEZA 4JN2B 5JUEH 4RRPA 5B4MD 3C5SB 1MH5B 1OB1A 5JPNB 2EEBA 3O6FB 4HS8H 3RGHA 1NAMA 1Q9KA 1ZOXA 3IJYA 2NY6B 3EOAB 3T4AB 4Y16C 4JHAL 5DTFA 1QRND 2R4RH 3OPZH 2HFGL 1RUKH 4IMLA 1LO3L 4XAKE 1EK3A 3CPLB 4DKDC 1BBDH 1P7KB 3AMKA 1AY1H 3NZ8B 3IDNA 3FB6A 4GSDH 2JB5H 2WV3A 4UNUA 5CP3H 1RULH 4AEIH 4X7EC 5C09A 1YQ2A 5MEQB 2XN9B 4DQOL 2GJ6E 3NCMA 4PGBA 1EHLL 5C07D 3UDWC 3HZMA 4HH9A 1OPGL 3BHBA 1HHKA 1KB5H 2NR6C 4HV8B 3T1FB 1HQRB 1U8OA 1BBJA 4OGXH 4YNYB 5KW9H 2R0LL 3NACH 5I16A 4TYUA 3RGVD 5E08L 2EYRB 1UCTA 5IBLC 3O3EA 5E6ID 1JGLL 4JKKA 3FCTB 1P4LA 5KG9A 5D6DA 5C0JB 5EU4B 5DVOA 3ZE1E 3V7MA 3BH8B 1HKLL 1RJCA 4WDIA 5EZJA 3WFBH 2FZ3B 2DJUA 2YC1A 3STLB 3OAYH 2DKMA 1J10A 1NGYA 4WO4C 4LVNB 5C08B 4KI5F 1FLTX 3WIHL 5J3HC 1ODAA 4Q9BA 5I1JL 1JWUA 4WNQB 2DQFA 5SV4A 4XB8A 3PWPB 2ZOKA 5TE6L 3HC4L 1MCSA 3DVGA 5BQ7B 1WZMA 4GRLD 2ESVB 3L7FA 1U8NB 4X5LA 3GHBL 2J5LC 1F4XL 1QSZA 4CU6A 1QFOA 1HHGA 4P2RE 5LCVL 3P4MB 2DOCA 1MFAL 2IBZX 4JFFE 3P3YA 5ELIA 4XMLL 4JZJC 3BZ4B 1GL4B 1UZ6E 2PYEA 4XBEL 1LK2B 2HFEA 4HK0A 3PWJA 4OFIA 1HE7A 1KENL 3DXAD 1NFDE 5IW6A 4LLMB 4U0RB 4ACPA 3EYOA 5L88L 2X4TB 1T5WA 4H8WH 4HWZB 4EN3C 4I2XB 1UFUA 5T3XD 4EDXA 1MFBH 2DQEH 5EOCJ 1MHPH 2XRAL 1V3JA 3BPLB 2Z31D 3V0VB 4ISVB 3FRPA 3IU4L 3SDDA 2R1WA 3U0TA 4ELMA 4ZO6A 1F11A 1IGTA 4OV5B 3K8LA 2VRAA 1NSNL 1ZT4B 4KK6D 3KPQA 3GSNB 5HHVH 4MNHB 5HDOA 2GJZB 2BK8A 3OAYK 3MCG1 1QFWM 2OTPA 4RZCA 5HGAB 3T8XB 2VLJB 2CDGB 2WWMC 1QRNA 2DIAA 3P9WB 1UYWH 1N0XL 3RKDC 3I2CL 3CSGA 3AXLB 5HI3C 4P9HL 3T04D 5JIHA 3E6HA 2FBJL 3NCBB 3W39B 2DJ4A 4H5SA 2GK2A 2V2WB 4J2XA 4QXGL 5CILH 3WYRA 4XHJC 1WFUA 2A83B 3QCUH 4PR5B 4Y4HB 3QFJD 1LO2L 5C07A 2J6EH 4I3SL 3ZZ1A 4JM2D 2OZ4L 5DZNA 1A6VL 2KDGA 4R3SB 2MPAL 3D0VA 4OQTL 4URTB 2FB4H 1BQUA 2XXCB 2VSCA 1SJVA 5ETUA 2X41A 5I0ZA 4PY8I 1MCBA 5CGYD 1F3RB 5T5FH 2NY0C 1FRGL 3EAKA 1CZ8L 1ZLVH 1XH3A 4IOSD 5E6IA 4MNQD 2A77H 1A7NH 2IH1A 4JY6A 1RHHA 1NUGA 4HJ0C 5EO0A 2BXYA 3JWDH 2UZYB 5SWSD 4AIZB 4TQEH 5HVWA 4QXUL 2RR3A 4JRYD 3TO2A 1ZAGA 4HKXB 3FAWA 3KPRA 3L7EB 4XX1E 1OWWA 5DEFB 5C0EA 1I7ZB 3WNPA 4NYLA 4K3EH 4OLYH 4ZUSA 1PSKH 1KACB 4D0DB 4JFEE 5C92A 4Y1AD 2KL6A 3CFEA 4GRLA 3WJJC 3I9GH 2XZCH 5HPMB 4RMWA 5EB9A 1J0IA 2CUHA 3GZKA 5ISZE 4J4PD 5GS0H 3O4LD 1CE1H 4NQUA 2FLRT 3V0AC 5KN5A 3R0NA 1R3JB 2BNRB 3GJFH 2E7CA 1U8PA 4KUCF 4JFYB 3RY5A 2B8OT 5DJCB 1QBLH 1A6PA 4IRJC 1QR1B 2N7AA 5KSAA 1BJMA 4RGMC 4ZUUA 3LKNA 2XY2A 1CE6B 2VXSH 1UA6L 4PJGA 2H45A 2QQQA 4WEBL 1YMMD 2FRGP 1BEYL 4HUKB 3F7YA 2XTJE 3QPQD 4KQ3L 5EIIB 3SDCC 3V4UH 5J11C 5EG6C 2HG5B 3K8KA 1DFBH 2XWJA 2I07B 2A9MH 2B0SH 3C9NA 3RZCB 1U8KB 3TCLA 4FFYL 3CXDH 2Z31A 4LRNH 4NKDA 4G80A 3QO0A 1ZLVK 2GJ6B 5FO8B 1DSFL 3GB7A 12E8L 1L0QA 1CD1B 3CFBA 1P7QB 4DTGL 2RIKA 5HYSG 1T5XA 1RZ8A 1SMOA 4MNGE 4O2CA 3VFTA 1ES0B 4QF1B 4U1IA 2H32A 5E2UL 4C83A 2B1HH 2I27N 4JHWL 5EU5A 1N2RB 4PJ5D 3R1GL 2JCCA 2UY7A 2P7TB 1A4JA 5B38B 1SY6A 3GM8A 4RMQA 3QRFM 1HYSC 4XXDA 4OKVB 1CDBA 3MJ9H 3DX9A 5I8OH 1U95B 5LBSL 2EDKA 3HUJA 3F7PC 2WINB 2Q3AA 4ONOA 4H20L 3QFJA 4F7PA 5I71C 1KIPB 4X6DE 3RU8L 2HMID 4Q9RL 5D70H 4MQXD 5GPRA 3DRTB 1MIML 3BZFA 3HS0A 3CH1B 4DW2L 1FVDA 1ZMYA 1LEGA 3QUKA 4LSSH 1YY8B 3RTQB 3TBVA 3RWCA 4LEOB 1LK3L 2XG4A 5KAQF 4EOWH 3EHBC 3O4OC 1LEKA 4PRDA 4KY1H 4MNQA 3SQOL 3FB8B 5HD8C 4DUVA 5T3ZE 2IANB 4ZNEE 4NM8L 4GG6A 5BMFL 2R69L 1DBMH 1MJUL 1NFDB 3H6JA 4U6HB 5I76B 1A7PL 3MJ7A 2Q8AH 5SWSA 1TETL 3WHE0 1MFCL 3V6FA 4HDIB 5I75C 2UWEF 3HE6B 4JRYA 4PJFE 1P5UA 3O9WA 3JWDC 4J23A 4XRCA 1FNHA 1EJOH 2HH0L 3G04B 2D3VA 4FTVE 1CXIA 5GGQH 3DTXA 4QRRD 1WISA 3BN9C 3EJZC 4YX2H 1W0WA 4Y1AA 3S4SG 3TPUB 2WUCL 3C8KB 4FG6D 4J8RB 1F3DH 2QQLL 4MCZB 5JDSB 1B88A 4P2OD 3CAFA 4NO0D 1NCCH 4JY5L 2I9LB 3JV5A 4XB7A 4M1CC 3C6LB 4J4PA 2DQJL 1JMXA 2CO7B 32C2A 5DJ6A 5JW4M 1WSST 3QXTA 3VDCA 4F8QA 4PJDF 4PRNA 4P59H 5GS0C 5F6HJ 4NC1C 3VXNB 1T2QL 4B50A 2FEDD 2ICWJ 3MCLL 4JPVL 2VDML 4D3CL 3H42L 3GMLA 5A2FA 2F53E 3LKPA 1YMMA 4TSAH 4DAGH 1A3RL 3OGCB 3OF6A 2EE9A 5FK9B 1AO7A 3VWJA 3K1DA 4Y0GA 3WUWG 1Q1JH 2D0GA 1AHWA 1T7YA 2EDLA 5HGDA 1T2JA 3IFOA 3IDXH 4MAYD 1KLUA 3HG1E 2R15A 2WIIB 4QGTA 5K9QI 2VDLL 5CEYB 4HCRA 2J8UF 4RAHA 3PWUB 2HRLA 1ETZA 2R1YB 4RA0C 5ITBL 5CP7A 1IGCL 5CCKL 2HLFD 2WUBL 3MZGB 5DRWA 4NO3A 3MUHL 4TVSa 4HUWA 3LV3B 4OFDA 3ET9F 4DZBB 4X7DC 2BNUA 3QDJD 3SGEI 4O2FB 2B4CH 4WY7H 1J18A 3QNXA 4WRLA 5DQDL 4ZNCD 4ODBD 4MA1C 4J7RA 4GXUM 2CLZB 4E5XB 2BCKA 3QUMB 1J0HA 3PGDA 1NBQA 3VA2C 5I1HL 3RX5A 2EIDA 4R26H 2PTTB 5LJYH 5E8DL 2BOBB 1Q9OB 4JQIL 1FZKB 4QRQA 5DEGA 3K4ZA 4LCUB 4NN7B 3L6FA 1XF2A 2ZOLA 4OB5L 4YQXL 3HAEH 1FL5A 2JKXA 1D3CA 2OSLB 4N0FB 2BVQA 5TH2A 1KEML 1NGZA 5DEZA 2DM4A 4XVTH 3WDHA 4EI6B 3KPNB 1QBML 4RGOH 5DFTA 5ISZB 4U1SB 3I6GA 5ADPL 5EO9B 1SEBA 1YEKH 5ADOH 2YD1A 1PZ5B 43C9A 1H5BC 8CGTA 5EUOF 2DAVA 4LAQL 3VXTA 4L8BB 4YZFF 3UTPD 5C0CE 1YEHL 2P8LB 1FC1A 3PP4H 2FL5A 2OJEB 4OI8A 1OTSD 3DUHA 2MSPA 5I66A 2FBOJ 2XTJB 5D71H 4R7NB 4HJGA 1A7BA 2H26A 1EEYB 1OGAA 2M2DA 3IETA 5DMIL 1NCTA 1MLCB 2NX5E 5GGVY 1C1EH 4HJJL 4QWWD 5J13B 4GOSA 2Y5EA 1D5XA 4MMZC 4WW2B 1OW0A 1SYSA 4NUJA 2VDQH 4JO3L 3MRGA 3MXWH 5L0QC 2R29H 4PV9A 4LVOB 4N90D 1KLFA 1JTTA 3RUGE 3HNTH 2ICCA 4FXKB 3DRQB 4P2OA 4NO0A 1BJ8A 1JGEB 1QLFA 3GBML 4I18B 4I3RL 2PYFA 3LQMA 1JF1A 1K6QL 1MVUA 3M45A 5E99L 2EXYC 1I7TA 4ZUWB 5DHVH 4X6EA 4Q6IC 1UM4H 1KCVH 3DBXA 4HT1H 5ACLA 4MNGB 2H9GB 4WJ5B 5ICZB 1QKZL 4PJIE 5M7QA 4ODSL 3BD4A 4WFEE 2JIXB 3FQTB 1PX3A 5D7IA 3WFDL 4K55A 3FT4B 5GRVL 1FO0B 1LP9F 1DLFL 3FOMB 1YNLH 5DXWA 1GGCH 1MLBA 4HWEL 4UQ2A 3UPAA 4F7CA 4V1DD 4YHZH 3SE4A 1FSKB 4FQLH 1MOEA 1NAMH 4ONGL 1JGVL 1DBKH 1NDGA 4O4YH 4ODUB 4N0UB 2KZWA 3LQZB 3OJDA 3INUL 2FIKB 4XGZA 5D9SA 4NJAH 1Y0LA 4F2MA 2VQ1A 3OKDA 4XP6H 1F2QA 1OAYH 3ARBA 4GQ9L 3AREC 1CU4H 3MA9L 3EOYG 3QEGH 2HT3D 3DX6A 4M7JH 2XA8L 3AB0C 5D7LD 5JPMA 1IC5L 4MWFB 5AUMB 4X6DB 1OVZA 3QDJA 2NY2C 4DGVH 2UUDH 3ECBB 4KTEH 5DD3L 1A6WL 3H7LA 3U1SH 4M6OH 4O02L 5SX4I 1N8ZB 3DURA 3EFFA 3TFKD 1DDHB 2VH5L 1B4JL 2D2OA 2B4CC 5F1KC 2HRPH 1VFAA 4IJ3B 4ZSOE 1KXVC 1XCQA 4OZFB 2VDPL 3UBXA 5C9JB 3BVNB 2OTWB 2E6PA 4G6ML 1U3JA 3RWIB 3A6BH 2VISA 2DQCL 2DMCA 2VZTA 1P4BL 3S35X 4P5KB 1LHZA 1TZIA 1EXUA 3TWCH 3O3BA 5IB1A 5BZWA 4LU5H 3RHWF 1AE6H 4PJFB 5CD3A 3GUTB 1R3LB 4FOMA 4IRZH 2F58H 3ZHDA 4IOIB 4PTUA 2AVGA 4RWYL 5C0IA 1T83A 2EEDA 3VI3E 5FDYA 1DVFC 2IPTH 3H9ZA 2C3XA 2MWCA 5HY9A 3O8XC 4BKLB 1MFDL 1CICA 4R8WL 3ESUF 1QNZL 3NMEA 5FV1L 1M4KA 4HQQH 4M8VA 1X4XA 4FZEL 1KXTB 5DRXA 4MAUL 2C26A 4PLJC 3UZQA 3ZTNL 4GAGH 1WBYB 4M7KH 4AK1A 4ZUVB 2N4IA 4HIHA 4AG4H 2ZSWA 1G7QA 4DVBA 1NGPH 1X5LA 1XGPB 3O3AA 1RU9H 1OD7A 3VFRB 1YPZF 3UP1A 1I3RA 1IAIH 1UQSA 1MUJA 5BV7L 4G8GA 5ANMB 1JBJA 3DUUA 4MX7B 5JHDB 1JMZA 2UUDK 3A0OA 2OJZL 3V6OE 3IU3A 1BFVH 1J0YA 1FQ9C 4JR9L 3T09A 2NY4D 4G8FB 4WWID 4JVPA 3MRPA 2GT9B 2J2ZA 4JPWH 1FG9C 3QSKB 25C8H 3CVHB 2OMBA 2RAMA 2VXQL 4BUGA 3T77A 1AXSA 3O6LL 1HZHH 1SM3L 2VLMD 2VWEE 3MLYH 3SCMB 1JNLL 2B5IC 5F6HI 4GXVH 3HR6A 5HPOA 4PTTB 1R0AH 2W0KA 3D39A 4KUCD 2ICWI 3MLWH 1HK6A 4UU9A 1ZA6B 3Q3GA 2R0KL 4JKLA 2AV1B 3KLHC 1E4XH 1GGIH 5F1NA 1JN6A 4RQQA 3C2AL 1RJZA 5K9OA 2DLFL 1MAML 1ZHNB 2IBBA 3UTQB 5CSBA 5GS1C 2RJMA 3RVWD 2VLKE 3IJSB 4NRZA 4M9OA 4V1DA 2F19L 1TZHB 1IQDA 1C5BH 3WHXA 2VABB 4OCRH