1IAOA

Class ii mhc i-ad in complex with ovalbumin peptide 323-339
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
178
structure length
178
Chain Sequence
b'EADHVGFYGTTVYQSPGDIGQYTHEFDGDELFYVDLDKKKTVWRLPEFGQLILFEPQGGLQNIAAEKHNLGILTKRSNFTPATNEAPQATVFPKSPVLLGQPNTLICFVDNIFPPVINITWLRNSKSVTDGVYETSFLVNRDHSFHKLSYLTFIPSDDDIYDCKVEHWGLEEPVLKHW'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords MHC CLASS II I-AD
publication title Crystal structures of two I-Ad-peptide complexes reveal that high affinity can be achieved without large anchor residues.
pubmed doi rcsb
source organism Mus musculus
molecule tags Mhc ii
total genus 33
structure length 178
sequence length 178
ec nomenclature
pdb deposition date 1998-03-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00993 MHC_II_alpha Class II histocompatibility antigen, alpha domain
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1iaoA02
3.10.320.10 Alpha Beta Roll Class II Histocompatibility Antigen, M Beta Chain; Chain B, domain 1 Class II Histocompatibility Antigen, M Beta Chain; Chain B, domain 1 1iaoA01
2NY7H 3FOMA 2DQFA 4PTTB 2BOBB 2QKIB 3DVIA 4DAGL 4PTTA 2BOBA 2QKIA 1OARL 1RIUH 4U3HA 2WIIB 3FQXB 4ODTH 3MLZL 2WIIA 1QBML 3FQXA 3Q6GH 3QNYA 3HNTL 3QDGD 4UIKH 5DEFB 3WFCH 1AGDA 1IGIL 2WWMD 3IJHB 2E6JA 3M07A 4P2QE 1N6QH 4DOHE 4KY1H 2B4CL 2UV3A 1EEZB 5F7WC 4U7KA 1EEZA 1R3KB 4ZNCD 1TFHA 1Y0LB 1BOGB 3H9SB 1X5ZA 1H3WM 1BOGA 3H9SA 5D1ZB 4G6KL 2FX9L 1FVEB 5D1ZA 2F19H 5EU6A 2VH5L 1FVEA 3WN5B 5CZXD 5FO8B 3WN5A 5JDSA 4YHOL 5IUSA 5FO8A 3VWKD 2YPKB 2VSCA 3BEWB 1KJ2B 5MEQB 4RRPG 3BEWA 1KJ2A 4ZS7H 4NQCB 2RR3A 4LPUA 4NQCA 2Y5EA 2AJUH 3W9EB 5ISZB 4XP5H 5ISZA 3U9PH 4KI5F 3W9EA 4N0FB 3DRQB 1P1ZB 5ICYA 3QEGL 4N0FA 1U8LB 3DRQA 1U8LA 1C08B 5H2BB 2RCSL 1C08A 5H2BA 3UJJH 3QDMD 4LASH 1T03L 5KG9B 2WUCL 5KG9A 2VITB 4X9GA 3VFWB 2VITA 4B0MM 3VFWA 2VDRL 4LFHD 4WI4A 1T7YA 3G08B 4UDTB 3G08A 3T0ED 4UTAH 4BZ1L 7FABH 4UDTA 2NXYD 4QOKE 4ZAKC 4HC1A 4K7PH 3JWOH 3X13A 1OQOA 1UENA 4YFDB 5F1OB 1NMAH 4HJ0C 5GHWL 4G7VL 4C56A 1YUHB 4IRJB 3IETB 5F7EL 2DF3A 1YUHA 4IRJA 4LGSB 3IETA 1R3IL 3OKNB 3B8SA 3QNZB 4M6MH 1FBIL 3OKNA 3QNZA 4RISH 5HJ3B 5HJ3A 4WI7A 3G6JE 4HK3J 1X5JA 4WUUB 4WUUA 4HUWB 3U36B 5IF0A 2Y23A 4HUWA 3U36A 4G6AD 1I4FB 4KI5C 1ZE3C 2ADFH 4XVTH 5DJZA 2AEQH 4OM0H 4LSSH 2XXCB 1UKSA 4MZ2A 1OAKL 5JTWA 3F7YA 1VPOL 1LNUB 3HNSL 1LNUA 5C7XL 4UQ2B 4URTB 3OPZH 4KDVA 4UQ2A 3SE8H 3JUYA 3PWPB 1BF8A 3PWPA 2C1PB 1I7RB 3ILPA 4D8PB 4AM0B 3UBXG 4D8PA 4AM0A 5D1ZC 1QFPA 5HHVH 4R4NC 1TNNA 3WN5C 2CO6B 4JREB 3THML 4NCC2 1FZMA 1LO2H 1BQHB 4O02L 1GIGL 3BP4B 1BQHA 2AXGB 2DQEL 1U8IA 2AJXH 2KBGA 5B38G 3PHSA 3BP4A 2AXGA 1QHOA 2BJMH 3B9DA 2ERJB 4BK5A 2AK4D 1NAKL 5GQBA 2B39A 3C5SB 3RX8A 3CK0H 2Y7QB 2GJ6D 3C5SA 3MREB 2Y7QA 1EBAA 2FH8A 5EIVA 1TTUA 3IDNA 4M6OL 3VFGL 4KUCF 4WFED 4G7YL 3EYQC 3O4OB 3QXUA 5ID0A 4D94A 2X1PA 4PP1D 2Z4QA 1NL0H 5A2JH 5IB1B 5B4MD 4OCMC 5MHSE 5IB1A 2R0LH 4MLIA 3VH8G 3BQUB 1HIML 3FQWA 4KRNA 1QRKA 1K3IA 1HSAB 4XBEL 3E8UH 3UTQB 4FS0A 1HSAA 4UIMA 3UTQA 5GGRB 5DS8B 1L7IL 2DQTH 3TFKD 1KELL 5GGRA 5T1MA 4JAMB 3QEHB 5D1QD 1QG3A 3QEHA 5TQ2H 3SPVA 2PYEB 3KYOA 4AMKL 3P73B 2PYEA 4PJDE 4IRJC 1RZKL 4K8RH 4DGYL 3P73A 1YEFH 1G7JB 1MQ8A 2BNRB 1G7JA 2BNRA 1X44A 5HYJE 1YQ2A 5E00A 3QULB 5C0CD 1Z0NA 2NY0D 1PSKH 1A0QH 3QULA 4TOYL 1MHCB 5D6CA 3CH1A 1IGFH 4NHUA 1MHCA 1OGTB 1MFBL 1OGTA 3PUCA 1EIBA 1JHTB 4NQDA 4ZUSB 2HLFC 2WINB 3IDXH 4ZUSA 3BGAA 1RUKH 2WINA 4OCLC 3TN0D 3IXAB 1BJ1J 5HHOE 5C09D 5KVGH 3IXAA 3MV8B 4WTWA 3REVA 4JLRB 5F7FA 2OS7A 1RHFA 2D0GA 4PGCB 4JLRA 3S4SG 2DQCL 4PGCA 2OZ4H 2FZ3B 2V7NB 2A1WH 2XOTA 2V7NA 3UO1L 4RAUA 1G6RA 4F37K 4JREC 3F6LA 3OKMB 1CGVA 5D7KE 2APFA 3OKMA 2XN9E 4BK4A 4UNVA 5GRUL 2R0WL 4N0UA 3FO9B 3S3PA 5FYLE 1G9MH 3FO9A 4J23A 1U8HB 2V2TB 1U8HA 3G5XB 2ERJC 2V2TA 1RZ8A 3NIDE 3G5XA 4MNQB 4NUJB 1RMFH 1LO0H 3SHSA 3IDGB 4MNQA 4NUJA 3STLB 1N5YH 3IDGA 3WFDH 2YPLD 4ODBD 2YD6A 4YDVA 3STLA 2R1WA 4M4RA 3RWIB 3LRSB 1IKFH 3X17A 3RWIA 5KS9E 5BCAA 5IFAH 3Q6GL 4V2BA 1U95A 5L7XL 3O4OC 4EN3D 4UIKL 3WFCL 1VGEH 5FGCB 5ILTH 3VRIB 3BQUC 4HHAB 3PWJA 2FX7H 3VRIA 2ENSA 1N6QL 2IPUK 4HHAA 5D7IA 4KY1L 1JGEB 3MFFB 1KTKE 3MLXL 1JGEA 3MFFA 1GOGA 5T33H 4R6UA 3NFNB 4X6DA 2AXFB 4BSJA 2AGJH 3NFNA 1QPPA 4TQEH 2X1QA 3G5ZB 1X6LA 4JY4B 3SDXB 3G5ZA 4JY4A 4OB5L 3IVKB 2F19L 3SDXA 5J1SC 3GI8H 4I0PB 1OWWA 1CK0L 4I0PA 2UWEE 3KLDA 4OQ1A 3W82A 5FYLH 4N0YH 4JHZA 5HI4C 4RGMC 4MB3A 4ZS7L 5L2JA 4JHWH 4Y0GA 2X4PB 1KJMB 4WI3A 3QZWB 2X4PA 1KJMA 3QZWA 4XP5L 1MI5E 5IW1B 3U9PL 5IW1A 2BNUB 3LQAC 1KCLA 1MHPH 4P9MH 4YHLH 3MR9B 1OTUD 1U42A 1YQVH 3MR9A 4UT9H 5C9JB 1EHXA 5C9JA 3AVEA 2HN7B 3M8OL 4LASL 5GGSA 2HN7A 3OAZK 4QYOA 5CSZB 4TNVF 3N1QC 5CSZA 3BMWA 4PLKC 5LAXB 4OJFH 3ARWA 2L7JA 3QHZL 1N26A 1PEWA 5LAXA 2O5YH 4DKEH 1T1ZB 4I8DA 1ZV5A 4LPYA 5D4QA 1MJJA 2XXMB 4UTAL 3UC0H 7FABL 1IQWH 4Q9QL 3V7AE 3QRFM 1BJMA 4K7PL 2CRMA 1Z9OA 4PRBA 2JJWA 1NMAL 5DJDB 4HH8A 5KZCD 2CIKB 4U3XA 2CIKA 1OAZH 4KMQA 4ODVH 1ZXQA 1JPGB 1MLBB 1KJVB 2C7UB 3UJTH 1JPGA 2F53E 1KJVA 2C7UA 1LEIB 3R4DA 4RISL 1RZJC 3DYOA 1LEIA 3QJHA 4P46B 4JFDE 4L1HA 1NC4B 4WTXA 4KGJA 1NC4A 4FN0A 4FQXD 4DJMA 1FHGA 5GRVK 3EOTH 4OAWB 3DO7A 3NIGE 1RD6A 2ADFL 4XVTL 2AEQL 4ODHH 4OM0L 4LSSL 4PJ8B 4PJ8A 2D7MA 5MENE 2Y4SA 4LCUB 1SY6H 5H37H 4LCUA 3OPZL 4B7IA 5HYQB 1A02N 4H8WC 3SE8L 4BQ8A 5LGKA 4OV6F 1T20B 5D2LA 4OZHE 1T20A 1IFHH 3P4LA 4HD9A 1AKJD 2VKWA 2DD8L 1LK3H 5C0NC 4DZ8A 5HHVL 1QUNA 5B3JF 4PRNA 4I0PC 3LN9A 1DVFD 4KGLA 4XB7A 1BVZA 1OSPH 4U6TA 1LO2L 3OAUH 2Q6WB 1KT2A 2Q6WA 4GJTB 3VD9A 3RWHB 4LSDA 1W0VB 1AR2A 2AJXL 1Z9MA 3RWHA 1AR1C 1W0VA 5E9DD 1KCUH 2CO7B 3ZMRA 5KSUA 4GRWB 4I3SH 1S3KH 1NAMH 2VDPH 4K94H 1F45A 4XVJH 4F2MB 1TITA 1FE8H 1DBJL 3L5JA 4F2MA 1AIFB 4RNRB 2P24B 1AIFA 4PJGB 2J8HA 4I48A 3JV4B 5AYUL 3VXRD 3JV4A 1CDCA 1IL1A 3VGAB 4BKLA 3DLQR 1GVIA 1NL0L 5E5MA 2F54E 4I18A 4U05A 2X4TB 4O00A 2R0LL 4ZNEE 2X4TA 2Z8SA 2WAHA 1DP0A 3BHBB 1OD7A 2ZP0T 3BHBA 3RY5A 2P5EE 4K7FB 3E8UL 3FRPG 1J0HA 4K7FA 3WLBB 1ZLUK 4MGXA 4MYWB 1FCCA 5KVDH 2DQTL 4BJLA 5FYJE 3MV9A 5TQ2L 2BSSB 2FHCA 3B4NA 5TFSH 2BSSA 4K8RL 1JTPA 4C55A 2HVJA 1WWAX 4NN7B 4YDLB 3KLSA 3J7HA 4KJQC 4P46C 1ADQA 1T21A 2AEIT 1U91B 4PJGF 2GSIB 1KXVC 4OZHF 3IT8D 2GSIA 1F97A 3BP7A 3BUYA 4PJ8C 1RUKL 2X70B 2HJFB 2X70A 5KVGL 1U3JA 5FIEA 1UCBH 3BDBA 3MJ8B 5HPMA 4WW1B 3MJ8A 4HWZB 1ES0B 4HWZA 5AZEH 1JGLL 2OZ4L 5LWYL 1ES0A 2VLJD 2HJLB 1K6QH 2A1WL 3BSZL 1QLEL 3M1BA 4GT7A 5D7LD 4ODWB 1BZ7B 3F7PC 3HZVB 4ODWA 2I25N 4FQLH 1BZ7A 1MCPH 3HZVA 4KI1A 2VQ1B 2WP3O 4D9QD 2FGZA 2VQ1A 3BFOA 2DS4A 2PO6D 3T0XA 3MLVH 1G9ML 2AJVH 3VD3A 4D2NA 4OFYD 4UUJA 3T65B 1RMFL 1LO0L 1ZS8B 4M43H 2PW1B 5D1XD 4MMXC 1ZS8A 4FQ1H 1N5YL 2PW1A 3WFDL 4QT5B 3WUZA 1JK8B 3CFJA 4G8GB 4QT5A 1JK8A 4ZDHB 3WNMA 5IFAL 3LS4H 3ZT5A 2IH1A 5E4IA 3VGAC 1VGEL 1T5WB 2YA0A 4LOUC 2HKFH 3C8KA 1T5WA 2N7AA 5ILTL 2MKWA 1LO3H 3QQ3B 1E4KA 4ZS6D 4PPTA 3QDHA 3QIBD 3QQ3A 2FX7L 1CGYA 1HYSC 1N0XH 4KRMB 1WZ1H 5FHAH 1T0PB 2NY5H 3D2UB 1F8TH 5T33L 3D2UA 1FV1B 4LCWD 2AGJL 2DQGH 1FV1A 4TQEL 3KPOB 1J1PH 2NX5E 5BV7H 3HE7D 4X6CB 4X6CA 3GI8L 4MJIB 2B7DT 4CW1B 5K9QG 1KB9J 4ONGH 4CW1A 4A6YB 4NN7C 3BZFB 5MEOB 1SJVA 4YDLC 3WFBH 5MEOA 5FYLL 4N0YL 2MWCA 3B5TA 1MCRA 2YD2A 1GHFH 3KPSE 4Y5VA 3CH8A 3QHFH 1OM3H 1ZVYA 4FZ8L 4NZRH 5T3ZE 1VA9A 1MHPL 4P9ML 4YHLL 3ARUA 4BSVB 1YQVL 4UT9L 5EU7C 3RDTB 2JF1A 4BSVA 2DLGA 1GC1C 1WEJL 4R97B 1P7KB 4LCCB 1P7KA 4WO4B 4OJFL 4UI2A 4PLJC 4WWKD 1ZLWH 1UXWB 2O5YL 4DKEL 3BD4A 2AEWA 4LHUG 3UC0L 1IQWL 1TJHH 1NCAH 3EO0B 4YEFA 3I6GB 3EO0A 3I6GA 2D4FA 1HQ4B 4GFTB 1DQDH 1HQ4A 3UTSE 5I1KH 5KANI 1I8MB 3MACH 4ODVL 1I8MA 3RVWD 4AYFA 2VR5A 1IARB 2DN7A 2VERN 3CZJA 4PB0H 1Q9OB 5CFHA 3KPTA 1Q9OA 2H26B 4GBXD 2H26A 2J4WH 2BNQB 5T3ZH 2BNQA 5ABDE 2IPTL 3EOTL 5IMLA 2YD3A 2EDFA 5EA0H 1CD0A 2NZ9D 1E4KC 4ODHL 1FL5B 1OTTD 1HXMA 2DTMH 3ES6B 1FL5A 3QFDB 3K7UA 3ES6A 2NY1D 3QFDA 5IQ7H 1ROWA 1SY6L 1FLRL 1VSCA 3DTXB 2BVYA 5F9DC 5C0GB 3DTXA 1KCSH 1ZA6B 2X9XA 3FOLB 2PF6A 5C0GA 5TE6H 1ZA6A 2BSRA 3FOLA 1IFHL 3V0WH 3TH2T 3AM8A 1MCKA 4HPOL 1JRHH 1U92B 2ZNXA 1T1XB 1LK3L 1J0KA 1U92A 6CGTA 3VG0H 1T1XA 4G6MH 2E7CA 4WVRA 3CDCA 2LABA 3Q0HA 4Q2ZB 4GMSH 3ME0A 4QHNB 1OSPL 2W0LA 4Q2ZA 3K3QA 4QHNA 3HS0B 1T89A 1CG9B 2YR3A 4M1DH 4M8VA 5I2IA 3HS0A 1CG9A 2FEDC 4RRPA 3EJYC 1P7QD 1YEEH 4KHTH 2RHEA 1JGUH 1KCUL 4H20H 4L4TE 1DFBH 1NAML 2VDPL 4K94L 5I18H 4JG1H 4XVJL 5D93B 4OLUH 4E41E 1FE8L 4QGYA 4RGNB 3RDTC 2D0HA 1INEH 1PDKA 4R97C 3EO1B 4XBPB 1AXIB 4LCCC 3EO1A 4XBPA 2YXMA 4WO4C 5C71A 3DO3A 3OX8B 1E28B 2G60H 3OX8A 2P44B 1E28A 5J9PB 1F6AA 1AGEB 3DMMB 1UG9A 3DMMA 3PIQB 3VXMD 1HH6A 3ULVE 3PIQA 3K8MA 3FFCB 5GRWA 3FFCA 4P5KB 1L7TH 4P5KA 2DLEA 5KVDL 1W0WB 1W0WA 3LEYH 4K9EH 2V17L 3MBED 4E5XA 3QIWB 3MOBH 2FYYA 4PJBE 4WCYH 5H37G 1T7ZA 3QIWA 3FQNB 1KF9B 5F71A 3FQNA 1J1XH 1A7PH 5EUOB 4JG0H 5EUOA 4LLMB 4LLMA 2D3VA 3WJJA 3X3FH 5ICZB 5JOPD 5ICZA 5CZKA 2EYSB 5FGSA 3V7AG 3L5HA 1PYWA 1EPFA 2EYSA 3FT4B 4OZFB 2K9UA 4OZFA 4KVNL 1CCZA 4PJIE 4G3YH 3GSNH 4PV8B 4PG2A 3QO1B 4PV8A 4O2EB 1F13A 3QO1A 1IGTB 3HR5B 1UADC 4L29B 3VMNA 3VD4A 1IGTA 3HR5A 5GZNC 5I19L 4M1CC 1T83A 2W91A 4L29A 4Y1AB 4Y19A 1UCBL 1Q9KB 4Y4KD 4Y1AA 1B6UA 1BBDH 1Q9KA 4QXWA 1CQYA 2XICA 4ZUVB 3U48A 5J1AB 3L5WB 3EDKA 5AZEL 1IM9D 1TMCB 4ZUVA 5J1AA 3ULVH 3L5WA 3ULUF 1K6QL 1RJLA 1G7QB 4U1HB 5DRZA 4U1HA 1VADB 3AXLB 3O0RH 3S3JA 3SGEI 5IOPB 1VADA 3AXLA 4KMTH 5IOPA 3I6LE 3OR6B 1LK2B 1A64A 2Z92B 3OR6A 4FQLL 1MCPL 1T89C 2Z92A 5FYJL 1QSEA 4MXQD 4ZFZA 3MLVL 1VKXB 3GSXB 2VZOA 1IJ9A 4XCEA 1VKXA 3GSXA 2AJVL 2CRZA 4N5UA 1ZAGA 1FFOB 1SQ2N 1BZQK 1YEJH 3S9DB 1FFOA 1NFDB 1YYLH 4M43L 1H15B 2APBA 1NFDA 1QFWH 1H15A 2OSLA 4FMFA 4TRPH 5D93C 2WQ8A 4JY5H 4RGNC 3QEQE 3CMOH 1P4IL 4OFKA 3EYVB 5B39G 3UAJC 4JKWA 1X4ZA 3EYVA 3LS4L 4MQTB 3IDIB 1CFSB 3KHQA 2FO1A 2HKFL 3VGGA 1CFSA 4Y5XB 1LO3L 1KIRB 3DMMC 1WSST 3F6IA 1KIRA 4Y4FA 1N0XL 4L4JA 1WZ1L 3BXNA 2CQVA 1LHZA 5FHAL 1HH9B 3RVXD 4GQ9H 3UDWA 1MCSA 1HH9A 2B0SH 2DQGL 1HOCB 4JO2H 1J1PL 4NQEE 3QIWC 1HOCA 3PWUA 4K2UH 4KKAC 5DRNB 2EZ0C 3IDJB 4PRHB 1YECL 4I9WD 5DRNA 5I1LB 5I1LA 2NY3B 3EYFB 4ONGL 3WJJC 2F74B 1INQA 1I7TB 4TVPE 3WFBL 4PJ7F 5FFLA 4LLQB 1H5BB 4LLQA 1GHFL 4P99A 4DUVA 3QHFL 3MMEB 1OM3L 3MMEA 1MJ8H 4NZRL 4M6NH 4PG2C 5MERB 5FO9B 5MERA 1ACYH 5FO9A 1VHPA 1D9KB 1FZKB 3A6BL 1D9KA 1FZKA 2R56H 4RQQB 2X44D 1FNGB 4RQQA 3GNMH 5C8JB 4IIQB 2DAVA 2LU7A 2A77H 4IIQA 2P5WB 3CVHB 2R9HC 2P5WA 1MLCB 3CVHA 3MJ6A 3MV7E 7CGTA 5AWNL 3C60A 1DEDA 3ARXA 2FWOB 4U1SB 5HVWA 2FWOA 1S9XB 1JZ3A 4YJZL 5I1KL 3OKDB 3SDYL 3OKDA 3MACL 4OCRH 4LLUB 1B9ZA 1HQRB 1G0XA 4TVPH 4LLUA 2I5YH 1HQRA 4PB0L 4OTXH 2HRPL 4BUGA 5INDB 5LXGH 5INDA 1MHHB 1MHHA 1S7UA 3ARYA 2XTJB 2HFFB 3QHTC 4OBSA 5T3ZL 4JDZB 4QNPE 1SYSB 1CGWA 2HFFA 4JDZA 5SX5K 1SYSA 4NO0A 5EA0L 4NHCH 1AXSB 3JWNC 4Y5XC 4FOMA 1AXSA 2DTML 4HIXH 1UC6A 2OL3H 2Q3AA 3JTSB 2EO1A 1X5YA 3IJSB 4DGIH 3IJSA 2ZOKB 4ZXBD 4YE4H 1KCSL 5DI8A 5HDQH 5TE6L 3WNOA 5MP6H 2ZOKA 3V0WL 2J6EH 2W0FB 4Z76A 2W0FA 1JRHL 1CT8B 1JZ7A 4RDQF 1CT8A 2XI9A 2ZSVB 3VG0L 4G6ML 1ITCA 3UTTD 2ZSVA 1BLNB 1JUFB 4JO1H 1BLNA 2NY3C 3RIFF 4GMSL 3P4NB 5CJOH 4LKXB 5F1IB 3P4NA 4M1DL 4LKXA 4FQPA 1H5BC 5F8QC 1S7TB 2AQ1A 1S7TA 4KHTL 1JGUL 1VGKB 4H20L 5D5MF 2Q8AH 1VGKA 1DFBL 4S2SB 4ZPTB 5I18L 5DC0A 4JG1L 4S2SA 3MRQB 1UH3A 3AB0B 4YXHH 1D9KC 5EOQL 3D69B 3T2QA 1FIEA 1QNZH 5KW9L 3D69A 3CDGB 2ICEB 1B4JH 3CDGA 1U3HD 2ICEA 1Q9WB 4QF1B 5CJQL 1Q9WA 1RUPL 4IIQC 5DA4A 5DRXB 5DRXA 4HGWB 4FRWA 4Y16D 3FQTB 3UTPE 3FQTA 3QUZD 3JWDH 1TIUA 2XKNB 4KUZH 4OUOA 3WDJA 5GSVB 3QDJD 2B2XH 5GSVA 3MOBL 3SKMB 4WJ5B 4WCYL 2DDQH 4WJ5A 4YHKL 5E1AB 3NOIA 1EK3A 1J1XL 1A7PL 4GAFB 4UZGA 5E1AA 4JG0L 3KPNB 1F00I 3TO4B 2Q7YB 5T3XE 2V9TA 3TO4A 2Q7YA 5I1CH 4BM7A 3OV6A 2LU3A 1ZHKA 5T5NF 2XWJB 3W11D 2XT1B 2XTJC 2ZG2A 4NOBA 1IAII 3FKUS 4J3WA 4Q6IA 3TA3D 2NPLX 4DKDC 1XGRB 5HGGS 4G3YL 3GSNL 3R1GL 1XGRA 2HT3C 5HYSB 3G6AB 5L2KB 1T1WB 5C0AA 4N1HB 2I24N 3G6AA 1T1WA 5L2KA 2VZVA 3G6DH 4OD1L 2ZSWB 2ZSWA 4IDLA 4JR9H 4K07A 3DETC 4IHOB 4QRRD 3WFZA 1Q0XH 2I26N 3VI3E 4DKAA 3T8XB 4WIQA 4HPYH 3ULVL 4M61B 5DUBA 3T8XA 2YXFA 5DJAB 2IAND 5J3HC 3CX5J 5DJAA 4HK3N 3HMXH 4KMTL 1KLUB 1R5VB 3ALXA 1KLUA 1R5VA 4P2QB 4P2QA 1DN2A 1EO7A 1R3HB 1QRNE 1R3HA 3VMPA 3O9WA 5T3XH 1YEJL 4J3SA 1YYLL 1QFWL 4N1CA 1ZLVK 4JY5L 3AB0C 3CMOL 3IAPA 3GKWH 3PE9A 5SWZE 4KZDH 3F12A 2GCYB 4QRUB 3Q48A 4HF5H 5IIEB 2GCYA 4QRUA 5IIEA 1WBXB 4NBZB 4QRPE 4NRXA 1WBXA 3JBG7 5E24E 2CLVB 1YC7A 2E6PA 2CLVA 4GQ9L 3U30B 3SN6N 1INDH 4G8EB 5DEGB 3KJ6H 1XGYH 4G8EA 4JO2L 4KQ4H 5CBEB 1I7ZB 3H7LA 5CBEA 1GRWA 1I7ZA 3TO4C 1HSBB 4AIXA 5DURD 3I2CH 1HSBA 4KTEH 3FT3B 3FT3A 4Z0XB 1A9EB 4QOKB 1FC2D 4Z0XA 1A9EA 4Q6IC 4QOKA 2VXVH 3LQMA 3V79C 2QLVB 4M6NL 2X4QB 3WD5H 1ACYL 2X4QA 2VLRE 2X05A 1AC0A 2DKMA 1CGSH 3O6FB 3MA9H 3MYJB 3O6FA 5FA3B 3U7AA 2R56L 3MYJA 4GAYB 5FA3A 3UX9B 4GAYA 3G6JA 4HXAH 2A77L 2EIEA 3KYKH 3WO3B 1SMAA 1OGAD 3HZMA 1KGCE 3V5KB 1OQXA 2IFFH 1ZGLB 4GRLD 3DYMA 4GG6F 1CE1H 4NRZB 1ZGLA 5T1KD 3MRBB 5J06A 3N9GL 1A6TB 4NRZA 3RX7A 3MRBA 1WUNT 1Z2KA 2VN7A 5DVLA 3UTZB 4WRLA 3UTZA 5IESH 1MHEB 4WWID 3O9WC 2V7HB 1MCCA 1P7HL 4NCDA 2V7HA 1BD2E 4OCRL 3V6FB 4TVPL 4Y5YB 5D7SH 2I5YL 3MV01 5TDOB 3V6FA 4Y5YA 4OTXL 3RY6A 3MQIA 5LXGL 4M02A 4I77L 3QUXB 1J0IA 2VSDA 3HG1D 3QUXA 4XNUH 3KLHC 1IVLA 4U0QB 1TJGH 3KR3L 4ZAKD 2OMBA 4NHCL 4PS4H 3MBXH 4IS6A 1FRGH 1S78C 2HMID 4QHKJ 1WCBB 1JF5A 4HIXL 2YBRB 4RGOH 1WCBA 1HZHH 2OL3L 4YHIA 1URLA 3CXDH 3G9VA 5K93A 1CFTB 4YE4L 3LSOB 5HDQL 3U30C 5MP6L 1CFTA 5BJTA 3LSOA 4Z7WB 2MFNA 3OR7A 1K9TA 2J6EL 1NDMA 2EDRA 3WIHL 3I3EA 3HC4H 3U6RB 1TZGL 3ZHLA 5E95B 3MZGB 5EC2A 5B21A 4GAGL 1YMME 4JO1L 5IVXB 3K4DA 4IRSB 2OYPA 1I1AB 4ZODA 4DN4H 1HCFX 4KI5D 3PF2A 4IRSA 4WFFD 5CJOL 1I1AA 2JE8A 4E0RB 3DX8B 2OZ4A 2P49B 3EJZD 4E0RA 3Q3GB 3Q3GA 1KTDB 5HGDA 1JVKA 2H32B 1KTDA 3TBSB 3OWEA 2H32A 3TBSA 5L9DL 5F1KC 3RPIB 2Q8AL 3RUGE 1S9YB 1WZLA 1S9YA 4PJDB 2BERA 4YXHL 1P84J 3H9SD 4PJDA 1QNZL 3FHQA 3O6FC 5D1ZD 5EU6D 1CI5A 4B53A 4R4ND 1B4JL 4G6FB 5I74B 1XGQB 3L3KA 4HUVA 1UZ6F 1WWCA 5DC4B 1XGQA 4Z7WF 3SGJC 2IMNA 1K2DB 5HYJA 4XVUD 1K2DA 4PJ5B 1FVDB 1H3XA 4RDQG 2XACC 3EDEA 1FVDA 1JHLH 4NQCD 1SVZA 1SJHB 1T7WA 5EN2B 2AJYH 4FXLA 4LHUA 1SJHA 5DJ8B 5DGRA 5EN2A 3JWDL 3D18B 5IVXF 5ISZD 5DJ8A 4KUZL 2HJKB 3D18A 5K59E 2YUWA 3GSUA 2HJKA 2YRPA 5EUKB 1M71B 3BYYA 8FABA 5HHOA 5EUKA 2CIIB 2B2XL 3LD8B 1M71A 3T2NH 3T3ME 4CBPA 4YFLF 2DDQL 2AVGA 1EO8L 4U1IB 4LNRB 4WHDA 5HI3C 4Y5YC 4U1IA 4LNRA 3EYQD 3RY6C 1ZGLP 2FECL 2W07A 5I9QB 4N0RA 2X4OB 3MRPB 5I1CL 2ZCLH 2ICWB 2X4OA 1VFOA 3MRPA 3QUXC 3A0OA 2ICWA 1U8OB 5GGTH 4X98B 2XN9B 1MEXH 2EEAA 2B8OT 2XN9A 1QYGH 1W2KT 5HVHB 3UBXI 1KACB 3ILQC 4YBHA 3W0WB 3E6HB 4C56D 4PD4K 3W0WA 5IB3A 3E6HA 5E03A 1FZOB 4IRJD 5J11C 1FL3B 3ISWA 5E6ZA 4X5WB 4HPYL 1DL7H 4X5WA 5KS9B 5SWQB 5KS9A 2VZSA 5GS1B 4WUUD 5SWQA 4M7KH 1JZ2A 3JV6B 3WUWB 1H8NA 3HMXL 3JV6A 3WUWA 5EBWA 4IRSC 3KHOA 1I1AC 3LIZH 4FFZH 4ZO9A 1ODAA 2QHRH 2EDQA 3VD5A 4QTIH 5J0BA 2MJWA 2YD7A 5T3XL 4LPXA 4DUWA 3WFEH 3BZ4B 4KUCD 3PWPD 4OZIE 3MUHL 3GHEH 5ADOH 2O93L 4ISVB 1G9MC 3RL1B 2UYLA 5IMKB 3GKWL 4ISVA 4LSQH 2GY7B 2UWEB 4KZDL 5I74C 2UWEA 4DVBB 1RJYB 4DVBA 4HF5L 3T0DA 2M8XA 1A7QH 5DHYB 3T08A 5DHYA 5EFIA 1MY5A 4PYHA 1NDGB 1Z9LA 1NDGA 4DW2H 2AI0H 2UUDH 4PJHB 1WTLA 1BGXL 3T0EE 3VCLB 1INDL 2W1NA 3FCTA 1XGYL 2DQUH 3TCLB 1DUZA 3TCLA 3LD8C 4PJFE 3O6KL 1QTYT 1SY6A 4KQ4L 4HUKB 2FIRT 3ARBB 4JFXB 1BMGA 2FLBT 5DHVB 3ARBA 5I9QC 5DHVA 3I2CL 2EYTA 4XH2B 2PTUA 3D25A 1OAYH 4XH2A 3TO2B 2QQKH 3QDMB 5CWSB 1BQLL 1WAAF 1EJOH 1EEYA 4YC2B 2IG2H 3WD5L 5HVHC 5H35A 1GOHA 4YWGH 1J5OH 1CDJA 2PYED 3MA9L 2F53A 1ZHNB 4PJHF 4CMHB 3OKLB 2ADJA 4AK1A 1ZHNA 5DHXB 3CIQA 3OKLA 3WL9A 1J7VR 5I17A 2N4IA 2BNRD 4HXAL 1NAMA 1CYGA 3PABB 4BYHA 2YD8A 3KYKL 1N8ZB 3QUYB 5DQ9B 3QUYA 4GXVH 5HI4D 5DQ9A 2CKBH 5GS1C 1A6WH 4NDMB 4ONOA 4NDMA 2IFFL 4OZIF 1CE1L 1A5FH 2Q8BH 3MJGX 5JQ6H 4NQDD 4POYA 1S7VA 1L0QA 4S1SH 5MENA 3QH3A 1A4JB 1FNSH 4R0LA 5CGYC 4XC3L 5IESL 1A4JA 1CDBA 1NUFA 3S5LG 4WW2B 3S36X 2GQHA 4LQ1A 1MFEH 4WW2A 5JA9A 3TVMB 2PKDA 3UYPA 1DBAH 5M7QA 4OI9A 3TVMA 1XF5B 1XF5A 2J88H 4PLKD 3VG9B 3QNXB 3QNXA 1VB9A 4XNUL 3FO0L 1AD9B 1IGCH 1VFUA 4KJWC 1AD9A 1EZVY 1TJGL 1JNLH 4QRTB 3OJVC 4WFEE 4MJ5A 4QRTA 4TUJA 1BM3H 1WFOA 2E5EA 4PS4L 4XPGH 3MBXL 1FRGL 2P45B 1IT9H 4NBXB 4RGOL 3DNKA 4X9FA 4WUKH 3V0AC 1CZ8H 3CXDL 3HPLA 4M03A 4YX2H 1BFSA 3MRNB 3HI6H 1WZMA 2ZUTA 3WKMH 5BVJB 4LIQE 3VDCA 3MRNA 4MNQD 4X9BA 5BVJA 3HAEH 1REIA 5I0DA 4OT1L 5AYQA 4PY7B 1A6PA 4PY7A 4LPVA 5EU5B 2UVEA 5EU5A 3KJ4B 3ZDXE 3ARBC 3T0VA 2F54A 5I16B 3RJQB 4AH2B 4NJAH 4DN4L 4PJAB 5I16A 4JQXC 4AH2A 4ZNEA 3OKEB 4XZUA 3RU8H 2Z91B 1T1YB 3OKEA 5JNYA 4JZOB 2Z91A 1T1YA 2G75B 4JZOA 3ZHKA 5TDNB 2P5EA 2G75A 5TDNA 1X5FA 4YC2C 3UJIH 5LGJA 3DXAE 4YXLH 4YZFE 5C0EB 3S88L 1TQCB 4CMHC 4FZEH 1UT9A 4R2GC 2ZNWA 4I0PD 5CLTA 3V95A 4EDXB 3F65A 4EDXA 1T0MB 2O61B 4K94C 1FCGA 2O61A 2YD9A 1EGJL 3QUYC 4JFHD 4B7LA 5HI5C 1FGNH 2ZUVA 3RVTC 1UXSA 1JHLL 2NLJB 1HYRC 3QP3A 2NLJA 4LIQH 3ZTJH 2AAVA 1UWXH 1AR1D 3CGTA 4EQ3A 4XHQA 4PJAF 5KSBE 1CDIA 3I75B 5GISH 1MREH 1WTGT 3D0LA 4NZUH 4A2LA 5C0CB 3MJ9H 1I85A 3T2NL 1RUML 3ALPA 4WW2C 5FGBA 4MSWB 2EO9A 4Z7QF 4MSWA 4ELME 3TVMC 5JIHA 4FQ2H 4CRPA 3WIFB 2JCCB 5E2JA 1AGBB 3VG9C 2YK1L 4ZUWB 1RU9H 5D2NE 3JSSA 2YZ8A 4ZUWA 5IMOB 5IMOA 1MEXL 1HN1A 2CPCA 4TNVK 1QYGL 4NIKB 5C0JA 3NCMA 2KH2B 3FONA 1CXKA 2A6KB 4XCNB 3RFZC 1OL0A 2A6KA 3CLFH 4U2YA 5DZNA 1BWWA 3FAWA 4MVBC 1Q94B 4M6AA 5E94B 1Q94A 2I07A 3PWLB 1MFDH 5E94A 3PWLA 5I73C 3V4PL 3FMGH 2PR4L 1DL7L 1QHPA 5FF6B 4KJQD 5FF6A 4XCFH 4M7KL 1ZHBB 1ZHLB 1NC4D 1ZHLA 1ZHBA 3KJ4C 3MZTA 4Q6YA 4RMSA 5JXAH 3LIZL 2JCCF 2QHRL 4Z78B 4PJ8D 1J8KA 4QTIL 2EDBA 4Z78A 1FO0H 2VMFA 3LKOB 1RZ7H 4JZJB 3UXFA 4JZJA 2FLRT 4EN3B 2CJUH 3WFEL 1VENA 3GHEL 5IHBA 5ADOL 4TNWF 2X89A 1MIMH 2D9CA 1A7OH 4LSQL 2KDGA 1TQCC 3UPRA 3DI2B 5C08E 4L4VB 5TGBB 1WFTA 4L4VA 5C0BE 4UOW0 3W5NA 3KPSB 5I1IH 2VDLL 1X9QA 3KPSA 1WBYB 4WI2A 1BIHA 2YN5A 1QACA 1WF5A 2ZCHH 5JZ7C 4DW2L 1DEEB 2AI0L 1M7DB 5LKNA 3OKOB 1UB5B 3OKOA 1D5XB 4OI8A 4AIOA 1UB5A 3SKNB 1ITBB 3SKNA 1I85C 1WFNA 4OFVA 4KK5C 3RNQB 5DMIH 5FGBC 1HEZB 1B0RA 1HEZA 4XT1C 2WNGA 2NMSA 4LMQI 1XR8B 2OP4H 4HZAA 1XR8A 4X4XB 4DKFH 4LOUD 4F57H 5JPNB 2QQKL 1PY9A 4OUUA 5JPNA 5F88B 4UQ3B 1HYSD 5F88A 4UQ3A 2W59A 5CMAA 1EJOL 3UTSB 2IG2L 3BO8B 5GJTH 5AG8A 3UTSA 2E7HA 2APXA 3CXHJ 1J5OL 4Z7OE 3MV9D 2J8UF 3MUY1 1E4WH 4N90E 4FXKB 2EEDA 5DRWB 1RIHH 3HZYA 5EIIB 4YHZH 4GXVL 2CKBL 1A6WL 1A5FL 4XPAH 5JQ6L 3AS0A 3B2VL 4S1SL 1FNSL 2Y07H 4FQXB 4JZJC 1MFEL 3CPLB 4EN3C 1DBAL 3CPLA 3CLEH 5BO1H 5E9DE 1J87A 4NM4H 4XI5C 5I71B 2J88L 1JI1A 4PLJD 4LSPH 1IGCL 4AY0A 4JFEE 3NCJL 2XQBH 2XQYG 4I1NB 1JNLL 3QYCA 1NGYB 3LMJH 1BM3L 5L88H 5IBUG 1Z0MA 4EIGB 2HT2C 2R0KH 3PG2A 5DVMA 5JW4N 4L4TB 1CZ8L 5D71H 2A9MH 3V0VB 4L4TA 2R29H 5H8DA 3V0VA 3HI6L 1NFIB 3GSNB 4E41A 3BKJH 1NFIA 3GSNA 5E5RB 4P2RE 5CJBA 3RY4A 4X5XB 3R06B 4X5XA 1JBJA 4F3FB 1WFUA 4NJAL 2ZOLA 4LFHG 4M9OA 3TT3H 3EBAA 1DQQA 4GW5B 4WTZA 3RU8L 1LEKB 5HBBA 4H0IA 5F6HJ 1LEKA 1AD0B 3SKJH 1AD0A 4W68A 5TF0A 1FFPB 5I8OH 1FFPA 3D2UD 2B1HH 1YNLH 2AW2A 3BN9C 3HPJB 4N8VB 3UJIL 3HPJA 5H94B 4N8VA 1EUUA 5H94A 4XNMB 4YXLL 1O5DT 2A73B 2EEBA 2J8OA 5IB5A 5I1JH 2FB4H 4XNMA 3RWDB 2A73A 5DLML 3RWDA 2HYMA 4Z7UE 3U0WH 1UZ8A 4POZD 5JR1L 4XPHH 2VLJE 1FGNL 1P2CB 3WDIA 5I1AB 4PJIB 3EJYD 1P2CA 4LIQL 4PJIA 4M1GH 5DUMH 3A67H 1WIUA 4JRYE 1J11A 5D7LE 5GISL 1MREL 4XCYB 4NZUL 5J13B 4XCYA 1JNJA 2EXYC 1AO7E 1BVLA 4N8PA 4D9QE 3RDTD 4FQXC 4M7ZB 3ARZA 4P3CH 3ZZ1A 3SGEH 1U2CA 2K7QA 5HHPB 2BHZA 1IKNA 4FQ2L 3ECBA 3MRFA 4WO4D 1JL8A 2DL9A 5HHPA 5I71C 4OGXH 4UB0H 5FKAB 4EUPB 5FKAA 1RU9L 4EUPA 2MSPA 4WEUD 4GS7B 5EZJB 5C1MB 3GI9H 3KPLB 2ATKA 4WFGE 1XZ0B 4XX1E 3KPLA 4E42B 4E42A 2BVQB 3CLFL 5J1TC 1YMHB 3KG5A 3VDBA 3T3PE 3PDGA 1MFDL 5C0RL 5JW5B 1CL7L 1EUTA 3CUPB 4MHHI 4OV5B 5JW5A 3QEQB 1U93B 3CUPA 3FMGL 2RJMA 3QEQA 5DJ6B 5GS0H 5DJ6A 4LCWE 4Y4HB 2DWDA 4Y4HA 5C9KA 5FYKD 1Z6JT 2BNQD 1PKQE 2Y1VA 1HHIB 5JXAL 2Q76B 1HHIA 2AV7A 1LEGB 2Q76A 4JRXE 5I6XB 5FOBB 4J8RB 1LEGA 5FOBA 1ZLWK 1FO0L 1PFCA 3ZL4H 5GZND 3RRQA 4M1CD 4UINH 2CJUL 4U1KB 2X1XR 3D39B 1JZ4A 4U1KA 3D39A 4NQEB 4HFWB 1IRAY 4NQEA 4HFWA 2ED7A 4P9HC 4HWEH 3IFLL 1MIML 3QIBB 3GJFH 4WNQA 3VGEA 1A7OL 4LRNH 4C58B 2JK5A 1JPSH 3NTCH 1ZA3B 5D96B 2F5AH 5MEPB 1ZA3A 5MEPA 4J3VA 1U8KB 3IF1B 2EDLA 5EOCJ 5I1IL 1U8KA 2NTFB 3IF1A 4JHAH 4HSQA 3HE7B 2NTFA 2LFGA 3TBWB 2ZCHL 1I1RA 5IR1A 3TBWA 2V2WB 2V5MA 2V2WA 3MNWA 3IGAB 4AENA 1CICB 5DMYA 1X4YA 4LBEA 3MLRH 1CICA 4UNUA 5JORB 1P6AB 1KCVH 4IEFB 2NYYD 1OP3H 5J13C 5JORA 3N85L 2MPAH 5GGUB 4RGND 4XMLL 4M7ZC 4CUCA 5GGUA 2OL3A 3UAJD 1B2WH 2OP4L 1IKNC 1MFAH 1I1FB 1PGRB 4LCYB 3RAJH 5KSVB 2W9DH 1EEUA 5KSVA 3GB7B 4DKFL 3WIHA 4F57L 3GB7A 3BMVA 3DMMD 3MV7A 4KV5E 4EI5B 4GS7C 1MRFH 2DJ4A 4FFVC 4DEPB 4EI5A 3FFCD 2KZ1B 3BKYH 1UWGH 1NEZG 3VXQB 3VU2A 5GJTL 5FV1L 2HTKC 3VXQA 3MRIB 3T77B 4LARL 3QIWD 3MRIA 2BXZA 3T77A 4KKAD 3AROA 2BRRH 2EZ0D 3LRGA 5CINH 1E4WL 2F8XC 1IC4L 5E8OB 3BH8A 3RWJB 3QXTA 1MJ7L 5E8OA 1RIHL 3RWJA 3OJ2C 3SDCB 3IXTB 5KOMC 1FNEB 5I66A 4Y4HC 4APQB 3SDCA 3IXTA 4OCYH 1FNEA 4APQA 4FA8A 3RVVD 2ITCB 4HBCL 2HWZH 4XPAL 3QBTB 2ITCA 5AG9A 4BZ2L 5I6XC 1AC6A 1BREA 5IK3B 3FT2B 2Y07L 3FT2A 3LCYA 5DZOA 3X12B 4Y1AD 2M26A 3X12A 5IHZB 1NMBH 4NC1E 3T1FB 2VXUH 2IADB 4KROB 5IHZA 5JUEH 3Q6FA 2NY1B 3FTGB 4KK9C 4LSPL 2R9HD 3EDJA 3WIIH 5IEHA 5D96C 2V5SA 1UEYA 4OZGF 1FAKT 3QQNA 2D7OA 3LMJL 4BQ9A 3S37L 3BD5A 5L88L 1QSED 3SJVB 4PRDB 3HE7C 3SJVA 3LB6D 2R0KL 4JB9H 1AFVH 1BJ8A 2AXJA 2A9ML 1IEBB 3BP5B 4XP4L 2R29L 5CCKH 3PL6B 5IQ9B 1IEBA 3BP5A 3PHQB 5IQ9A 3PL6A 1F4XH 2BOCA 1CICC 2BVPA 3PHQA 3BKJL 4TVSa 5SWSE 1XF3B 1P7QB 1XF3A 4OLWH 4BH8B 4O51B 5DD6B 2VDQH 4GRMB 4HUXB 1F11B 1RUQH 4O51A 5DD6A 4HUXA 3KLAB 1F11A 1IGJB 3L3JA 4GUPB 1U2HA 3KLAA 1IGJA 4AEIH 3O2VH 1I9RH 3R0MA 3TT3L 1ZGLM 5IEKA 1DBMH 4H1LH 3JV5A 5F7YC 4Y4FD 5TQ0H 3QCTH 4EI5C 4HUNB 3O8XB 5EO9B 4DEPC 3O8XA 5EO9A 2ZJSH 2LTQB 4DFHA 2B1HL 3O41B 3MLWL 3PNWA 3O41A 1YYML 4PJEE 3QISA 1WZKA 1OWRM 5I1JL 1U6AH 2FB4L 4CU8A 1T04B 2DKSA 3MLTA 3U0WL 1T04A 4B5EA 2NQCA 1IAIH 4UU9B 1KLFA 2NY3D 3TT1H 4UU9A 4H5SB 5F9OH 2P8LB 4LPTA 4H5SA 3HC0A 1XGUB 4YBQC 3SDCC 2P8LA 4XPHL 5E8NB 4APQC 3BWAB 1W8NA 1E27B 5E8NA 1RHHA 3BWAA 1P4BH 4HZLB 1E27A 2IALB 1TDQA 4M1GL 3PQYB 3BPCB 3U1SL 2IALA 4JKPH 5CEZE 3H3KA 3BPCA 1MQKH 4PJXE 4UBDC 3WLWC 2X1WL 4X7EC 5A43C 2C4XA 1PX3A 4YUEL 1D9KD 1HILB 4P3CL 3S5LA 4Z7VB 5LQBH 4Z7VA 5KBNC 2WLYA 2GK2A 3CAFA 2NZ9C 1LP9B 4KROC 1CXHA 2RAMA 4UB0L 5DD1H 3EOBB 1QSZA 4HH9B 2P5WD 25C8H 4HH9A 5EULV 3QG7H 4OLEA 3C60D 4KAQH 4JO3H 3QRGL 1C16B 3GI9L 2OR8A 4OFIA 1NQBA 2PN5A 1QRNB 3SGKC 5L6YH 4IOFC 1QRNA 3PGCA 2BSED 3RIAF 3PL6C 2DJUA 2C1OA 1J8HE 3G04B 3MX0A 4U1LA 4YHYB 3G04A 3WKNA 4M62H 4NWTH 5SWZB 4ZFOB 5GS0L 1EAPB 5SWZA 4ZFOA 4OF0A 1EAPA 2EIDA 5CEZH 4Z7VF 5IV2B 2XTJD 4WY7L 5IV2A 4P3DB 4QRPB 4NO0D 4P3DA 43CAB 1LP9F 4QRPA 3SE3A 5GS2H 2HT3D 1V3KA 1N2RB 5I75B 3O8XC 1N2RA 4G8IB 3ZL4L 1R3LB 4G8IA 3LPWA 4UINL 3DETD 4ODXB 2LTQC 1JYVA 1R3LA 2XKUA 3O6MH 4ODXA 3AU1A 3ZYJA 2R15A 2I9LA 4HWEL 1L6ZA 1MSPA 2ZUSA 1XCTB 4OIBA 4NPYB 1XCTA 1HCVA 3QJFB 1LD9B 4NPYA 5J3HD 4LRNL 5ESQB 3QJFA 1LD9A 4ZOCA 3NTCL 5ESQA 5HHXH 2F5AL 1KV3A 5A1AA 3OG4B 2XZQH 4TYUA 1L0XA 5IB2A 1G9NH 2P8MB 2ED9A 2P8MA 2VNCA 3ZDZE 5BS0B 4PFEA 4P23B 3N1MC 5BS0A 3OHXA 5HDOA 3VXSE 5DVOA 3S35L 2VLRB 3NZHH 3RIFK 4X9IA 3GJEB 2VLRA 3OJDB 3MLRL 1FQ9C 2GK0B 1SJXA 3GJEA 1KCVL 3OJDA 2GK0A 3RWEA 3DSFH 4FTVE 4Y89A 4K23H 1B2WL 1MFAL 1SYVB 3RAJL 4NO5B 2W9DL 1KCRL 4CDGC 2LQRA 2QV2A 2H41A 1JJUA 4CADA 4H26B 5J4MA 5FB8A 4H26A 4MAYB 1CFNB 1YPZE 3OXRB 4PV9A 3BKYL 1CDUA 4NRYB 4MAYA 1CFNA 1UWGL 1ZK9A 3L95B 3OXRA 4JPWH 3L95A 1BD2B 1V05A 3U4EA 1BD2A 3WE6B 1DUYA 1E4JA 3P2TA 2BRRL 3CSGA 3RZCB 3RZCA 5CS7A 4YHYC 3TO4D 2WP3T 3F5WB 4LVHB 3F5WA 3LRHA 4OF7A 2JB5L 4Z95H 3LN4B 1AI1H 3V6ZA 3N1PC 4R26H 3LN4A 2HWZL 4XRCB 4XX1G 5HYEA 5KVEH 5EZLB 3SE3C 5EZLA 1N4XH 1NC2B 5C0AD 2JJTA 1NC2A 1EGJA 5L2KD 3PJSB 2QQQA 3PJSA 4XNQB 1Q38A 4XNQA 3RWFB 3BIBX 5MI0B 1DQJA 3RWFA 2YUXA 4OD2B 1ZLSL 4CDHA 2X7LB 4OD2A 1YMMB 3V4UL 2X7LA 1YMMA 2AXHA 1MCNA 1N59B 3WIIL 2GT9B 5A2LH 3ZKMC 4P2QD 4F7CB 4JB9L 1AFVL 3MRGB 4F7CA 3O9WD 4P23C 3MRGA 4X7CC 3RUGA 4LLVB 2CK0H 1F4XL 3B83A 5C0DA 2IFGA 4R3SA 5DK3A 1JWSA 1RFDL 1ULVA 3PGDB 2GI7A 4OLWL 3PGDA 2VDQL 1FIGL 3RL2B 5LJYH 1RUQL 3KLHD 2VZ3A 3RL2A 4I0KA 3CJJA 4AEIL 3FRUB 2WMPA 4YPGB 3O2VL 1C5BL 4QY8B 1I9RL 3FRUA 3LZFH 4GKZA 1DBML 4YPGA 2KQMA 4QY8A 1F4AA 1NH6A 2I60L 2QSQA 1S78D 5TQ0L 3QCTL 2ZUXA 3W2DH 2VZTA 2YSSB 2LU4A 3LKRB 2DWEB 2VYRE 2YSSA 2ZJSL 3LKRA 4MAYC 2DWEA 3MXVH 2X4SB 2YA2A 5LG1A 1V7MH 4ORZC 2X4SA 4R8WL 3PP4H 3N50A 5C07E 1C1EH 5JOFA 1U6AL 3VFRB 3KPQB 3FB7B 3VFRA 5EB9A 3RZCC 1L4IA 1QD0A 1IAIL 3HUJF 4BFGA 3TT1L 1NKOA 5F9OL 2PYFA 4LVHC 2Q1EA 1OSZA 3MODH 1NSNL 2WM0A 4QOKD 2FR4B 3RHWK 2FR4A 4JKPL 2Z8WC 1MQKL 5CEXB 2JJTC 5CEXA 4FQHB 4FQHA 1BFOB 5EU4B 5LQBL 3O6FD 3BEVB 1BFOA 5EU4A 3TA3B 5JO5A 3Q5YA 3BEVA 2P7TB 3VFVA 5MI0C 2P7TA 3TIDB 3FJTA 5J89A 3TIDA 5DD1L 1TENA 2Z35A 3FB5B 1MH5B 4X83A 3QG7L 3FB5A 1I3RA 1VCAA 4M4PA 1YEHH 3QQ4A 4MNGE 4JO3L 4OGYH 1FG2A 3ZDYF 3GK8H 2VUYA 1QSVA 4HG4K 5L6YL 3REWB 2C3VB 3REWA 2FGWH 1S9WB 2C3VA 5ESAB 4PR5B 1S9WA 4HJGA 1QA9B 4V2CB 4PR5A 5ESAA 5HI3D 1I1CA 2VIRA 3EO9H 4K71B 1QA9A 1D5BB 2FH6A 5ID1B 4M62L 1D5BA 4O9HH 1JYXA 5F7MC 5AUMB 4NWTL 5ID1A 1MRDH 4X5LA 4TPRH 3QUXD 1RAMA 5CEZL 6FABL 4ZMAT 1RULH 4JO4H 4TTDC 4POUB 3RWGB 2YKLH 35C8H 3RWGA 4HEPG 4F7TB 1F2XK 1KB5H 2CKBB 3WYRA 4ENED 3ILQD 2CKBA 4HJJH 3ZE1E 3IRPX 4OLZL 3UYRH 1W72H 3IYLW 4DK6A 1UM4H 3O6ML 3JUZA 5HD8C 4IJ3C 3PWVA 1SEBB 4PJFA 4ZUTB 1SEBA 1UM5H 1CDHA 4X7SH 2ZPKH 3IS0X 3KPRE 5FKPB 3TBTA 5HHXL 4PRIE 5FKPA 2L0DA 5MHSD 2ZG1A 4IRSD 1I1AD 2XZQL 1MCHA 5ALBH 1JF6A 1G9NL 5AEAA 3E0GA 4HW6A 4LF3B 1OGAE 4DVRH 4TTGA 5HDBE 4LF3A 3P0GB 2DMCA 1UKTA 4L3EB 4IRZH 4P57A 3C09B 1WGOA 2Z8RA 3C8HA 3DSFL 4L3EA 3W9DB 2E7MA 3W9DA 1KSRA 4MXWH 3NCCB 3TA3C 3C6LB 2CGRL 4OGZA 4G6FD 1DQML 4HWBH 3C6LA 3GRWH 5BW7A 3HAEB 5HYJD 4Z0BH 3HAEA 3ZE2F 1II4E 2VLLB 3DGCR 4W6YB 1D5ZB 2VLLA 4HGKC 3NZ8B 4LHUD 3RP1A 3V6OE 1S7QB 3C5JB 4U1NB 3LKNB 1S7QA 3C5JA 4U1NA 4S11A 3O3BB 4HS3B 4JPWL 3O3BA 4HS3A 3ROLB 3MRCB 3MRCA 43C9A 4GRLB 1VESA 3VFSA 4P48A 2PW2A 1Z9SA 3HB3C 3MTRA 4K71C 3KS0J 2VLKE 3GSOB 4YDKH 2JB6B 3GSOA 3HFMH 1Q0YH 3P9MB 1FDLH 2JB6A 4ODUA 4Z95L 3P9MA 1KLGB 1AI1L 3GGWB 1KLGA 3GGWA 2FJGB 1KCKA 5KVEL 4ONHA 1X5IA 2XN9D 4KJYB 1E0OB 2X1OA 1T3FB 4NP4H 3EGSB 4KJYA 2R8SH 4KI5E 1TVHB 3HG1B 1TVHA 2DQJH 1YEDB 5E8EB 4ZQKB 3AS2A 1YEDA 5E8EA 3W0WD 4ZQKA 2ITDB 3SGDI 4JM2A 3HMWH 4OIIH 4YO0B 1QP1A 4FNLL 3H9SE 4PY8J 4S1RH 2DQFB 1K8DB 4P2YA 2OR9H 2B5IB 1K8DA 3G9AB 1RI8A 4PJCB 3VXUE 4PJCA 3HN3A 3VI4F 2UVFA 3M45A 3FB6B 4K3HA 3FB6A 5CGYD 3MOAH 3W39B 2DICA 3QNYB 4Z77B 3W39A 4WU5B 4NQCE 2V9RA 5E70A 4Z77A 4WU5A 1AGDB 4X8JA 2PXYB 4OSUH 3DXAB 2PXYA 5ANME 5ISZE 3C87A 4KRPB 3DXAA 3C09C 3DWTA 4RWYH 4XP6H 1Y18B 5CP7B 1Y18A 4F37F 5CP7A 3WNLA 4QGTA 3IDYB 4KJWD 1SEQH 1W0YT 3RWCB 3C6LC 5BW7C 3RWCA 2GW5A 3OXSB 3LZFL 3OXSA 3TPUA 1X7QB 3RNKB 3BKMH 1X7QA 3RNKA 2BK8A 5EU6B 1KJ3L 3VA6A 5JMOC 4RMUA 5KSBB 2DQDH 2R2EA 3MOQA 5JDSB 5KSBA 4PJCF 3MXVL 1V7ML 3OG6B 3IAQA 3PP4L 4LNVA 1FO0B 5LGHH 3WSQL 4ELMB 1MJUH 1C1EL 4M00A 2JJSA 5I30H 1FO0A 4ELMA 4XPFH 1D6VL 4GRLC 4X6BA 3CFCH 4LKCA 2PTTB 5E8DH 4GMTH 4HQQH 2PTTA 1BQUA 3TIEA 3ARBD 5ITFA 5ICYB 1KJ2H 5D2NA 4GKSB 1MWAB 4PRPE 4GKSA 1MWAA 3MODL 5JIIA 5JW3H 3L5IA 4WUUE 2DI8A 2OTUA 2G9HA 5LBSH 2DM3A 3AFLA 1MAJA 1UJ3A 1C5DB 2F8OA 4HT1L 4MCZB 1C5DA 4MCZA 2PETA 2F53D 1IC5H 3BYTA 2UUDK 4OQTH 1HWHB 4R2GD 3X13B 1RZFH 1RJCA 2HMIC 1NCNA 4G5ZH 5I1GL 3L3HA 2E9BA 5IHUH 3QUYD 2WW8A 5HI5D 4C56B 3RVTD 2C9AA 4XAKD 2B5IC 1YEHL 4B41A 1G0DA 1HKLH 3K4AA 2X2YA 2VC2H 3ZE0F 4EXKA 3GK8L 5MEND 4C54A 2EKJA 2ESVE 2FGWL 5IF0B 5DQDH 4YIQB 3QI9A 1MPAH 4YIQA 4XTRC 2PXYC 3EO9L 3TVMD 5DJZB 2WSKA 3UZEA 4H0GA 1DLHA 4KRPC 4O9HL 4RAVB 1OAQH 3EJZC 3F7YB 4JFZH 4RAVA 3MRLB 2C3WA 1QFWM 4TPRL 1PW3A 3MRLA 3ZYOA 5C08B 5C08A 3IDYC 3NVQA 3QWRA 1RULL 5C0BA 3BDYH 4JO4L 1F02I 3ILPB 4XC1H 4DZBB 35C8L 4O58L 1IEAB 4DZBA 4MZ3A 3PDDA 1IEAA 2I9TB 1KB5L 2I9TA 3V8CA 2DQIH 4MVBD 1OT1A 2XY1A 3UYRL 1CBVL 4Z8FH 1W72L 4CJ0A 3DX9B 1UM4L 1FZMB 3DX9A 3TLRA 4XVUC 1MVFA 2JJSC 2H1PL 1U8IB 5KVFH 4DTGH 2Y5TA 4X7SL 3NH7H 2ZPKL 1DR9A 3TNMA 5IVNA 4Q74A 3C2SA 2F54D 1BZ9B 3CSYA 1U9KA 3UZQA 1BZ9A 1NUDA 2BNRE 5ALBL 3SY0B 1N64L 3SY0A 3IDNB 3M17B 4DVRL 1C7TA 2P5ED 2G5BB 3M17A 1XR9B 2Y9RT 2G5BA 5ID0B 1XR9A 3OAYH 1G7HB 1NUNB 2Z4QB 1G7HA 5F7KC 5CILH 1TQBB 5FYJD 1J9CT 4HIHA 1PG7H 3QXWA 1H3PH 3V5DB 2VXSH 3B3IB 3FQWB 3V5DA 3B3IA 4MXWL 1D6EB 4UIMB 1D6EA 4HWBL 4OKVB 3MV8E 5T1MB 3GRWL 5CUSH 4D9LH 4OKVA 4Z0BL 4KQ3H 1QFOA 4EI6B 1AKJA 1TZHB 2VLME 3SPVB 2F15A 2OBGA 2QTEA 3I9GH 3KYOB 4NSKA 1TZHA 5HTSA 3MLUH 1IM3A 4CU6A 4EI6A 2EDJA 3HHRB 4MXVF 1SMOA 3OMZA 5JZ7D 4NT6B 1NGQH 2HFEA 4NT6A 3P0VH 4ZOEA 4EOWH 1VACB 2APTA 1VACA 2QADB 2W0KA 3LKPA 5E00B 4YFLI 4RGMB 5D6CB 1DANU 3CH1B 4KK5D 4NHUB 2P46B 1XGPB 1F6FB 3GSQB 1CIDA 5DMKB 3QUMH 4OCXL 1CN4A 1XGPA 3GSQA 5DMKA 5BMFH 4NQDB 2GITA 5M94B 4YDKL 1CD9B 3OKKB 1S5HA 4W4NA 4JFEB 1FC1A 1Q0YL 3OKKA 4CVZB 1FDLL 5HXMA 1ZSDB 2P4AB 4JFEA 4CVZA 5K9JL 1J1OL 1NLDH 3NCEB 1ZSDA 3REVB 3BH9B 4JCMA 2GHWB 3BH9A 4F7EB 4F7EA 4K7PY 4NP4L 2R8SL 3QSKB 3GIZL 3LQAH 4TSBH 5D8JH 2CXKA 3E6FB 2JIXB 1BVKB 2MCPH 4L5FH 3E6FA 2JIXA 4J6RH 4RAUB 1BVKA 2DQJL 1G6RB 3FL7A 1A4KB 1FYTE 4C57C 1A4KA 1I3GH 2PNDA 1Q1JH 1ZOXA 1UWXK 3FN0H 1FL6A 4HXBH 1CFBA 4P2RA 4MQ7A 3VFTB 1I9IH 2EXWC 3VFTA 4N0UB 4OLYH 3FO2B 5KAQF 3LDBB 3FO2A 3BT2H 4S1RL 2NY7L 5FV2A 1PZ5B 1RZ8B 4BFBD 1PZ5A 1CIUA 2UZYB 2SEBB 4QKXB 5J6HB 2SEBA 4YDVB 5I0ZA 2R1WB 1RIUL 5J6HA 4K55A 2EH7H 3CFDA 2ARJA 1JP5A 1U95B 4ODTL 4U6YA 3VFPA 5HGBB 1G7PB 1H9VA 2VDNH 5HGBA 4QRSB 1A6AA 1G7PA 4QRSA 1KOAA 1TQBC 4XI5D 2X89D 5F7LB 3ZKNC 2A2QT 3PWJB 5BOPA 4XP6L 2VB5A 5D7IB 4Z7UB 3O81A 1QVOB 4Z7UA 4X0KA 1TJIH 3QPQC 1QVOA 5HVGB 1SEQL 2HFTA 3SQOH 4L4VD 4X6DB 4NN5B 4JPVH 2VLJA 1H3UA 3BKML 3KPSD 2EDOA 1CGTA 2HT2D 2M1KA 4JRYB 4LU5H 4FFYH 4JRYA 2B1AH 4PREB 2DQDL 4H8WH 4PREA 3TEUA 4LDOB 1D5IH 1JPTH 1AO7B 4XP9H 1KC5H 4IMKA 4OF3A 2QADC 3V6BR 1AO7A 4Y2OA 5L2JB 3GSWB 4DK3A 5LGHL 1MJUL 5I30L 3GSWA 1JI2A 2FSEB 4XPFL 2FSEA 3CFCL 2AJUL 4NNPH 1KEMH 2R2BB 5E8DL 4EXPX 4GMTL 4HQQL 2R2BA 3EFFB 3U0PB 5B3JE 3EFFA 1HHJB 3U0PA 1KJ2L 1HHJA 1JF1B 3VE0A 1JF1A 5D7IF 1GH7A 5JW3L 4AQOA 5GGSB 2F58H 4LDLB 4QYOB 2WZPD 3UJJL 1BPVA 3KWWB 4X6DF 1KYOK 2BFVH 3KWWA 4JFOA 5LBSL 3UTSD 4X8XA 2DM2A 3BN9D 1JFQH 1MJJB 4JN2B 3SDXF 4JN2A 3BRFA 4OD3H 4OQTL 4I4WB 1NKRA 4LSRH 1RZFL 4I4WA 4PRBB 3JWOL 4G5ZL 5IW3A 5IHUL 4JN1H 1LQSR 1NGZB 2VDMH 4CKVX 3MCG1 3NA9H 3LDBC 1NGZA 2GEEA 1ZTXH 2E9IA 1PKQA 2P1YA 4LGPB 4JRXA 1HKLL 2NXZB 1TVBB 4M6ML 3S7GA 3QJHB 1T66C 3ARDA 2H2PC 1TVBA 2YUVA 1RJZB 4GSDH 1ZT1B 1CLOH 1RJZA 3DJ9A 2IPUG 1ZT1A 2EXYD 3CDFA 4F58H 4FHBD 4EKXA 1MPAL 5C6WH 3DO7B 3MGOA 2GTZB 3GHBH 4HS8H 2GTZA 12E8H 1NCUA 3RI5F 4JFZL 4ZSOE 3ZLQC 3T1WA 1GZPB 3RA7H 1WT5A 1GZPA 3DBXB 4K3EH 5D2LB 3DBXA 1T7XA 1FORH 4PJGE 1U8JB 3BDYL 4KK8C 4NN5C 4XC1L 1QKZH 1U8JA 3BX7C 1BX2B 5GS0C 1P53A 3UPAA 1BX2A 4KXZI 4DZ8B 1ORQB 1ORQA 2EDKA 4AJ0A 4PRNB 5EIQA 3IS1X 1GGYA 4L4TD 2C26A 3ROOB 4Z8FL 1WJ3A 2BVEA 4IMKC 3ROOA 4E41D 4YHMH 3L3GB 1KT2B 1NFKA 3L3GA 2CUIA 3WS6A 5KVFL 4DTGL 1ZVHA 3NH7L 3UCRA 3HI1A 2Z31B 1MIEH 2BJML 4NWUH 5KSUB 2Z31A 1JYNA 2EDXA 1PG7W 3T0BA 3T09A 3CK0L 4LLAA 3LAFA 4MJ2A 4NJ9H 3EOYG 3Q1SH 4I48B 1WC7B 1WC7A 1X4XA 3H9YA 3D3VB 1IL1B 5D2LF 5DA0B 4BKLB 3D3VA 3NBNA 5E5MB 4KJPC 4I18B 4G43A 5CILL 3DVGB 5C2BH 1PG7L 1H3PL 3DVGA 2VXSL 5AAWA 4HEME 3WNKA 2HFGH 4D9LL 2OTWB 3TH4T 4KQ3L 2OTWA 2IPKA 2CDGB 3MV9B 4XMKH 5BRZE 3I9GL 1K5NA 2CDGA 3MLUL 3QCUH 4B50A 1YEFL 2HVJB 4BQ6A 3OGCB 4GRWF 3P0VL 2NXZC 4V1DE 4EOWL 1ORSB 2X4NB 3OGCA 3RBGA 1ORSA 2X4NA 1T21B 4H1LB 1GJIA 4H1LA 4YR6B 3D9AH 1PSKL 1A0QL 4YR6A 2C3HA 1IGFL 2N7BA 5DZLA 3BP7B 3QUML 3BUYB 3SCMB 3K74B 3HE6B 3SCMA 2DBLH 2X4UB 5FM4A 3HE6A 2X4UA 3IDXL 5DC9B 1UYWH 1MUJB 3J8F7 4LSVH 2VUOA 4ELKB 4NNXA 1WQVT 1MUJA 1YY8B 4ELKA 1NLDL 1RK0B 1WT5C 3I6LD 4G8GE 1P6FA 1YY8A 1RK0A 5HPMB 4FFVD 2AQ2A 4WV1B 1DJSA 4WV1A 3I6KB 3LQAL 4TSBL 5D8JL 3I6KA 2ORBH 1CR9H 1BQHG 2HTKD 4L5FL 2MCPL 2CLZB 4J6RL 4U49A 2CLZA 1TLKA 3M1BB 5EZOH 4BA8A 1J10A 1I3GL 1Q1JL 1QSFE 4HXBL 5SWSB 1P5VA 4P49A 5SWSA 5GGVH 3S6CA 3QEQD 3WHXB 4OLYL 3WHXA 1MNUH 5HVFB 2IMMA 4Y4HD 3MV11 3BT2L 4MD5B 2Z31C 4UUJB 4MD5A 1A22B 1OTSC 3I84A 4MJIE 3CFJB 3IFNH 4ZO8A 1LGVA 3E3QE 2EECA 1IKFL 3FQRB 2HLAB 3O3EA 1V3JA 4LAQH 4D0BA 2NY6B 3FQRA 2HLAA 1KPVB 2IH1B 1KPVA 1LILA 2VDNL 3D39D 4PJEB 3BP6B 3C8KB 4I18C 5GZOC 4NQED 4PJEA 3BP6A 3QAZB 3H9HB 1IBGH 5HHME 5GGQH 3H9HA 4KKNA 1A7RH 5HPOA 3TWCH 3BGMA 3LY6A 4KK9D 3OGOE 2ZWLT 4JFFB 1CVSC 5F7HA 1TJIL 2ENYA 2QQNH 2QBWA 4JFFA 2EDWA 3SQOL 4TVPD 3WDHA 1A9BB 1Y6MR 1E6JH 1A9BA 4F80A 1EHLH 4OLVH 4HS6B 2JELH 4LU5L 4HS6A 4MX7A 4RFOH 4FFYL 4PJXB 1JNHA 2B1AL 4PJXA 5DYOB 1QQDA 4OCWH 5DYOA 3EHBD 1D5IL 4I2XB 4XP9L 2BC4A 3EIFA 3L3IB 1CICD 3JV0A 4I2XA 3L3IA 5EO0A 4Y5VB 2V9QA 4JHWL 4G9FE 2AK1H 4NC1C 4NNPL 2D0FA 3D5OF 3T4YB 3SCMC 3T4YA 4A6YH 3HE6C 4G9DB 4G9DA 3NA4A 3GJFK 3MV7D 1NPUA 2EIZB 2EIZA 3RQ3A 4P2OB 3EW3B 4EI5D 5DK0B 4QHKI 4P2OA 3R8QA 5DK0A 3LPGA 4WV1C 5DJCB 4PD4J 2ICES 2BFVL 3SKUD 5DJCA 4BH7B 4OIAA 4MA1B 5I1EH 4BH7A 1IAOB 1JFQL 2FNBA 5B8CB 1NBYA 1IAOA 3PV6A 5BZWB 4X6CF 5B8CA 1J8HB 4Q58C 2BHUA 2EDYA 3BUTA 5BZWA 1J8HA 2FHFA 4OD3L 2QR0B 1OB1A 4KKBC 2QR0A 4LVEA 4LSRL 2GJJA 5ELIA 5IWLA 3KYNB 4JN1L 1OP3K 3NA9L 3KYNA 4YBQD 3SDCD 4U0RB 3KXFB 3VRLF 4APQD 5DMJB 3KXFA 2DIBA 1ZTXL 1OAZL 5ETUB 5ETUA 3UJTL 3K2UH 4UBDD 3WLWD 1CLOL 3MRDB 3K0WA 3MRDA 3L9RB 3FO1B 2NY6C 4F58L 3L9RA 3FO1A 4P59H 1M6OB 5IMLB 1B0GB 1A1MA 1M6OA 5I1DB 3GHBL 4HS8L 1B0GA 4M7JH 2FJFB 5I1DA 1HXMB 5DEZA 12E8L 2FJFA 3QAZC 1ACZA 4KROD 5L8KB 5K9OB 1T6WA 4PRAB 2D7NA 5K9OA 1RURH 1EBPA 4PRAA 1WCQA 4PBXA 2HH0H 3MRJB 2YPVH 3RA7L 5FCSH 4FG6C 1LE5B 3MRJA 1J86A 1LE5A 1FORL 2BSRB 5GGVY 3B9AA 1PQZB 1BJ1H 1FPTH 1PQZA 1CF8H 2K3TA 3SJVD 1HKFA 2YS4A 4IOFD 4M7LH 3VXSB 3QZWG 3GO1H 3VXSA 1YEKH 4Q9RH 1S7SA 4POZC 1P4LA 3PL6D 3FFCE 3H3BC 3WJLA 1JIBA 4YHML 4MHHG 4WEMB 5I2IB 4LLWA 4UTBH 4FTVA 3OAUL 4UAOB 4Y5VC 1NCTA 3ULUE 2YD4A 1MIEL 1CU4H 1IC7H 2EDHA 4P0DA 1AGFA 4I3SL 4PGJA 1S3KL 5CSBA 5INCB 1BAFH 5INCA 3UTPD 3NFSH 4NJ9L 1RSFA 1KPUB 2EKSB 2O5ZH 1YPZB 4P2OC 1KPUA 2EKSA 1YPZA 4AEHH 3O8XD 5FECB 3ARFB 5FECA 2LAAA 3ARFA 5HHQB 1F6AB 4MA1C 5HHQA 4JPIB 1HH6B 5IMMB 5B8CC 4JPIA 5IMMA 5T3XD 4NBYB 1X5HA 2HFGL 5IWLC 4NUGH 2XPGB 4E5XB 2XPGA 2FYYB 4XMKL 5CIPB 3VFMB 4JVPA 4U0RC 5CIPA 3VFMA 5TFSL 1QBMH 3QCUL 1J12A 3PQYD 4XHJC 5D7JA 2BCKB 3CC5A 2BCKA 3QCVH 3ULUH 1T5XB 1PYWB 3D9AL 1T5XA 3TJEH 5F9WB 3ARSA 5BOZG 3GMPA 4G80B 3O3AA 2DBLL 3DARA 3IKCB 2XV6B 4G80A 1X5AA 3IKCA 2YOCA 4RMQA 3EYOB 3AREB 1UYWL 4LSVL 3EYOA 3AREA 4Y19B 4PJ7E 3TBYB 5M95B 3TBYA 4OZFH 5GJSH 4KKLD 1UACH 2MQ3A 4F8TA 3AM8C 1PX4A 2ORBL 1RJLB 1CR9L 3UBXB 1QRND 5F89B 5DRZB 3UBXA 5F89A 4UT7H 4NO3A 1UVQB 3CZFA 5CKAA 5EUOF 1UVQA 3SDDB 3WJLC 3SDDA 5GGVL 1QSEB 4UAOC 2COQA 4YAQB 4ZFZB 5SWZD 1MNUL 4XCEB 4YAQA 4X7TB 4MLSA 2RCSH 5B38B 4X7TA 1MCWW 1P69B 4KDWA 5B38A 1E4XI 2WUCH 4PRHE 4QRPD 2OSLB 2VDRH 4FQ1L 2NYYC 1FZJA 2H6PB 5T1LB 4LAQL 4P5MB 2H6PA 3IKKA 5T1LA 4BZ1H 4P5MA 3P3YA 1S9KC 3ARFC 4X4ZA 5F7UA 2FIKB 5C07B 2FIKA 5C07A 3MPCA 5GHWH 5GGQL 4Y4FB 5E1HB 3VH8B 1A7RL 4G7VH 4KDTA 1MF2H 3QXVA 3TWCL 3VH8A 1NGXB 3BXNB 1NGXA 2J3SA 4JKKA 4RMVA 5F7EH 3VGDA 1U58A 1I8IB 2EDNA 4AEEA 3L3OA 2NY5L 3WFHB 4BZYA 3HR6A 1I8IA 3MSPA 1F8TL 1E6JL 3WFHA 4FXGB 4XB8A 4JJHA 1Q9LB 4FXGA 1M05B 2BRQA 3ZKMD 1Q9LA 1T2XA 4HIEB 3PWUB 4PGEB 1M05A 3R0NA 4OLVL 1EHLL 3QPXH 1D5MA 4HIEA 5BV7L 4PGEA 1A6UH 4RFOL 4UT6H 2B4CC 3AMKA 2Z9TA 5HGHB 5BS0D 4OCWL 4P23D 5HGHA 1NFDF 2V5RA 1INQB 2KQNA 2VLRD 2VDKH 2R1XA 4F9PA 1VEMA 4NQXB 4NQXA 4HLZH 4RWHA 1IQDB 5C7XH 2AK1L 3RVVC 2ICWJ 1IQDA 5F9WC 1W72B 2GY5A 4A6YL 1W72A 2E9WA 4OF5A 1KGCD 1OD9A 1F5WA 3DI3B 2A0LC 3QIUA 4LQFH 3AREC 1JGDA 3OB0H 1T83C 4JANB 4MNGA 4JANA 1I1YA 2WWKO 1CLCA 5D9SB 3S4SB 4XMPH 4MAYD 3THMH 5D9SA 4WEBH 3S4SA 1ERNA 5I1EL 5D5ME 4L8BA 1BD2D 1O0VA 3C60B 1NMCB 4FFWC 2ZUQB 1F3DJ 3SDDC 1TJHL 1NCAL 3RZCD 4F33B 3P77B 1OOAA 4F33A 3P77A 3F7RA 1DQDL 3LB6C 2R2CA 3CVHH 2GYSA 1IGYB 1IGYA 3VFGH 2MNUA 1XF1A 3BE1H 3T0AA 1R6VA 1OCWH 2IBZX 2OR7A 1GGUA 3MRHB 4WU7B 3GRWA 3K2UL 3MRHA 4WU7A 2P43B 1NC2D 3GDBA 2MOVA 1S7UB 5CBAB 3ZSSA 2J4WL 5CBAA 4KC3B 4XBEH 4OZ4B 4NO0B 4OZ4A 4M7JL 4HIJB 1KELH 4HIJA 4KDTC 4Y4FC 1IAKB 2MMXA 1WWBX 1RURL 1YMMD 5IQ7L 1IAKA 2YD5A 3KPRA 4PRIB 1KIQA 3BIAX 2HH0L 2YPVL 4PRIA 5DI8B 3UDWC 1CXIA 2Z8VC 3VXNB 3VXNA 2VABA 4Z76B 1FPTL 1CF8L 1YC8A 3B5GA 3WHE1 4M7LL 4GG8B 5DVNA 4U7MA 3GO1L 4PGZA 4GG8A 1YEKL 4TUKH 4Q9RL 2WK2A 3RGHA 1MFBH 3EYSH 3MLSH 4F9PC 5GSRB 3VGHA 4UTBL 3WEXB 4U2ZA 4PBWD 5GSRA 5DD3H 3WEXA 3TV3H 2H45A 1YEEL 5B22A 4X4YB 3U4AA 1CU4L 1MCFA 4X4YA 1NCBH 1AXTH 4MS8D 4PJ9B 4TTDD 4PJ9A 2VL5B 1BAFL 4OLUL 2VL5A 3EZJB 1INEL 1F4HA 2MQ0A 3V6OA 2E3VA 4GXUN 4AEHL 4NQTA 4YDJA 4QRQB 5C86A 2KKQA 4KK6C 2G60L 4QRQA 3TH3T 5HD8D 5D6DA 2R0WH 2R1YB 2CR3A 2R1YA 1OP9A 5L2KE 4D9RE 3C60C 1NMCC 1T80A 5F1NA 2ZUQC 5EDXA 5TE7H 5L8LB 5CHNB 1FN4B 2VLKB 5CHNA 1FN4A 1L7TL 2VLKA 4NUGL 4XPBH 4I3GA 3LEYL 4K9EL 4MDIB 1FAIH 4MDIA 3V4VH 5L7XH 3WNNA 3ARGB 1JMXA 4OKDA 1NANI 3SGDH 5DEFA 3ARGA 3AY4A 1ZHKB 3IJHA 3X3FL 3QCVL 3UROR 3ULUL 4GO6B 1GGBH 5IGXH 4JVWA 4L8DB 3OB8A 4L8DA 1RZKC 4Q6IB 4JEGB 3MLXH 3TJEL 3NIFF 5FUZH 2OM5A 5C0AB 3QFJE 1R3KA 1Y0LA 4R9HA 1DSFH 4OB5H 5FYKU 3BJLA 3KDMB 3VXUB 2BVTA 1CK0H 3KDMA 2O26U 5GJSL 3VXUA 4QXGH 1UACL 4LP4A 4U1JB 1BBDL 1GGCH 4KMLB 4U1JA 2W38A 5DUBB 3LS5H 2YPKA 2FO4B 5MEQA 1PEZA 4OCSH 2FO4A 4UT7L 1NBQA 2HP4A 3O4LE 2BSTB 3O0RL 3GKZA 5C3TA 5ANMB 2BSTA 4LP5A 1B4RA 5E2VH 5ANMA 3HB3D 2KUTA 1P1ZA 4DOHB 2XA8H 1IC1A 4LGRB 2CRYA 4E9LA 3O9WB 1BOYA 3M8OH 5FEBA 2VR4A 4OQTA 4PJ9C 1JV5B 5HY9B 4GG6E 3QHZH 3U83A 1JV5A 5HY9A 3RTQB 4Z7NF 4TRPL 1PKOA 5JHDE 3RTQA 1N6UA 3V6OC 1J0ZA 4ETQB 1QFUH 5E2UH 4GAJH 4ETQA 1ZT4B 4Q9QH 3F12B 4FQCH 1ZT4A 4HWUA 2E8ZA 4HAFA 4KPHH 4PG9B 3GMLB 4PG9A 5D6DC 1KUMA 3GMLA 4NRXB 1F4YH 2R23B 2DTSA 4KTYA 2R23A 1MF2L 3CSBA 5C70A 1VFMA 3FRPA 1PVHA 4PRPB 3GM0A 2B0SL 4PRPA 2LVCA 3QPXL 4K2UL 1A6UL 4UT6L 5DMGC 4OZFG 3NPZB 1J18A 3S96B 2AEPH 3QT2A 3ARGC 3AY4C 3S96A 4FP8H 4FQQB 1I4FA 2VDKL 4FQQA 3FZUC 2HRLA 4L3ED 2ILLA 5BZDB 1DZBA 2HTLC 2IBZY 5C6TH 5BZDA 3C6LD 1MJ8L 4KH2A 2XA3A 4N5EC 2C1PA 4P2CG 1I7RA 2XFXB 4LQFL 5IB4B 2XFXA 2DD8H 5IB4A 2VTFA 3D0VB 4LEOB 1F3JB 1UJTA 3D0VA 4LEOA 1F3JA 5CZVH 1U3ZA 3G6JB 4XMPL 5GRXG 3GNML 4WEBL 2ESVB 9CGTA 3HZMB 3T2PA 2ESVA 4I5BB 4RMWA 4I5BA 3QG6B 5I8CB 1TZIB 3QG6A 5I8CA 1TZIA 3C5ZB 3BD3A 3C5ZA 3RPKA 3H0TB 1DBJH 1UZ6E 2AKRB 3H0TA 3C2AH 4Z7WE 3MREA 3CVHL 5EC1B 3MUJA 2AKRA 5EC1A 1FNAA 3BJ91 5F6HI 1QPXA 5AYUH 3GFUA 1X5GA 3BE1L 3DX7B 4M5ZH 1AH1A 3DX7A 5SX4I 1OCWL 1VERA 3BDXA 3JWOC 3RTQC 3AGVA 5IVXE 4ZPVB 5CAYB 3P11H 4F9LA 4ZPVA 2DQHH 2KZWA 3BQUA 3ORJA 4EEEA 1CVRA 5ITBH 4JM2D 5I76B 3G6JF 5I76A 4IS6B 4YBLB 3MC0A 5DS8A 2XY2A 1CTNA 2ICCA 2FHBA 4JAMA 4HLZG 4YHIB 5EWIH 4OCNC 3X3GH 4AZ8A 4DGIL 3QUMB 3QUMA 5BJTB 3OR7B 4R90H 5DD5H 5E08H 1NDMB 5J11B 3LEXB 3DUUB 4WFHE 3LEXA 3DUUA 3TM6A 5EBLB 5EC2B 4BUHA 5EBLA 1KTLB 1P9MA 3LOWA 4NC0B 4PJ5E 3B43A 1KTLA 2BXYA 4TUKL 2DOCA 2GAZB 2GAZA 4H0HB 1UH4A 4XTRD 2PXYD 3EYSL 3MLSL 1JHTA 3DXAD 4KRPD 5DD3L 3F7QA 3TV3L 5HGDB 4PLNC 1YY9C 1FGVH 3MV8A 2M2DA 1NCBL 1AXTL 1EZVX 5ALCH 5IKCB 1JGLH 1U8PB 5IKCA 5LWYH 3Q5OA 1U8PA 2FZ3A 3BSZH 2VRAA 2YWZA 2OXGA 5DUPH 2DRUA 1QLEH 2H32H 1K8IB 3L3KB 4HUVB 4TSCH 1K8IA 3OBAA 5FXCH 5HYJB 4JFYB 3CFEB 2ZKHH 4Y2DB 4M9PA 4JFYA 3CFEA 2P48B 4Y2DA 3SQBA 3CD4A 4LHUB 2FRGP 5TE7L 3W0WE 4QLRA 3L5XH 3GSUB 3C5ZC 2BMKB 1L0YA 1K85A 4XPBL 4JDTH 1UGNA 2BMKA 4OFDA 4IOIB 8FABB 1A3QA 5HHOB 2LVEA 4IOIA 1FAIL 1AGCB 3LRSA 2V5TA 4N0CC 4CL7A 1AGCA 5CKGA 3CDYA 3V4VL 2ARJQ 1NCWH 4XCCH 3MA7B 3OL2A 1NBVH 3MA7A 4QCIB 4F9LC 3K4ZA 4PJDF 1FYTB 4QCIA 1GGBL 5IGXL 5IM7B 1FYTA 1J0JA 1YNTB 4D0CB 1BF2A 4YHNB 5IM7A 5C2UB 1YNTA 4K8RC 1IILE 4D0CA 4YHNA 1GYAA 3P4OB 1EXUB 2HT4C 5FUZL 3P4OA 1EXUA 4YBLC 3QDGE 2AXFA 1DSFL 4ENEC 1XGTB 2BHYA 4P4RB 3G6DL 2VXTH 5DO2D 5IB3B 1XGTA 4P4RA 3S34H 4GLRI 4JR9L 3IVKA 1OW0A 2APVA 4QXGL 1Q0XL 4XPTH 5J6GB 1GGCL 2HKHH 3D85B 4S0SD 5J6GA 1WAAE 3D85A 3LS5L 4X9HA 4JQIH 1H3TA 5FM5M 2IC2A 1P9MC 4OCSL 1CD8A 3QI9D 5EBWB 5E2VL 4FZ8H 2ADGB 5EO1B 2ADGA 4PJHE 5EO1A 2BNUA 4WGWB 4YDIH 5ENWB 4JVUA 1F3DH 5ENWA 3KAAA 4NCC1 3EFDH 2XA8L 3O11B 5T5NG 4GXUM 1OP5H 1WEJH 3O11A 4LHJB 5C08D 3QWRD 5DFVC 1NEUA 3HI5H 5C0BD 4W4OA 1WIOA 4JM4H 3LN5B 3RX5A 3LN5A 2WUBH 3GBLA 4XVSH 3ESVF 1EJ6A 2LV4A 2UYLB 5J7CC 1JZ8A 3NIDF 1T1ZA 1QFUL 5E2UL 4CN4A 3ETBF 4GAJL 1FG9C 3V7MA 3T04D 3HRPA 4FQCL 3O2WH 3QDME 4KPHL 3PP3H 4Y2DC 1F4YL 1FNFA 2EC9U 2VOTA 2EXWD 5EFIB 5KS9F 2RFXB 4UV7H 3DVFA 2RFXA 5F7DB 5DJDA 1MI5B 5JHLH 5F7DA 4G6JH 1MI5A 3VFNB 3R8BB 1MLBA 3VFNA 1CGUA 3FCTB 3IB4A 4Q0XH 3KJ6L 1DUZB 1IAIM 4P46A 3L6FB 1B88A 3L6FA 1WLHA 5FM8A 2IPTH 2AEPL 4XAKE 2EYTB 4S0TD 4OAWA 1JPST 4FP8L 1Q8MA 2Y06H 3D25B 5HYSG 1BECA 3TJHC 4KTEL 3ZKND 2Y36H 1FLRH 4EDWH 4N90D 2UWEF 5HYQA 2VXVL 3NAAH 3QPQD 1EEYB 5C6TL 5DHVH 2EE3A 5H35B 4U4BA 4BQBA 1LE9B 4HPOH 1LE9A 2QSTA 1R0AH 1S7RB 1CGSL 1OW0C 2F53B 1S7RA 5F3HB 5F96H 1NBZB 4U31A 3RZWA 2ADJB 2NNAB 5D72H 5F3HA 1NBZA 5CZVL 3WL9B 2NNAA 5I17B 4R2GB 1WITA 4JFDB 1NAMB 4JFDA 3S3SA 2QADD