1IAOB

Class ii mhc i-ad in complex with ovalbumin peptide 323-339
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
216
structure length
200
Chain Sequence
RGISQAVHAAHAEIHFVVQFKGECYYTNGTQRIRLVTRYIYNREEYVRYDSDVGEYRAVTELGRPDAEYWNSQPEILDRTRAEVDTACRHNYEGPETSTSLRRLEQPNVAISLSRTEALNHHNTLVCSVTDFYPAKIKVRWFRNGQEETVGVSSTQLIRNGDWTFQVLVMLEMTPHQGEVYTCHVEHPSLKSPITVEWSS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords MHC CLASS II I-AD
publication title Crystal structures of two I-Ad-peptide complexes reveal that high affinity can be achieved without large anchor residues.
pubmed doi rcsb
source organism Mus musculus
molecule tags Mhc ii
total genus 40
structure length 200
sequence length 216
ec nomenclature
pdb deposition date 1998-03-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00969 MHC_II_beta Class II histocompatibility antigen, beta domain
B PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1iaoB02
3.10.320.10 Alpha Beta Roll Class II Histocompatibility Antigen, M Beta Chain; Chain B, domain 1 Class II Histocompatibility Antigen, M Beta Chain; Chain B, domain 1 1iaoB01
2P8MA 5GGVY 4J6RH 2FO4A 3OKYA 4K9EL 3B8YA 4NM4L 3QI9C 4G3YH 3A6OA 4G43A 4YDLC 4Q9CA 4JN1H 1NLBH 4TUKH 5L6YH 1U8QA 2NY0D 3QDME 5DA0B 5EWIH 1ZVYA 4JVWA 3E6FB 4JRYA 4JZNB 4X6DF 4YX2L 2XQYK 3JBG7 1WISA 4I8DA 2EDOA 5DI8B 3LN9A 5INDA 4E41D 2YMXH 5E7BA 1CDIA 3S5LB 4OTXL 1OGAE 4ONOA 1UZ6F 3OAYK 2YXFA 1IC4H 1QSFA 3EJZC 3EZJB 1FDLH 1BEYL 5JIHA 1NCTA 5FUOH 3TYGH 1AD9B 2Q86A 4NHCH 3OKKA 3U9PL 5H2BB 2B1HH 3MOAH 3RVVD 4IRSB 1ROWA 1AP2B 3VD4A 5BRZA 4PRAB 3UAJC 2GJ6A 4B41A 3FT4A 1ZT7A 3VXRA 4KVNL 3EOBA 3TJEL 2Z31D 4NUJB 2DTML 1T66C 4PRHE 3RVTC 1KB5L 1WAAF 2CGRL 4G9FD 1S7XB 4HBQA 1PKQA 3HC3H 4UNTA 2BDNL 3NIGF 5DVKA 3FO1A 1YMMA 4NNPH 4BKLA 2XWTA 2OYPA 4YXHL 2RGSA 3FQXA 4QY8A 4BQ8A 5CMAA 3ET9F 1HDMB 1M4KA 3O8XD 4BM7A 4FQ1L 4PRBA 5FGSA 1CTOA 5D7LD 5A40E 3ZHLA 3C2SA 1D7FA 2FSEA 4DVRH 4J3WA 4XI5C 3RWFA 1L4IA 5D72H 1FYTE 5F70A 3RZCD 1W72A 3MXVH 1CLCA 3SQOL 1CIDA 2BSRA 1INQA 5EU7C 1FV1B 4NKOA 1ZTXL 4WFHD 2VAAA 1WBXA 4I48B 2ZCHH 5JOEA 1IGMH 1KBGL 2ATPB 2G2RA 2E5EA 4IDLA 3O0RL 3O2WH 2QSQA 4ZFGL 3DUHA 1CFSA 4I9WD 3QDGA 2OTPA 3PIQB 2JB6A 2CIIA 4Z0XB 4AT6A 3WN5A 1KELL 1A7PH 3RUGE 1CBVH 1XR8B 2O61A 1ZHKB 5CJBA 4P2RA 1IILE 3V6OE 4HXBH 3HMXL 4XAKD 1PDKA 3OXSB 5EFIB 4XHJC 4F33B 5DRWA 3E0GA 2YBRA 2NNAA 5FHAH 4ZPTB 2KDGA 3KJ6H 1P4IH 4Y2DD 1RD6A 3QZWG 1B2WL 1ZHLA 3MV8A 2CKBA 1FPTL 4DQOH 4GW4A 2NR6C 4J3UA 4WNQB 4ZUTB 4HZLB 5B38B 1GGIH 1NLDL 4PYHA 3GO1L 3FTGB 4OKVB 4F7PB 5KSAA 3IF1B 2WBKA 2IQAB 3KPNA 5SX5H 5C0CB 5IMMA 4X5XA 4GKZB 4UQ3B 4YZFE 1E4XH 1FLRL 3GHEH 1C5DA 1U2HA 3P9MB 5EU3A 3RDTC 2QSCL 2DQGH 3P11L 1CICD 3MJ7B 3VA6A 1MLCB 2XIDA 5GGUB 3SCMD 3FB8A 3EJYD 3BH9B 4R8WL 1D5ZB 1T04B 2XWJA 1HXMA 2FECI 2AK4B 5C08D 5DLMH 4PJ8D 4WI4A 3WUZA 2KBGA 5TDPB 4JFPA 2X7LA 1K3IA 4PGZA 2IPKA 4DJMA 3L3KB 1Z9LA 3BP6A 3EDKA 1UZ6E 2YD7A 1UM5H 1ZA6A 4X4ZA 1YNLL 3OJDA 3SDDB 5HYQB 4RGNB 3C08H 3MLTB 4NRXB 2C3GA 4UINH 1MF2L 3CFIC 1YEIL 4YHZL 3BIAX 5EC1B 2FX9H 2XYCA 2EDDA 3Q6FB 4CVXB 3V95A 3REVA 4JFDE 4X80L 1X5IA 4O58L 2YD3A 5GJSL 3PF2A 5CP3A 3UBXA 3NCJL 3QISA 2X1QA 4LHJB 1WAAE 1BFOA 1BJMA 1YC7A 1U8IB 3CMGA 1K8DA 1MCRA 1J0ZA 2H2SD 3QWOB 4P23A 5AZ2L 3U36A 2NX5A 3MXWH 2H9GA 1HKLL 4Y88A 2KPNA 4KPHH 5E8OB 4LCWB 1XGPB 1MWAL 1FLTX 2ZG2A 5ESAB 2OL3H 3GJEA 4ONFL 4S1SH 5DMKA 4XPAL 3MRIA 5FHBL 4KTEH 2DTSA 3ILPB 1CXFA 3RHWK 3MJGX 4HIIA 2DD8H 1F8TL 1VSCA 4YDVA 3HA0A 3ZSTA 4R26H 1YNTB 1IEBA 3SGJC 1ZEAL 4PJDA 4ZOAA 2DQTL 3H3BC 4PJ9A 3D9AH 1DBBL 1MVFA 4CMHB 3N9GH 2OXGA 4N8VA 5C0ND 2GAZB 4CGTA 3ZYJA 3R1GH 1N64L 4YBQC 3H9SA 5F7DB 3UJTL 4HK3J 5ACLA 1N0LA 3HI1B 4J1UA 3B6SB 1IAII 3LN4A 3TNNB 3UTSD 3LEYH 4R3SA 3HNSH 3P4LA 1QLEL 1NBVH 4NQCA 4NPYA 3K2UL 2P8LB 3C8HA 4HKBB 5E6ID 5C07B 5I1KH 2OMNA 5HDQL 3BN9D 4KV5F 1KEGH 4OGAC 1I1AB 3MRNB 1K2DB 3FCTA 4WJ5B 1EDQA 3BSZH 5A2KH 4PS4L 3LPGA 5SX4H 4L3EA 1LO4L 1C7SA 1FBIL 3GI8L 4JKPL 4MB3A 1D5MA 4OD2A 4PJXB 3DYPA 5KSBB 3QEGL 4PJAA 1NKRA 4P3CH 1RIHL 1Q9OB 4GBXA 2E7LC 5HI4C 1BVKA 4OQ1A 2JCCA 4LVOB 5JQHC 5SWQB 4I0PA 2MHAB 2UYLA 1BF2A 2ERJB 4TUJA 1BOGB 2F19H 5EO1A 1A21A 3TWCH 1U8HB 4TULL 1TIUA 5DFVC 5GS3A 1NSNH 3CH1A 3CLEH 4XVJL 5ALCH 3IAGC 1P5VA 3WFCH 3NGBB 1A4KB 3ARBD 4P4RB 2WWMC 3B4NA 3QXAA 4ZD3H 4OV5A 2YN5A 1GZQB 5F3HA 4F7TA 1MCQA 3CFEB 3WMSA 2BP3A 5DJCB 3C8DA 2K7QA 1QG3A 5DK2B 4YHNB 4U6VH 1U58A 3DBXB 3U46B 1AGCA 5T3XH 1DQTA 3MBXL 3BHBA 1NMBH 4J8RA 3CFJB 2YD5A 3CVHH 3L3DA 3R8BB 2MPAH 5KANI 2NY1C 1ZLVH 5HVHB 3X11A 3P9LA 1J05B 4MA8L 3CIQA 5EU7E 2J4WL 4NWTH 5F7WC 3WIHA 1G7JB 3QQ4A 1NH6A 2EEBA 3O3BB 1A4JB 1GRWA 1RK0B 1FZOA 2F74B 4J3SA 3TBSA 1JPFB 2YXMA 5IF0B 5D96B 5ANMB 3V0WL 4KJQC 4JRXB 5IQ7L 1S7TA 1N5AA 2R2EA 3FQWA 1JPTL 1MIML 4CADB 3VRJA 1FG2A 1XR9A 4KRPC 4U1JB 5FYJH 5L7XH 1VB9A 1NFDF 2VDML 3FHQA 1MEXH 3KHOA 4X9HA 3B3IB 5D1XA 4JM4H 1LNUA 5F96H 1ZT1B 2IPUG 4NJAH 1I3UA 1EH9A 1JWMB 1V8HA 1IAKB 4XCCL 5CINL 4GQ9H 4KROB 5EZJA 3EFFB 4DAGL 3IJYA 1BP3B 2A6KA 1R5WA 4J3TA 2A9ML 1RFDL 4JO2L 3FJTA 2VDPH 4D0BA 4RMSA 3GJFK 5CILH 3U9UA 3C60B 3NFSH 4PJ5B 2VRAA 3QXUA 3VI3F 2Z4QB 3SE3C 5DYOA 5BJTB 3MRKA 1ADQH 3ARTA 4OGXH 2JJSC 1AKJD 3WO4B 3MGTA 3UJIL 5EC2A 5EPMA 3SDDC 2APFA 3UTQA 1OLLA 2YPVL 2ZSWA 1F4WH 3OKMA 4LAQH 1I9IL 1O7VA 3KR3L 5LG1A 4F15B 4PRIE 2IH1B 5DC0A 3I9GH 4OD3L 2X1WL 3ILQC 1JGDB 3SPVB 3T77A 1P53A 2L7UA 3STZA 5H94B 3BWUC 1DQMH 5FV1L 3GBMH 1NAMA 4G80B 3REWA 3PWJB 3WLWC 4UU9B 1KN2H 4EEEA 4UDTB 4I2XE 4YQXL 1TJGL 1P7QB 3O6LL 3S35L 4OF7A 4NQDE 2IFGA 4CVZA 3PWNB 3QUZA 1MFEL 2IPTL 4LVHC 3P0YL 4XP9L 3AREB 5DT1L 3UBXG 2P44B 4CJ1A 3T8XA 2YHGA 4TVPL 5EU4A 4MQXD 4APQB 3K1KC 5I8OH 3LKRB 3FT2A 1UVQB 1KFAH 2VL4A 5MEQA 2JE8A 5JOFA 2ZUWA 4NO0D 5C8JA 1UB5A 3MLUH 5I19L 1JPSL 2E8YA 2J6EL 1CXEA 3G5YA 1K6QH 1KCRL 4LCUA 1N8ZB 4XC3H 1FVDA 1G0YR 3ARRA 5DWUH 1MHCA 4IOSD 1KC5H 3T08A 1EGJH 4CMHC 5HYJA 4LCCA 4YDKH 5IFJA 4QHLB 1RVFL 3K8MA 4Y8DC 5CJ8A 4PP1D 2R2HB 5E94B 1IC5L 43CAA 3NIFE 4YBHA 5FYKD 2ICEA 3BYYA 1IQWL 3MLWL 3GSOB 4OLVH 3DIFB 3MRRB 1ACYH 3PQYD 2RFXA 3PWUB 4J7RA 4M5ZL 2DQJH 3RWEB 5ILTH 1CD0A 3EO0B 3RTQB 3ZZ1A 4LSRL 5DTFA 2EC8A 3QPXH 4P2QA 4N8VG 4RFOH 4XBEH 1R3JB 4F9PA 5E00A 1EJ6A 1ITCA 3VI4E 1CL7H 1I1AC 2Y5EA 1RSFA 1P4BL 3SE4A 2DIBA 3O6KL 4AIZA 4EN3B 3DETD 2WIIA 3TVMD 4O9HH 1AY1L 1AE6L 3RWDA 1MAMH 2BOBA 1KCUL 1WIPA 4Z7VF 4KKBD 4BELD 2BY0A 4JB9L 4G7VL 1SYVB 2JIXD 3UYPA 3CFKA 4QWWD 4MAYA 1CDCA 4MZ3A 4B50A 2EDBA 3VD3A 4M43H 1QVOA 2H6PA 3MJ8A 4LVOC 5LGKA 4Z7QE 5TH2B 4CNIB 2CIKA 3HZYB 2ERJC 3PGDA 3C9NA 3K4DA 4S0TD 1P2CB 1RZKL 3FONA 3ZYIA 3F62A 2AABH 3MCLL 3ARGA 2VL5B 3VI3E 4IS6A 2AERT 4Y4FA 3O3EB 3JV0A 4Z7WA 3NGBC 4NZRH 2AXGA 5L2KD 2EIDA 1JWSA 3OF6A 4WU5A 2ZUUA 1U93A 1NCAH 2ESVD 4AIOA 1XIWD 5HHNB 1LO5B 4HWBA 5ITBH 1JHLL 4XMKL 3OKOB 5F9DC 4IMKC 4GRMA 5ENWB 1V05A 1UZ8B 2XKUA 2Z8RA 1MRCH 2LAAA 1DEEA 3MA7B 3GSNL 5JLZA 2EKSB 2HKHL 4TVSa 5IKCB 3VH8A 4AL8L 5FA3B 1FC1A 1AJ7H 1EEZA 5HVHC 1JFQH 4YHIB 5A2JH 2PXYA 3OG4B 2HTKD 3MLRH 4UV7L 4LNRA 1MHHA 2F8OA 1AHWA 1CFQA 4OF8A 4AQ1B 5GISH 5IEHA 3PHQB 5IFHL 3K8KA 1NC4D 4M7ZC 2APXA 4DW2L 1I8LC 1C16B 4PLNC 4NQXB 1VGKA 3ZL4H 3P40A 3FFCB 3CAFA 1GAFH 5LBSL 1IL1A 1RZGB 3P4MB 5E1HB 2H3NA 2YD2A 4FFWD 3GRWL 4OZGB 3SGKA 4F2MA 2A77L 4PV8B 2C26A 2VDNL 2GSIA 1A3LL 4FABL 4LHUB 1Q38A 2VLRD 4LNVA 1G6VK 4B5EA 4M6AA 4UT9H 5GPRA 2NW2B 4KROC 1YYLH 4LEOB 2XKSA 4G8GD 3X12B 1P84K 3DX9B 4M62L 1QSVA 3VXPB 4GT7A 3HE7C 5GRZA 1KULA 25C8H 2UWEF 3V6FA 3PWPB 3C2AH 5C9JB 1PQZB 3C60C 3T2OA 5DD6A 1YYML 4KAQL 3S9DB 4PJXF 2P42B 1F3JA 1AGEA 3MREB 1RZ8B 5C0CE 4IRJC 1G7LA 2PO6D 4ERSH 3WO4C 2YA0A 1TXKA 2VISA 4I77L 2FR4A 3LKPA 2DWDA 4X4XB 4PB0L 5CZXC 4FS0A 4Y5VA 3TA3A 1JGVH 5I1CL 4S1QH 1Q9LA 3V52L 2AK4E 1M05A 2QADD 5IUSA 3LQMA 2PTTA 4PUBH 3HR6A 1MFDL 4Z7VE 4LCIH 3KPTA 4NFBA 4KI5C 2FL5A 2NLJB 2AAVA 3L3JA 4HKXA 2HFEB 3BPOB 3UXFA 5D70L 1BJ1H 4UT6H 2X05A 4RGNE 2NMSA 3SKJL 4G6ML 1A1MB 1I9RH 1X9QA 3HS0B 1G6RA 2NTFB 5D2LF 4LSVH 3RX7A 3AREC 4KUCD 2WLYA 4APQC 3PL6B 2IANA 2ZPKL 4NQEB 2QSTA 2Y07H 5C0DB 1HQRA 3ECBA 2X9XA 3DVGB 1EFXB 5BV7L 3O9WB 1R3LA 1OQOA 1SMAA 3NOIA 4HKZB 1X4ZA 3RX8A 4ZQKB 3U2SB 2VLKA 3CDGA 2DI9A 1TTFA 2M2DA 2P45B 4BK5A 1NUFA 1T2QL 3HPJB 4LVEA 3BGMA 4BQBA 2PN5A 3FO0H 4HUUB 4R4BA 1C12A 4LCWE 1RUAH 2BZDA 3GHBL 4HS6A 5CUSH 5D6DC 5DJ0B 1UEMA 3WUWB 1BM3L 1DQLH 2HT2C 3WDIA 1XT5A 4OCXL 1LEGB 1AD0A 5GGSA 2ZUQB 1XF5A 4PJCA 4O2FA 4LEXH 4D8PA 2Q7YB 5IW1A 4JRYD 5LGHH 4JM2C 3DX8A 3MR9B 1CDHA 1N3NB 1KJMA 4HIEB 4EN3C 1A3QA 1N6QL 4U2YA 3JWOC 5DQ9B 2DB8A 4A6YB 2X89A 5C0RL 1QEWA 3Q5YA 3DMMB 4D0CB 5CKGA 1SJEB 2ZUYA 1QSFD 4OD1H 4PLKC 3VXMB 2YR3A 5AYUH 5HHXH 5JMOC 4HUVA 2F5AL 5CD3A 1HI6A 4LARL 2UY6A 4G6JH 4K9EH 2FD6L 2WUCL 5BRZD 5IB2B 4UT7H 3VXRD 4PRPA 2B2XL 3VFVA 1KLFA 1H15B 4MJ5B 1TZHA 4B7IA 4WWKC 2HFGH 4TRPH 4DTGL 5KTEH 5DGQA 4PJXE 3PHOB 3N1PC 1NCBL 2CXGA 4RBPK 3V8CA 5JOPD 1VPOH 3TFKC 5KSBE 4GW1B 1INDH 3S4SB 4MJ4A 4WU7B 1OWRM 1T1XB 1YMMD 1KIQB 2WMPA 3I2CH 2R1WA 2HKFL 5E08L 4F37K 4BZ2L 3DVNA 1MQ8A 1OSPH 4CDGC 4BSVB 4FTVB 4RWYL 3LRHA 4MXWL 4UNVA 3FO9B 5BZWA 4MQ7A 5HGDB 5ACMA 3LN5B 5J4MA 1YJDH 1IGIH 3CXDL 4NHUA 3BP4B 1RJYB 1YN6A 3DXAD 4QF1A 2V7NB 1LDPL 1NCWH 2ZNWA 1RK1A 4U1MA 4JKLA 4F9LC 4N8CH 2VLJB 3ZT5A 1WWBX 2DTMH 3WKMH 1Y6KR 1UB6A 3EFDH 1P7KB 2CGRH 5ICXA 4CDHA 2YPLA 3QDGD 5GHWL 1CF8H 2WAHA 1KB5B 5BVPL 2ADGA 4U1KB 4ODXA 1FFPB 4KVCL 3VH8G 2VJXA 1A6AA 4P2RD 3DYOA 3K2MC 5TE7L 4FQ1H 1QSED 4Z77B 2CK0H 3B2VL 5L0QB 1RURH 5L2JA 4U1HB 3V8OA 2LVEA 1Z0MA 2FEDC 1GGCL 2DBLH 4M7KH 4BH8A 4F7MB 1N5YL 1KIRB 3SQOH 3BT2H 1MFBH 1CR9L 1D5IL 4WTZA 2Z93A 3GUTA 4J12A 3EO1B 3H9HA 4P9HC 1T1WA 5TF0A 5ANME 1JZ6A 3VW3H 4JRXE 5L8LB 1S7UA 1PG7L 3D25A 3QFDA 5KSAD 4IIQB 5C6TH 2Q8BL 1Q94A 5I75C 4PR5A 4XNXL 1D5BB 4AQOA 1P7HL 3VXSD 1XF4A 3NN8B 1O7SA 1P69B 5CGYC 4E0RB 4O2EB 4RAVA 3OB0K 5BOZG 3MGAA 5C6PB 4YBLB 1ORQA 1B3JA 4XVSL 2GTWB 1SY6A 3BUYB 4JZOB 4ONHA 4EUPB 3JTSB 4KKCD 3PWVA 1WGOA 3QUKA 4GMSL 4DZBB 4MNQE 5IEKA 2PUQT 5SWZB 1ZHNB 3PGCB 2YK1L 2RJMA 1T3FB 4PJ5E 2W9EL 3W81A 1WWWX 4HMEA 3BKYH 1U8MB 2FEEI 5IHZA 3ES6A 5TF1L 1FO0A 3EYOB 1NLDH 1DJSA 4NUGH 4RSVA 2C3VB 1IEHA 3BPOC 3SJVE 2NY0B 5KW9H 5BXFA 2V9TA 3VFTB 4UBDD 3JXAA 3VWKA 3LPWA 2MJWA 2XXCB 4MNGB 1JK8B 2VITB 1M1SA 2BERA 1OP5K 1L7IH 5HGAA 4U3HA 5IW6B 1I7RB 1F4AA 3GSQB 4HK0A 4WI6A 3PL6C 5J06A 3FQUA 4NQDA 4OUUA 1I7ZB 3IKCB 2DN7A 1F00I 2FZ3A 3MO1B 4KJPC 3LIZL 1HN1A 35C8L 3O9WC 4JZJB 1W72L 4HDIB 1RZJL 4JFED 3MA9L 3O4LA 5EBLA 3CZFA 1MAKA 2VAJA 4NSKB 2VDRL 1J87A 2H41A 5HY9A 2Z31B 2V5MA 4HQQL 2FHBA 3FB5A 4CN6A 4X99A 4M6NH 3E6HB 5HVWA 4XH2A 1JGLH 4G9FB 1IM9A 4O58H 5I18H 2ZUQC 4O51B 2YEZB 2ICWJ 2E3VA 4I4WA 4NQVA 4GMTL 2HT3D 4M3KB 1M7IA 3TPUB 3QUMH 4RMRA 3O8XB 4PJ9D 4MA3A 1OPGH 5D7LB 1QLRA 2B39A 2H1PL 3JUYA 1MJUH 3H9SD 1H0DA 5KAQG 3RZCB 5JW5A 2WUBL 4WFGE 1MHEA 4N9GA 3DMMC 3SGJA 4XNZC 2FBJH 5IGXH 2AEQL 2CKBL 4NQCD 5AWNH 4NWUL 4WGWB 4YGAB 6FABL 3MLVL 1TCMA 3BKML 1J8HD 3BPNB 1KLGB 3LAFA 4FZ8H 4ENEC 4PFEA 2VUYA 4ODTH 4L3ED 5F97E 2PETA 5B4MD 2IALA 1CFTB 2AKRB 2ITDA 2GITB 5DMYA 2CJUH 4NDMA 3UO1L 2P1YA 4RGOL 3V6ZB 4XMLL 4MNHA 2VXVL 3MLXH 5DHYB 1AD9A 5MP6L 5JXEC 4EIGB 5CJ5A 3KNBA 32C2B 3DRQB 2A6DB 4I0PD 1NBZB 3RPIB 3QXDB 4MS8C 5I30H 1D5XB 1QLEH 2FJFA 5GSRB 2B20A 4ZUSB 3K2UH 3V4UL 2R4RH 1TTUA 2HJKA 1GGBH 4HCRH 3VFPB 3RL2B 1G7IB 5HI3D 2OR9L 4FNLH 5KVDH 3GMOB 2AJXH 3I3EA 3O3UN 4JJ5A 5JMRA 4W4OC 1WF5A 4NT6B 3SGEI 2BY1A 2QTEA 3LQZB 4H88H 2YSSB 3F7QA 3Q2CA 4HXAL 4RNRA 1KCVH 5CGMA 3BZ4B 1CICB 3IDIB 2WWKT 4P46A 3MRLB 4XNUH 4HHAA 4S1DC 4P2CG 2AV1B 3BRGC 5GZNC 2G60L 5C08B 1ZHBB 1DSFL 4PJ8B 2Z8VC 1FSKB 3NPSC 3BOVA 4ZTOL 5L0QC 4MJ6A 5CEZD 3EDEA 3QQ3A 4YGVB 1X5YA 3QG7L 1CS6A 3G5ZA 3G04B 3PIQA 3T0VA 4D3CH 3QEHA 1PAMA 4N0FA 5HHPB 1IQDA 5C0JB 2VO5A 5DJDA 5C0AA 1LD9B 2CRYA 4RA3A 1TVHB 3FFCE 3OXSA 4F33A 4WHYH 1VKXA 2X1XR 1OY3B 2X4QB 2D7PA 4R4FH 1QBML 4PJHB 4WTZG 4ZPTA 1BOYA 2J8UA 4HPOH 4BUHA 2HJLB 5I1GL 1UACL 4HPYL 1HWHB 4YBLC 3TO2B 3WFHA 4MA8H 3L7FA 2X70A 1UG9A 4K55A 4JHAH 5ESQA 1GHFL 1I8KA 2CLZB 4LSPL 4M6ML 2Z91A 5J7CC 4ZAKA 4OKVA 3RBGA 5EUOF 3V0WH 3U1SL 1P9MC 4MB4A 4UQ2B 3SKUD 1W0YT 3BIKA 4MD0A 5CS7A 1RPQA 4AENB 5IVXF 4KJYB 1TQBB 5B8CC 3CFCL 4GG6B 4KHXH 1QA9B 1MLCA 2ILLA 1J18A 4FQHB 1HH9B 2EIZB 3BH9A 3CU7A 5HHOA 1D5ZA 1T04A 4WO4D 1ZLWK 3BX7C 2EO9A 2NY0C 3OG6B 2DS4A 4OZ4A 3SE3A 2X4RB 5FA4B 3DSFH 4HS8L 3MJ6A 1QD0A 2I9LB 3EHBD 2N56A 3GEWB 3L3KA 3D6GA 2JJSA 1NGWB 1RFDH 3T1WA 1IKNC 4C56B 4P9ML 4Z5RB 2EDHA 3SDDA 3OR6B 1AI1H 4XWGL 1GGTA 4YHLH 4PY7A 1RUQL 5T5FH 2PNDA 3WEXB 3LHPL 1EUTA 4H5SB 5EC1A 5CKAA 4WEMB 1A6VL 2HVKA 3RVVC 4AH2B 3I6LE 2HLAB 2FIKA 4DKDC 4FFZL 2Y5TB 1SYSB 2YPVH 4ODUB 4HWEH 3SDAD 4WI3A 3GGWA 2W0KA 1H5BB 1G1YA 5I1AB 1G9ML 2H8PA 2Z31C 3H9YA 5GS0H 5SV4A 4QHKJ 1VGEL 1VESA 3IVKB 2RHEA 5DJ2A 4NQEE 5BO1L 4RDQF 3QNZB 2IFFL 5MERB 3E1F1 2Y4SA 3AU1B 3SKOB 2Q3AA 4QHKI 3K4AA 1INEL 1U8PA 4G7YL 3O8XC 5E2UL 5L8JB 1ZVSB 5ICYA 3MOBH 2GI7A 4LL9A 4YQXH 1IAIH 2OL3A 1HCVA 3GMLA 3VXUA 3TO4A 3UDWC 3OGCB 3D85A 5LAXA 2IPTH 3NFPB 5GZOD 4X0KA 3N85L 4R90L 1R0AL 1S5IH 2VSDA 5HYFA 2LV4A 4L29B 3ARBB 1T21B 1CFVH 1KTLA 5F1SA 1JNJA 4XMPL 5D71H 3ULSA 4P2QD 3T4AA 3V0AC 4HC1H 4PJ7F 4YHPA 2XPGA 3EOAA 3LKOB 1XFPA 3BPNC 1PLGL 1AXTH 1JI1A 1S9YA 3PXHA 4G8EA 4QXGL 3BPLB 3MCKA 4H26B 1X44A 4PB9H 3QWRD 1IRAY 1YUHA 1T6WA 1WCQA 1RVFH 4MAYD 3CPLB 1OARH 3CVIL 5GGQL 2BFVL 1W0VB 4DN4L 5E9DA 5C07A 1IC5H 1OT2A 1BQUA 3VXME 1I1AA 3HMWL 3RKPA 1K2DA 3MNVB 4WJ5A 2IEPA 3KLDA 1X4YA 3BDBA 3BZFB 3QNXA 1XH3A 1P4LA 1T80A 4Y2DC 2DKMA 5INCA 2A6IA 4ZFOB 3BW9B 2QQLL 4QRPE 2WINB 2Y72A 1T6VN 5L88H 5DRZB 5GGVL 4LPCA 5D7SL 3NCEB 4Y4FD 1JZ2A 3MLZH 1HSBA 4MYWB 2R0LL 3NABL 1U8KA 1C1EH 4N8PA 1YY8B 1LEKB 4UNUA 5H35B 4YIQA 5MEPA 3L5JA 3OF6D 5T1MA 2MHAA 1FL6B 5EIQA 1M7DB 1DLFL 1GH7A 2OZ4H 2LAGB 1G7QB 1IBGL 4MXQD 1QBBA 1KGCD 3CC5B 3SCMC 3EJYC 4FTVE 5EA0L 3HI6H 1S7VA 2W60A 1KIPB 1A4KA 3O2VL 1AO7A 4PJ8C 4P4RA 1YEKL 2E27L 1FSKC 3AMKA 4U05A 1T4KA 1A9EA 1VFMA 3FMGL 1R5IA 1RZKH 4QRSA 1AGDB 2DQEH 4YHNA 5DK2A 1HOCB 1DZBA 4RAUB 2CH8A 1WLHA 4KRNA 4M8VA 4MSWB 1CD1B 2MCPL 1K5NB 2VZ1A 1LDSA 2B4CL 1B0RB 5K9OA 2NTSP 3GSVB 1Z3GH 3CVHA 4NZUH 5CCKH 4YUEH 1SBBA 2ARWA 4LBEA 3M1BB 3G5VB 3ZYZA 5JQ6L 1A14L 1HNFA 2W9DH 3VGAB 4PJIA 3O3AA 4M02A 4OBRA 3O3BA 1A4JA 3ESVF 5CP7B 3BWAB 1DBJL 4LAJH 4MD5A 4CN4A 3RA7H 1JPFA 1FP5A 3GSNB 5FGRA 4OZFB 1YPZA 3K0WA 2V5RA 3U6RA 2H2SC 4UV7H 4WW2B 5EOQH 5DVMA 1D9KB 3GJFB 1RHFA 5L9DL 4QXUH 5C86A 5IFHH 2F53E 3C6LD 2ZUTA 4XP1H 1BIHA 1ZT1A 3L5IA 3Q3GB 4LLQB 5B39B 5ID0A 4ELMA 1R3IH 4DGIH 2AQ3A 4JFHE 4PRDB 5FM4A 2P49B 4GRWF 1TQBC 4NO0B 3GRWH 1A3LH 3HE7A 4FABH 1FFNB 3MLYL 2AXJA 2NPLX 4U1NA 3C60A 3TA3D 3WLBB 3HZMB 2X4TB 2Z4QA 3CMOL 4XPGL 2EO1A 4TUOB 1EO5A 5E1AB 4IRJA 4O2CB 5HGHB 4GJTB 1KLUA 3VCLB 2BSSB 1X6LA 1DQJA 3B9EA 3D39A 5JIIA 2Q3ZA 3MV01 4K3JL 5TGBA 3KXFA 2R56H 3ZKXC 4GW5A 4EKXA 3PQYB 1ACZA 1XF3B 1I7UB 3UROR 3DVFA 1U91B 1FYHB 4PY8I 4MAUL 1VEPA 5E6IC 2HJFB 4H8WH 2IH1A 3BH8B 4LMQI 3BN9C 4LSQH 2FHFA 4NKIH 1WZKA 4PGBB 5H94A 4K3DL 3GMRB 2Y06H 1NDMB 3TVMB 1C5BH 3VXQA 1QYGH 4G80A 1H5BC 4MMZC 5I1CH 1JPGB 4UU9A 1KJ2L 2ATKB 1OD9A 4OSUL 1JGEB 3FT3B 1LGVA 1E4WH 1I9JL 3RVUD 4PJEB 1HINL 5JNYB 2VLKD 2GTZB 4M7JL 4X6CB 2NY2D 4OKDA 3GMPB 2LTQB 2ZCKL 1UVQA 5GRXG 4KY1L 4RMVA 2C1OB 3KYNA 4GUPA 3M17B 4F8TA 1KCSH 4WFFD 5HHQA 1RJZA 3N06B 3DYMA 5E99L 3ARBC 2BVPA 5IWLA 3SHSA 4G9FE 1N8ZA 3ZE0F 2QSVA 4HAGA 4EQ2A 4ALAL 3D2UD 3NZHH 5HPMB 2FO1A 3GKWH 1XIWB 5SWSD 1ZA3A 4P0DA 5E70A 1A7QL 3ULUD 4UTBL 3QO0B 4RISL 1MREL 2X4SA 3MMEA 1Z5LB 3QIWB 5D7LE 1CGSH 4WCYL 5BV7B 3CFDB 3RIAF 3IXTB 5KJRH 3RY6C 1AQKL 2Y7QA 1LMKA 3BPLC 2X89D 5E8NB 3PWUA 4G8FB 2HFFA 1GZPA 4NJ9H 4HH9B 4OFVA 3PP4H 3AS2A 3CZJA 2AXFA 3ZYOA 2O5YH 4WFHE 3O6ML 2H26B 1EHXA 3EZ8A 4I5BB 4JM2A 4OCXH 2Y6SC 2W0FB 5ADPH 1NC4B 1M7XA 3QFJA 1EVTC 4XCFH 1HHIB 1KPVA 4I9WE 3TBWA 3UZEA 3HLAB 5DR5L 4PRPD 1FZKA 4XP6L 4XBGB 3FL7A 4WIQA 1DL7L 4WEBH 3VWJD 1E6OL 4EDWL 1CXKA 4I13B 4JR9H 4OLXH 4XAKE 3ROOB 3IDMB 3QPQD 2VLRB 4QRRA 4LRIC 4CNIA 4YAQA 2I5YL 3GBLA 1TETL 5K9JL 2D9CA 4Y7MA 1FZJB 4G8GB 5IHBA 3LKSB 5ACZB 1UH4A 2R1YB 4WWKA 5JZ7D 1H3TA 5J3HD 4XXCA 5FUCC 1RIUH 1XF2A 1IC7L 1T0MB 3C09B 3IDJB 5DEGA 5BMFL 4L8DB 4MJIB 3DGCR 3MUY1 4NNYB 2PO6B 3H3PH 1HILB 1LO5A 2AJ3A 5DSCB 2I26N 3L7EB 2YPLD 2CUHA 1UZ8A 3D3VB 4LLVB 3GSWB 1F4XL 4HJJL 3VRIB 1JHTA 4UIKL 4YHIA 5IB1A 4ZNCD 4F9LA 5C08E 3UYRH 5F3BA 1FZMB 1QFWI 2QADB 3UEZA 1U0QA 3VGAC 3WNNA 5IBTH 2O93L 3ALWA 1DUZA 5FO9A 5JDJA 2RQ8A 4R7DB 2XACC 3ZTNL 5EU5A 1KJ3H 4WW2C 2OLDA 4OZGA 3B5TA 4PJBF 4PV8A 5F9OH 3BEVB 4EXPX 4LHUA 3GSXA 3TZVD 1DBAL 2A1WH 3KYMA 1B90A 2P5WA 4LOUD 4PJHE 2VWEE 3X12A 4PLJC 5J6HB 3ULUL 1Y0LB 3QIBA 1NBYA 1FL5A 3V5DB 1QO3A 2K9UA 2DYPD 5GIRA 2QR0B 1FIGL 1Q72H 4TNVK 1LO3H 4ZFFB 3PWPA 1UXSB 1CR9H 1D5IH 1NUGA 1OTUD 4JFFD 1IGTA 2BNRD 4XCYB 3BN3B 3MRDA 3IFPA 1VDGA 4MHHG 4PP1C 3OZ9H 2P24B 1P1ZB 2W91A 2XN9D 1SEBB 2ADIA 3GIZH 2P8MB 3I6GB 3JWDL 2FO4B 1JV5A 1QLFA 3Q1SL 4DK3A 4GG6E 4X4XA 4G43B 3C5SA 2VLME 3M8OH 4KRMB 1U8QB 5AAWA 2I25N 5GGTA 2WQRA 1P84J 4JRYB 3BDXA 3VWKD 5J57B 1UKSA 3VGEA 3HG1A 5I74B 4YJZL 3SDCA 3SO3B 3DETC 3G6JA 4H20H 1C5CL 4OI8A 5INDB 5F7MC 3TVMC 2NLJA 2Y1VA 4NO2A 4C56E 2AQ2A 4KKBC 5JHDA 1A6TB 5FKAA 1U3JA 1JRHL 1MHPL 4IOIA 3ULVL 2CDGA 1QSFB 4OQTH 3RJDA 5C0EB 2W9EH 4LSTH 4LASH 2OQJA 1TZGL 3OV6A 2Q86B 1QFPA 5TF1H 3VG9C 4Z18A 1N4XH 3IB4A 4LFHG 2VZ3A 1F90L 5BRZB 1OLZA 2GJ6B 4R97C 3FT4B 1ZT7B 3VXRB 5IB3A 3EOBB 1OD7A 4JY4A 1T5WA 1MCIA 1JCKA 3BAEH 4JPWL 3TBYA 3DVGA 1OB1B 1KEMH 3IFNL 4U0RC 2XTJD 1IM9D 1PKQB 4NC2B 4OCRL 1OAXL 4OZIF 1YMMB 4BKLB 4L5FH 2XWTB 3FB6A 3LV3A 3HPJA 2EIBA 4F58L 3FQXB 1JZ5A 5CMAB 5F1NA 1Y18A 3F7RA 3A67H 1PG7X 2FJGA 4KTYA 4YXLL 4K94C 2FSEB 4QRUA 1SHMA 5AZEH 4Z7UF 5ETUA 3JV5A 5BV7C 2UVFA 4D94A 3C8KA 1W72B 3MA9H 1FL3A 3QEUA 3DXAB 1BAFH 4XHQA 5GRVK 2BSRB 4QHMB 3SKMA 3L6FA 1NGZB 4N1CA 1BFVL 4NKOB 2VDRH 2VAAB 1WBXB 2G2RB 4LLUA 5C2BL 2Q7YA 5DMJB 4XB7A 3QIUD 3DUUA 1CFSB 2CMRL 2VR5A 3PV6B 1J9CT 3QDGB 4HIEA 2AJZB 2JB6B 4PJFB 2CIIB 4OCWH 4AT6B 1NCCL 3TV3H 4ZUVB 4MVBD 5DD1H 4WY7H 2B0SH 2O61B 1MFNA 3EO9L 4P2RB 3DMMA 1KB9K 2E7CA 1QSEB 1X5FA 4MA7H 4FFWC 1SBSL 1HCFX 1T03L 5D4QA 5SV3A 4Z7NF 2H1PH 5I1HL 3EGSA 5DRWB 1G0DA 3VD9A 2YBRB 5I1JL 2ICCA 2NNAB 3F6LA 2AV7B 3ULVF 4YK4B 2VH5H 4WUKL 1BZQK 2GUOA 4KTDH 2BJML 2VXQH 1U3YA 4PREA 1ZHLB 3STBA 2CKBB 2EXWC 4JEGB 2A73A 4G8IA 4GW4B 3BISA 1ZGLM 4JQIL 5KSAB 3C09C 5JXEA 4Z0BL 1UCBL 4WU7A 3KPNB 1OP9A 1T1XA 5IMMB 4X5XB 4Y0GA 3VXSB 2D7TH 3LMJH 1C5DB 2PO6C 2RBLA 4M00A 1YEGH 1FNGA 2XG4A 4D9LH 4P46D 4FP8L 3FB8B 4Y1AA 2Q6WA 1RJYA 2OJZL 4AG4L 3DURA 3HE6C 5CSGA 2V7NA 1QBLL 5CBAB 2XWJB 4W4OA 5T5NG 5IMLB 4JFPB 2X7LB 4CVUA 2VLJA 2IPKB 2QADC 1FAIH 5SX5K 5GS2H 3IJSB 4G5ZL 3BP6B 1N26A 2VTFA 1ZA6B 1KB5A 3OJDB 4WHCA 1DUYA 3VFNA 1FFPA 1FRGH 5JW4R 3OJMB 4BK4A 1RUPH 1S7SA 2NY1D 4Z77A 5J9PB 4HXAH 4UZGA 3MZTA 3IDUA 1ZLSL 1WK0A 4OV6F 2FRGP 3REVB 1X3DA 4U1HA 2VC2L 4FMKA 3LH2L 3C5JB 1KIRA 3UBXB 1CI5A 2DMKA 1I3GH 1BFOB 5C09D 1A7NL 1S78D 4ZTOH 4OZIE 5TE4H 1K8DB 1PZ5B 2D03H 4P23B 2E7BA 2I60L 1RY7B 4HAFA 4KRPD 3U36B 3TPKA 4Z78A 4LHUG 2PYED 2VXSH 4J6RL 2H9GB 4ZAKD 5DURD 2M26A 4AZ8A 1F42A 4JN1L 3DO7A 3GJEB 4NBXB 1ZVHA 3NN8A 4TUKL 5L6YL 4O2EA 3TT3H 5DMKB 3H0TA 4HUMB 5EWIL 4CMMA 1KV3A 4HIIB 4YDVB 1BMGA 3HMXA 3BUYA 4WRLA 4FQQA 4EUPA 3JTSA 3CSBA 1IEBB 5HHOD 2YMXL 2DM7A 2MSPA 1CDGA 5FYKU 2C1PA 4LIQL 4PJDB 4XB8A 3SDXF 5SWZA 1KXVC 4HPYH 4PJ9B 1ZHNA 3PGCA 1P9MA 1XMWA 1JP5A 2ICWA 5B8CA 3H9SB 1U8MA 5FUOL 4AEEA 4NHCL 2DLIA 2B1HL 1NGQH 4J1UB 2YUVA 5FYKE 3AUVA 3LN4B 2N7BA 4Z7NE 1KTKE 2C3VA 4H25A 3U1SH 1EJOH 1FQ9C 3P30H 2IBGA 5CIPH 4NQCB 4NPYB 2GEEA 3PQYE 1L7TH 3S88L 3CNKA 1A6WL 3EIFA 4MNGA 2R39A 5CD5D 4JFYA 1IKNA 1J8HB 2HRPH 3HC3L 4XCEA 3UBXI 4E41A 3TIDB 4J2XA 1YEHH 4NNPL 4L3EB 2DM3A 1IM3B 3RWIA 4GS7B 4OD2B 5CLTA 1IKFH 4HS8H 3MO1A 4FQLH 4OFDA 3VDAA 4DVRL 5D72L 1FE8H 1BVKB 2JCCB 3MXVL 5D2NA 1EHAA 1JNLH 2IQ9H 4PJEE 4M48H 4I0PB 3UCRA 2UYLB 4TUJB 4D9QD 4OFYD 4X6CE 5T33H 1FFRA 2ZCHL 1IGML 1LP9F 1U41A 1UEYA 2Z31A 3VXUD 3TO4D 4NBZB 2RAMA 4YDIH 3D85D 1A6VH 3CH1B 3BO8B 2DLHA 4X6BA 2H2PD 1MUJA 4YXKH 5TQ2L 1TFHA 1RZJC 4JY6A 4MDJB 5BCAA 2AEPL 3IGAA 1A7PL 1CBVL 3U7YH 5CSZA 3QXAB 1PY9A 4OV5B 4FQPA 5F3HB 1CTNA 4F7TB 1UH3A 2VABA 4MLIA 4HXBL 1MCOH 4NFDA 4OZHA 2IFFH 4HV8B 3UDWA 1OQXA 1U58B 4NQTA 1G0XA 1TTGA 1RQ5A 1FNHA 1H3WM 3OKEA 5FHAL 4J8RB 1OL0A 1INEH 3W5MA 3L3DB 5DMGC 3KJ6L 1P4IL 1PY4A 1RIVH 1MWAA 5DEFA 5HJ3A 3I3BA 3P9LB 5E9DD 3FZUD 4DQOL 1JNHB 3QQ4B 3MV7A 2VXTH 1IT9H 4YK4C 1ULVA 2FBOJ 1BZ7A 1FZOB 1NKOA 3TBSB 5C0BD 4XMPH 1E4XL 4YPGA 3GHEL 2R0WL 1CFTA 3QEQA 1L0XA 2GITA 1N5AB 5F93C 3SGEH 2DQGL 1KYOK 3FQWB 5JPMB 3VRJB 4UAOC 2NY6C 3SOBH 5JO5A 1B4RA 4DUWA 1O5DT 5KSAC 1LNUB 4OM0H 1HHGB 1XGRA 3GI9H 1WTGT 3DRQA 3BEWA 3H42H 1NBZA 3BRFA 4Z76A 5DLML 2VLRE 5EZJB 4FG6D 5J1SC 4Y2DA 1D5XA 4U1LA 4DFIA 5GSRA 5ECJE 2BHZA 3BP7A 4MD4A 4YE4H 2GQHA 2R0KH 2A6KB 1R5WB 1A8JH 3D18A 4KKCC 2LFGA 4D0BB 1UM5L 3I50H 5GJTH 3U9UB 1WV7T 4LLMA 1PYWA 5DYOB 4UINL 3MRKB 1NFDA 2YSSA 4MJIE 5FDWA 2DQDH 1YDPA 4V2CB 1DE4B 2FX9L 3MGTB 3BZ4A 2DM4A 3IDIA 3U4EA 3SCMA 4GRWH 2R0LH 3NABH 3UTQB 2ZSWB 5T3XD 4WO4B 3OKMB 1ZHBA 3D3VE 3FOMA 4PJ8A 3LQAH 2BVTA 2R8SL 1BWWA 1DLFH 2V7HA 1U8NA 4MQSB 4UBDC 3ROLB 5BQ7A 4KH2A 4YGVA 1JF6A 1IGFL 2PTVA 3T77B 3P4OA 3STZB 1U3HA 5EA0H 2P7TA 3MXWL 1GOGA 2QKIB 4KPHL 2BHUA 4URTB 1NAMB 4U0QB 3O2VH 3REWB 1KIUA 3WXWH 5EOCH 2E27H 2WWKO 4DVBA 1LD9A 3L5XH 4S1SL 4KTEL 1TVHA 1RJLA 2DD8L 4LLWA 4ZTPH 5EORH 1J10A 1UYWH 5AG9A 4R26L 5FYJD 2BY3A 3L5WB 3T8XB 2YRPA 4HIHA 1U8JA 2B4CH 5EU4B 2HAZA 2HJLA 4L4TA 2EDRA 3D9AL 3FT2B 3N9GL 5F9AC 5JOFB 3IAPA 3D87B 5C8JB 3R1GL 3V4VH 1UB5B 3GMMA 3G5YB 4UOJA 4YO0A 2HT3C 1B9ZA 4LCUB 3LEYL 1FVDB 1MHCB 4PJ9C 4L4VE 3HRPA 3HNSL 1HQ4A 4UQ2A 1NBVL 5IFJB 3RY5A 5I1KL 1BBDH 1SVZA 4KJYA 5E2WH 43CAB 4H1LH 1KEGL 2ICEB 3D39D 4EUPG 4F3FA 2VQ1B 3KXFD 4JO1L 4JY5H 3MROA 2VZUA 3BSZL 2RFXB 3OXRA 3DV4B 4LK4A 5DTFB 1NCDH 4P2QB 3KDMA 5E00B 2GIYA 2R2BB 4NKQB 4P3CL 4KKLD 1FC2D 2JJUA 3NCYP 3NBNA 4JRYE 1CGYA 3E3QC 2WIIB 4LFHD 3T3MF 3RWDB 3UTSA 1WFOA 2BOBB 5B4MC 4GS7C 3DWTA 2F19L 5F8RC 2DKUA 3QQNA 5CJQL 3CFKB 3TWCL 4MAYB 5E6IA 3UZQA 3WHXB 4ZOEA 1S3KH 1QSFE 3CLEL 1QVOB 3MJ8B 5ALCL 2HLAA 1FNAA 3WFCL 5ADOH 4I0PC 4W81A 3C9NB 4ZD3L 1BQLH 1H5BA 1DQQA 5I1AA 5BRZE 1UM6L 2I27N 2GJ6E 3FONB 1HYSD 3VXRE 3DOSA 4KQ4H 5J8OA 1YN7A 4GH7B 5HI3C 3QNZA 4IS6B 4U6VL 3HNTH 4Y4FB 3ARDC 1LO0H 2FYYA 4X9BA 4Z7WB 1NMBL 3KS0J 3GMQB 2AXGB 1JWSB 2X9YA 4FFVD 4WU5B 1PKQE 3MC0A 1U93B 2MPAL 3ISWA 1YMME 1BQSA 4JGUA 5ESVB 2AJUH 3DJ9A 1G9MC 2AJSL 3AB0C 5F7EH 5E8PB 4NWTL 4I3RH 3OGCA 2HT2D 4Z7OF 4Y4KD 2D0HA 2V9RA 3IDGA 4ODHH 5FKPB 3ARBA 3VH8B 5J13B 4Q9RH 3DXAE 1EEZB 4DGVL 2DJUA 2PXYB 2NXYC 3ARXA 4LNRB 1MHHB 5L7XL 5FYJL 1CFQB 2FGWH 4RFNB 1MAJA 2NY4B 5BVJA 4JM2D 2I07B 1MEXL 3FHAA 5E99H 4JM4L 5F96L 3QFJD 4PJDF 1FHGA 3MRPB 1VGKB 3QDGE 3LZFH 2ZUSA 3RY6A 4PJFE 1KG0A 4GQ9L 1IL1B 3ZHKA 5F7YC 1CVRA 2H3NB 4OCYL 4PLKD 4C54A 4P2RE 4UTBH 2OXHA 1MREH 4U2ZA 1A6PA 2GSIB 6CGTA 3VFMA 2CRMA 3QCUH 5LVEA 3NFSL 3T4YA 2DLEA 1ADQL 4FXLA 3QDMD 4X5LA 5DRZA 2GJZA 2L7JA 4KK6C 4OGXL 3CSPA 3O6MH 1IZKA 3K8LA 4GFTB 3MV8E 4P2YA 2AI0H 3C6LB 3QNYA 2C3XA 3LKQA 3V6FB 3TFKD 5D6CA 4H0HB 4ISVA 5H35A 3BMWA 5DD6B 1TNNA 3JTTA 1F4WL 2Y25A 4LAQL 1F3JB 1AGEB 4HJ0D 4AK1A 4PJAF 1OGAD 2P4AB 1YQ2A 4A2MA 3VXSE 3I9GL 1DVFD 4FQ2H 4TN9A 2OZ4A 5DVNA 4G6FD 2I9TA 2VISB 1FNFA 2FR4B 1DQML 4N1HB 5IROA 2DWDB 4WO4C 3GBML 4Y5VB 5I73B 2I5YH 3TA3B 1PW3A 3MQIA 4QXWA 5GRYA 3B9AA 2WBJD 2HG5A 1KN2L 1DP0A 4XT1C 2R29H 1BVLA 1KNOA 3CX2A 4IRZH 3ME0A 2Q8AL 1Q9LB 3D5OF 3QHFH 1M05B 2UWEA 3EHBC 5IVNA 5EOTA 3RIFF 3T3ME 1AKJA 2PTTB 3WNMA 1HOCA 4X7SH 3D0VA 4OGYH 2FL5B 4QGTA 3HKFA 4OF5A 1VHPA 4NZJA 1CD1A 3L3JB 1OCWH 2Y9RT 4HKXB 4HS3B 3JZ7A 5I8OL 2DJSA 2K7PA 2WP3O 3G5VA 3PABA 1JIBA 3MLUL 2FEDD 1K6QL 4QRTA 3SDAC 3ZDYF 1F4XH 4XC3L 3VFGH 5DWUL 2P5WD 4H0IA 1HE7A 1EGJL 3QIBD 4YDKL 1GIGH 1HQRB 3ECBB 1NJ9A 4MDIA 1R3LB 2OK0H 4WW1A 1AQDA 5KS9B 3OJVC 2VLKB 4OLVL 5B39A 3CDGB 4LLQA 5GS1B 4PPTA 2NX5E 4EZMA 5JW4N 1ACYL 3S37H 3BGMB 2DQJL 2BVOA 4X83A 2XT1B 4R4BB 1C12B 2NY7H 1GYAA 4PRDA 5CGYD 3QPXL 4HS6B 3TBVB 4RFOL 4XBEL 4NO0A 2FIRT 1CL7L 1CE6A 5GZOC 4Z8FL 3SBWC 2OBGA 3GRWA 3ARVA 1AD0B 3OHXA 4TPRH 5GGSB 3QA3A 3I85A 2VB5A 2ADFH 4O9HL 1U8OA 2OSLA 1DBAH 1Z9MA 1MAML 4FA8A 4PJCB 4O2FB 1OAZH 3HCVA 4JFZH 4F9PC 3CCHA 1CCZA 1GGYA 4MGXA 4D8PB 4OZFH 3V5KA 5IW1B 4PJDE 5HI5C 5E1AA 5JHLH 4O2CA 5HGHA 3SE4C 3O3DA 2B5IB 1EV2E 5HVFB 3HG1D 3SDCD 1ZKAA 1KJMB 4M43L 3H9SE 3O6FD 4EI6A 5EIVA 1PFCA 4YDLB 1A6UL 5JHDD 1QEWB 4JPVH 1KN4H 3LD8B 2A9NH 4MAYC 1R5VA 1PJ9A 1U36A 2AABL 4HUVB 3BH8A 3MBEC 4OJFH 1HI6B 4NQCE 5DHVB 3L3HB 4K2UH 3Q1SH 1KPRB 4NZRL 1EFQA 1L0QA 4PRPB 1NANI 2ZUXA 3VFVB 2O5ZH 1NCAL 4OCNC 1TZHB 2JIXA 4L3EE 1CE1H 3UPCA 5TJWK 4YFLI 3VWJB 4Y2OA 4POYA 4N0UA 5ICZA 4PJAE 4HBCH 3RWGB 5FYKH 3VD7A 1JF1A 1MRCL 2J3SA 4X6CA 3S37X 2GT9B 2RCSH 2JCCE 4O00A 4PTUB 3R0MA 1AJ7L 1MFAH 3HFMH 1JFQL 5CBEB 1BX2B 4MXQC 3MLRL 1ZWIA 4E42B 2EEDA 5BZWB 1T7XA 2V5SA 2FH6A 4MQ7B 3L3OB 5GISL 4NHUB 4JFDD 1YN6B 2X4NB 4QF1B 4UIMA 2E7MA 1F90H 3O2DH 5L2KA 1RK1B 1WZ1H 2CLRA 5J13C 4U1MB 4M8QA 3ZL4L 1HEZA 1GAFL 3RRQA 5KVFH 4L1HA 1CLOH 5FM5O 1LK2A 2ESVA 5DZOA 4JPWH 5JDSA 4RFNC 1UB6B 3X3FH 5ICXB 4IMLA 4CJ0A 2YPLB 3CFDA 2Q1EA 3QXTA 5BS0A 2ADGB 2YKLH 3TN0A 4UT9L 4CL7A 4KK9D 4G8FA 1A6AB 1YYLL 3MYJA 5CEYA 1FCGA 3VFSB 3SGKC 3ZDYE 1WWCA 1U92A 1CLYL 2EZ0D 2H26A 5L2JB 2UVEA 5CEZE 2F8XC 25C8L 3DV6A 3ARZA 2W0FA 4JQXC 3BKCH 1MIEL 1JHKH 4BH8B 3DRTB 5E2VL 2Z93B 1TVDA 2DM2A 3GUTB 2XTLA 4ENED 1PD6A 1R3KB 2FJHA 1T1WB 2HTLD 2JF1A 5DQJB 4XBGA 3LS5H 1S7UB 2CMRH 4Y4HA 3C6LC 3D25B 5F7HA 1OGTA 3IDMA 3QFDB 5I66A 1AIFA 1Q94B 3TZVB 3M07A 5J6GA 3EO9H 3PV7A 4RAVB 1FZJA 4G8GA 1F58H 2AEWA 5DD0H 5ACZA 4S1QL 1ORQB 4WV1C 5HPOA 2DYPB 4PUBL 5I1HH 2ID5A 4LCIL 4U49A 2PW1A 4Y1AD 1QFWH 3QUKB 4Y5VC 3MYZA 3TA3C 5IEKB 4L8DA 4JFFB 2BNRB 4UT6L 4NNYA 4C83A 4NKMB 3NMEA 2D7NA 1I9RL 4CU6A 2XN9B 4XBPB 4Z7WF 5I0DA 4NKDA 3L7EA 5FXCH 5IHZB 4HFUH 1HIMH 1ES0B 3ES6B 1FO0B 4LSVL 4ODWA 3RWCA 4LLVA 4ZG1A 3GSWA 4KI1A 3HE6A 5ID1A 1H8NA 5J12B 4PBXA 4Z95H 5BXFB 2Y07L 3HAEH 3VWKB 1FZMA 4OIIL 5KVEH 2X4PA 3FO2A 3MNZA 1RZFH 1OWWA 4NRZA 4MCZA 4AG4H 5HGAB 1QBLH 4HK0B 3FO0L 3KLAA 4OUUB 1JN6B 1RI8A 1S9XB 5A2LH 2VDLH 1TZIA 2FZ3B 1NMAH 3DSNA 2X4OA 4JGJA 3RUGF 1DQLL 4IJ3B 5C0IA 3RVUC 1ZGLA 3FAWA 5GS1C 2NY2C 2QHLA 5EBLB 3CZFB 2BX5A 4XWOD 2VN4A 4NC0B 1GJIA 1BQHA 4NM8H 3MPCA 5M95B 2AGJH 4YEFA 5HY9B 5J6HA 2Z8WC 4WTXA 4UUJA 2B8OT 3MRBA 4X99B 5LGHL 1NGPH 4BZ1H 4C4KO 4HMCA 4XH2B 2XTJB 1IM9B 4GXVH 5I15H 1LE9B 5B39G 4OLZH 3VFOA 1OW0C 4I4WB 1M7IB 1MCKA 4GAGH 4N0CD 1FVCA 2VN7A 4MA3B 1HZHL 4NN7B 4OD1L 4MB5A 3ULUC 5AYUL 5HHXL 1QLRB 5FV2A 3P0VH 4YZFF 1H0DB 5MI0B 1G9NC 2YUXA 4G6JL 3T65A 2Z92A 5JW5B 3FQTB 2DMBA 2ZNXA 1MHEB 1U8LB 2BY2A 4FZEH 4N9GB 4UT7L 2V5YA 3LD8C 3ZLQC 4M1DH 2EH8L 5D7IA 3NPZB 1PX4A 3O41A 3LPFA 2HFGL 4TRPL 3QIUB 5KTEL 5HTSA 4P2QE 2R15A 2WANA 4S1RH 1VPOL 4YHKH 2ED8A 1INDL 3JWDC 5KVGL 3I2CL 4LIQH 1A6TA 2A0LD 3OR7A 5I1EH 2IALB 2ITDB 3HZVA 1OSPL 4J3OC 4NDMB 3VWJC 5C0EA 2Q87A 3AS0A 4MNHB 4X7TB 1RUKH 1QQDA 2C3WA 4ZUUB 3W11D 5A43C 1YJDL 3QPQC 2EDLA 1IGIL 3KNBB 2VE6B 5T1LD 5CFHA 4Q6YA 1NCWL 4OCSH 2V2TA 5I76A 2FJFB 3NFNB 4MCYA 4Q74A 5D7JC 4N8CL 2NY5C 2L4OA 3ULVC 2HJKB 3S88H 4PRID 3WKML 1A6WH 1OB1A 3EFDL 5JZ7C 5J3HC 1CDYA 1I8IA 4J4PC 3PXJA 1CF8L 4JJ5B 2NYYC 2XRAH 4Z7WE 5TE6H 4BQ9A 3MUZ1 1WEJH 2XWBB 2CK0L 4YFLF 3HI5L 4RNRB 3GK8H 4YC2C 1RURL 3SE8H 3L1OH 2J2ZA 4P46B 5FCSH 4GAYB 1KGCE 2DBLL 4HHAB 4M7KL 3DXAA 3UPRA 3BT2L 1MFBL 4JQVC 4QHMA 5LJYH 1NGZA 3V6BR 1I85A 1T89C 3KVQA 3VGHA 2FX7H 5D1QA 4HJGA 4MJ6B 3QQ3B 4LGRB 3VW3L 2F54A 4WFED 5KAQF 2EDFA 3TT1L 3PV6A 3AAZA 3MV7D 4X4MA 4JLRA 4DUVA 3G5ZB 2EEAA 2AJZA 5TQ2H 1WWAX 4PJFA 1G7PA 2R9HD 3QEHB 4PJCF 5C6TL 3RVXC 1XCQA 2AEPH 4N0FB 4C55A 4ZUVA 4CU8A 1IQDB 5TDNA 2ZOLA 4L1DA 5DJDB 5C0AB 3RWJA 2APWA 3QEQD 1QSEA 2NY1B 4R9HA 3HZKA 3KPRA 4V1DA 2BNUA 1VKXB 4ZS7H 2H45A 3F58H 1CQKA 3RJQB 1RHHA 2C4FU 1IZJA 3A6BH 1JVKA 4JG1H 2AV7A 2UZXB 2XA8H 4TQEH 5DUPH 3TZVC 4AEFA 1GOHA 3IFLH 1JNNH 2J8UB 4LOUC 3JV4A 4POUB 5C09B 3G5XA 1JZ3A 3WFHB 3L7FB 4P99A 2X70B 1CD8A 2XI9A 5ESQB 3AFLA 1I8KB 3BKYL 4KRPB 4PG9A 2QQNL 2PYEB 2Z91B 4ZAKB 5DURB 4TTDC 4NUGL 1OTUC 5IJKC 3VXSA 2R0WH 3BIKB 1KB9J 4MD0B 5KW9L 5L8KB 1EZVY 2NZIA 2J12B 4UTAH 1Q0XH 4NBYB 3L9RA 1L7IL 3ZE2E 5CBAA 4F7CB 5HHOB 5J12C 5DJYA 4E9LA 3H9ZA 4OZ4B 5IMLA 3VWKC 3AVEA 5I16A 1ZLUH 3SY0A 4GXUN 3T09A 3IJSA 3RVWC 5EUOA 4P3DA 3EYVA 1U3HD 5K9QG 4TSCH 1DBKH 1YEFH 5IVXA 4OLYH 4PY7B 5J9PA 1OSZA 3WNOA 3AROA 5C0FA 4IJ3C 3MACH 1W8OA 1CXLA 2HVKB 2H32A 4M6NL 1IFHH 3UTTA 1JGLL 4DKFH 5I18L 4PV9A 4U6YA 2FIKB 3U79A 3C5JA 2MKWA 2EDXA 3GGWB 4KQ3H 5CZVH 3QUML 4L4TD 1WCBA 1RU9H 2R8SH 2H8PB 3LB6D 1OPGL 2OR7A 2IANE 2HFTA 3MLPA 4JHBA 1IGFH 1PZ5A 5DJ2B 3KPSA 1A0QH 1MJUL 3L3IA 2D31A 2XTJC 4P59H 4JFEA 2ZOKB 4LVHB 1MCWW 1U8PB 1BQHG 3U7AA 2VLKE 3UTOA 3AC0A 5ICYB 2FBJL 5IGXL 4NN7C 4XC1H 3HUJA 2OL3B 3GMLB 5AWNL 3VXUB 4UOW0 3TO4B 1SVCP 3DX6A 3D85B 3LEVL 1UWGL 5MI0C 2EE3A 3NIDE 1X5ZA 5LAXB 2CLVA 4X0KB 3S98A 5EIIA 2P43B 2F9BT 4M3JA 4FZ8L 4PGDA 4WFFE 1KTLB 4ODTL 1BECA 3ULSB 3E2HB 4EOWL 3T4AB 3QIUC 4JKMA 2CJUL 2XPGB 4PJCE 4YHPB 1EEYA 5FGBA 3EOAB 3MLXL 2CPCA 4MVBC 1S9YB 4JREB 4G8EB 3MCKB 4YH6A 4RX4A 4XXDB 3G9VA 4E5XA 5I30L 1YUHB 2DDQH 2R4RL 5E9DB 5CIPA 1GGBL 4HCRL 4G6KH 2QEJA 4FNLL 5KVDL 1J8HA 4JO1H 2AJXL 3RFZC 5F72S 2HA1A 3TIDA 5C0BB 3UX9B 3QNXB 4PJ7A 4EBQL 5KZCD 1XH3B 1P4LB 5INCB 1IM3A 1MRFH 2A6IB 2AQ1A 2VXUL 5EBGA 4H88L 2MTPA 5A3ID 3OQ3B 4XP5H 3SEPA 4LU5H 4PRPE 2AK4D 1KCVL 5GS0D 4X7FC 3R8QA 4GAFB 1ZAGA 1HSBB 3D69A 4XNUL 5J11C 1U8KB 1UXWA 4YIQB 5MEPB 3IKKA 5T1MB 2EYTA 2DIJA 2VR4A 3QDJA 4KKNA 5D7KE 5FK9A 2YD9A 5CJQH 4CU7A 1KT2B 4RGND 5HHME 3ARFC 2UY7A 4P46C 3BO8A 1YC8A 3BQUD 1S7VB 2W60B 4TOYH 3ARDA 1NC2A 2JJVA 2E6PA 4BZYA 4D3CL 4WEUD 4MDJA 4OCMC 1AO7B 1MCPH 5DUBA 3GIVA 1T4KB 1LO2H 3WS6C 4TVPD 5CLWA 1A9EB 1UM6H 2VDOH 1R5IB 2VOTA 4QRSB 5E6ZA 2FCBA 2VIRA 5DD3H 4HV8A 4K3HA 4P5TD 3K74B 5GRWA 1QTYT 1YEJH 5EN2A 2XOTA 4R4FL 3OGOE 3RWHA 2YPLE 1A6ZA 1BGXH 3NIFF 1UQSA 4HPOL 5K9OB 3AY4C 3S7GA 4Q2ZA 2FECL 3CVHB 3UZVB 5IG7A 2AJSH 4RGMC 3K7UA 1DFBH 4PBWD 4LBEB 3PDOA 4JHAL 4OIBA 4GKSA 1JNHA 1MJ7H 4PJIB 3O3AB 2AJYH 2Y6SD 4M7ZB 1MSPA 2APTA 3P4NA 1J1PH 3VI4F 4MD5B 1V7MH 1P6FA 1YPZB 1S78C 4Q58C 2DLGA 2V2WA 4W6WB 4DGVH 1NEUA 3U6RB 5I2IA 2YRLA 3RPKA 2X5PA 1LEIA 5JPMA 1EO8L 2YZ1A 3QCTH 4ZAKC 4KHXL 5ID0B 1HHGA 3KYOA 4ELMB 2G5RA 5IM7A 4HFWB 4OF0A 1FGNH 4I3SH 4X8JA 5IP4A 3DSFL 4Z7QF 3D0LA 4OCYH 2OI9B 2IMMA 5EU6D 4HW6A 5CEZH 3HE7B 3R0NA 3WIHH 4HGWB 3F5WA 1F6AA 1KENH 4U1NB 5IJVA 2W1NA 1AI1L 4YHLL 1ONQB 3U0PB 2KKQA 4CAGA 5T5FL 4K7PH 5C92A 4IRJB 1PSKH 2LU3A 5HVGB 1MCHA 3JV6B 1KYOJ 1KLUB 1MNUL 1DE4A 4KMQA 3D39B 1DQJB 3FN0H 5TGBB 4YNYB 1W0WA 3KXFB 1QNZH 1MCCA 2XN9E 5DRNB 4GW5B 4HWEL 4WO4A 2VR9A 1XEDA 2B7DT 1GGUA 5GS0L 2QHRH 3ROLA 4ZPVB 1CGWA 5CD5C 5IK3A 3ZTJH 2QKIA 1BWMA 1XGQB 3VXQB 2BRRL 4LRNH 4HX1A 3MOBL 1CU4H 2Q8AH 1IAIL 5ALBL 5TPWH 2OMBA 1FH5H 2CXKA 2BC4A 4J3VA 2UZYB 1S5IL 1KSRA 3QQ9C 1JUFA 1BJ8A 3L5WA 3H8NA 4QTIH 3QHZH 3SDAA 1CFVL 3NZ8B 5D71L 3BXNA 3EYFA 1A22B 3O4LE 4MHHI 1C8PA 2CKNA 3T3PE 4PLJD 4HC1L 3TO4C 5GGRA 3KYNB 4U6HB 4GUPB 2H2PC 5HHQB 1RJZB 4FQCL 2BVPB 1AXTL 4O02H 2KL6A 1CFNA 2RIKA 2X44D 3E2HC 4PB9L 1XGYL 4XCNB 3JVGC 2NY3D 3LVEA 1QFOA 1OARL 1ZA3B 2X4SB 3N50A 2GY5A 3MMEB 2XNAB 1UADC 4Y4KB 2HN7A 3EYSH 1EEUA 3SBWA 4H1LA 2VQ1A 1UM4H 4JREC 2Y7QB 1TDQA 5EZLA 2HFFB 1GZPB 4N0YL 4GSDH 1GSMA 3DV4A 3KWWA 5L88L 2AXFB 5DFWH 5FYLH 2EDJA 5T3ZE 2OM5A 3FZUC 2R2BA 4GQPH 5DC9B 4Z8FH 1TENA 3MLZL 4JM2B 3MUGA 3QUXA 1T2XA 3BE1H 2EYRA 3QFJB 4ZNEA 1C1EL 1KPVB 3TBWB 1FNSH 4FFYH 4MNQD 3DTXA 4NP4L 3X13A 3QWRA 1FZKB 2HH0H 1T22B 2OZ4L 4X6EB 5DK0A 4L8CA 1XCTA 3WHXA 3MBEA 1DQDH 1A64A 5I17A 3HI6L 4QRRB 4YAQB 2FLRT 4O4YH 1A6UH 1F4YH 1GC1H 5EB9A 4FG6C 1R24B 3SJVD 1YMHA 3SO5A 5FF6B 4MXVE 5KSUA 3QDMB 1L6ZA 3WE6B 4WWKB 3KPLA 2DQEL 4O5LL 2AK1H 2R1XA 3OAZH 5CWSA 1XF2B 3LRSA 5EDXA 4IOFD 1ZXQA 3GMQA 5DEGB 2J8HA 1NFKA 3F7VA 3KPPA 3PHSA 1MY7A 3MRCB 4RMQA 1N0XH 3LKNB 3OWEA 1FORH 1Z3GL 4NZUL 5ESVA 5CCKL 4YUEL 1KJ2A 5E8PA 2VZSA 2AJ3B 4KC3B 3T0EC 4XPBH 4G6FB 5MHSD 2W9DL 5BS0D 4UB0H 1PZUB 5FKPA 2ARJA 3TN0D 3RA7L 2CUIA 5FM8A 2WBJB 1JHTB 1G7HA 2VNCA 4YHOH 5IB1B 4Y5YA 5F3BB 3G08A 3EYQD 3KPQA 5EOQL 1F3DH 1CGTA 2EC9U 2VDKH 2GW5A 4QXUL 2I07A 4XP1L 1SEQH 1DUZB 5FO9B 4WWID 3MRPA 3BJ91 5D1ZC 1R3IL 5EBMB 3WKNA 4GG8A 4DGIL 2G9HA 4DKEH 5C3TA 5EU5B 1X5JA 4ZFZA 1CQYA 5C0AE 4Y4HD 4HWBH 2GK2A 4JQXA 3GSXB 2AW2A 4K71B 1PBYA 2P5WB 3KYMB 5IVZA 3QIBB 3BGFC 1V3JA 2J8UE 2OI9C 5IW3A 1NBYB 1FL5B 1QO3B 5GIRB 2EXWD 1CLYH 5DJAA 3BDYH 3C6LA 4EI5C 2CDFA 1MIEH 2IGFH 2R56L 2UUDH 4EJ1C 3HRZA 5E2VH 5I75B 1IGTB 5KN5A 3MRDB 3IFPB 2QV2A 4PJBA 5KSBF 3WJLC 1PKOA 4M93C 1J1OH 1WBYB 2R0ZH 2Z8SA 1S7QA 4H8WL 4PP2A 2SEBB 4LSQL 4WV1A 4OI9A 4MMXC 4AMKL 2BVQA 4NKIL 2ADIB 3MLSH 1JV5B 1QLFB 2YA2A 2Y06L 1VFAA 1C5BL 2XICA 3HE6D 1QYGL 2ITCA 4UV4H 3C5SB 4TNWF 5E2TH 5HHOE 1QZ1A 2MQ0A 4MZ2A 3MRJA 3VGBA 4KKLC 3IDXH 3TYFA 1N59A 4K8RH 3HG1B 4QHNA 1E4WL 5DEZA 5I8EA 3SDCB 3G6JB 4XPHH 3QP3A 3OKNA 4KHTH 4NQSA 3O6FB 4NO2B 1IGJA 5JHDB 5FKAB 3E8UL 1WQVT 3LS4H 5DA4A 4HS3A 4CBPA 4IOIB 1S5HA 2ZCLL 2CDGB 2FATH 2BMKA 3W2DL 3MRGA 3ZSSA 2F5BH 4NRYB 2OQJB 2OJEA 1KCSL 4LLYA 3ZO0A 1DDHA 1WJ3A 4W4NA 1HK6A 1T20A 7FABH 3PJSA 5I9QB 2B1AL 4GKNA 5GRUH 4X6DB 5IB3B 3NZHL 3P9WB 1HYSC 3LDBC 4JY4B 1T5WB 1HHHA 3GKWL 4LP4A 3SKNA 1WFUA 3TBYB 3ZDXF 4PGCA 4OIIH 4P2OC 5FAAA 3WD5H 5KS9A 1CGSL 4XZUA 5IWLC 2VYRE 5KJRL 4FFVC 5GS1A 3FB6B 3LV3B 4POZD 4NJ9L 5F1NB 1VADA 3PP4L 1Y18B 1TCRA 3TBVA 4S11A 3P3YA 4D9QE 2O5YL 2YRZA 2FJGB 5JW3H 4HEPG 4QRUB 5MEOA 4Y4KC 5ETUB 1HHJA 3VXUE 1G6RH 5HSFA 4JFDB 3C8KB 1ZV5A 3FRPA 5ADPL 1FL3B 1YQVH 3QEUB 3QWQB 2PW2A 4ZSOB 5F6IB 1OW0A 2Z35A 4QO1A 4XCFL 4GO6B 3L6FB 1MJ8H 3SKMB 5JORA 3FN9A 5C7XH 2DL9A 3D2UA 3WO3B 3KYKH 4LLUB 2X1OA 5SWSA 1NANH 4WEBL 1CT8A 4LKXA 3IS1X 5IBUG 3DUUB 4LF3A 4JR9L 4OLXL 1CIUA 2DRUA 4H1LG 1BJ1J 5BW7C 4ZS6D 5F9JA 2MFNA 1ZANH 4Z7UA 4XNZB 1HZHH 5CZKA 4XP4L 1YNKH 2GK0A 5E8EA 4RIRA 5HD8D 3EGSB 5DHVA 3L3HA 2FB4H 5E9DE 5C07E 3JSSA 1RIUL 3DI3B 1KPRA 4HEME 2DQHH 3I84A 4XGZB 4AEHL 2GSGA 3JWOL 1OAKH 2GUOB 4K3GA 2EH8H 5DDHA 4PREB 1J1XL 1Y6NR 3H3PL 1B6DA 1I4FA 2YUWA 3VWJA 2A73B 4G8IB 3ORJA 5CHNA 4XXCC 4KI5F 2LQRA 1URLA 5F1IB 3CJJA 3RWGA 5KVGH 15C8H 3BPCA 2GT9A 3W9DA 4S2SB 1X5KA 2EIEA 4UILL 4HJ0C 5F1KC 4PTUA 2V5TA 1A7RH 4Z9KB 4DN3H 1FNGB 5B22A 5CBEA 3UYRL 1BX2A 1DVFC 5D7JA 4NC1C 1H3VA 4PJGA 5CJOH 1NGYA 3VFUA 4E42A 3QCVH 4EVNB 3L3OA 4J4PA 4Y1AB 3HC4L 2Q6WB 5IBTL 3K1DA 5T1DH 4HMDA 2QBWA 3DURB 2X4NA 1CG9A 1JWUA 5DGRA 4JPKL 1F6LL 2WBJC 2HVJA 2NCMA 3QSKB 3O2DA 5ABDE 3TJHD 1AO7E 5D1QD 1KJ3L 2BNQA 1JE6A 4R0LB 3SN6N 2F54D 4NQED 1VFBB 2YC1A 1F13A 5F9OL 3LCYA 2IH3A 5LKNA 1DUYB 3VFNB 2W07A 4JQVA 2A1WL 3WFEH 5DMGD 2A83A 5T3XE 1S7SB 4QCIA 5K59E 3NPSB 5F7LB 2J7LA 3VFSA 1T89A 3HI5H 3KPRD 4V1DD 1CZ8H 1Q72L 2FHCA 1LO3L 1IJ9A 1UFUA 1XZ0B 3I75A 3DRTA 4K71C 3ZDXE 3EDFA 4QT5A 3CU1A 4PJIE 3J7HA 1TLKA 4LLDA 3QIBC 1R3KA 5DQJA 4WI2A 3OZ9L 4AM0B 1YPZE 4FHBD 4JM2F 3IRZA 3QULA 3TT1H 4Z78B 5I6XB 1QRND 2NY6D 3GIZL 3HR5B 5KBNC 3W9EA 2BSED 5F7NC 4N0RA 3PGFH 3TZVA 2CDEA 4F7EA 2XV6B 3DO7B 3M8OL 4ELME 3H0TB 3V6OC 4MWFA 3BRDA 4CMMB 3TCLA 4XNMA 2DYPA 1GPOH 2C5DC 4P9HL 4GRLD 1R3HA 5J1TC 5B3JE 4FQQB 4U31A 3VXMD 4H20L 1EERB 3CUPA 2C1PB 4JFFA 5IJKA 2BNRA 4QRPD 3DECA 3QXWA 4OQTL 4NKMA 2ICWB 4LSTL 4HIJA 1HHKB 4ORGA 2XN9A 3MODL 4LASL 4XBPA 3SDCC 5B8CB 5GS2D 2QQNH 2V17L 4OFKA 1ES0A 3O6FC 1N4XL 3T2QA 3IU4H 2KQNA 3D39E 3G6AA 3GKZA 2XFXA 5T5NF 1Q1JH 3KXFE 4H25B 1NGXA 3GB7A 4NYLB 4IDJH 1KXTB 1BD2A 3BAEL 3K81A 1UA6H 4OF3A 2ZJSH 3MV9A 3HAEA 1KEML 4JFYB 1SY6H 3UTTD 3SDXA 4XCEB 5I9QC 4E41B 4LDLB 4L5FL 2DF3A 3RWIB 4KI5E 1JN6A 1S9XA 3A67L 5J0BA 5JW4M 5BOPA 2AP2A 5KSVA 3FN3A 3KPSD 5AZEL 4DKAA 4IHOA 1MI5A 3LEXA 5D2NB 5T1LB 3ETBF 1BAFL 1FO0H 3AGVA 4QTHA 1R6VA 3H6JA 2NXZD 1JTOA 3O11A 4NGHH 4OZGF 1AFVH 4PRIB 1EXUA 4X6BB 1A1OA 3ZE1F 1MUJB 1LE9A 3GSRA 2BSTB 4JY6B 5F6IC 4OCWL 3TV3L 3IGAB 1GXEA 3RP1A 3S6CA 2BVEA 1AGBA 5DD1L 4WY7L 2B0SL 5CSZB 1E6JL 3VGGA 2VABB 1TJIH 4MA7L 4YHYB 5E8DH 3BZEB 3FQRA 2ICWI 1TJHH 4OZHB 2KH2B 4K7PY 3V4PH 3OKEB 3FRPG 2D4FA 5D8JH 4M9PA 2F53D 3FQTA 1LP9A 1AC6A 2VH5L 4KK9C 1U8LA 2APBA 4RX4D 3FFDB 4KTDL 1MWAB 2VXQL 5DEFB 5HJ3B 4JFHD 5DXWA 5IIEA 3QIUA 2EZ0C 3LEVH 1UWGH 3KYAA 5C71A 4FQXA 3MV7B 5DUMH 1LE5B 1ZS8A 1BZ7B 4K9EC 1JF5A 3QFJE 4YPGB 2D7TL 2HTLC 3LMJL 4A6YL 3QEQB 4EOWH 1YEGL 1JYWA 5JA9A 1N7MH 5DFTA 4X7TA 4K7FA 5K9KA 4D9LL 5JO5B 4ZUUA 4PIRF 2VE6A 3F7PC 3HPLB 4D9RD 1XGRB 3G6DH 5DHXB 2R2CA 2CQVA 3BEWB 2X4UB 3QDJD 2DQIH 4ODVH 2EH7H 4Z76B 1I3VA 4KXZI 4QRRE 4Y2DB 4U1LB 3NFNA 5T3ZH 3BP7B 4MD4B 5I1IL 3QH3A 4TSBH 1FAIL 3UTZB 1SJVA 3WJJA 3DROA 5A16B 1EEQA 3D18B 5D9SB 3ARDD 1K4DB 1NC2D 4QEGA 1YJDC 3QJHA 1JZ7A 3A0OA 5FO8A 4EIZC 2N1KA 4EBQH 4LLMB 1FRGL 1PYWB 3DUSA 3OB8A 5FB8A 2VXUH 5BZDA 1JGUL 4UMGA 1EO7A 2XWBA 1RUPL 4KFZC 5FGCB 1NFDB 3CK0H 5T1KA 2EYSB 5CEXB 2P5EA 4OCLC 5FDWB 4R0LC 1KCLA 3U4BH 1YDPB 2D0FA 3ARFA 3WYRA 4XVTH 4Q97A 3VG0H 3U4EB 4GAYA 3SCMB 1QP1A 4NC1E 4U6TA 3RY4A 3ARUA 3CXHK 3VMOA 2W0LA 3FOMB 1I3GL 2PR4H 1U8NB 2V7HB 4EXKA 3WS6A 5BQ7B 4XNQA 1ED3A 5TE4L 2D03L 2NXYD 1ZSDA 2IAMA 4P5KA 1K4CA 3P4OB 2CO6B 4X6FA 1U3HB 2P7TB 2VXSL 1IVLA 5KOMC 5GGRY 1QR4A 4PGJA 2FEEL 3RI5F 3PDGA 4DVBB 3AMLA 3AY4A 2MQ3A 3OTTA 3TT3L 1PX3A 1N2RA 1C08A 1RJLB 5DD5L 4LLWB 5I6XC 3B83A 4OZGE 4XWOC 1J0HA 4HIHB 1U8JB 2DQUH 5FUZH 3VFWA 1WICA 4YHMH 1V7NH 3ZE1E 4L4TB 5C09A 4Q6IA 2F58H 4LHQB 2P5WE 4KK6D 2UZIH 2XZQH 2Z9TA 5DJXA 3GMMB 5TQ0H 4R4NC 2PYEA 4YO0B 1NGQL 1OTTD 5LCVH 3QG6A 5E6YA 4N0CC 3PWPE 2IBZY 1HQ4B 4JG0H 1EJOL 1X4XA 3P30L 4HT1H 2CR3A 4Y16A 3ZHDA 2D7MA 1L7TL 3IDYC 2APVA 1EO8H 3ZKMC 3S34H 4F3FB 1MVUB 3FQNA 5E4EB 2DLFH 2HRPL 2JB5H 4HH8A 4F57H 3O45A 3MROB 1IC1A 1NDGA 3U0WH 4F7CA 4KK5D 1YEHL 1Q9KB 3OXRB 5I1LB 1LWRA 1IKFL 1VERA 3KDMB 2A6JB 4FQLL 4AJ0A 5JXAH 4JPIA 4L8SB 2HT4D 4QRQB 1UWEH 1YEDA 1FE8L 3GBNH 1GOFA 4X5WA 3HG1E 1JNLL 3ZKXB 3UTSB 2IQ9L 2A0LC 3G6JE 4JO3H 4M48L 4LGSB 4WUUD 4WDIA 5T33L 4NCDA 2VDQH 2V2XA 5JHDE 2DBJA 5E6IB 1MNUH 5DZLA 3HAEG 4M7LH 3W11C 4YDIL 5DRXA 4ACPA 5D2NC 5B21A 5FDYA 4YXKL 3S96A 1D6EB 3VXTB 3WSQH 1EHLH 4QGYA 4JN2A 2EKJA 5KZCB 3U7YL 4FRWA 1SJHA 3TF7C 1DQQB 4X6DE 2AJVH 5HYSA 1MCOL 1YN7B 5F7KC 4JCLA 4RFEA 1L0YA 4GKOA 2NQCA 3RIAK 4Z7VB 2FYYB 2ZOKA 4X7EC 5FCUL 3Q5OA 2BRRH 4MLSA 5EO0A 3ZT6A 4OFYA 3DLQR 1RIVL 4YHYC 1J12A 3VMPA 5ALBH 3K46A 2WW8A 4W68A 3MFGB 5IB4A 3BQUB 2VXTL 1IT9L 4L9LB 2VMFA 5I8CA 3IDGB 5MENA 1Z6JT 5D5MA 1S9VB 4YDJA 4YWGH 5M7QA 4ZSOE 3A6CH 5JUEH 1VFUA 3JVGA 2J5LB 2DL2A 1KTDA 3BGAA 5HI5D 3CX5K 1F5WA 2GFBB 3SOBL 1NEZB 4P5TB 5BVJB 3T0BA 3QUXD 1T7WA 1EIBA 4FQCH 3DPBA 2R9HC 4MX7A 3NIGE 4OM0L 4D0DB 4TSAH 1BBJB 4DCQA 3GI9L 4ODSH 3DHJA 3H42L 4KJWD 1HKFA 1KG0B 4HGKC 2A38A 1XGYH 4JDTH 4PGEB 4JO4H 4XXDA 3QRGH 3UC0H 1X5AA 4XX1G 2BOCA 1U42A 4S10A 4YE4L 1OOAA 4BFIA 2R0KL 3MBED 4JFXA 4FQIH 1A3RL 4DGYH 4M1GH 1OAYH 3I50L 1DR9A 5GJTL 3VFMB 5C0BA 4N0YH 3T4YB 1U6AH 1XGTA 2VLMD 5LWYL 4KMTH 2GJZB 2DQDL 3NAAL 5A2IH 1NL0H 1G84A 1DEDA 4X4YA 3HN3A 3EOTH 7CGTA 3QNYB 1UGNA 3LKQB 3CLFL 5D6CB 4ISVB 3JTTB 2PYFA 4C56D 1RZ7H 5IB5A 4NP4H 3LQAL 4HUXB 5LXGH 1KT2A 2PCPB 5FIEA 5EU6B 3MJ9H 2I9TB 3EUUA 2HMID 3VRLF 3RGVA 2XY2A 4BSJA 4JHWH 3WXWL 4Y1AE 5EOCL 1Z0NA 2HG5B 2WP3T 4IRSC 1BVLB 1KNOB 3B2UD 3L5XL 4KDTC 2UWEB 5EOTB 1QBAA 4BFBD 4NCC1 2Y36L 3LSOA 1AKJB 4O5LH 4ZTPL 2ADJA 1U3HC 5EORL 2VLJE 3D0VB 1UYWL 4IEFB 3T0EA 2EDEA 1T5XA 5C6WH 1OAQH 4J3XA 1A5FH 1NCUA 2QQQA 2DMCA 3MRFA 4WI5A 4OZHF 1DBMH 3WL9B 3RNKA 1IAOB 3QJFB 3ZKND 1MJJA 3PABB 3V4VL 1VACA 4OAWB 1F4HA 3EYUH 4ORZC 3BIBX 2D9QB 4QRTB 4UOW1 3HB3C 5D1ZA 1K85A 4OLEA 3KHQA 3LB6C 5GGSY 2X09A 1A7OH 5HDLA 2WNGA 1NJ9B 1Y6MR 4JCMA 4MDIB 8FABA 5I0ZA 1BBDL 5E2WL 4ELKA 3STLA 4WW1B 1AQDB 4FQJH 4NO3B 4C57C 1CLZH 4GAJH 4JY5L 4HFWA 3WDHA 1J11A 3H7BA 2BVOB 1IGYA 1EA9C 1A1NA 1TVBA 1NCDL 5D2LB 1LILA 1CE6B 1O0VA 3ZMRA 4YFEA 5E4EC 4HGWA 3OHXB 3OPZH 3OX8B 3CDYA 4EI5A 3QA3B 4GXUM 4X8XA 1U8OB 2OSLB 5IMOB 1ONQA 3HCVB 3U0PA 3CCHB 4P5MA 2NY3B 3V5KB 2KZWA 3WJLA 2DQCH 4L8SC 5F8QC 5SWZE 3JV6A 1IAIM 4ZOBA 1ADQA 3WFBH 3O3DB 4OF6A 1S3KL 4DZ8A 1HXYA 2X42A 4PLOB 4YNYA 5DRNA 4JGMA 5ADOL 4EI6B 4KZEH 3C87A 1HWGB 2DICA 1BQLL 5DQDH 1R5VB 4ZPVA 4KQ4L 4W6XB 4AMKH 3CD4A 3HNTL 1LO0L 4ZXBD 2MMXA 4NN6B 1LHZA 4MNGE 1T1ZA 3MRQA 1XGQA 1OM3H 3MUHL 4FXKA 4MNQB 4NFCA 3AM8C 4E41E 1YEEH 2XZAL 5A3IC 2JIXB 2AJUL 5GS0C 5F7EL 4G6AD 4I3RL 4N0UB 1H3PH 5ICZB 2F15A 2NW3A 5HHVH 1ERNA 1JF1B 3NCYS 1U3ZA 3VG9B 4ODHL 3TNMA 5ISZA 5TFSH 4LPUA 3MGOA 4L3CA 3KGRA 3NZ8A 5D2NE 3E8UH 4R97B 4Q9RL 2Y23A 3INUH 3SJVB 2ZCLH 4S0SD 4RGNC 4YFDB 3VRLE 5HYSG 1CDBA 3W2DH 1ZWIB 1WC7A 4KV5E 1WFNA 4U6HA 3W0WA 2FGWL 1S7WA 3BQUC 2MKLC 4Y19A 3FB7A 4L9LC 3U7WH 4PJHF 4U0RB 1J0YA 1S8DB 4P2OA 3Q6GL 4UIMB 5L2KB 2B1AH 2CLRB 1U2CA 4I18B 3LZFL 4M8QB 1HEZB 4XCNA 2J5LC 1NBQA 1LK2B 2ESVB 1EGJA 5JDSB 4KUZL 5LGJA 4P5TC 3KPOA 4LDEB 2EE2A 3IT8D 4IMLB 2XNAA 2JELH 4Y4KA 4OZHE 2HRLA 3IFOA 5BS0B 2EDKA 3ALXA 1D9KD 3KJ4B 3WNLA 3QCUL 3TN0B 5E24E 1MLBA 5IESL 3MYJB 5E5MA 5CEYB 1S7RA 4GG6F 1N6UA 4XNYH 4N90D 1U92B 2YZ8A 2LABA 2AI0L 3DV6B 1ZOXA 4WFEE 3MTRA 4XTRD 5IOPA