1IB4A

Crystal structure of polygalacturonase from aspergillus aculeatus at ph4.5
Total Genus 126
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
126
sequence length
339
structure length
339
Chain Sequence
ATTCTFSGSNGASSASKSKTSCSTIVLSNVAVPSGTTLDLTKLNDGTHVIFSGETTFGYKEWSGPLISVSGSDLTITGASGHSINGDGSRWWDGEGGNGGKTKPKFFAAHSLTNSVISGLKIVNSPVQVFSVAGSDYLTLKDITIDNSDGDDNGGHNTDAFDIGTSTYVTISGATVYNQDDCVAVNSGENIYFSGGYCSGGHGLSIGSVGGRSDNTVKNVTFVDSTIINSDNGVRIKTNIDTTGSVSDVTYKDITLTSIAKYGIVVQQNYGDTSSTPTTGVPITDFVLDNVHGSVVSSGTNILISCGSGSCSDWTWTDVSVSGGKTSSKCTNVPSGASC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords POLYGALACTURONASE
publication title The X-ray structure of Aspergillus aculeatus polygalacturonase and a modeled structure of the polygalacturonase-octagalacturonate complex.
pubmed doi rcsb
molecule tags Hydrolase
total genus 126
structure length 339
sequence length 339
chains with identical sequence B
ec nomenclature ec 3.2.1.15: Endo-polygalacturonase.
pdb deposition date 2001-03-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00295 Glyco_hydro_28 Glycosyl hydrolases family 28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.160.20.10 Mainly Beta 3 Solenoid Pectate Lyase C-like Single-stranded right-handed beta-helix, Pectin lyase-like 1ib4A00
3B8YA 2PECA 2Z8GA 4XR6A 2X6WA 4YZQA 4YEJA 4MXNA 5C1CA 1IA5A 1O8HA 1OGMX 4C2LA 1RWRA 3B90A 4Z05A 3GRHA 1DBOA 1O8DA 1IDKA 3FY3A 4OJLA 3JURA 1O8MA 1O8LA 4U4BA 3WWGA 1HG8A 2VBMA 4YELA 4OJ5A 4XNFA 1K5CA 1O8JA 1EE6A 2VBEA 1RMGA 1O8IA 1DBGA 2PYGA 1X0CA 2VJJA 4XL9A 2X6XA 2QX3A 4I84A 2VBKA 4NK6A 4OJ6A 4YZ0A 3KRGA 4XLAA 2BSPA 3GQ8A 1IB4A 2NT6A 4OJOA 1GQ8A 1WMRA 3EQNA 2IQ7A 1O8KA 2NTQA 2NTBA 4XLFA 4XOPA 1PLUA 4W8QA 3ZSCA 3VMWA 4W8SA 1O8FA 2ODLA 4YZAA 1OFMA 4XONA 4HWVA 4XN3A 4XM3A 4XQFA 1NHCA 2UVFA 3GQ9A 2QXZA 2X6YA 3VSTA 3UW0A 1KTWA 4XLEA 4W8RA 1KCDA 4XMYA 1O8EA 3ZPPA 4PMHA 1O88A 2NSTA 1BN8A 4XKVA 3SUCA 2O0WA 4OJPA 2NZMA 1PE9A 2NSPA 4AVZA 1QJVA 4XLCA 4OZYA 2INVA 2O04A 4XOTA 4OZZA 5AMVA 2NTPA 3EQOA 3GQAA 1JRGA 1BHEA 4NK8A 3VMVA 4Z03A 2X3HA 1JTAA 1PXZA 1VBLA 3LMWA 4XORA 1XG2A 4YZXA 2EWEA 1AIRA 4W8TA 1KCCA 1RU4A 2X85A 1H80A 2VJIA 1OGOX 1OOCA 4Z06A 2O17A 1OFLA 2O0VA 4URRA 2PYHA 1QCXA 4U49A 5C1EA 2INUA 3GQ7A 2UVEA 3B4NA 4XLHA 1IDJA 3VSVA 1CZFA 3VSUA 4XKWA 2O1DA 2QY1A 1O8GA 2NT9A 4MR0A 3T9GA 4EW9A 4XN0A
chains in the Genus database with same CATH superfamily
1HF2A 3B8YA 2PECA 2Z8GA 4XR6A 2X6WA 2V5IA 4YZQA 4MXNA 4YEJA 5C1CA 3ML3A 1IA5A 1O8HA 2QZAA 1OGMX 1QA1A 1LM1A 4C2LA 1RWRA 3B90A 4Z05A 4YC5A 1OFDA 3GRHA 1DBOA 1EA0A 1O8DA 1CLWA 2XTYA 1IDKA 3BH7B 3FY3A 1TSPA 3JURA 1O8MA 1O8LA 2BM7A 4OJLA 4U4BA 1HG8A 3WWGA 3AK5A 2VBMA 4YELA 1TYUA 4OJ5A 4XNFA 3SY2A 1K5CA 2O6WA 1O8JA 1EE6A 1TYXA 1WXRA 1RMGA 1KQ5A 2VBEA 1TYWA 1O8IA 2VFQA 1DBGA 2PYGA 1X0CA 2VJJA 4OM9A 4XL9A 2X6XA 4YCQA 1QRBA 2QX3A 2BM4A 2VFOA 4I84A 2F3LA 2VBKA 4NK6A 4OJ6A 2G0YA 1DABA 4YZ0A 3DU1X 3KRGA 4OPWA 4XLAA 2BSPA 2W7ZA 1QQ1A 1QRCA 1NHCA 3GQ8A 1IB4A 2NT6A 2BM6A 1GQ8A 1WMRA 3EQNA 4OJOA 3PSZA 2IQ7A 1O8KA 2NTQA 3N90A 2NTBA 4XLFA 3JX8A 4XOPA 1PLUA 2IOUG 2QYUA 2B0RA 4W8QA 3LJYA 2YUHA 3ZSCA 3VMWA 4W8SA 1O8FA 3PSSA 2ODLA 4YZAA 1OFMA 4XONA 4HWVA 4XN3A 4XM3A 3BH6B 2VFMA 4XQFA 2UVFA 3GQ9A 2QXZA 2X6YA 3VSTA 3UW0A 1KTWA 4XLEA 1LLZA 4W8RA 1KCDA 1QA3A 4XMYA 1O8EA 3SYJA 3ZPPA 2XT2A 4PMHA 1OFEA 1O88A 2NSTA 1BN8A 4XKVA 3SUCA 2O0WA 4OJPA 2NZMA 2XTWA 1PE9A 2NSPA 2VFPA 4V02C 4AVZA 2XT4A 1QJVA 4XLCA 3RIQA 4OZYA 4KH3A 5JLVC 2INVA 5JMCB 2O04A 4XOTA 4OZZA 4YEIA 5AMVA 2NTPA 3EQOA 3GQAA 3SZEA 1JRGA 3PETA 1BHEA 4NK8A 3N6ZA 3LYCA 3VMVA 1EZGA 3P4GA 2XC1A 4XN0A 4Z03A 2X3HA 3NB2A 1K8FA 1JTAA 5DNSA 1L1IA 3H09A 1PXZA 4EW9A 1VBLA 3LMWA 4XORA 1XG2A 2VFNA 4YZXA 2EWEA 1AIRA 4W8TA 1KCCA 1RU4A 4JRAC 2BM5A 2X85A 3TH0A 1H80A 2VJIA 1OGOX 1OOCA 1TYVA 4Z06A 1K4ZA 2XTXA 2O17A 1OFLA 2O0VA 3NAWA 4URRA 2PYHA 4YDTA 1QA2A 1QCXA 3SQVA 4U49A 5C1EA 2INUA 3GQ7A 2UVEA 3B4NA 4XLHA 1IDJA 3VSVA 1CZFA 2J8IA 4YFOA 4XKWA 3VSUA 2O1DA 2QY1A 1O8GA 2NT9A 4MR0A 3T9GA 2BX6A 1LLWA 2J8KA
chains in the Genus database with same CATH topology
3B8YA 2PECA 2Z8GA 4XR6A 2X6WA 4YZQA 4YEJA 4MXNA 5C1CA 1IA5A 1O8HA 1OGMX 4C2LA 1RWRA 3B90A 4Z05A 3GRHA 1DBOA 1O8DA 1IDKA 3FY3A 4OJLA 3JURA 1O8MA 1O8LA 4U4BA 3WWGA 1HG8A 2VBMA 4YELA 4OJ5A 4XNFA 1K5CA 1O8JA 1EE6A 2VBEA 1RMGA 1O8IA 1DBGA 2PYGA 1X0CA 2VJJA 4XL9A 2X6XA 2QX3A 4I84A 2VBKA 4NK6A 4OJ6A 4YZ0A 3KRGA 4XLAA 2BSPA 3GQ8A 1IB4A 2NT6A 4OJOA 1GQ8A 1WMRA 3EQNA 2IQ7A 1O8KA 2NTQA 2NTBA 4XLFA 4XOPA 1PLUA 4W8QA 3ZSCA 3VMWA 4W8SA 1O8FA 2ODLA 4YZAA 1OFMA 4XONA 4HWVA 4XN3A 4XM3A 4XQFA 1NHCA 2UVFA 3GQ9A 2QXZA 2X6YA 3VSTA 3UW0A 1KTWA 4XLEA 4W8RA 1KCDA 4XMYA 1O8EA 3ZPPA 4PMHA 1O88A 2NSTA 1BN8A 4XKVA 3SUCA 2O0WA 4OJPA 2NZMA 1PE9A 2NSPA 4AVZA 1QJVA 4XLCA 4OZYA 2INVA 2O04A 4XOTA 4OZZA 5AMVA 2NTPA 3EQOA 3GQAA 1JRGA 1BHEA 4NK8A 3VMVA 4Z03A 2X3HA 1JTAA 1PXZA 1VBLA 3LMWA 4XORA 1XG2A 4YZXA 2EWEA 1AIRA 4W8TA 1KCCA 1RU4A 2X85A 1H80A 2VJIA 1OGOX 1OOCA 4Z06A 2O17A 1OFLA 2O0VA 4URRA 2PYHA 1QCXA 4U49A 5C1EA 2INUA 3GQ7A 2UVEA 3B4NA 4XLHA 1IDJA 3VSVA 1CZFA 3VSUA 4XKWA 2O1DA 2QY1A 1O8GA 2NT9A 4MR0A 3T9GA 4EW9A 4XN0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3B8Y A;  2PEC A;  2Z8G A;  4XR6 A;  2X6W A;  4YZQ A;  4YEJ A;  4MXN A;  5C1C A;  1IA5 A;  1O8H A;  1OGM X;  4C2L A;  1RWR A;  3B90 A;  4Z05 A;  3GRH A;  1DBO A;  1O8D A;  1IDK A;  3FY3 A;  4OJL A;  3JUR A;  1O8M A;  1O8L A;  4U4B A;  3WWG A;  1HG8 A;  2VBM A;  4YEL A;  4OJ5 A;  4XNF A;  1K5C A;  1O8J A;  1EE6 A;  2VBE A;  1RMG A;  1O8I A;  1DBG A;  2PYG A;  1X0C A;  2VJJ A;  4XL9 A;  2X6X A;  2QX3 A;  4I84 A;  2VBK A;  4NK6 A;  4OJ6 A;  4YZ0 A;  3KRG A;  4XLA A;  2BSP A;  3GQ8 A;  1IB4 A;  2NT6 A;  4OJO A;  1GQ8 A;  1WMR A;  3EQN A;  2IQ7 A;  1O8K A;  2NTQ A;  2NTB A;  4XLF A;  4XOP A;  1PLU A;  4W8Q A;  3ZSC A;  3VMW A;  4W8S A;  1O8F A;  2ODL A;  4YZA A;  1OFM A;  4XON A;  4HWV A;  4XN3 A;  4XM3 A;  4XQF A;  1NHC A;  2UVF A;  3GQ9 A;  2QXZ A;  2X6Y A;  3VST A;  3UW0 A;  1KTW A;  4XLE A;  4W8R A;  1KCD A;  4XMY A;  1O8E A;  3ZPP A;  4PMH A;  1O88 A;  2NST A;  1BN8 A;  4XKV A;  3SUC A;  2O0W A;  4OJP A;  2NZM A;  1PE9 A;  2NSP A;  4AVZ A;  1QJV A;  4XLC A;  4OZY A;  2INV A;  2O04 A;  4XOT A;  4OZZ A;  5AMV A;  2NTP A;  3EQO A;  3GQA A;  1JRG A;  1BHE A;  4NK8 A;  3VMV A;  4Z03 A;  2X3H A;  1JTA A;  1PXZ A;  1VBL A;  3LMW A;  4XOR A;  1XG2 A;  4YZX A;  2EWE A;  1AIR A;  4W8T A;  1KCC A;  1RU4 A;  2X85 A;  1H80 A;  2VJI A;  1OGO X;  1OOC A;  4Z06 A;  2O17 A;  1OFL A;  2O0V A;  4URR A;  2PYH A;  1QCX A;  4U49 A;  5C1E A;  2INU A;  3GQ7 A;  2UVE A;  3B4N A;  4XLH A;  1IDJ A;  3VSV A;  1CZF A;  3VSU A;  4XKW A;  2O1D A;  2QY1 A;  1O8G A;  2NT9 A;  4MR0 A;  3T9G A;  4EW9 A;  4XN0 A; 
#chains in the Genus database with same CATH topology
 1HF2 A;  3B8Y A;  2PEC A;  2Z8G A;  4XR6 A;  2X6W A;  2V5I A;  4YZQ A;  4MXN A;  4YEJ A;  5C1C A;  3ML3 A;  1IA5 A;  1O8H A;  2QZA A;  1OGM X;  1QA1 A;  1LM1 A;  4C2L A;  1RWR A;  3B90 A;  4Z05 A;  4YC5 A;  1OFD A;  3GRH A;  1DBO A;  1EA0 A;  1O8D A;  1CLW A;  2XTY A;  1IDK A;  3BH7 B;  3FY3 A;  1TSP A;  3JUR A;  1O8M A;  1O8L A;  2BM7 A;  4OJL A;  4U4B A;  1HG8 A;  3WWG A;  3AK5 A;  2VBM A;  4YEL A;  1TYU A;  4OJ5 A;  4XNF A;  3SY2 A;  1K5C A;  2O6W A;  1O8J A;  1EE6 A;  1TYX A;  1WXR A;  1RMG A;  1KQ5 A;  2VBE A;  1TYW A;  1O8I A;  2VFQ A;  1DBG A;  2PYG A;  1X0C A;  2VJJ A;  4OM9 A;  4XL9 A;  2X6X A;  4YCQ A;  1QRB A;  2QX3 A;  2BM4 A;  2VFO A;  4I84 A;  2F3L A;  2VBK A;  4NK6 A;  4OJ6 A;  2G0Y A;  1DAB A;  4YZ0 A;  3DU1 X;  3KRG A;  4OPW A;  4XLA A;  2BSP A;  2W7Z A;  1QQ1 A;  1QRC A;  1NHC A;  3GQ8 A;  1IB4 A;  2NT6 A;  2BM6 A;  1GQ8 A;  1WMR A;  3EQN A;  4OJO A;  3PSZ A;  2IQ7 A;  1O8K A;  2NTQ A;  3N90 A;  2NTB A;  4XLF A;  3JX8 A;  4XOP A;  1PLU A;  2IOU G;  2QYU A;  2B0R A;  4W8Q A;  3LJY A;  2YUH A;  3ZSC A;  3VMW A;  4W8S A;  1O8F A;  3PSS A;  2ODL A;  4YZA A;  1OFM A;  4XON A;  4HWV A;  4XN3 A;  4XM3 A;  3BH6 B;  2VFM A;  4XQF A;  2UVF A;  3GQ9 A;  2QXZ A;  2X6Y A;  3VST A;  3UW0 A;  1KTW A;  4XLE A;  1LLZ A;  4W8R A;  1KCD A;  1QA3 A;  4XMY A;  1O8E A;  3SYJ A;  3ZPP A;  2XT2 A;  4PMH A;  1OFE A;  1O88 A;  2NST A;  1BN8 A;  4XKV A;  3SUC A;  2O0W A;  4OJP A;  2NZM A;  2XTW A;  1PE9 A;  2NSP A;  2VFP A;  4V02 C;  4AVZ A;  2XT4 A;  1QJV A;  4XLC A;  3RIQ A;  4OZY A;  4KH3 A;  5JLV C;  2INV A;  5JMC B;  2O04 A;  4XOT A;  4OZZ A;  4YEI A;  5AMV A;  2NTP A;  3EQO A;  3GQA A;  3SZE A;  1JRG A;  3PET A;  1BHE A;  4NK8 A;  3N6Z A;  3LYC A;  3VMV A;  1EZG A;  3P4G A;  2XC1 A;  4XN0 A;  4Z03 A;  2X3H A;  3NB2 A;  1K8F A;  1JTA A;  5DNS A;  1L1I A;  3H09 A;  1PXZ A;  4EW9 A;  1VBL A;  3LMW A;  4XOR A;  1XG2 A;  2VFN A;  4YZX A;  2EWE A;  1AIR A;  4W8T A;  1KCC A;  1RU4 A;  4JRA C;  2BM5 A;  2X85 A;  3TH0 A;  1H80 A;  2VJI A;  1OGO X;  1OOC A;  1TYV A;  4Z06 A;  1K4Z A;  2XTX A;  2O17 A;  1OFL A;  2O0V A;  3NAW A;  4URR A;  2PYH A;  4YDT A;  1QA2 A;  1QCX A;  3SQV A;  4U49 A;  5C1E A;  2INU A;  3GQ7 A;  2UVE A;  3B4N A;  4XLH A;  1IDJ A;  3VSV A;  1CZF A;  2J8I A;  4YFO A;  4XKW A;  3VSU A;  2O1D A;  2QY1 A;  1O8G A;  2NT9 A;  4MR0 A;  3T9G A;  2BX6 A;  1LLW A;  2J8K A; 
#chains in the Genus database with same CATH homology
 3B8Y A;  2PEC A;  2Z8G A;  4XR6 A;  2X6W A;  4YZQ A;  4YEJ A;  4MXN A;  5C1C A;  1IA5 A;  1O8H A;  1OGM X;  4C2L A;  1RWR A;  3B90 A;  4Z05 A;  3GRH A;  1DBO A;  1O8D A;  1IDK A;  3FY3 A;  4OJL A;  3JUR A;  1O8M A;  1O8L A;  4U4B A;  3WWG A;  1HG8 A;  2VBM A;  4YEL A;  4OJ5 A;  4XNF A;  1K5C A;  1O8J A;  1EE6 A;  2VBE A;  1RMG A;  1O8I A;  1DBG A;  2PYG A;  1X0C A;  2VJJ A;  4XL9 A;  2X6X A;  2QX3 A;  4I84 A;  2VBK A;  4NK6 A;  4OJ6 A;  4YZ0 A;  3KRG A;  4XLA A;  2BSP A;  3GQ8 A;  1IB4 A;  2NT6 A;  4OJO A;  1GQ8 A;  1WMR A;  3EQN A;  2IQ7 A;  1O8K A;  2NTQ A;  2NTB A;  4XLF A;  4XOP A;  1PLU A;  4W8Q A;  3ZSC A;  3VMW A;  4W8S A;  1O8F A;  2ODL A;  4YZA A;  1OFM A;  4XON A;  4HWV A;  4XN3 A;  4XM3 A;  4XQF A;  1NHC A;  2UVF A;  3GQ9 A;  2QXZ A;  2X6Y A;  3VST A;  3UW0 A;  1KTW A;  4XLE A;  4W8R A;  1KCD A;  4XMY A;  1O8E A;  3ZPP A;  4PMH A;  1O88 A;  2NST A;  1BN8 A;  4XKV A;  3SUC A;  2O0W A;  4OJP A;  2NZM A;  1PE9 A;  2NSP A;  4AVZ A;  1QJV A;  4XLC A;  4OZY A;  2INV A;  2O04 A;  4XOT A;  4OZZ A;  5AMV A;  2NTP A;  3EQO A;  3GQA A;  1JRG A;  1BHE A;  4NK8 A;  3VMV A;  4Z03 A;  2X3H A;  1JTA A;  1PXZ A;  1VBL A;  3LMW A;  4XOR A;  1XG2 A;  4YZX A;  2EWE A;  1AIR A;  4W8T A;  1KCC A;  1RU4 A;  2X85 A;  1H80 A;  2VJI A;  1OGO X;  1OOC A;  4Z06 A;  2O17 A;  1OFL A;  2O0V A;  4URR A;  2PYH A;  1QCX A;  4U49 A;  5C1E A;  2INU A;  3GQ7 A;  2UVE A;  3B4N A;  4XLH A;  1IDJ A;  3VSV A;  1CZF A;  3VSU A;  4XKW A;  2O1D A;  2QY1 A;  1O8G A;  2NT9 A;  4MR0 A;  3T9G A;  4EW9 A;  4XN0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...