1IB4A

Crystal structure of polygalacturonase from aspergillus aculeatus at ph4.5
Total Genus 126
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
126
sequence length
339
structure length
339
Chain Sequence
b'ATTCTFSGSNGASSASKSKTSCSTIVLSNVAVPSGTTLDLTKLNDGTHVIFSGETTFGYKEWSGPLISVSGSDLTITGASGHSINGDGSRWWDGEGGNGGKTKPKFFAAHSLTNSVISGLKIVNSPVQVFSVAGSDYLTLKDITIDNSDGDDNGGHNTDAFDIGTSTYVTISGATVYNQDDCVAVNSGENIYFSGGYCSGGHGLSIGSVGGRSDNTVKNVTFVDSTIINSDNGVRIKTNIDTTGSVSDVTYKDITLTSIAKYGIVVQQNYGDTSSTPTTGVPITDFVLDNVHGSVVSSGTNILISCGSGSCSDWTWTDVSVSGGKTSSKCTNVPSGASC'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords POLYGALACTURONASE
publication title The X-ray structure of Aspergillus aculeatus polygalacturonase and a modeled structure of the polygalacturonase-octagalacturonate complex.
pubmed doi rcsb
molecule tags Hydrolase
total genus 126
structure length 339
sequence length 339
chains with identical sequence B
ec nomenclature ec 3.2.1.15: Endo-polygalacturonase.
pdb deposition date 2001-03-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00295 Glyco_hydro_28 Glycosyl hydrolases family 28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.160.20.10 Mainly Beta 3 Solenoid Pectate Lyase C-like Single-stranded right-handed beta-helix, Pectin lyase-like 1ib4A00
4XKWA 2PYHA 1CZFA 4XR6A 1VBLA 3B8YA 1O8KA 2VJJA 4XLHA 4OJ5A 1O8EA 2NTBA 3UW0A 1IB4A 2O1DA 2X85A 1IDJA 1WMRA 2NTPA 2ODLA 3VMVA 1XG2A 2QY1A 1O8JA 1PLUA 1KCCA 4Z03A 3T9GA 4XM3A 4MR0A 2VBEA 1RMGA 1PXZA 3GQ7A 4YZQA 4XONA 2VBMA 4OJ6A 4EW9A 2UVFA 4XOTA 4PMHA 2VJIA 4AVZA 4YZ0A 1O88A 5AMVA 4NK6A 4W8RA 3ZSCA 4XQFA 1QJVA 1KTWA 3FY3A 5C1EA 4U4BA 1EE6A 2INUA 1BHEA 2O17A 2QXZA 3GQAA 4OZYA 4YZXA 1DBOA 4YZAA 1RU4A 4MXNA 4XORA 2X3HA 1O8GA 2VBKA 1DBGA 3KRGA 4XN3A 4XLCA 1PE9A 2O0WA 4W8QA 3JURA 2QX3A 1JTAA 3ZPPA 5C1CA 1O8LA 3VMWA 4XLAA 1OGMX 3B4NA 4XMYA 4I84A 3LMWA 2X6XA 2NZMA 3GQ9A 3VSUA 1RWRA 4HWVA 3WWGA 4OJPA 2UVEA 4OZZA 4XOPA 2X6WA 1OGOX 2Z8GA 4Z06A 4W8TA 1OOCA 1IDKA 4OJOA 1BN8A 4OJLA 4URRA 2X6YA 2NTQA 3EQNA 3GRHA 2NT9A 1O8HA 4XL9A 2O04A 2IQ7A 2PECA 3GQ8A 1GQ8A 2O0VA 2PYGA 2BSPA 1OFLA 3SUCA 1X0CA 1H80A 4XN0A 4C2LA 2INVA 1K5CA 1IA5A 4Z05A 1OFMA 2EWEA 2NSPA 1KCDA 3EQOA 4U49A 1AIRA 1JRGA 4YELA 4NK8A 4XNFA 3VSTA 2NSTA 3VSVA 1O8DA 1O8FA 1QCXA 3B90A 1NHCA 4XKVA 1O8IA 4W8SA 2NT6A 4XLFA 1O8MA 4XLEA 4YEJA 1HG8A
chains in the Genus database with same CATH superfamily
2XTXA 4XKWA 2BM7A 2PYHA 1CZFA 3LJYA 4XR6A 1VBLA 3B8YA 1O8KA 2VJJA 3H09A 4OJ5A 4XLHA 1O8EA 2NTBA 3UW0A 1IB4A 1L1IA 2O1DA 2X85A 1IDJA 2B0RA 3BH6B 3TH0A 1WMRA 2NTPA 2ODLA 2W7ZA 1XG2A 3VMVA 2QY1A 1O8JA 1PLUA 2VFOA 3NB2A 1KCCA 4Z03A 3T9GA 4XM3A 3DU1X 4MR0A 3AK5A 2VBEA 1RMGA 1PXZA 3GQ7A 1TYXA 2VFMA 2IOUG 2G0YA 4YZQA 4XONA 2VBMA 4OJ6A 2XTWA 4EW9A 2UVFA 1WXRA 4XOTA 4PMHA 1KQ5A 2VFPA 2VJIA 3P4GA 4AVZA 4YZ0A 1O88A 2BM4A 5AMVA 4NK6A 4W8RA 3ZSCA 4XQFA 1LLZA 1QJVA 1KTWA 3FY3A 5C1EA 4U4BA 1EE6A 2BX6A 1BHEA 2INUA 2O17A 2QXZA 3GQAA 4OZYA 4YZXA 1DBOA 5DNSA 1K4ZA 2BM5A 1QQ1A 4YZAA 4YEIA 1RU4A 4MXNA 1LLWA 4XORA 3BH7B 1QA2A 2X3HA 1TYUA 1O8GA 1K8FA 2VBKA 1DBGA 3KRGA 4XN3A 4XLCA 1QA3A 1PE9A 2O0WA 2J8IA 4YCQA 4W8QA 3JURA 2QX3A 1DABA 1JTAA 1LM1A 1QA1A 2VFNA 3ZPPA 1HF2A 5C1CA 1O8LA 3VMWA 4XLAA 1OGMX 2F3LA 3B4NA 2O6WA 1EA0A 4XMYA 4I84A 3JX8A 3LMWA 3SY2A 2X6XA 2NZMA 3SYJA 3GQ9A 4YC5A 3VSUA 1RWRA 1TSPA 4HWVA 3WWGA 4OJPA 4JRAC 2UVEA 4OZZA 4XOPA 4YDTA 2X6WA 1OGOX 3NAWA 2Z8GA 2QZAA 2YUHA 4Z06A 4W8TA 1QRCA 3PETA 1OOCA 2XC1A 1IDKA 2V5IA 4OJOA 1BN8A 4OJLA 4URRA 2X6YA 3SZEA 2NTQA 1EZGA 3EQNA 3GRHA 3RIQA 2NT9A 1O8HA 3N6ZA 3N90A 4XL9A 2O04A 2XTYA 2IQ7A 2PECA 2VFQA 3GQ8A 1TYWA 4OM9A 1GQ8A 2O0VA 2PYGA 2BSPA 1OFLA 3SUCA 1X0CA 2QYUA 2XT2A 3PSSA 3SQVA 1TYVA 1H80A 4XN0A 4C2LA 5JLVC 5JMCB 2INVA 1K5CA 1QRBA 4YFOA 1IA5A 4Z05A 1OFMA 2EWEA 3PSZA 1OFEA 2NSPA 1KCDA 4V02C 3EQOA 3ML3A 4U49A 4KH3A 1AIRA 1JRGA 2J8KA 4YELA 4NK8A 4XNFA 1OFDA 3VSTA 2NSTA 3VSVA 1O8DA 1O8FA 1QCXA 3B90A 1NHCA 2BM6A 3LYCA 4XKVA 1O8IA 4W8SA 2NT6A 1CLWA 1O8MA 2XT4A 4OPWA 4XLFA 4XLEA 4YEJA 1HG8A
chains in the Genus database with same CATH topology
4XKWA 2PYHA 1CZFA 4XR6A 1VBLA 3B8YA 1O8KA 2VJJA 4XLHA 4OJ5A 1O8EA 2NTBA 3UW0A 1IB4A 2O1DA 2X85A 1IDJA 1WMRA 2NTPA 2ODLA 3VMVA 1XG2A 2QY1A 1O8JA 1PLUA 1KCCA 4Z03A 3T9GA 4XM3A 4MR0A 2VBEA 1RMGA 1PXZA 3GQ7A 4YZQA 4XONA 2VBMA 4OJ6A 4EW9A 2UVFA 4XOTA 4PMHA 2VJIA 4AVZA 4YZ0A 1O88A 5AMVA 4NK6A 4W8RA 3ZSCA 4XQFA 1QJVA 1KTWA 3FY3A 5C1EA 4U4BA 1EE6A 2INUA 1BHEA 2O17A 2QXZA 3GQAA 4OZYA 4YZXA 1DBOA 4YZAA 1RU4A 4MXNA 4XORA 2X3HA 1O8GA 2VBKA 1DBGA 3KRGA 4XN3A 4XLCA 1PE9A 2O0WA 4W8QA 3JURA 2QX3A 1JTAA 3ZPPA 5C1CA 1O8LA 3VMWA 4XLAA 1OGMX 3B4NA 4XMYA 4I84A 3LMWA 2X6XA 2NZMA 3GQ9A 3VSUA 1RWRA 4HWVA 3WWGA 4OJPA 2UVEA 4OZZA 4XOPA 2X6WA 1OGOX 2Z8GA 4Z06A 4W8TA 1OOCA 1IDKA 4OJOA 1BN8A 4OJLA 4URRA 2X6YA 2NTQA 3EQNA 3GRHA 2NT9A 1O8HA 4XL9A 2O04A 2IQ7A 2PECA 3GQ8A 1GQ8A 2O0VA 2PYGA 2BSPA 1OFLA 3SUCA 1X0CA 1H80A 4XN0A 4C2LA 2INVA 1K5CA 1IA5A 4Z05A 1OFMA 2EWEA 2NSPA 1KCDA 3EQOA 4U49A 1AIRA 1JRGA 4YELA 4NK8A 4XNFA 3VSTA 2NSTA 3VSVA 1O8DA 1O8FA 1QCXA 3B90A 1NHCA 4XKVA 1O8IA 4W8SA 2NT6A 4XLFA 1O8MA 4XLEA 4YEJA 1HG8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4XKW A;  2PYH A;  1CZF A;  4XR6 A;  1VBL A;  3B8Y A;  1O8K A;  2VJJ A;  4XLH A;  4OJ5 A;  1O8E A;  2NTB A;  3UW0 A;  1IB4 A;  2O1D A;  2X85 A;  1IDJ A;  1WMR A;  2NTP A;  2ODL A;  3VMV A;  1XG2 A;  2QY1 A;  1O8J A;  1PLU A;  1KCC A;  4Z03 A;  3T9G A;  4XM3 A;  4MR0 A;  2VBE A;  1RMG A;  1PXZ A;  3GQ7 A;  4YZQ A;  4XON A;  2VBM A;  4OJ6 A;  4EW9 A;  2UVF A;  4XOT A;  4PMH A;  2VJI A;  4AVZ A;  4YZ0 A;  1O88 A;  5AMV A;  4NK6 A;  4W8R A;  3ZSC A;  4XQF A;  1QJV A;  1KTW A;  3FY3 A;  5C1E A;  4U4B A;  1EE6 A;  2INU A;  1BHE A;  2O17 A;  2QXZ A;  3GQA A;  4OZY A;  4YZX A;  1DBO A;  4YZA A;  1RU4 A;  4MXN A;  4XOR A;  2X3H A;  1O8G A;  2VBK A;  1DBG A;  3KRG A;  4XN3 A;  4XLC A;  1PE9 A;  2O0W A;  4W8Q A;  3JUR A;  2QX3 A;  1JTA A;  3ZPP A;  5C1C A;  1O8L A;  3VMW A;  4XLA A;  1OGM X;  3B4N A;  4XMY A;  4I84 A;  3LMW A;  2X6X A;  2NZM A;  3GQ9 A;  3VSU A;  1RWR A;  4HWV A;  3WWG A;  4OJP A;  2UVE A;  4OZZ A;  4XOP A;  2X6W A;  1OGO X;  2Z8G A;  4Z06 A;  4W8T A;  1OOC A;  1IDK A;  4OJO A;  1BN8 A;  4OJL A;  4URR A;  2X6Y A;  2NTQ A;  3EQN A;  3GRH A;  2NT9 A;  1O8H A;  4XL9 A;  2O04 A;  2IQ7 A;  2PEC A;  3GQ8 A;  1GQ8 A;  2O0V A;  2PYG A;  2BSP A;  1OFL A;  3SUC A;  1X0C A;  1H80 A;  4XN0 A;  4C2L A;  2INV A;  1K5C A;  1IA5 A;  4Z05 A;  1OFM A;  2EWE A;  2NSP A;  1KCD A;  3EQO A;  4U49 A;  1AIR A;  1JRG A;  4YEL A;  4NK8 A;  4XNF A;  3VST A;  2NST A;  3VSV A;  1O8D A;  1O8F A;  1QCX A;  3B90 A;  1NHC A;  4XKV A;  1O8I A;  4W8S A;  2NT6 A;  4XLF A;  1O8M A;  4XLE A;  4YEJ A;  1HG8 A; 
#chains in the Genus database with same CATH topology
 2XTX A;  4XKW A;  2BM7 A;  2PYH A;  1CZF A;  3LJY A;  4XR6 A;  1VBL A;  3B8Y A;  1O8K A;  2VJJ A;  3H09 A;  4OJ5 A;  4XLH A;  1O8E A;  2NTB A;  3UW0 A;  1IB4 A;  1L1I A;  2O1D A;  2X85 A;  1IDJ A;  2B0R A;  3BH6 B;  3TH0 A;  1WMR A;  2NTP A;  2ODL A;  2W7Z A;  1XG2 A;  3VMV A;  2QY1 A;  1O8J A;  1PLU A;  2VFO A;  3NB2 A;  1KCC A;  4Z03 A;  3T9G A;  4XM3 A;  3DU1 X;  4MR0 A;  3AK5 A;  2VBE A;  1RMG A;  1PXZ A;  3GQ7 A;  1TYX A;  2VFM A;  2IOU G;  2G0Y A;  4YZQ A;  4XON A;  2VBM A;  4OJ6 A;  2XTW A;  4EW9 A;  2UVF A;  1WXR A;  4XOT A;  4PMH A;  1KQ5 A;  2VFP A;  2VJI A;  3P4G A;  4AVZ A;  4YZ0 A;  1O88 A;  2BM4 A;  5AMV A;  4NK6 A;  4W8R A;  3ZSC A;  4XQF A;  1LLZ A;  1QJV A;  1KTW A;  3FY3 A;  5C1E A;  4U4B A;  1EE6 A;  2BX6 A;  1BHE A;  2INU A;  2O17 A;  2QXZ A;  3GQA A;  4OZY A;  4YZX A;  1DBO A;  5DNS A;  1K4Z A;  2BM5 A;  1QQ1 A;  4YZA A;  4YEI A;  1RU4 A;  4MXN A;  1LLW A;  4XOR A;  3BH7 B;  1QA2 A;  2X3H A;  1TYU A;  1O8G A;  1K8F A;  2VBK A;  1DBG A;  3KRG A;  4XN3 A;  4XLC A;  1QA3 A;  1PE9 A;  2O0W A;  2J8I A;  4YCQ A;  4W8Q A;  3JUR A;  2QX3 A;  1DAB A;  1JTA A;  1LM1 A;  1QA1 A;  2VFN A;  3ZPP A;  1HF2 A;  5C1C A;  1O8L A;  3VMW A;  4XLA A;  1OGM X;  2F3L A;  3B4N A;  2O6W A;  1EA0 A;  4XMY A;  4I84 A;  3JX8 A;  3LMW A;  3SY2 A;  2X6X A;  2NZM A;  3SYJ A;  3GQ9 A;  4YC5 A;  3VSU A;  1RWR A;  1TSP A;  4HWV A;  3WWG A;  4OJP A;  4JRA C;  2UVE A;  4OZZ A;  4XOP A;  4YDT A;  2X6W A;  1OGO X;  3NAW A;  2Z8G A;  2QZA A;  2YUH A;  4Z06 A;  4W8T A;  1QRC A;  3PET A;  1OOC A;  2XC1 A;  1IDK A;  2V5I A;  4OJO A;  1BN8 A;  4OJL A;  4URR A;  2X6Y A;  3SZE A;  2NTQ A;  1EZG A;  3EQN A;  3GRH A;  3RIQ A;  2NT9 A;  1O8H A;  3N6Z A;  3N90 A;  4XL9 A;  2O04 A;  2XTY A;  2IQ7 A;  2PEC A;  2VFQ A;  3GQ8 A;  1TYW A;  4OM9 A;  1GQ8 A;  2O0V A;  2PYG A;  2BSP A;  1OFL A;  3SUC A;  1X0C A;  2QYU A;  2XT2 A;  3PSS A;  3SQV A;  1TYV A;  1H80 A;  4XN0 A;  4C2L A;  5JLV C;  5JMC B;  2INV A;  1K5C A;  1QRB A;  4YFO A;  1IA5 A;  4Z05 A;  1OFM A;  2EWE A;  3PSZ A;  1OFE A;  2NSP A;  1KCD A;  4V02 C;  3EQO A;  3ML3 A;  4U49 A;  4KH3 A;  1AIR A;  1JRG A;  2J8K A;  4YEL A;  4NK8 A;  4XNF A;  1OFD A;  3VST A;  2NST A;  3VSV A;  1O8D A;  1O8F A;  1QCX A;  3B90 A;  1NHC A;  2BM6 A;  3LYC A;  4XKV A;  1O8I A;  4W8S A;  2NT6 A;  1CLW A;  1O8M A;  2XT4 A;  4OPW A;  4XLF A;  4XLE A;  4YEJ A;  1HG8 A; 
#chains in the Genus database with same CATH homology
 4XKW A;  2PYH A;  1CZF A;  4XR6 A;  1VBL A;  3B8Y A;  1O8K A;  2VJJ A;  4XLH A;  4OJ5 A;  1O8E A;  2NTB A;  3UW0 A;  1IB4 A;  2O1D A;  2X85 A;  1IDJ A;  1WMR A;  2NTP A;  2ODL A;  3VMV A;  1XG2 A;  2QY1 A;  1O8J A;  1PLU A;  1KCC A;  4Z03 A;  3T9G A;  4XM3 A;  4MR0 A;  2VBE A;  1RMG A;  1PXZ A;  3GQ7 A;  4YZQ A;  4XON A;  2VBM A;  4OJ6 A;  4EW9 A;  2UVF A;  4XOT A;  4PMH A;  2VJI A;  4AVZ A;  4YZ0 A;  1O88 A;  5AMV A;  4NK6 A;  4W8R A;  3ZSC A;  4XQF A;  1QJV A;  1KTW A;  3FY3 A;  5C1E A;  4U4B A;  1EE6 A;  2INU A;  1BHE A;  2O17 A;  2QXZ A;  3GQA A;  4OZY A;  4YZX A;  1DBO A;  4YZA A;  1RU4 A;  4MXN A;  4XOR A;  2X3H A;  1O8G A;  2VBK A;  1DBG A;  3KRG A;  4XN3 A;  4XLC A;  1PE9 A;  2O0W A;  4W8Q A;  3JUR A;  2QX3 A;  1JTA A;  3ZPP A;  5C1C A;  1O8L A;  3VMW A;  4XLA A;  1OGM X;  3B4N A;  4XMY A;  4I84 A;  3LMW A;  2X6X A;  2NZM A;  3GQ9 A;  3VSU A;  1RWR A;  4HWV A;  3WWG A;  4OJP A;  2UVE A;  4OZZ A;  4XOP A;  2X6W A;  1OGO X;  2Z8G A;  4Z06 A;  4W8T A;  1OOC A;  1IDK A;  4OJO A;  1BN8 A;  4OJL A;  4URR A;  2X6Y A;  2NTQ A;  3EQN A;  3GRH A;  2NT9 A;  1O8H A;  4XL9 A;  2O04 A;  2IQ7 A;  2PEC A;  3GQ8 A;  1GQ8 A;  2O0V A;  2PYG A;  2BSP A;  1OFL A;  3SUC A;  1X0C A;  1H80 A;  4XN0 A;  4C2L A;  2INV A;  1K5C A;  1IA5 A;  4Z05 A;  1OFM A;  2EWE A;  2NSP A;  1KCD A;  3EQO A;  4U49 A;  1AIR A;  1JRG A;  4YEL A;  4NK8 A;  4XNF A;  3VST A;  2NST A;  3VSV A;  1O8D A;  1O8F A;  1QCX A;  3B90 A;  1NHC A;  4XKV A;  1O8I A;  4W8S A;  2NT6 A;  4XLF A;  1O8M A;  4XLE A;  4YEJ A;  1HG8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...