1IB4A

Crystal structure of polygalacturonase from aspergillus aculeatus at ph4.5
Total Genus 126
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
126
sequence length
339
structure length
339
Chain Sequence
ATTCTFSGSNGASSASKSKTSCSTIVLSNVAVPSGTTLDLTKLNDGTHVIFSGETTFGYKEWSGPLISVSGSDLTITGASGHSINGDGSRWWDGEGGNGGKTKPKFFAAHSLTNSVISGLKIVNSPVQVFSVAGSDYLTLKDITIDNSDGDDNGGHNTDAFDIGTSTYVTISGATVYNQDDCVAVNSGENIYFSGGYCSGGHGLSIGSVGGRSDNTVKNVTFVDSTIINSDNGVRIKTNIDTTGSVSDVTYKDITLTSIAKYGIVVQQNYGDTSSTPTTGVPITDFVLDNVHGSVVSSGTNILISCGSGSCSDWTWTDVSVSGGKTSSKCTNVPSGASC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords POLYGALACTURONASE
publication title The X-ray structure of Aspergillus aculeatus polygalacturonase and a modeled structure of the polygalacturonase-octagalacturonate complex.
pubmed doi rcsb
molecule tags Hydrolase
total genus 126
structure length 339
sequence length 339
chains with identical sequence B
ec nomenclature ec 3.2.1.15: Endo-polygalacturonase.
pdb deposition date 2001-03-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00295 Glyco_hydro_28 Glycosyl hydrolases family 28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.160.20.10 Mainly Beta 3 Solenoid Pectate Lyase C-like Single-stranded right-handed beta-helix, Pectin lyase-like 1ib4A00
1OFLA 1QCXA 1X0CA 4Z05A 4Z06A 4AVZA 4MXNA 5C1CA 1EE6A 1K5CA 1OFMA 3B4NA 1O88A 4XORA 3GQ8A 4URRA 1RU4A 4NK8A 4XN3A 4XN0A 1KCDA 2O0WA 4Z03A 1O8IA 4U4BA 2NTBA 4HWVA 1KTWA 2O17A 3WWGA 4W8SA 4XKVA 2INVA 2NT6A 2INUA 1IA5A 1IB4A 4XL9A 4YZQA 2QXZA 4OJPA 4W8RA 3ZSCA 1JRGA 4XLFA 1O8MA 4XKWA 4XOTA 3UW0A 3ZPPA 2VBEA 5AMVA 4OJ6A 1PLUA 2NZMA 4XMYA 3GRHA 1WMRA 1O8FA 2ODLA 2X3HA 1AIRA 1BN8A 2X6XA 3T9GA 4MR0A 1RMGA 4OZYA 1OOCA 3B90A 4XONA 1XG2A 4XOPA 4YZAA 4YZXA 4U49A 2O04A 1KCCA 2Z8GA 2X85A 1O8KA 4XNFA 2O1DA 1DBOA 2VJJA 3VSTA 2QY1A 1CZFA 3GQAA 2PECA 4OJOA 4YEJA 4XLHA 1VBLA 2NSPA 4W8TA 1O8JA 3GQ7A 1OGOX 4XR6A 2UVEA 1NHCA 4I84A 2X6WA 2NT9A 4XM3A 3SUCA 1PE9A 4OJLA 2EWEA 1BHEA 1IDJA 5C1EA 3KRGA 1H80A 2VBKA 3VSVA 3EQOA 3VMWA 3EQNA 2IQ7A 1DBGA 3FY3A 3VSUA 4YELA 1IDKA 1O8EA 1O8LA 4XLCA 3VMVA 1O8DA 1HG8A 3JURA 1JTAA 2NTQA 4W8QA 4OJ5A 1QJVA 4XLAA 2PYGA 2O0VA 3B8YA 4EW9A 2UVFA 1RWRA 2X6YA 2VJIA 4C2LA 4XLEA 4XQFA 1GQ8A 3GQ9A 1PXZA 1OGMX 2VBMA 1O8GA 1O8HA 2QX3A 4PMHA 2NSTA 4YZ0A 4NK6A 2PYHA 2NTPA 4OZZA 3LMWA 2BSPA
chains in the Genus database with same CATH superfamily
1OFLA 1QCXA 3RIQA 1X0CA 4Z05A 1TYUA 2VFPA 4Z06A 2B0RA 4AVZA 4MXNA 2IOUG 1QQ1A 5C1CA 1EE6A 1K5CA 1OFMA 1CLWA 3B4NA 1O88A 4XORA 3GQ8A 2XTXA 1QA2A 3DU1X 4URRA 1RU4A 4NK8A 4XN3A 4XN0A 1KCDA 2O0WA 4Z03A 1O8IA 3BH6B 4U4BA 2NTBA 4HWVA 1KTWA 2O17A 3SQVA 4YFOA 3WWGA 3LMWA 4W8SA 4XKVA 2INVA 2NT6A 2INUA 1IA5A 1IB4A 1TYVA 4XL9A 4YZQA 1WXRA 2QXZA 2VFQA 4OJPA 4W8RA 3ZSCA 3NB2A 5DNSA 1JRGA 4XLFA 3SY2A 2BM4A 3PSZA 1O8MA 5JMCB 2YUHA 4XKWA 4XOTA 3UW0A 1LLWA 3ZPPA 2VBEA 5AMVA 3AK5A 1EA0A 4OJ6A 1PLUA 2NZMA 1KQ5A 4XMYA 1L1IA 3LJYA 3GRHA 3N6ZA 1WMRA 1O8FA 2ODLA 2X3HA 3SZEA 1AIRA 4KH3A 1BN8A 2X6XA 3T9GA 4MR0A 1RMGA 4OZYA 4YEIA 3TH0A 2BM5A 1OOCA 2J8IA 3B90A 1XG2A 4XONA 4XOPA 4YZAA 4YZXA 4U49A 1QA3A 2O04A 3P4GA 3ML3A 1KCCA 4YC5A 2Z8GA 2X85A 1O8KA 1QRCA 1OFDA 4XNFA 2O1DA 1DBOA 2VJJA 3PSSA 1TYXA 3VSTA 2QY1A 2O6WA 2XTYA 3H09A 2BX6A 1CZFA 2BM7A 3GQAA 2PECA 2G0YA 4OJOA 4YEJA 4XLHA 1VBLA 2NSPA 4W8TA 1O8JA 3GQ7A 1OGOX 4XR6A 2UVEA 2V5IA 1NHCA 4I84A 3PETA 2QYUA 2NT9A 2X6WA 4XM3A 4YCQA 1LLZA 3SUCA 1PE9A 4XQFA 4OJLA 2XTWA 2EWEA 1BHEA 1QA1A 1TYWA 1IDJA 1EZGA 1HF2A 5C1EA 3KRGA 1H80A 2VBKA 3VSVA 3BH7B 2VFNA 1K4ZA 1TSPA 1DABA 3LYCA 3SYJA 3EQOA 3VMWA 3EQNA 2IQ7A 1DBGA 3FY3A 3NAWA 3VSUA 2J8KA 2QZAA 4YELA 1IDKA 1O8EA 1O8LA 4OM9A 4XLCA 1O8DA 3VMVA 1HG8A 3JURA 2BM6A 1JTAA 2NTQA 2XC1A 2VFMA 4W8QA 4OJ5A 5JLVC 1QJVA 4XLAA 2VFOA 2PYGA 2O0VA 3B8YA 4EW9A 2UVFA 1RWRA 2XT2A 3JX8A 4YDTA 2X6YA 1QRBA 1OFEA 2VJIA 4V02C 2XT4A 2W7ZA 1GQ8A 3GQ9A 1PXZA 1OGMX 4XLEA 2VBMA 4C2LA 1O8GA 1O8HA 2QX3A 4OPWA 4PMHA 1K8FA 2F3LA 2NSTA 4JRAC 4YZ0A 4NK6A 2PYHA 2NTPA 4OZZA 3N90A 1LM1A 2BSPA
chains in the Genus database with same CATH topology
1OFLA 1QCXA 1X0CA 4Z05A 4Z06A 4AVZA 4MXNA 5C1CA 1EE6A 1K5CA 1OFMA 3B4NA 1O88A 4XORA 3GQ8A 4URRA 1RU4A 4NK8A 4XN3A 4XN0A 1KCDA 2O0WA 4Z03A 1O8IA 4U4BA 2NTBA 4HWVA 1KTWA 2O17A 3WWGA 4W8SA 4XKVA 2INVA 2NT6A 2INUA 1IA5A 1IB4A 4XL9A 4YZQA 2QXZA 4OJPA 4W8RA 3ZSCA 1JRGA 4XLFA 1O8MA 4XKWA 4XOTA 3UW0A 3ZPPA 2VBEA 5AMVA 4OJ6A 1PLUA 2NZMA 4XMYA 3GRHA 1WMRA 1O8FA 2ODLA 2X3HA 1AIRA 1BN8A 2X6XA 3T9GA 4MR0A 1RMGA 4OZYA 1OOCA 3B90A 4XONA 1XG2A 4XOPA 4YZAA 4YZXA 4U49A 2O04A 1KCCA 2Z8GA 2X85A 1O8KA 4XNFA 2O1DA 1DBOA 2VJJA 3VSTA 2QY1A 1CZFA 3GQAA 2PECA 4OJOA 4YEJA 4XLHA 1VBLA 2NSPA 4W8TA 1O8JA 3GQ7A 1OGOX 4XR6A 2UVEA 1NHCA 4I84A 2X6WA 2NT9A 4XM3A 3SUCA 1PE9A 4OJLA 2EWEA 1BHEA 1IDJA 5C1EA 3KRGA 1H80A 2VBKA 3VSVA 3EQOA 3VMWA 3EQNA 2IQ7A 1DBGA 3FY3A 3VSUA 4YELA 1IDKA 1O8EA 1O8LA 4XLCA 3VMVA 1O8DA 1HG8A 3JURA 1JTAA 2NTQA 4W8QA 4OJ5A 1QJVA 4XLAA 2PYGA 2O0VA 3B8YA 4EW9A 2UVFA 1RWRA 2X6YA 2VJIA 4C2LA 4XLEA 4XQFA 1GQ8A 3GQ9A 1PXZA 1OGMX 2VBMA 1O8GA 1O8HA 2QX3A 4PMHA 2NSTA 4YZ0A 4NK6A 2PYHA 2NTPA 4OZZA 3LMWA 2BSPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1OFL A;  1QCX A;  1X0C A;  4Z05 A;  4Z06 A;  4AVZ A;  4MXN A;  5C1C A;  1EE6 A;  1K5C A;  1OFM A;  3B4N A;  1O88 A;  4XOR A;  3GQ8 A;  4URR A;  1RU4 A;  4NK8 A;  4XN3 A;  4XN0 A;  1KCD A;  2O0W A;  4Z03 A;  1O8I A;  4U4B A;  2NTB A;  4HWV A;  1KTW A;  2O17 A;  3WWG A;  4W8S A;  4XKV A;  2INV A;  2NT6 A;  2INU A;  1IA5 A;  1IB4 A;  4XL9 A;  4YZQ A;  2QXZ A;  4OJP A;  4W8R A;  3ZSC A;  1JRG A;  4XLF A;  1O8M A;  4XKW A;  4XOT A;  3UW0 A;  3ZPP A;  2VBE A;  5AMV A;  4OJ6 A;  1PLU A;  2NZM A;  4XMY A;  3GRH A;  1WMR A;  1O8F A;  2ODL A;  2X3H A;  1AIR A;  1BN8 A;  2X6X A;  3T9G A;  4MR0 A;  1RMG A;  4OZY A;  1OOC A;  3B90 A;  4XON A;  1XG2 A;  4XOP A;  4YZA A;  4YZX A;  4U49 A;  2O04 A;  1KCC A;  2Z8G A;  2X85 A;  1O8K A;  4XNF A;  2O1D A;  1DBO A;  2VJJ A;  3VST A;  2QY1 A;  1CZF A;  3GQA A;  2PEC A;  4OJO A;  4YEJ A;  4XLH A;  1VBL A;  2NSP A;  4W8T A;  1O8J A;  3GQ7 A;  1OGO X;  4XR6 A;  2UVE A;  1NHC A;  4I84 A;  2X6W A;  2NT9 A;  4XM3 A;  3SUC A;  1PE9 A;  4OJL A;  2EWE A;  1BHE A;  1IDJ A;  5C1E A;  3KRG A;  1H80 A;  2VBK A;  3VSV A;  3EQO A;  3VMW A;  3EQN A;  2IQ7 A;  1DBG A;  3FY3 A;  3VSU A;  4YEL A;  1IDK A;  1O8E A;  1O8L A;  4XLC A;  3VMV A;  1O8D A;  1HG8 A;  3JUR A;  1JTA A;  2NTQ A;  4W8Q A;  4OJ5 A;  1QJV A;  4XLA A;  2PYG A;  2O0V A;  3B8Y A;  4EW9 A;  2UVF A;  1RWR A;  2X6Y A;  2VJI A;  4C2L A;  4XLE A;  4XQF A;  1GQ8 A;  3GQ9 A;  1PXZ A;  1OGM X;  2VBM A;  1O8G A;  1O8H A;  2QX3 A;  4PMH A;  2NST A;  4YZ0 A;  4NK6 A;  2PYH A;  2NTP A;  4OZZ A;  3LMW A;  2BSP A; 
#chains in the Genus database with same CATH topology
 1OFL A;  1QCX A;  3RIQ A;  1X0C A;  4Z05 A;  1TYU A;  2VFP A;  4Z06 A;  2B0R A;  4AVZ A;  4MXN A;  2IOU G;  1QQ1 A;  5C1C A;  1EE6 A;  1K5C A;  1OFM A;  1CLW A;  3B4N A;  1O88 A;  4XOR A;  3GQ8 A;  2XTX A;  1QA2 A;  3DU1 X;  4URR A;  1RU4 A;  4NK8 A;  4XN3 A;  4XN0 A;  1KCD A;  2O0W A;  4Z03 A;  1O8I A;  3BH6 B;  4U4B A;  2NTB A;  4HWV A;  1KTW A;  2O17 A;  3SQV A;  4YFO A;  3WWG A;  3LMW A;  4W8S A;  4XKV A;  2INV A;  2NT6 A;  2INU A;  1IA5 A;  1IB4 A;  1TYV A;  4XL9 A;  4YZQ A;  1WXR A;  2QXZ A;  2VFQ A;  4OJP A;  4W8R A;  3ZSC A;  3NB2 A;  5DNS A;  1JRG A;  4XLF A;  3SY2 A;  2BM4 A;  3PSZ A;  1O8M A;  5JMC B;  2YUH A;  4XKW A;  4XOT A;  3UW0 A;  1LLW A;  3ZPP A;  2VBE A;  5AMV A;  3AK5 A;  1EA0 A;  4OJ6 A;  1PLU A;  2NZM A;  1KQ5 A;  4XMY A;  1L1I A;  3LJY A;  3GRH A;  3N6Z A;  1WMR A;  1O8F A;  2ODL A;  2X3H A;  3SZE A;  1AIR A;  4KH3 A;  1BN8 A;  2X6X A;  3T9G A;  4MR0 A;  1RMG A;  4OZY A;  4YEI A;  3TH0 A;  2BM5 A;  1OOC A;  2J8I A;  3B90 A;  1XG2 A;  4XON A;  4XOP A;  4YZA A;  4YZX A;  4U49 A;  1QA3 A;  2O04 A;  3P4G A;  3ML3 A;  1KCC A;  4YC5 A;  2Z8G A;  2X85 A;  1O8K A;  1QRC A;  1OFD A;  4XNF A;  2O1D A;  1DBO A;  2VJJ A;  3PSS A;  1TYX A;  3VST A;  2QY1 A;  2O6W A;  2XTY A;  3H09 A;  2BX6 A;  1CZF A;  2BM7 A;  3GQA A;  2PEC A;  2G0Y A;  4OJO A;  4YEJ A;  4XLH A;  1VBL A;  2NSP A;  4W8T A;  1O8J A;  3GQ7 A;  1OGO X;  4XR6 A;  2UVE A;  2V5I A;  1NHC A;  4I84 A;  3PET A;  2QYU A;  2NT9 A;  2X6W A;  4XM3 A;  4YCQ A;  1LLZ A;  3SUC A;  1PE9 A;  4XQF A;  4OJL A;  2XTW A;  2EWE A;  1BHE A;  1QA1 A;  1TYW A;  1IDJ A;  1EZG A;  1HF2 A;  5C1E A;  3KRG A;  1H80 A;  2VBK A;  3VSV A;  3BH7 B;  2VFN A;  1K4Z A;  1TSP A;  1DAB A;  3LYC A;  3SYJ A;  3EQO A;  3VMW A;  3EQN A;  2IQ7 A;  1DBG A;  3FY3 A;  3NAW A;  3VSU A;  2J8K A;  2QZA A;  4YEL A;  1IDK A;  1O8E A;  1O8L A;  4OM9 A;  4XLC A;  1O8D A;  3VMV A;  1HG8 A;  3JUR A;  2BM6 A;  1JTA A;  2NTQ A;  2XC1 A;  2VFM A;  4W8Q A;  4OJ5 A;  5JLV C;  1QJV A;  4XLA A;  2VFO A;  2PYG A;  2O0V A;  3B8Y A;  4EW9 A;  2UVF A;  1RWR A;  2XT2 A;  3JX8 A;  4YDT A;  2X6Y A;  1QRB A;  1OFE A;  2VJI A;  4V02 C;  2XT4 A;  2W7Z A;  1GQ8 A;  3GQ9 A;  1PXZ A;  1OGM X;  4XLE A;  2VBM A;  4C2L A;  1O8G A;  1O8H A;  2QX3 A;  4OPW A;  4PMH A;  1K8F A;  2F3L A;  2NST A;  4JRA C;  4YZ0 A;  4NK6 A;  2PYH A;  2NTP A;  4OZZ A;  3N90 A;  1LM1 A;  2BSP A; 
#chains in the Genus database with same CATH homology
 1OFL A;  1QCX A;  1X0C A;  4Z05 A;  4Z06 A;  4AVZ A;  4MXN A;  5C1C A;  1EE6 A;  1K5C A;  1OFM A;  3B4N A;  1O88 A;  4XOR A;  3GQ8 A;  4URR A;  1RU4 A;  4NK8 A;  4XN3 A;  4XN0 A;  1KCD A;  2O0W A;  4Z03 A;  1O8I A;  4U4B A;  2NTB A;  4HWV A;  1KTW A;  2O17 A;  3WWG A;  4W8S A;  4XKV A;  2INV A;  2NT6 A;  2INU A;  1IA5 A;  1IB4 A;  4XL9 A;  4YZQ A;  2QXZ A;  4OJP A;  4W8R A;  3ZSC A;  1JRG A;  4XLF A;  1O8M A;  4XKW A;  4XOT A;  3UW0 A;  3ZPP A;  2VBE A;  5AMV A;  4OJ6 A;  1PLU A;  2NZM A;  4XMY A;  3GRH A;  1WMR A;  1O8F A;  2ODL A;  2X3H A;  1AIR A;  1BN8 A;  2X6X A;  3T9G A;  4MR0 A;  1RMG A;  4OZY A;  1OOC A;  3B90 A;  4XON A;  1XG2 A;  4XOP A;  4YZA A;  4YZX A;  4U49 A;  2O04 A;  1KCC A;  2Z8G A;  2X85 A;  1O8K A;  4XNF A;  2O1D A;  1DBO A;  2VJJ A;  3VST A;  2QY1 A;  1CZF A;  3GQA A;  2PEC A;  4OJO A;  4YEJ A;  4XLH A;  1VBL A;  2NSP A;  4W8T A;  1O8J A;  3GQ7 A;  1OGO X;  4XR6 A;  2UVE A;  1NHC A;  4I84 A;  2X6W A;  2NT9 A;  4XM3 A;  3SUC A;  1PE9 A;  4OJL A;  2EWE A;  1BHE A;  1IDJ A;  5C1E A;  3KRG A;  1H80 A;  2VBK A;  3VSV A;  3EQO A;  3VMW A;  3EQN A;  2IQ7 A;  1DBG A;  3FY3 A;  3VSU A;  4YEL A;  1IDK A;  1O8E A;  1O8L A;  4XLC A;  3VMV A;  1O8D A;  1HG8 A;  3JUR A;  1JTA A;  2NTQ A;  4W8Q A;  4OJ5 A;  1QJV A;  4XLA A;  2PYG A;  2O0V A;  3B8Y A;  4EW9 A;  2UVF A;  1RWR A;  2X6Y A;  2VJI A;  4C2L A;  4XLE A;  4XQF A;  1GQ8 A;  3GQ9 A;  1PXZ A;  1OGM X;  2VBM A;  1O8G A;  1O8H A;  2QX3 A;  4PMH A;  2NST A;  4YZ0 A;  4NK6 A;  2PYH A;  2NTP A;  4OZZ A;  3LMW A;  2BSP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...