1IB4A

Crystal structure of polygalacturonase from aspergillus aculeatus at ph4.5
Total Genus 126
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
126
sequence length
339
structure length
339
Chain Sequence
ATTCTFSGSNGASSASKSKTSCSTIVLSNVAVPSGTTLDLTKLNDGTHVIFSGETTFGYKEWSGPLISVSGSDLTITGASGHSINGDGSRWWDGEGGNGGKTKPKFFAAHSLTNSVISGLKIVNSPVQVFSVAGSDYLTLKDITIDNSDGDDNGGHNTDAFDIGTSTYVTISGATVYNQDDCVAVNSGENIYFSGGYCSGGHGLSIGSVGGRSDNTVKNVTFVDSTIINSDNGVRIKTNIDTTGSVSDVTYKDITLTSIAKYGIVVQQNYGDTSSTPTTGVPITDFVLDNVHGSVVSSGTNILISCGSGSCSDWTWTDVSVSGGKTSSKCTNVPSGASC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The X-ray structure of Aspergillus aculeatus polygalacturonase and a modeled structure of the polygalacturonase-octagalacturonate complex.
pubmed doi rcsb
molecule tags Hydrolase
molecule keywords POLYGALACTURONASE
total genus 126
structure length 339
sequence length 339
chains with identical sequence B
ec nomenclature ec 3.2.1.15: Endo-polygalacturonase.
pdb deposition date 2001-03-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00295 Glyco_hydro_28 Glycosyl hydrolases family 28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.160.20.10 Mainly Beta 3 Solenoid Pectate Lyase C-like Single-stranded right-handed beta-helix, Pectin lyase-like 1ib4A00
1DBOA 3SUCA 3LMWA 4MR0A 4XLHA 4YZXA 4U4BA 2QY1A 1IDKA 3EQOA 1CZFA 5C1CA 1HG8A 2UVEA 1XG2A 1O8HA 4XL9A 4YZQA 2VBKA 4OZYA 1O88A 2NSPA 3GQ7A 1O8EA 4XLCA 4PMHA 4W8RA 1EE6A 2X85A 4C2LA 1BHEA 4OJOA 4OZZA 1RWRA 1OFMA 1OGMX 4OJPA 4W8TA 3T9GA 1KCCA 4OJ5A 1K5CA 2ODLA 1O8DA 3ZSCA 2X6XA 1BN8A 2O04A 2INUA 2PYGA 2INVA 2VJJA 4Z06A 2UVFA 4XN0A 1O8GA 4W8SA 1X0CA 1PXZA 1O8LA 1O8KA 1IDJA 4I84A 4HWVA 3VSTA 3FY3A 2X3HA 4XKWA 2VJIA 4Z05A 1O8JA 3B90A 2VBEA 1IA5A 4XLEA 1PE9A 1O8IA 1QCXA 1RU4A 2O17A 2O1DA 2PYHA 3GQAA 3GQ9A 4OJLA 5C1EA 2NSTA 1OOCA 2NTPA 1O8MA 4XKVA 4XR6A 4XM3A 1IB4A 1NHCA 3VMVA 4XNFA 1QJVA 1WMRA 2X6WA 2NTBA 2NT6A 4XMYA 4AVZA 1O8FA 4YELA 3VSVA 1GQ8A 3EQNA 2QXZA 4YZ0A 1KTWA 1DBGA 2O0WA 3JURA 4W8QA 4XLAA 3B4NA 3WWGA 1KCDA 1VBLA 2EWEA 1OFLA 2BSPA 2NZMA 1JRGA 4MXNA 4OJ6A 1RMGA 4YZAA 4XLFA 1OGOX 2IQ7A 4U49A 3B8YA 4XOPA 4XOTA 1AIRA 2NTQA 2X6YA 4NK6A 3VSUA 3UW0A 4XQFA 3VMWA 2NT9A 4URRA 4XN3A 4XORA 4XONA 3ZPPA 4EW9A 2Z8GA 2O0VA 5AMVA 4NK8A 4Z03A 1H80A 2VBMA 3KRGA 3GQ8A 3GRHA 1JTAA 4YEJA 1PLUA 2QX3A 2PECA
chains in the Genus database with same CATH superfamily
3PETA 2VFPA 1DBOA 3SUCA 5JMCB 2VFOA 3LMWA 4YC5A 4MR0A 1CLWA 2F3LA 4XLHA 4YDTA 2XTYA 4YZXA 1TYVA 3BH6B 4U4BA 3TH0A 2QY1A 1TSPA 1IDKA 1OFEA 3EQOA 3SYJA 1CZFA 5C1CA 1HG8A 3JX8A 2UVEA 1XG2A 1WXRA 3NAWA 1L1IA 1O8HA 1QQ1A 4XL9A 4YZQA 2VBKA 4OZYA 1O88A 2NSPA 2BM6A 3GQ7A 1O8EA 4XLCA 4PMHA 3ML3A 3H09A 4W8RA 1EE6A 2X85A 1KQ5A 1BHEA 4C2LA 4OJOA 4OZZA 1RWRA 1OFMA 1LLWA 3RIQA 3PSSA 1OGMX 4OJPA 4W8TA 2YUHA 3T9GA 3P4GA 1KCCA 4OJ5A 5C1EA 1K4ZA 1K5CA 3AK5A 3SQVA 2ODLA 1O8DA 3ZSCA 4YCQA 2X6XA 1BN8A 2O04A 2INUA 2PYGA 2INVA 2VJJA 4Z06A 2UVFA 4XN0A 1O8GA 4W8SA 1X0CA 1PXZA 2VFQA 3NB2A 1O8LA 3SZEA 1O8KA 1IDJA 2O6WA 4I84A 1QRCA 2IOUG 4HWVA 3VSTA 3FY3A 2X3HA 4XKWA 1TYXA 2V5IA 2VJIA 4YEIA 2QZAA 1K8FA 4Z05A 3PSZA 1O8JA 3B90A 1EZGA 2VBEA 2BM4A 1LLZA 1IA5A 4XLEA 3BH7B 2BM7A 1PE9A 1O8IA 1DABA 1QCXA 1RU4A 2O17A 2O1DA 2PYHA 3GQAA 3GQ9A 3N90A 4KH3A 2NSTA 1OOCA 2NTPA 1O8MA 4OJLA 4XKVA 4XR6A 4XM3A 1IB4A 1QA1A 1NHCA 3VMVA 4XNFA 1QJVA 1WMRA 2VFMA 1HF2A 2NTBA 2X6WA 2NT6A 4XMYA 2XT4A 4YFOA 1TYUA 4AVZA 1O8FA 4YELA 5JLVC 1OFDA 3VSVA 1GQ8A 3EQNA 2QXZA 2J8IA 4YZ0A 1KTWA 2BM5A 2B0RA 3LJYA 3N6ZA 1DBGA 2O0WA 3JURA 2XC1A 4W8QA 4XLAA 3LYCA 2BX6A 2J8KA 3B4NA 4OM9A 3WWGA 1KCDA 1VBLA 2EWEA 1OFLA 1LM1A 2BSPA 2NZMA 1JRGA 4MXNA 4OJ6A 1QRBA 4V02C 2XTXA 1RMGA 4YZAA 4XLFA 1OGOX 2IQ7A 2XT2A 4U49A 3B8YA 4XOPA 4XOTA 1AIRA 2W7ZA 3DU1X 4JRAC 2NTQA 2VFNA 1EA0A 2X6YA 4NK6A 3VSUA 3UW0A 4XQFA 3VMWA 2NT9A 4URRA 4XN3A 1TYWA 4OPWA 4XONA 2G0YA 4XORA 3ZPPA 1QA2A 4EW9A 2QYUA 2Z8GA 2O0VA 3SY2A 5AMVA 4NK8A 5DNSA 4Z03A 1H80A 1QA3A 2VBMA 2XTWA 3KRGA 3GQ8A 3GRHA 1JTAA 4YEJA 1PLUA 2QX3A 2PECA
chains in the Genus database with same CATH topology
1DBOA 3SUCA 3LMWA 4MR0A 4XLHA 4YZXA 4U4BA 2QY1A 1IDKA 3EQOA 1CZFA 5C1CA 1HG8A 2UVEA 1XG2A 1O8HA 4XL9A 4YZQA 2VBKA 4OZYA 1O88A 2NSPA 3GQ7A 1O8EA 4XLCA 4PMHA 4W8RA 1EE6A 2X85A 4C2LA 1BHEA 4OJOA 4OZZA 1RWRA 1OFMA 1OGMX 4OJPA 4W8TA 3T9GA 1KCCA 4OJ5A 1K5CA 2ODLA 1O8DA 3ZSCA 2X6XA 1BN8A 2O04A 2INUA 2PYGA 2INVA 2VJJA 4Z06A 2UVFA 4XN0A 1O8GA 4W8SA 1X0CA 1PXZA 1O8LA 1O8KA 1IDJA 4I84A 4HWVA 3VSTA 3FY3A 2X3HA 4XKWA 2VJIA 4Z05A 1O8JA 3B90A 2VBEA 1IA5A 4XLEA 1PE9A 1O8IA 1QCXA 1RU4A 2O17A 2O1DA 2PYHA 3GQAA 3GQ9A 4OJLA 5C1EA 2NSTA 1OOCA 2NTPA 1O8MA 4XKVA 4XR6A 4XM3A 1IB4A 1NHCA 3VMVA 4XNFA 1QJVA 1WMRA 2X6WA 2NTBA 2NT6A 4XMYA 4AVZA 1O8FA 4YELA 3VSVA 1GQ8A 3EQNA 2QXZA 4YZ0A 1KTWA 1DBGA 2O0WA 3JURA 4W8QA 4XLAA 3B4NA 3WWGA 1KCDA 1VBLA 2EWEA 1OFLA 2BSPA 2NZMA 1JRGA 4MXNA 4OJ6A 1RMGA 4YZAA 4XLFA 1OGOX 2IQ7A 4U49A 3B8YA 4XOPA 4XOTA 1AIRA 2NTQA 2X6YA 4NK6A 3VSUA 3UW0A 4XQFA 3VMWA 2NT9A 4URRA 4XN3A 4XORA 4XONA 3ZPPA 4EW9A 2Z8GA 2O0VA 5AMVA 4NK8A 4Z03A 1H80A 2VBMA 3KRGA 3GQ8A 3GRHA 1JTAA 4YEJA 1PLUA 2QX3A 2PECA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1DBO A;  3SUC A;  3LMW A;  4MR0 A;  4XLH A;  4YZX A;  4U4B A;  2QY1 A;  1IDK A;  3EQO A;  1CZF A;  5C1C A;  1HG8 A;  2UVE A;  1XG2 A;  1O8H A;  4XL9 A;  4YZQ A;  2VBK A;  4OZY A;  1O88 A;  2NSP A;  3GQ7 A;  1O8E A;  4XLC A;  4PMH A;  4W8R A;  1EE6 A;  2X85 A;  4C2L A;  1BHE A;  4OJO A;  4OZZ A;  1RWR A;  1OFM A;  1OGM X;  4OJP A;  4W8T A;  3T9G A;  1KCC A;  4OJ5 A;  1K5C A;  2ODL A;  1O8D A;  3ZSC A;  2X6X A;  1BN8 A;  2O04 A;  2INU A;  2PYG A;  2INV A;  2VJJ A;  4Z06 A;  2UVF A;  4XN0 A;  1O8G A;  4W8S A;  1X0C A;  1PXZ A;  1O8L A;  1O8K A;  1IDJ A;  4I84 A;  4HWV A;  3VST A;  3FY3 A;  2X3H A;  4XKW A;  2VJI A;  4Z05 A;  1O8J A;  3B90 A;  2VBE A;  1IA5 A;  4XLE A;  1PE9 A;  1O8I A;  1QCX A;  1RU4 A;  2O17 A;  2O1D A;  2PYH A;  3GQA A;  3GQ9 A;  4OJL A;  5C1E A;  2NST A;  1OOC A;  2NTP A;  1O8M A;  4XKV A;  4XR6 A;  4XM3 A;  1IB4 A;  1NHC A;  3VMV A;  4XNF A;  1QJV A;  1WMR A;  2X6W A;  2NTB A;  2NT6 A;  4XMY A;  4AVZ A;  1O8F A;  4YEL A;  3VSV A;  1GQ8 A;  3EQN A;  2QXZ A;  4YZ0 A;  1KTW A;  1DBG A;  2O0W A;  3JUR A;  4W8Q A;  4XLA A;  3B4N A;  3WWG A;  1KCD A;  1VBL A;  2EWE A;  1OFL A;  2BSP A;  2NZM A;  1JRG A;  4MXN A;  4OJ6 A;  1RMG A;  4YZA A;  4XLF A;  1OGO X;  2IQ7 A;  4U49 A;  3B8Y A;  4XOP A;  4XOT A;  1AIR A;  2NTQ A;  2X6Y A;  4NK6 A;  3VSU A;  3UW0 A;  4XQF A;  3VMW A;  2NT9 A;  4URR A;  4XN3 A;  4XOR A;  4XON A;  3ZPP A;  4EW9 A;  2Z8G A;  2O0V A;  5AMV A;  4NK8 A;  4Z03 A;  1H80 A;  2VBM A;  3KRG A;  3GQ8 A;  3GRH A;  1JTA A;  4YEJ A;  1PLU A;  2QX3 A;  2PEC A; 
#chains in the Genus database with same CATH topology
 3PET A;  2VFP A;  1DBO A;  3SUC A;  5JMC B;  2VFO A;  3LMW A;  4YC5 A;  4MR0 A;  1CLW A;  2F3L A;  4XLH A;  4YDT A;  2XTY A;  4YZX A;  1TYV A;  3BH6 B;  4U4B A;  3TH0 A;  2QY1 A;  1TSP A;  1IDK A;  1OFE A;  3EQO A;  3SYJ A;  1CZF A;  5C1C A;  1HG8 A;  3JX8 A;  2UVE A;  1XG2 A;  1WXR A;  3NAW A;  1L1I A;  1O8H A;  1QQ1 A;  4XL9 A;  4YZQ A;  2VBK A;  4OZY A;  1O88 A;  2NSP A;  2BM6 A;  3GQ7 A;  1O8E A;  4XLC A;  4PMH A;  3ML3 A;  3H09 A;  4W8R A;  1EE6 A;  2X85 A;  1KQ5 A;  1BHE A;  4C2L A;  4OJO A;  4OZZ A;  1RWR A;  1OFM A;  1LLW A;  3RIQ A;  3PSS A;  1OGM X;  4OJP A;  4W8T A;  2YUH A;  3T9G A;  3P4G A;  1KCC A;  4OJ5 A;  5C1E A;  1K4Z A;  1K5C A;  3AK5 A;  3SQV A;  2ODL A;  1O8D A;  3ZSC A;  4YCQ A;  2X6X A;  1BN8 A;  2O04 A;  2INU A;  2PYG A;  2INV A;  2VJJ A;  4Z06 A;  2UVF A;  4XN0 A;  1O8G A;  4W8S A;  1X0C A;  1PXZ A;  2VFQ A;  3NB2 A;  1O8L A;  3SZE A;  1O8K A;  1IDJ A;  2O6W A;  4I84 A;  1QRC A;  2IOU G;  4HWV A;  3VST A;  3FY3 A;  2X3H A;  4XKW A;  1TYX A;  2V5I A;  2VJI A;  4YEI A;  2QZA A;  1K8F A;  4Z05 A;  3PSZ A;  1O8J A;  3B90 A;  1EZG A;  2VBE A;  2BM4 A;  1LLZ A;  1IA5 A;  4XLE A;  3BH7 B;  2BM7 A;  1PE9 A;  1O8I A;  1DAB A;  1QCX A;  1RU4 A;  2O17 A;  2O1D A;  2PYH A;  3GQA A;  3GQ9 A;  3N90 A;  4KH3 A;  2NST A;  1OOC A;  2NTP A;  1O8M A;  4OJL A;  4XKV A;  4XR6 A;  4XM3 A;  1IB4 A;  1QA1 A;  1NHC A;  3VMV A;  4XNF A;  1QJV A;  1WMR A;  2VFM A;  1HF2 A;  2NTB A;  2X6W A;  2NT6 A;  4XMY A;  2XT4 A;  4YFO A;  1TYU A;  4AVZ A;  1O8F A;  4YEL A;  5JLV C;  1OFD A;  3VSV A;  1GQ8 A;  3EQN A;  2QXZ A;  2J8I A;  4YZ0 A;  1KTW A;  2BM5 A;  2B0R A;  3LJY A;  3N6Z A;  1DBG A;  2O0W A;  3JUR A;  2XC1 A;  4W8Q A;  4XLA A;  3LYC A;  2BX6 A;  2J8K A;  3B4N A;  4OM9 A;  3WWG A;  1KCD A;  1VBL A;  2EWE A;  1OFL A;  1LM1 A;  2BSP A;  2NZM A;  1JRG A;  4MXN A;  4OJ6 A;  1QRB A;  4V02 C;  2XTX A;  1RMG A;  4YZA A;  4XLF A;  1OGO X;  2IQ7 A;  2XT2 A;  4U49 A;  3B8Y A;  4XOP A;  4XOT A;  1AIR A;  2W7Z A;  3DU1 X;  4JRA C;  2NTQ A;  2VFN A;  1EA0 A;  2X6Y A;  4NK6 A;  3VSU A;  3UW0 A;  4XQF A;  3VMW A;  2NT9 A;  4URR A;  4XN3 A;  1TYW A;  4OPW A;  4XON A;  2G0Y A;  4XOR A;  3ZPP A;  1QA2 A;  4EW9 A;  2QYU A;  2Z8G A;  2O0V A;  3SY2 A;  5AMV A;  4NK8 A;  5DNS A;  4Z03 A;  1H80 A;  1QA3 A;  2VBM A;  2XTW A;  3KRG A;  3GQ8 A;  3GRH A;  1JTA A;  4YEJ A;  1PLU A;  2QX3 A;  2PEC A; 
#chains in the Genus database with same CATH homology
 1DBO A;  3SUC A;  3LMW A;  4MR0 A;  4XLH A;  4YZX A;  4U4B A;  2QY1 A;  1IDK A;  3EQO A;  1CZF A;  5C1C A;  1HG8 A;  2UVE A;  1XG2 A;  1O8H A;  4XL9 A;  4YZQ A;  2VBK A;  4OZY A;  1O88 A;  2NSP A;  3GQ7 A;  1O8E A;  4XLC A;  4PMH A;  4W8R A;  1EE6 A;  2X85 A;  4C2L A;  1BHE A;  4OJO A;  4OZZ A;  1RWR A;  1OFM A;  1OGM X;  4OJP A;  4W8T A;  3T9G A;  1KCC A;  4OJ5 A;  1K5C A;  2ODL A;  1O8D A;  3ZSC A;  2X6X A;  1BN8 A;  2O04 A;  2INU A;  2PYG A;  2INV A;  2VJJ A;  4Z06 A;  2UVF A;  4XN0 A;  1O8G A;  4W8S A;  1X0C A;  1PXZ A;  1O8L A;  1O8K A;  1IDJ A;  4I84 A;  4HWV A;  3VST A;  3FY3 A;  2X3H A;  4XKW A;  2VJI A;  4Z05 A;  1O8J A;  3B90 A;  2VBE A;  1IA5 A;  4XLE A;  1PE9 A;  1O8I A;  1QCX A;  1RU4 A;  2O17 A;  2O1D A;  2PYH A;  3GQA A;  3GQ9 A;  4OJL A;  5C1E A;  2NST A;  1OOC A;  2NTP A;  1O8M A;  4XKV A;  4XR6 A;  4XM3 A;  1IB4 A;  1NHC A;  3VMV A;  4XNF A;  1QJV A;  1WMR A;  2X6W A;  2NTB A;  2NT6 A;  4XMY A;  4AVZ A;  1O8F A;  4YEL A;  3VSV A;  1GQ8 A;  3EQN A;  2QXZ A;  4YZ0 A;  1KTW A;  1DBG A;  2O0W A;  3JUR A;  4W8Q A;  4XLA A;  3B4N A;  3WWG A;  1KCD A;  1VBL A;  2EWE A;  1OFL A;  2BSP A;  2NZM A;  1JRG A;  4MXN A;  4OJ6 A;  1RMG A;  4YZA A;  4XLF A;  1OGO X;  2IQ7 A;  4U49 A;  3B8Y A;  4XOP A;  4XOT A;  1AIR A;  2NTQ A;  2X6Y A;  4NK6 A;  3VSU A;  3UW0 A;  4XQF A;  3VMW A;  2NT9 A;  4URR A;  4XN3 A;  4XOR A;  4XON A;  3ZPP A;  4EW9 A;  2Z8G A;  2O0V A;  5AMV A;  4NK8 A;  4Z03 A;  1H80 A;  2VBM A;  3KRG A;  3GQ8 A;  3GRH A;  1JTA A;  4YEJ A;  1PLU A;  2QX3 A;  2PEC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...