1IB5A

X-ray 3d structure of p.leiognathi cu,zn sod mutant w83y
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
151
structure length
151
Chain Sequence
QDLTVKMTDLQTGKPVGTIELSQNKYGVVFIPELADLTPGMHGFHIHQNGSCASSEKDGKVVLGGAAGGHYDPEHTNKHGFPYTDDNHKGDLPALFVSANGLATNPVLAPRLTLKELKGHAIMIHAGGDNHSDMPKALGGGGARVACGVIQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CU,ZN SUPEROXIDE DISMUTASE
publication title Single mutations at the subunit interface modulate copper reactivity in Photobacterium leiognathi Cu,Zn superoxide dismutase.
pubmed doi rcsb
source organism Photobacterium leiognathi
molecule tags Oxidoreductase
total genus 33
structure length 151
sequence length 151
ec nomenclature ec 1.15.1.1: Superoxide dismutase.
pdb deposition date 2001-03-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00080 Sod_Cu Copper/zinc superoxide dismutase (SODC)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.200 Mainly Beta Sandwich Immunoglobulin-like Superoxide dismutase, copper/zinc binding domain 1ib5A00
3GZQA 4A7QA 1B4LA 1F1DA 2AQTA 3GZPA 4U4IA 2JCWA 3L9YA 1SXBA 2E46A 4BCZA 2AEOA 2WYZA 3GZOA 2ZKWA 2Q2LA 1F1AA 1IBFA 1L3NA 1S4IA 1SXSA 1SXZA 2AQRA 1JK9B 1JCVA 1SDAB 1U3NA 1IB5A 1QUPA 1SPDA 1YAZA 1BA9A 1E9PA 2V0AA 2AF2A 2AQPA 3HOGA 4FF9A 5KBMA 4N3TA 4MCNA 2XJKA 1HL4A 2Z7UA 1F1GA 2Z7WA 4BCYA 2C9VA 1XTLA 1YAIA 3LTVA 2SODB 1F18A 3CE1A 1SXCA 1PU0A 1Z9NA 2Z7YA 3RE0A 1TO5A 1P1VA 2XJLA 1FUNA 3QQDB 2APSA 1SXNA 3K91A 5CU9A 2Z7ZA 2WZ6A 2LU5A 1OZTG 2GBTA 3GTTA 3H2QA 2NNXA 1HL5A 2WKOF 1COBA 1E9OB 1EJ8A 3T5WA 1AZVA 1SOSA 1PZSA 5KBLA 1ESOA 2C9UA 1DSWA 1Q0EA 2WZ5A 2C9SA 3ECVA 2E47A 4A7TA 2WKOA 2AQSA 1JK9A 1XSOA 1EQWA 3S0PA 1DO5A 1CB4A 3ECUA 3KM1A 1KMGA 1E9OA 1N18A 1TO4A 1RK7A 4OH2A 4A7UA 4L05A 1SXAA 2AQQA 3F7LA 1IBBA 1OAJA 3KM2A 1Z9PA 3KH4A 2ZOWA 1SRDA 3SODB 3MKGA 3ECWA 1PTZA 4MCMA 1UXMA 1E9QB 1BZOA 1IBDA 3HFFA 3KBFA 4OJAA 4BD4A 1YSOA 1IBHA 1E9PB 2K4WA 3L9EA 3QQDA 1OZUA 2ZKXA 4A7GA 2WWNA 4A7VA 3KH3A 2WWOA 3H2PA 4B3EA 2GBUA 1CBJA 2VR6A 1OEZW 1B4TA 1SDYA 3CQPA 3MNDA 2WYTA 1UXLA 1OALA 1XTMA 3GTVA 3HW7A 3F7KA 3PU7A 2VR7A 1E9QA 3KBEA 5KBKA 3CQQA 2AQNA 1MFMA 3GQFA 4N3UA 4A7GF 4A7SA 2VR8A 2ZKYA 2WZ0A 2GBVA 1N19A 2JLPA 2R27A
chains in the Genus database with same CATH superfamily
3DTUB 1J9CT 1HXYA 1QLEH 1XH3A 2GY7B 1I3GH 2NX5D 3SE9H 4JHZA 3SE8L 1FJ1B 2FNWA 1KB9J 4X6CF 5BVJA 4YFDB 1C5CL 4H5SB 5IF0B 3ZKXC 3BSZL 1EEZB 5DJ8B 4NNXB 2DWEB 5I24A 4BQ8A 2PR4H 4ZFOB 4K73A 4DERA 2XNAB 4EOWH 3V6OA 2A9ML 3L8QA 2CRIA 3SQOH 3H7BB 3V0EA 3U1QA 1Q0XH 1HJBC 1SDAB 2DEXX 4HHAB 3ARFC 3CX5K 4GSRA 1G87A 2WLIA 5T1MB 5IBUB 3ATEA 2C1OB 3LKRB 4TM9A 2V9UA 1VZGA 5FYKH 5LGHL 3MV8A 3HUJE 3HZVB 4QF1B 1D5ZB 4ANUA 1TQBC 4KFMA 4AM0A 4Z7WE 1S3KH 4AKOA 3E6HA 2VDQH 1E4HA 4NDMB 2CO7A 2ZOUA 1RPQA 1ZHKB 3RGHA 1SBBA 2G5BA 3LRMA 3ZQXA 2ZD0A 3BIKB 4UAHA 2LAGB 3LZPA 4FTVB 4UT6H 2OM5A 3VXRE 3VXPA 4OSUH 5GISH 1DQQB 1UXSA 3VRLE 3VJ6A 1X5GA 5EORH 2IANE 1LEKA 3AQDA 4OD1L 4PGCA 1ZGLP 4JFXA 4XNZB 4WDIB 5I28A 1FSKC 5AW0B 5GS1A 3U0TA 4NUGH 2Z35B 2HUHA 1OL0A 1P4LA 1M05B 2P5ED 1PVHA 3HS9A 3RVXD 5IROD 3QJZA 4J7RA 3RP1A 4A2HA 2I7OA 1JWMB 2Y1YA 2C9UA 4WVRA 4EDWL 2EEXA 1XEDA 3P2TA 1LLAA 5A2AA 5LHDA 3GMLA 1T66C 2BOLA 3EHBB 2FT6A 1W72H 4UM9B 2Y5QA 4KKLC 1NMCB 4Y7OC 4BA8A 1GPOL 1EJOL 1QASA 3D0LB 5FB8A 1E5YA 3O6LL 1P7QA 1BAGA 4N85A 4NBXB 5I1JL 5E1HB 1ITCA 4Q6IA 2ZE0A 4EVNA 3T6ZA 1G9HA 3WEXA 1ZT7B 2IJ0C 4LL9A 3ZYIA 4R6UA 3QXAA 1U91A 4MHHI 2DMGA 1IT9L 1CXEA 2EXWC 2WXGA 3RY6A 3T65A 5GSRA 4Q9QL 3TVMA 2JH2A 3MODH 5CUSL 3ZTEA 2DKMA 1OSZB 4RGMB 1Z9OA 4ZJ9A 5IBLD 2Y2WA 4B9YA 3VFWB 2XXMB 2EDXA 2E74C 1SVBA 5DEFB 5CCKH 3PWUB 1KB9K 4GW4B 5TK2A 3EBAA 1KTCA 5I6OA 1B88A 4KTDH 3SBWA 4MA7L 2A6KA 4L9DA 5JHDB 1YEGL 2VR7A 2Q86B 3O2VL 5KBPA 4H88L 1AFVH 2R83A 5K9KB 3B9KC 4NZUH 3A6CL 4A7GF 3GQFA 3D3VB 3VRIA 5JUEH 3TPUB 1G9NL 4X5RA 3KGSA 3SGJC 4AQAA 2WQWA 2J8HA 4XCCH 1PD6A 1ZANH 1S7UB 3FHQA 2RMNA 4OZGF 3VMPA 2WYZA 3MA9H 5SWSA 2Y6SD 4LDCA 2KBGA 2CK0H 1H3VA 1XF3A 5ID1A 3WHXB 4L48A 5AZEH 1S7SA 1UOVA 3N43F 5E8NB 3TCLB 3VD9A 3GRWA 3OHXA 5DUBB 4TVPL 4ZOAA 1IL1B 1RD6A 2PP8A 2BVTA 4XN4A 3NPSC 1SJHA 3CNKA 3HKZA 5D4JA 4TULL 3GKZA 5DC9B 3JT2A 3NFSL 3MX0B 4J3OH 2VZOA 1H3TA 3T71A 3EO9H 4LVHB 1AXSB 1P1VA 2WTRB 2CCVA 1KXVC 1HNYA 1YNLL 3M88A 1UEYA 3QNXB 4DH2A 4DAGH 5I17B 5KSVB 1AGFB 2EO1A 1A4KA 1ND0A 1CN4A 3JWOH 2C3VB 1SJEB 4M8QB 3EADA 4V2CB 2G75B 4Z78A 3Q13A 1B0RB 5F7LB 2P5WD 4S1SH 1KCWA 4JN1H 1NANH 2EVHA 4WWKD 1BAWA 2RFXA 5CJ8A 5AW3B 1JMXA 4YXKL 2OSWA 2OTUA 3BUTA 3MXVH 3SD2A 5IF0A 1HE7A 5BUAA 2XYCA 3UBXA 3Q48A 1C7TA 5GIRB 2XNAA 3KXFD 2DM7A 1KTJA 1M71A 3GMNB 3M7FB 4H8WL 4WTQA 4ZYKB 5CEYA 3PWPB 3TA3D 5IHBA 3QE5A 1QFPA 3C60D 5I73B 3D87B 5T1MA 1U8OA 2C1OA 2N0KA 4B9IA 4Y5YA 4M7LT 1WZ1L 4G7YH 3X3GH 1TCMA 3HZVA 3I50L 5C0RL 5T1LA 1RHFA 2EVGA 4I13B 1QSFA 3O2DA 3PP3H 3VMNA 5KVFH 1ZHKA 2HRPH 5B21A 3U0PB 2XTJE 3CZJA 2PCXA 2EADA 3OLIA 4HHWA 3KPOB 1ID5I 4IKNA 4LHUB 3I2CL 1DQQA 3RTQD 4XXWC 4AIZB 4AYEC 2HVBA 4HWUA 1XHHA 2PCFB 4FABL 1T0MB 3AAZB 1QSVA 4WDIA 5HYIA 3RHWF 2EVFA 4Z3GA 1MHHA 3PJSB 3APCA 4S1QH 1M05A 2WXMA 1IGFL 3GKWL 2O6EA 2CGRL 2MH4A 3NRQA 3LNIA 2BMKB 1MCFA 2APWA 4UM9A 4WHTB 3UJTH 4NUJB 3CDGB 4QRAA 4RFEB 2BH0A 3N40F 1D9KD 1DBKL 2EAEA 3NCJH 4F3FB 4PRIB 5JHMA 4BZ1H 1W91A 4KH9A 5B7MA 3FPXA 2LFGA 4HCIA 4ANWA 3RZWA 1TFPA 4P9MH 2Y5EA 3AXLA 1YJDC 1ZT7A 2IWFA 4Y2DB 2W8CA 4MD5B 3EZJB 1RIVH 2YAEA 1EO8L 2F54E 1AS7A 4F2FA 5I18H 1MAML 1KYFA 4YHML 4TTGA 2WSKA 1UA7A 2CZNA 2FGZA 3FULA 4GQ9H 5C6WH 4OJEH 4KWUA 4KK8C 4N2GA 4PLNC 1RQ5A 4UBDD 3VFWA 5HBBA 4JQVA 2CO2A 3HVDA 5ISZD 3MLVH 1MCDA 3BPNB 2AJ3A 4GW4A 3IKKA 3NSXA 3TBBA 1RMFH 5F9OL 3BSHA 4XHJD 2N7SA 2Q86A 2F58L 2IPKB 5C0AE 1V27A 2GIYA 4AW4A 4BHUA 1FFRA 4KKAC 4QO1B 2WZ6A 3SKUD 2DMBA 1CD8A 5DXWA 4C4UA 1JF1A 1HS6A 5TDPB 4I3RH 3TPUA 2V3EA 4FQHB 4DKEH 3NIGE 5IQLA 2Z31B 1IGTB 5IWLA 3JZYA 2NY4D 3DRQA 4ODSL 3CH1B 4OLYH 2MFNA 3NIFE 2E3VA 4JCWA 1R24B 3SJVA 3VVVA 2W9LA 1IGIH 4DUWA 1IMHC 1S7UA 2BSED 3SGKC 5JXEC 1A6PA 3H9SB 1NM9A 5IUCA 5I9QB 4P46A 1I9IH 4G7RB 1KWGA 4ALAH 3LMJL 2L7JA 1ZD6A 3EZ8A 3OV6A 4GMTL 4TSCH 5DUBA 2R4SL 5E8NA 4R4BB 5FC9A 4YPGB 5LBSH 5FO8A 5I71C 1HX0A 1N0LB 2NZ9D 2J5WA 3L3KB 3LNGA 2KDGA 4HJTA 1QMUA 1Z5LB 5INCB 3FO1B 1HKLL 4FG0A 4FXKB 3P4NB 5IK3A 2AVFA 3QFJB 1B2YA 3LH2L 4NJ9H 4GW5B 2FUTA 5AOKA 2TAAA 4K71B 5MEOB 5F3HB 5FA4B 3M1CA 2ZQKA 1ZXQA 1TYRA 2J56A 2OULB 3IE4A 5I17A 4K3DL 4V2BA 3VI3B 5KSVA 2P48B 1FAIL 4JRXB 4MD0B 2C3VA 3F8UB 4M8QA 2GBUA 2IBZX 2G75A 1B0RA 1XR8B 2CGZA 3CHRA 1GW0A 3EYQD 2BW4A 4WY7H 5CMAB 3UC0H 3QWRA 5JIPA 5KBKA 3ETBJ 1D6VL 2NX5E 4N25A 4DGIH 1YLBB 5GZND 4N3UA 5AOZA 5CIPA 3D48R 2JLPA 4OZ4A 4XX1G 2NSQA 4LVOB 3GMNA 3Q5TA 3V4VA 4ZYKA 4NCDA 2YEVB 3PWPA 4H1LA 4LSRH 1QEXA 1IC5L 2YBRB 2EDTA 15C8L 3WFHB 4F7MB 4Z77B 2Z1KA 4NN6C 1KEGL 4OZIE 4QTHB 2D7NA 1O5PA 5EOCL 3THMH 4LLQB 1NM4A 2AXJA 3PNRB 1F4WH 1UD5A 4IOSA 2YAPA 3PDOB 2I5YH 3U0PA 1WRFA 1GOGA 2OQJB 2OZ4L 1LE9B 3GTNA 1NGZB 3IJSB 3MRRA 2EIDA 2HAZA 1KJMB 3KPOA 3B7TA 2VLRE 2X4RA 4GXFA 1OXYA 2E4FA 4LHUA 4F15C 2QPEB 4PWIA 3IFLH 2BM3A 2PCFA 4P5TD 1T0MA 2X4NB 3SO3B 4JKLA 2O5YL 5E9DE 1RHHA 3DJRA 3TJHC 3TBVB 4KY1L 1JNLL 2HLFC 3LKPA 3B3BA 5EU7C 2UUDK 2P5EE 3T3MF 2IALB 5F70A 1B4JL 3FRUB 4XCNB 4TQIA 4LOVA 4H40A 4GUOA 1UH2A 4G8GB 3NK3A 3ZKSD 2E4TA 4Y4FB 4OLVH 2HKFL 4AIOA 4KKPA 4F3FA 5FR3A 1NBCA 5ADOH 1SN2A 3IBOA 3OKDA 2VDKL 3OKOA 1DQVA 4KHTL 4LPXA 5DR5H 5FGBC 1NWOA 4HUUB 5T5FA 1QLEB 1MCRA 1JPGB 2VO5A 4LOEA 2DL9A 1OP9A 3LQAC 4AKPA 2DYPD 3K6SB 1J12A 5D1ZA 3TBTB 2W94A 1EBAA 4UB0H 1DUYA 2WJ7A 4G5AA 4Q4IA 1WO2A 1HJCA 5I8EB 1R3IL 3LHPL 3T3PE 3IBEA 5B7FA 3DIVA 4MGXA 3CLWA 1KENL 3QI9C 2EE3A 4LNRA 1DVFD 5DHXB 5HHPB 4C4KO 2BHUA 1T5WA 4FNLH 4P9HH 2MCMA 2IBZY 2XN9B 2X4OA 4X5WA 4BE5A 2OJZL 3K6IA 5F1NB 2VDQB 3RDTC 3VXNB 2IPKA 1B0WA 4PRPB 1G7HB 1OSYA 3HHMA 5HYSG 4FXGB 4MNQA 1BF2A 1HHHB 4QO1A 3AT9A 3DPBB 1YNTB 5M95B 5BCAA 1E4KC 2V9QA 5GGTA 5BS0D 1EA9C 3CZNA 1KB3A 2G60H 2Z31A 3C2SA 4LDOB 4MMXA 3T0AA 3UG3A 5DK3A 3DX9B 3CH1A 4B7LA 1CT8B 2P1YA 3KYOB 2OK0H 4JZOB 2HWZL 4KZDH 5BQ7B 4FKHA 1T6VN 4E9YA 2COVD 1YDPA 3WAJA 4RZCA 3H9SA 4WU7A 3GWJA 1T03H 4PU2A 1MRFH 2A6IB 4A1RA 1FPTL 5I5JA 1G6RL 4PJ7A 1H3WM 1W72B 2PWFA 3U9UA 1TPXC 2DYSB 2QVFB 4TNFA 1TZHA 4UILH 3L3KA 2WUCH 5INCA 3FO1A 4FXKA 3RWDA 2OMNA 1INDL 1YMMD 4OZFH 1UM5H 3MLZH 1ERNA 2GB2A 4DKTA 4ZUUB 5LG6A 1I1YB 3VGGA 5FA4A 5H4YA 4XVJH 1JGDB 1CICB 3CDZA 5AOJA 1LD9B 4L29A 3BISA 4NQCB 3QHFH 3VI3A 1OGAE 3QIUC 2H2SD 1SN5A 3DMMB 4JRXA 3GIVB 4MD0A 4M6AA 1H3GA 1JZ4A 1ULVA 3B43A 1XR8A 4HS3B 1EH9A 3DUSB 4X8CA 2P5WE 1AGBB 2EKSA 3KNBA 4CAGA 4P2CG 1QHQA 2Y1ZA 4XN9A 5HYJE 2CIIA 1BEXA 3NVQA 1DR9A 5D5MF 3V0HA 5JOPE 3UTTB 5SWZB 4HSQA 2BVOB 2QADC 1ONQB 1UEMA 5DD5L 2UXFA 2DTSA 5LJYH 1HYSC 5E4IA 3M17B 1NGYB 3WFHA 1MQKL 2FJSA 3R06B 5E6SB 4ENEC 4L2YA 4JG1H 3B4NA 4M7LH 5C7XH 2EEBA 4QTHA 4WEEA 2E7HA 3QDJA 4LLQA 4CRPA 3ZE2E 5EO1A 5EN2A 2NUTB 1TUPA 3PDOA 2UY7B 2C3WA 1KGXA 1VGKB 3IJSA 1NGZA 1KMGA 4CC1A 1L9PA 1KJMA 2F74B 5F7YC 1CFVL 3CK0H 5CU5A 2JKRM 5D7LD 4IBYA 4CNIA 4IRJA 2VM4A 3RIFF 5AYUH 1QLRA 3H2WA 4HSCX 4W81A 2QSCH 1WWWX 1A6VL 1UZ8B 2ARJB 3KBFA 4GUCA 3ZT7A 3TBVA 4DW2L 2FEEL 4HFWB 3CMOH 3BAEL 4MBOA 3GDCA 2AMUA 2QGEA 2NTFB 3FRUA 4ELDA 1E30A 1V7NH 5TH2A 5DWUH 4G8GA 1VIWA 2O30A 3CV5A 3AADB 3GXTA 1JF6A 3HR5B 5SX5H 3LCYA 4X6CE 3WTUA 3GXFA 1JPGA 3OJMB 2VXVL 5DK0B 1R4XA 1BZ9B 1KJ2B 2VJ8A 1EFXD 2P47B 1FG9C 4FQXD 2EYRA 4HS8H 4KDTC 2CO3A 1XO8A 3VYOA 4E2OA 3GIZH 3CAFA 4EZJA 4PJ8B 5I8EA 2X0UA 2HVKB 5DJYB 5HGBB 4MMZB 4F7TA 3UAJC 2XU9A 4XC1H 1AQMA 2OJEB 3BJLA 4GMSL 4PI2A 4AKQA 2ZCKH 4C57C 3IGFA 1SOQA 1MHPL 4PS8A 4D94A 5CZXC 1AGCB 2AQPA 1DBAL 4GXUM 1HTYA 2X2UA 4ZMZA 1UXWB 1Y1DA 4FXGA 4P5MB 2XTJC 1HHHA 4KU1A 3P77A 1HWWA 4I77H 1YNTA 1A2YA 1HWGB 1MFCL 4UT6A 3RVVC 1XGZA 5MENB 3KCWA 2IV9A 1PU0A 1HEZB 1MVFA 4AVJA 2EH7L 1RCYA 1UQSB 3AM8C 2R23A 2X38A 4XHQA 5IFHL 3KYOA 3EH3B 5K5YA 4JZOA 5BQ7A 3MCG1 4N8CL 4MYPA 5DO2D 1AOZA 2D7TL 3H2QA 5LGYA 1F5WA 1TQCB 4JRLA 1V3MA 4FFYA 2A6IA 3UTPE 1RJLB 4F1SA 4ZO9A 1XH2A 3OPUA 4HV8A 3IETB 1LDPL 2F5BL 3LZQA 1ZA3B 4H2AA 2ZKHL 3MRFB 3RQ3A 4UUJB 1HH9B 4OCLC 2MQ0A 1MFBH 4PPTA 3GXIA 3ECVA 2FE0A 2IADA 1L6ZA 4U1GC 3HHSA 1AD0A 2CBOA 2G30A 4WJ5A 2PWDA 3UC2A 4H0LC 4WJG3 4LGSB 4NENA 1U4FA 4P3CL 3WCYA 3NQKA 4ZUUA 4MZ3A 4UTAA 3EFOB 3TEWA 4N87A 1A1MA 3WMSA 5CJQH 1CICA 2EO7A 1LD9A 4XWOC 5DRXA 3SDXF 3GBEA 3DMMA 1MDTA 2ZPKH 1FRGH 2G2RB 5TE7L 4DPBX 4OKVB 5F7EH 4XTRC 3S88H 5T1KD 4HS3A 4XGZB 5DD0L 4ZUTB 1ZLUH 3RUGA 2EINB 2WVSA 4JZNA 4ODXB 2AK4B 1NKRA 1JZ8A 3F64A 1KBVA 4BFRA 4PRHD 5E51A 3LXCA 1JZEA 1OANA 4PV8B 5IT2H 3UJJH 4APQD 2RAMA 3K46A 2UXTA 4X80L 2BVOA 2WINB 3SO5A 5CWSB 2NOYA 3M17A 1MWAL 4TL5A 3BZEB 3NAAH 5AZ2L 2Q0ZX 5ANME 1I8IB 4HQQL 3TU6A 2WNWA 3RZCB 5D7HA 3X17A 1RPUA 5LG1A 1ICTA 4JFDB 5E1AB 2WGNB 4CU7A 1QBML 4U1SA 5E6IA 3EOTL 1NGXA 1VGKA 2BP8B 5I5MA 3LB6C 1Q8MA 2ZYIA 5J13C 2F74A 1DEDA 4FQ1L 3H4HA 1TQSA 5IVXE 4S1RH 4OTXL 3V6ZB 2ZX5A 2JJSA 4TNGA 1INEL 1DVTA 3QDME 4Q7DA 3I9PA 5BV7C 2VGLM 1NEPA 3GMQA 5KYUA 1PFOA 2V3FA 5DC0A 1D7DA 2ARJA 2YD2A 1ML0A 1DFBL 2WQSA 4JO5A 1M3IA 1FORH 2DH3A 4XN5A 2XPZA 1NKOA 3ARDA 4XPTL 1H15B 2NTFA 3DA0A 5HJGA 4EI5B 3D6GA 4X42A 4LSVL 3UYOD 2VC2B 4ZFGH 4NQTA 5AW5B 3QZMA 2BCKA 1HZHL 2JKWA 2NQCA 3WJLC 4KI5D 4B6ZA 1M2VB 2ED8A 4K2UH 3U36B 1Q9WB 1E4WH 1S7TB 4PJGA 5DGQA 3K6DA 1OZTG 1U8NB 4HD9A 2JB6A 2GTWB 2OMVB 1BECA 5DK0A 3WNOA 3KMDA 4LARH 1BZ9A 3C6LA 2P80A 3NYKA 1E7VA 1KJ2A 1X5AA 3CIQA 3NJGA 4G7VH 2XICA 1NMAH 4ABQA 4JQXC 1G7JB 5F21B 4FQCL 2KH2B 4LRNH 4L8SA 4OGAD 4WW2B 4F9LC 5ALCH 4MMZA 3M1BA 5C9JA 2JKSA 1LHZA 4HEME 1BM3H 2FGWH 1C7SA 4IRSA 4ZAKD 5FYJD 1BP3B 1IGJA 5GS2H 3H0TB 3S0PA 1XWVA 4N2EA 5K39A 2XXCB 1II4E 4NQED 4I5BB 2OJ1A 3RU8H 1FYTD 4KROB 1MI5B 5CBAA 2VLKD 1UXWA 3MBWB 2KPNA 4P5MA 5KVEH 2YPVL 4HU8A 3D05A 3NN8A 3E8VA 1BVZA 5H37A 2VRQA 4ETYA 3F6LA 1A3ZA 1TU2B 2P52A 4N90D 3LEXB 4IM8A 4LDLB 5MENA 1HEZA 1E40A 5C3LD 3QUZB 3VD0A 2VDNH 3PV6B 2WXPA 2FJGB 1WEJL 2YD4A 3TT3L 2JJUA 2QHRH 2J20A 3KS0H 2APFA 4BELD 1CI3M 3GUTB 3CFJB 2EC8A 1IZJA 4U0QB 2EE2A 3GC3A 5I6PA 4DO4A 4JN2A 3RVXC 2FEEI 4QHNA 1RJLA 3BWSA 4H8PA 1W8EA 3IETA 4XCFL 2YPLE 1PZCA 3CQFA 1XX9C 1ODUA 3MRFA 4P2OB 1HH9A 1LO5B 4OZFG 1QYGL 1I9JL 2OR7A 2BSDA 2R59A 1G7MA 4WEUD 1TFHA 4H0IA 5EEXA 1SJVA 5J56B 43CAB 1YMME 4KNQA 3EFOA 4ZO6A 4JHWH 4B0MM 2IFFL 1T04A 5IB4B 5F0MB 5D1XE 1J8SA 2BSSB 3JYBA 4G8EB 1YQVL 4KXCA 4ANVA 1LTXA 2LVEA 4JRFA 4ONOA 1ANUA 3RWEA 3ILPA 2LLNA 2NQDA 5GISL 3G3LA 1RK0B 1VEMA 1TR7A 4Z0BL 3AC0A 4M03A 1U58B 1CGSL 2IWKA 3T0ED 3UGEA 4LCIH 3RG1C 3ZT5A 1VJSA 3QIBD 3BAXA 1K8DB 3S5ZA 1WWAX 4XB3A 4O58L 5F0PB 3PV7A 1WTLA 4RDQF 1K8IA 1UM4L 3MYJB 4HIJB 3FUEA 2MQCA 2CCLA 5C0FA 1HL4A 4Z7VB 3ZMEA 1FZKB 1QI5A 1G5GA 2Q2EB 5EIVA 3P0VH 5EULV 4PWKA 4OZHB 3VGAB 5CWSA 1C8QA 4PS3A 3G08B 3UP1A 2J1ZA 3C5ZD 3GMMB 4ZTEA 3D33A 3LPWA 4JW3A 1CGYA 4L3FA 2AXFB 3RZCA 3WD5L 3OXRB 4PJBA 2UWEA 3DVGA 3MRBB 4MTMA 1BBDH 1N8ZB 5E1AA 4NGHL 1P2CA 5JPMB 1E9OB 2DN7A 1TTUA 5D7KE 1A8JH 4J6RL 5DS1A 4MVBC 3NJHA 3LV3B 3MRGB 3U2IA 4EKXA 2EDDA 1K2DA 4I0PB 4JJ5B 2HJKA 3LIZA 1S8DB 4JQIL 2DI9A 3OKKA 3QORD 4PJAF 5LBSA 3V6ZA 4JUSA 5D7LE 2BOBB 4GO6B 4IOFC 3DI2B 1NC4B 2E76C 1R3HA 3IJHB 3RHWK 1KTRL 3KAAA 4LFHD 4MQTB 2DQFB 5TK4A 2ZOWA 5JA8B 5IOKA 1AFVL 3LZNA 3LXUX 2DLFL 1Y18A 3DBXB 4GAYB 4EI5A 1V3LA 5A2BA 3KL0A 3ZRSA 1JV5A 4J4PC 3EJYD 4DQOL 4XVTH 2NY5H 4JDTH 1WQVT 4R8WH 4OI8A 4D2NA 1Q9WA 2HJLA 1S7TA 1THCA 4LBEB 4PJCF 3NFPB 1L9TA 4UIKL 4PLKD 1U8NA 4ZMTA 4GP5B 2OMVA 3AREC 2J3SA 2WTOA 4U1MA 5IG7B 4ERSL 3QJTB 5HPMB 2BNQD 3VXME 4ABVA 4JO4H 1UUNA 4XWGH 3N42F 2Y6TE 1X5IA 4WW2A 4YHOL 1JGIA 2M1KA 3OR7B 1XB8A 3ES6B 5E8DL 3TA3C 4B0MB 2IAMB 3X12A 4CADB 3H56A 1F13A 3QP3A 2A5UA 1I7ZB 1U95B 2P44B 1JYNA 3HKFA 2FO1A 3R7QA 3AQZA 2YKLH 1LP9B 4Z3IA 1BQHG 2HTLC 2WP3T 3FOMA 5DEGA 1MW2A 2XQBH 1J05B 3D39E 3GI8H 4AQ1A 4U6HA 1TU2A 3JWOL 4U1JA 3FN3A 1R5VB 5LAXA 4EUPH 2NYZA 4OCSL 4WEBH 4R97C 3QUZA 3MJ8B 4MNHB 4YBLB 2D9QB 3PV6A 1WYJA 1A22B 1P1ZB 3CXDL 4N0UB 5AB1A 1USQA 2BNUB 4YDLC 2VDMH 3GUTA 2PETA 3MXVL 1IEBB 1OAUL 1ZAGA 1J1OH 4OCXH 1EVTC 5AOMA 4P99A 3BGFC 4KO9A 4NS0A 5CEXA 4M93B 5FYJL 1MPAH 3ZKXB 1UD4A 1HILB 1ZE3C 3OQ3B 5J6SA 3ULVD 3HAEA 4NHCH 2OR8A 4JDZB 3F7YA 1LO5A 5E94B 1WJ3A 1CGTA 5A2FA 4NZDA 3BWAB 5DI8B 4QJ4B 2AVGA 1D9KC 3SDDD 1G0XA 3QA3A 4QRPE 1GR7A 4HF5L 4APXB 1Z32X 4PWGA 5IB4A 4F8LA 3P3YA 1ZHLB 3H6AA 1TQBB 2BC4B 4BK5C 2HT2C 4W4OA 5E5RB 4GBXA 1PKQA 3QG6B 2FSEA 1RK0A 1U58A 4Q0XL 4WU5A 5EOTA 1ZDQA 4M62L 4AG4H 3V9CA 1K8DA 1E6JH 1TO4A 4U7SA 2WLHA 4HIJA 4PP1D 2BO0A 2KL6A 3MAWA 1FSKB 2FVNA 2VYRE 5DFVC 3W0WB 2BPBA 1QA9A 3MGTA 2Q3ZA 3QNYA 4GRLD 4PRHE 1FZKA 4MJIE 3T2NL 5INDB 3Q0HA 4YX2H 4V1DE 4XHJC 1GS7A 4OZHA 3TJPA 3LN5A 4JFVA 5TPWL 3VD3A 2NY6C 4OFPA 3MLUL 3QDHA 3GMMA 2WWNA 4CSZA 5JPNC 5KAQG 1LO2L 2BJML 2AXFA 1EAPB 1P4BH 4LASH 1MFNA 3OXRA 5DMJB 5H2BB 2XQYG 2D3VA 1I8KB 2B1HL 3BFQG 5JPMA 3UPRB 2VWEE 5C1MB 3SDCB 3LXAA 4MXQD 3FUJA 1KNOB 4Z7UF 5B39B 4GKLA 3MRGA 3VI4F 1GZPB 1Z2KA 3N85L 1DBBL 1S8DA 3I9GH 5FIEA 5CAYB 4ZOCA 4GXUN 2X12A 1I8MB 1Z66A 2G4GA 1NC4A 2OPCA 3VRJA 1ZSDB 4JS7A 1C12B 3DK2A 3AQXA 3G6AB 2MHAB 2VQ1B 4WKZB 4YDJB 5DMIH 4WI8A 1Z0MA 3ECBA 4XI5C 2DQFA 2EDYA 3ZOAA 4MX7A 3QUYD 2XA8H 3QXDA 4GAYA 3DBXA 2V7HB 1DBJL 2R0ZH 2B2XL 3P40A 2VXUL 3FSWA 4XVUD 3RRQA 1SUHA 4BYHA 2Q7NA 4ZO8A 2ORBH 4HCGA 3NEEA 4FLRA 4JKNA 4ZQTA 3SQBB 1FH5L 4KI5E 4R5VA 3LN9A 4FNSA 5D5ME 1CDGA 4YFLF 3EYQC 5IEHB 1BVNP 3QNFA 3D8MA 3COOA 2YLHA 5BMFL 3TZVD 4ONHB 1XIWD 3U7YL 4AXWA 1HFUA 4HEPG 2X3CA 1X5YA 1X44A 2XWBB 1RZKC 4HWBH 5GZNC 1C08A 4ZS7H 1JGLH 4IIQC 2E86A 3K81A 5C3TA 5CP7B 5DQ9B 2AJYL 3OR7A 1IC7H 4MB1A 3O11A 3UO1H 1CFQA 5JXAH 4O02L 5AW6B 4LVNC 2JCCB 2Q76A 2CE6A 3VWKD 4W6WB 4Y1TA 1CVRA 3NPSB 4KPHL 4G71B 1U95A 1QPPA 1B9ZA 3KYNA 1LO4L 5EU5B 5A2LH 2AJVH 3L95B 2CLRB 3BQUD 3WTSA 5EPMA 3HFMH 3VWJB 1YUHA 2VLJE 3V55A 1YY8B 1J05A 4RRPG 1XSOA 1EEQA 2ZUQC 1O7SA 1A8ZA 4X6DB 4PP2B 1SHSA 4JFYA 5AYQA 4MNHA 4JR9H 4OH2A 4PY8I 3BESR 3ASWA 1P1ZA 1CYWA 3HEIB 4HC1H 4RMBA 4N0UA 3KPMB 3LRHA 4HWNA 2AS5M 1ES0B 1OK0A 5I1DA 2UZXB 1N64L 5IVOA 1IEBA 3ZSSA 5LN8A 1PBYA 5C2BH 5I8OL 1ZLSH 3RWIB 2ALAA 3LHAA 3QEGH 5DMKA 1OP3K 5EF2A 3GSRB 5JW4M 4X6FB 3K72B 4HIEB 2OL3L 2NY1D 1HILA 1V7ML 4JDZA 4LKXA 4XZUA 2JQMA 5E94A 1DLFL 2WNKA 3OZ9L 3HRZC 5CINH 2VR6A 4FYQA 1G43A 2ICWJ 3ARFA 4X4YB 3PUCA 4TUKL 4APXA 3L3GB 4UNVA 3BP6B 4RBPK 3HI5H 4MA3B 4NO2B 1ZHLA 3V10A 1IFRA 1UCTA 3WN5C 2BC4A 5DRNA 4HKJB 3OJDB 3UBXG 3BPCB 1IGYA 2B5IC 5CJOH 4TRPL 5EG6C 3V4PH 1N2RA 2PTTB 3DO7B 2DWTA 4CW1B 5HD8D 1OF0A 1HEHC 3IFLL 3JZ7A 1VSCA 3QRGH 3GSWB 4HA1A 3TLRA 3BD4A 1N9PA 3BUBA 2AABH 5JQIB 2DBLH 3FK3A 4BWTA 1KIPA 2P5PA 3FBQA 4Z18A 4U1KB 5BRZB 3RNKB 1SXZA 4YE4L 2BP5M 2GJ6B 5GRJL 4KXAA 2DQGH 4NO0B 5I15H 1NCIA 2NR6D 4QAWA 1A0QH 5H94B 1H3XA 4FQLL 2ZAGA 1E67A 4L8BA 1KDIA 5E9AA 3QUKB 1CC3A 4PM1A 3VA6A 4NM8L 1UCBH 4Y4HB 3TTYA 1EAPA 4YQXL 3P73B 3LTVA 1A9EB 1ZJBA 3E2HC 1UT1A 3OM3B 5HDBF 1S5IL 2FWLB 3RVUC 4HIHA 2JMRA 4M5ZL 1HHJB 3MNWA 3INOA 4NQSA 2WXLA 4AEIH 3ENEA 3UPRA 4LRIC 3QC5X 3QAZB 2Y2TA 3FB7A 1KNOA 1C5DB 1QSEA 1TTCA 4U1NA 5KUMA 2MTPA 5B39A 3KPPA 3TBWB 2DI8A 3EH2A 3K8MA 3TJEL 1J5DA 3CSYB 3MACH 3APMA 1ACCA 3P9LA 4OCRH 4PJFB 3S4SG 4MWFA 1CDYA 1H6FA 3OVUB 3D0AA 2QKIC 1ZSDA 4YUEL 1C12A 1TNMA 2W5PA 4KXZH 2D31B 5IW3A 4EIBA 5I0VA 1YNKH 5BOPA 2L0DA 3SDXE 1C1EH 1NAMA 3GDBA 1ZEAH 2K3HA 5D1XC 3BKMH 2UV3A 5IR1B 4WWNA 3CUPB 2IXQA 1V10A 1RLBA 3B9KA 3K4ZA 2H2SC 4B96A 1N18A 5HVFB 2J1WA 4G6FD 3SQBA 1X4XA 4HIXL 4BINA 4WUKH 4Z7NE 5D7IB 2ZP8A 2OK0L 5F0JB 5B7EA 3SGJA 2GUYA 3MLSL 2LHAA 3TH3T 5DJXB 3AWEA 3AGWA 4BD4A 1OAQL 1DDTA 1X5KA 2BNQE 1MRFL 3MCKB 2Q7YB 4OCMC 1WK0A 3I6KA 1SHXA 1JZDC 3MV8D 3B2PA 4MZIA 4CVWA 1BWWA 1NCJA 5IW6A 3WTYA 3CQPA 1MAJA 1MCOL 1VLXA 3NCWA 4MA8L 5E1QA 1MCSA 1UZ6F 2JCCA 4MAYC 1HSAA 3V5KA 5I71B 1THAA 4R9HA 3KBEA 5I2IB 3A5VA 2XWCA 3MLZL 5EU5A 3QDGB 3QCUH 3S96A 3KYKH 1EX0A 4GY4A 1QVOB 3PWJB 3MRDB 4B7IA 3ABLB 2WXNA 4KJYA 4EUPG 4LLDA 5BUGA 1CD9B 1T4WA 5L88H 4E0RA 1N6VA 1KXVA 4L37A 3N0PB 3H53A 4PP2A 4DOHE 5I1HL 3SDAB 3ZDYB 3QJHA 2FYYB 4QRFA 3S4SB 3VX0A 5AB0A 4XPFH 4U6TA 1DQML 1XF4B 1SXSA 4GRMA 5EZPA 4JLRB 2UZXA 2EE6A 5E6RB 3E8UH 2HH0L 3GSRA 4RGND 5DJAB 1Q90A 3L5WB 3K72A 5E2WH 1IO4C 1K3ZA 1X5FA 2V6HA 2V3DA 2ZAIA 3MNMA 4PV1C 3EGXB 2WKLA 4WCYH 4HKZB 4DZ8B 5FYJU 1A21A 4FQJL 4BZ2A 4FTDA 2XWTA 4KUZH 2X6VA 5L8KB 1U8LA 3BP6A 4M1CD 3TVMD 3FO2B 3KPRE 2J5LC 2D7MA 2VXQL 2YOCA 3QR0A 4B9PA 5KBNC 2W81C 5F9AC 2DMCA 2X5PA 4V11A 1J87A 3BPCA 5GGQL 3WI9A 1WG3A 1NZRA 3DO7A 4GINA 4E41B 4CW1A 5EHFA 4K8RH 5CILH 1BZEA 3H54A 3TNMB 2GCYA 3P02A 4NFCA 4W9LC 2EXYD 3F58H 3GSWA 4XXWA 5E2UL 5K1NA 5JW5A 3QPKA 1G4RA 3EYUL 4L4TB 4X9FA 1VPOH 4M7KL 4URKA 2OMZB 2GYSA 4YSOA 2WOBA 2JF1A 3O3EA 5DS8B 1ADQH 2CDFB 4S2SA 3KL3A 3OJVC 2VMFA 3L5XH 5HHVH 4Y8AA 5H94A 5MEPB 2QDWA 4Z76B 3SBPA 4EUPB 3QJOA 4WV1C 1OT2A 1BGXH 1VERA 4FYSA 5IUSA 3T4AC 2W59A 3D12B 4UM8B 5SWSD 1QTYT 1RIHH 1JP5A 5I5IA 2VDMB 1QPXA 4Y1AA 1HHJA 5M94B 5E1IA 3S3PA 1KELH 2ZKXA 1KLGB 2CPUA 1EXUB 2BW5A 1AGDB 5I19L 1C5DA 3UXFA 4HETA 3C08L 2Y7OA 4UTBH 3UH8A 3AWGA 3TBWA 1NC2B 3BD3A 1ZK9A 4OV5A 4PJFA 2IH1B 3MOAL 4LSUH 4FA8A 1D5IH 5FM8A 5L9DH 5TDNB 3ECQA 3Q6FB 1O9VA 3CPLA 3QI9B 5KTEL 5E4AA 3GLDA 4P49A 1YCSA 4F80A 4AX3A 4IHOB 2O26U 3UTSE 2P43B 3QG7L 1I1FA 3Q6GL 4G6MH 5E0FA 3RDTB 5J1TC 5IR1A 3CUPA 3KJ6H 4TQPA 5EU3B 2D2CC 5FKAA 5EU4B 1GAFL 2F7QA 3ZE0E 1T1ZB 3IU4L 2VUKA 2PCYA 4YHPA 3RGVC 3ULUH 3O0LA 1RZFL 1T1YB 1AI1L 1KWKA 1RUQH 3F6JA 4MQSB 4ZMLA 1QTPA 1U4EA 2ZF9A 4NYLB 4OQTH 1JXGA 2Z93A 3EIFA 5DJXA 3G6JF 3U30B 2AJSH 3K5SA 3SGKA 4APQC 5JXEA 4PTTA 5FFGA 1A14L 1UD8A 1ZHBA 3ILQD 3BP7A 1DEEA 1T7YA 5HHXL 1QNIA 2NNCA 1U0QA 3LRKA 4HKBB 4XCYB 2DQCL 4YXHL 2UXVA 1TPXB 4B9GA 3FSAA 4H8HA 1MZYA 1DQJB 1MJ8L 2OS7A 3TN0B 1ZIBA 3TWCH 2X9ZA 2A77L 4UQIM 4KKQA 5HI5D 3AXIA 2IGFH 3PWJA 3MRDA 4NI3A 2VWEC 5B8CB 5DA4A 4FRWA 3K74B 4PJAE 1OAYH 4AV0A 2WW8A 2AI0H 4PY7A 3QIUB 3S88L 1ESOA 2B59B 5E5MA 5C0GA 2CIKB 4PFEA 2FYYA 2ZCHH 4PGBB 5BO0D 2NUPA 3X1BA 4I9WD 3ZRCC 5J9PB 2I60L 4UM9D 3EHBD 4JG0L 2VR4A 2FX9L 2YJLA 3U48A 5DJAA 3L5WA 1UKSA 2WXQA 3IKCA 1ZS2A 2YUWA 2NNRA 3VD2A 2DEWX 3U1PA 3EGXA 4X4XB 2ZXDA 5IGXH 4PJ9B 3KPLA 4PJCE 1F4YL 3S37H 2A6JB 2B15A 1AC6A 4KVPA 4KK6D 4MD4A 2X4QB 2YRLA 4KI5C 4JPIB 2X1PA 2OKMA 1JXDA 3KLSA 4KTEH 4OCWL 5E08L 1CBVH 3D85B 3FO2A 2V2TA 2XN1A 5D6DC 2GSMB 4LB8A 5C0BA 1JHKH 3K5RA 2EE9A 3SD5A 3NOIA 1DE4B 4GT0A 5DQJB 2VDPB 4DCQA 4E41A 4HUNB 5I76B 4S1RL 4JL2A 5CSZB 4DETA 3TNMA 1DDHB 4OGAC 2YZ8A 3Q2NA 1IAOB 1OPGL 4WFHD 5T8IA 2VR8A 3GM8A 1L0PA 2ZKYA 3ZN6A 2DQHH 2YD8A 1KDJA 4IBQA 1MVYA 5EO9A 1QI4A 4ZAKC 4HP5A 4HLEA 2DKSA 5DS8A 3N6YA 2CDFA 4G70B 3O4LA 2YAOA 4Q74A 5MEPA 4PB9L 3HE7C 2A38A 4GOSA 4LHJB 4XNMA 1JRHH 1S3RA 3RWFA 1BEYL 2ZXCA 1TKWB 2R0LH 2K6YA 5DZPA 3Q2LA 2I26N 5F1SA 3ZT6A 4HOMA 2O6CA 1E2ZA 2R0WL 3IFOB 5FGBA 1BA9A 4OI7A 3DPDA 1LYQA 4NPKA 3ZHNA 2EDJA 5I1IL 1ACYL 4PR5A 1EXUA 1YEHH 3NGBC 1AGDA 3D50A 4I18C 3O6FB 1NMAL 4JFFB 1GC1H 4NSKB 2C4FT 3F01A 4ABWA 2O61A 3KDPB 4PVNA 5CLZA 4WI2A 1DVXA 2MIZA 5ALCL 1T89C 2UX7A 3FBKA 2H1LM 1A9BA 1XSJA 1F3DJ 2IH1A 3TEUA 5KSAB 3I3BA 2YN5A 1FNGB 4TNWK 4S0TD 2Q8BL 2WQ8A 2MPAH 2WBJB 3QI9A 4R7LA 1QHOA 3BLBA 3VFNB 4IHOA 3HUJA 1W0WB 2C34A 2OAAA 4A55A 4Z7WA 5FUCE 3RDTA 3V4PB 4EIUA 5FYLH 4DVRL 2EACA 4LGPB 4G59C 4K5PA 3UTOA 2FK9A 4JRYE 3FUKA 1DCEA 2DKUA 2BXZA 2XIIA 1T1YA 5JW4N 1E4KA 3VXRA 1PX8A 2VDNL 2ZWZA 3GRWL 4PB0H 3SKMB 1K6QH 1PAZA 2IANA 3TT1L 3PPEA 4NNPL 4LMQE 5E23A 2K1MA 3KM1A 4D3CL 1VGEL 4GSUA 3PWPD 2HG5A 3L2MA 1QUNA 1CLOL 4W6XB 3ROLB 1T80A 3KH4A 5GPRA 1E8XA 2VJ0A 1GGUA 3MV8E 3VFOB 4XCYA 3LZFH 1Z6JT 4IOSD 4DP9X 2X41A 4MJ4A 2C9XA 4F27A 1EJ6A 4QRTB 4ORGB 3KR3H 1MIML 5CGBA 2EIMB 3VI4E 4LHUD 2A83B 1NMBL 3LNFA 4XMPL 3DECA 5C0IB 1OE2A 3TIDB 3L3OC 5GRVL 3WNJA 4AVIA 1R3KB 1YEJL 2J88H 2FT8A 4DHLA 2F53E 3P1VA 3QIUA 5AAWC 3MBXL 2EDMA 4MLIA 2IG2L 2B59A 5ITBH 3QORC 1A5FL 4POZD 2CIKA 3S34H 1OT1A 4WO4B 4HJ1A 1VFBB 2JKLA 3QPXL 1MJ7L 3DX4A 2IQ9H 3V8OA 4QI3A 1P5UB 2CLZA 3WO3B 3CVIL 4K3EL 3O2DL 3MFFB 1SHMA 5F7NC 4X4XA 5T3XL 1RZKH 5FHBH 4PJ5E 3TESA 3EJYC 4OFDA 1IE4A 2X40A 4R96B 5D1ZD 3MO1A 3N41B 2VE6B 4ODHH 3D85A 1CK0H 4TSAH 4PLKC 3CFBB 5DO8A 3NIFB 2Z91B 3ZZLA 4BH8B 3UX9B 4YNYB 4LSPH 2WQVA 2IFGA 2Y22A 3SOBL 3G9VA 4XPGH 3MRNA 4ZTPL 5EWIL 5DQJA 2WXJA 4AZUA 4DKAA 4WF7A 4ELMB 2P9RA 2KUTA 1DDHA 4AENB 5FECB 4JFPA 1RULL 1TJIH 5CD3A 1IAOA 4K0OA 2YBGA 4U1LA 1ZVSB 4GLRH 4PSRA 4FMKA 5KYYA 2DH2A 2DEYX 4L3CA 4MNQD 3MU3A 4JPVH 1EJ8A 2FBJH 4NKDB 3CLEL 3NJFA 2YAQA 5ESVB 2Z31D 4AJ0A 3MRIA 5ACLA 3LY6A 4AGMA 4NQQA 4TXVB 1CTOA 1T0PB 4OF3A 1TKWA 5TQ0L 4HC1A 3H9SD 3G5XB 3V0VB 3HMXA 4N0YL 2WIIA 5FGCE 4RQQB 1MHEA 2Z4QB 4NT6B 3H3BC 4NSKA 4XNYH 4KNTA 3N5AA 1MFEL 1IUZA 4P2QB 4KDTA 3ZYOA 3QFJD 4L0ZA 3TYFB 4ECNA 4Z7OF 1HIMH 3FCUB 2VIRA 3X13A 4KTYA 5AG9A 3UTQA 4E9VA 3UAJA 3OMIB 2WWOA 4L3EB 5B1CA 4OCYH 4ATWA 3OKMA 1P4IH 3W9DA 4W93A 4QY8A 4JO1L 5DVPA 5J6GB 4OB5H 4H8UA 3H8NA 1WCBA 2ZONA 1W0WA 4JRXD 2LU3A 4QXTA 4NRYB 1NFDF 3I74A 3SIKA 5I0ZA 5EOCJ 1X7QB 3QPQC 2MJWA 3WL9A 4A7SA 2EUZA 1QBLH 3ISWA 4JGNA 5L4IA 3KHQA 5FAAA 2CXGA 3LEYL 4FEMA 4FQIL 2Z92B 4AH2B 1MDAA 4O2FA 4LL4A 1KEMH 2FJFB 3K8KA 3AM8A 2WXRA 4E9WA 2O6PA 3DSFL 4PJEB 5I82A 3GNMH 3HCVA 5E9DB 1N5YL 1JWSA 4PP1C 3WFBL 2I07B 3LNHA 4N8VG 3N04A 4B60A 3T04D 2GTZB 2J6EA 2UYLB 3ROLA 4LPYA 4MJ6B 4M3HA 4A2FA 3KZ8A 4W70A 3VFOA 5L4JA 2CR0A 5AVVB 2IH3A 5C0EA 3UAEA 1AO7B 5KS9F 1KJVA 2PN5A 4DP2X 2GIMA 5DJ6A 4QRTA 1RSFA 1SNRA 2ENSA 5B3NA 2A83A 4FTVE 3BZFB 3CZGA 4JE4B 1DJYA 3FUHA 4HAGA 4IRJD 3WIIL 1TDQA 2NXZC 4HGKC 2OI9C 1IEHA 2F15A 4FZ8L 3GBLA 2F54A 3GSQA 4HPOH 4MXQC 4R4FH 1UH4A 2DM3A 5C0CB 5ICZB 4N2HA 4DK6A 4DP1X 3V4VL 2F1EA 3NEOA 4YSUA 1TIUA 3NESA 1B0GB 2ADJB 4PJDF 3UABA 4F91B 5GS0D 2PXYC 3CHXA 4JB9L 3WKQA 1RZJC 1CXHA 3E3QE 3PXJA 1SOSA 3HB3B 4JY5L 4QOKB 1TG8A 4G8GD 4WWOA 4Y5VB 5EUOB 3OBAA 2H0JA 5IBTL 1L5GB 1EHXA 3KPSB 3MFFA 1WGVA 1EHNA 3EBGA 5C0AA 2BSBA 4R0LC 4XVUC 5E7BA 4NERA 2ADIA 3L4VA 3L1GA 1YEFH 3V52L 1TVDA 4K23H 2I9TB 2X0WA 1XGTA 2VE6A 2YXMA 4OT1H 1U92B 4IKKA 4WENB 3CFBA 1IGCH 5DZJA 3AY2A 5J12B 3SODB 1AY1H 1WBYB 4LSSL 4HJSA 3MNZA 2ZNWA 2HZHA 5FYKD 5KVGH 4N8VB 1MJJA 4NWUL 3S8GB 1YSOA 2C9AA 5E99H 4ELMA 1UZ6E 3OG6B 1HZLA 4BA0A 1E4XL 2XN9D 4DP0X 5GSVB 4LZKA 1JZ6A 6PAZA 3VH8B 3BLKA 1JPFA 2DIEA 3PE9A 1JOIA 4XN2A 4UNUA 5JMRA 4PRPD 1HH6B 2VQ4A 5JHDE 3VGHA 3K6NA 5T33H 1IX2A 5DD3H 3VWKC 4S1DD 1JS4A 1NA8A 2JK5B 1Y7VA 3K2UL 3ZUCA 5T5FL 1JXFA 3RPIB 2ZOLB 3P69A 3D3VE 2ZG1A 5ESVA 2RCSL 1X6NA 3P30L 1SN0A 2X2YA 6FABH 3WO4C 2IPUK 3H9YA 1MAKA 4G8AC 3HG5A 1OGAB 3RA7L 3UOAB 5D7SH 4L9LC 3NCFB 1R5IB 2RJMA 3UBXI 3WJLA 3HA0A 2DD8L 3G5XA 5SX4H 4N8PA 1A6WH 2ADGB 4HAKA 1XXFC 3EDDA 5F71A 4OGYH 1DQLL 5CN2A 3B37A 4UNIA 4ZX6A 3EGDB 7FABH 2DQUL 4AOFA 1BLNA 4NT6A 2HXAA 2XBTA 4HWBL 2ID5A 5HYJB 2NX5A 3L6FA 3GSXA 1HXMB 1N7ML 3P0GB 2DQTL 3GSNH 4NZTL 2EXTA 4RFOL 4AWJC 4JQXA 4PWFA 2NY1C 3TYFA 4HZLA 4UDUA 1NDGB 1XCQB 4F9LA 3EUDA 4BRJA 2QR0A 5GGTL 4HXAH 1CICD 4GAJH 4HWZB 4UU9B 5DK2B 4JKMA 3RBSA 4U6YA 3FPYA 1BVKB 1W8OA 4NQCD 2E56A 3QT2A 2OCCB 3DMMD 4OZIA 3O4OC 4ZFZB 3BO8B 3LS4L 4NRYA 3WS3A 4K9EC 1AZNA 3RGBA 1EEYB 3A21A 3PFQA 3QS2A 4MNGB 3LD8C 1RJYA 1IAIL 1SQMA 2LV4A 5B38A 3KPQB 1VACB 4F2MB 1KFAL 2EIZB 3FSOA 4RFNC 2VLRA 2BDNH 2Z92A 4AH2A 1OCRB 2V37A 1FFOB 35C8H 5JDSA 3UTTD 3VFSA 4OBRA 5IVNA 2CO4A 2FJFA 4R97B 2WQUA 5SWZD 3MRLA 2BIPA 2OP4L 3QWOA 2B3RA 1DSWA 5E9DA 1AKJB 1ADQA 4X5LA 2I07A 1M6OB 2V33A 4YDLB 1L0XA 4U0RB 4X5QA 1FZOA 2WPGA 2D03H 2GTZA 2UYLA 2P5EA 1N5AA 4AEFA 3MLYH 1U3HB 3BGMA 4CSSA 2O5XL 4PEEA 1FVEA 4ZPVB 3BX7C 4OLWL 2AV7A 4ZFQA 3UAAA 1AO7A 1DHKA 3UROR 2QSVA 5E6ID 4HGMA 4X4KA 2WY3B 3AXHA 4ZMOA 2ICES 3MRPA 4X6CB 5F1OB 2PWEA 3RNQA 3BZFA 4G9FB 4LOUD 5EC1B 5CEZD 5IQ9A 3MLRL 4HBCH 1C5BL 3SKJH 1B90A 3W2DL 2EDFA 3R7RA 4JM0A 1AR1C 1EHKB 4JGMA 4CMMA 2GK0B 4JG9A 3N1QC 4J3OD 5JIHA 3PRZA 5T1DH 2ADFL 3ARDD 3EJJX 4E9QA 3U6XA 5HVHB 4BHUI 4DKFL 2ADJA 5JORA 4XVOA 4QOKA 5KZCB 5FUZH 4AMKL 4N4YB 4WEMB 3KPSA 5FUCC 1KLFA 4PRIE 2X4SB 1ZTXH 2R69A 5I1GH 4WHYG 4QWWC 2WYIA 3LJ3A 4DVBA 2NW3B 4J8RA 5ENWA 3IJYB 5ADPH 3C6LD 2I9TA 2P80D 4LKCB 3C2AH 3ESPA 3FB6A 5AYTA 2DL2A 3ATAA 5EO0B 2ZKWA 2WLNA 3G6JE 1SM3L 4PS4H 5EV7A 5I1KH 1S2EA 4BWUA 3CFCL 4HT1H 3UL4A 4O4YH 1OP3H 4EXKA 1FGVH 1WBYA 4C55A 4GNKB 2EKJA 3CVHH 1T5XB 2H41A 1OSPL 2X7LA 4IRSD 3BH8B 2NY3B 3S3JA 4BUQA 1MCNA 1UWXH 3TC9A 3IDUA 3NJNA 3BGAA 1NPJA 5GSVA 5AFAA 5C6TH 3QARA 2C1PA 5L2KE 5HGAA 3TFKC 4K55A 1XTLA 3BKCH 5ID0A 1OD7A 2JK5A 4LSQH 1DQTA 1F58H 1Y6MR 3B2UD 2ZOLA 5MEND 4NCC2 1R5WB 2MCG1 4FFWC 4M9OA 1E6OL 3DHJA 1AOHA 3CFKB 5EBWA 2XDHA 4N1CA 4XBEH 3B7RL 4IKJA 1U3JA 4MB5A 1OGAA 4HCRH 5IV2A 1A1NB 3L45A 2J1YA 2VUYA 4J4PA 5IMLB 1A4JA 3LN4B 1F2XK 4FGMA 1MLCB 5M7QA 2KZWA 3H9SE 1U8IA 4J39A 2P5WA 3CN4A 3PL6C 2X4PA 4NNYA 1AE6L 2A73B 3AREA 2APTA 3GBNL 3VXUB 5HYJA 1HXMA 4XMXA 2IDCA 3F7RA 4FLQA 3W57A 5DD1H 4F57H 5HP5A 2H0PA 2FHCA 3PGCB 4YC2B 1VCAA 1I1AB 3GMPB 2B1AL 3QFJE 4UYPA 1AGEB 1SYSA 5I1EL 3BSGA 1J0IA 1FE8L 3TA3A 3DX3A 4TOYL 4PJ6A 1CVSC 4AYID 1BVKA 5ANMB 2NQ3A 4LVNB 5LCVA 1CXKA 2V9TA 3KYKL 3IEAA 1OTSC 3HIZA 3VI3E 4OZGB 3OB8A 1R1CA 5LWYL 2JKIS 3EO1B 3GM0A 2BK8A 4ZBJA 1U93B 3MLXL 4U6XB 2VRKA 1YYML 4MNGA 5D93B 2OLDA 3CC5B 3OGOE 5TFSH 4KQ4L 2ITFA 3KPQA 3N43B 3LXBA 4IOIB 1VACA 4FFYL 2AK4D 3CZLA 4XNXH 3VSUA 2EIZA 4A63A 4Z7QF 4DGYL 3TOPA 3TCTA 2XXGA 3V0DA 1J7VR 1FFOA 3QRLA 4JANB 5DLMH 5FF6A 1KTDA 1RUMH 1UA6H 2EXYC 3MRQB 4HJUA 4UIMB 1E4XI 1S9WB 5GGRB 3UPCA 4F8PA 2WWMD 3N1GC 5FKPB 4A2MA 1QQDB 2AQNA 1AKJA 2BY2A 2MSPA 1M6OA 1GGBH 4O51B 4UTAL 4X99B 5FCSH 4DPCX 3RZCD 4L1HA 2A9BA 4CC4C 3DVNA 3BKJH 2WP3O 3AS2A 3MJ9A 3WKNA 4JFDD 2H6OA 3BEVA 5D1ZI 3O6KH 1CF8L 1T0NB 5F8RC 5HVGB 5FW6A 4KUZL 3QR2A 1D9KA 1I7TB 2CUMA 4X6CA 3CG8A 4DF9A 4PWHA 5I6XC 4D7PA 1LP9F 2EDQA 5EC1A 4JPWL 1T1XB 3B2MA 1NQBA 3I9IA 1ROCA 3WN5B 1T22B 3MZTA 4BK5A 2W60B 5TE6L 1CLCA 4OGXL 5LB1A 4ZW7A 4KDVA 2YK1L 1S9VB 4NO3B 1YA5A 1VPOL 3UDWC 3VXOA 3ZUNC 2XC8A 4EI5D 2OZNA 3M1OA 4ADJA 4JJHA 3TP4A 4M4PA 3T0XA 4ZTOH 5C0ND 2W9DH 5GGVH 3TBSA 1L9NA 1WPCA 5F3BB 2EDRA 1J1PL 4J1UA 3EJQA 1UFUA 3CC1A 1CCZA 4EI0A 4M8RA 4DEWA 3MRKB 5C71A 3IJYA 1IAII 5AUMB 2MCPL 5JOFB 5CEZL 5JPNA 1SVCP 3D4YA 1LMKA 5GHWL 5TDOB 5EO0A 1EMTL 3HG3A 2V7NA 4HX1A 3E2HB 2X1XR 3US0A 3WENA 3LZRA 5FLUA 1BIHA 4WWID 1JHTB 1T5XA 4XX1E 1YVLA 1HI6A 3LZOA 3BZ5A 2GG1A 3BH8A 4Y89A 2Y4SA 3OQRA 2PF6A 5FYKE 3KLAB 3T1FA 4XP4H 1HQRB 2XN9E 3WN6A 3A0OA 4KROD 1MI5D 5DJCA 4HAFA 4MS8D 4XCEA 5EDSA 1QFWL 4LHQB 4ZUSB 2QKIB 2VO8A 4PRPE 4YSRA 1H3PL 1AP2B 5HGHA 4K94L 4LLWB 3O81A 5ES4B 1F90H 4ZUVB 3CFKA 3QUZD 3O3AA 3D2UB 1KJ2L 5D1XB 2IDSA 4XNZC 2QPUA 2X9XA 1A1NA 3JWDL 2WVVA 3GTVA 1M6UA 5IMLA 1AJ7H 3EDFA 1OF2B 5E2TH 1JPTH 1MLCA 3W5MA 1BZQK 1YEIH 3ZKMC 3VD7A 2B08A 4I48B 4LAQH 1A6UH 3UBGA 4M43H 2QTEA 5TF0A 3E3QC 2F8XC 3O2WH 1J0YA 3EHBC 4GI6A 1N3NB 2R27A 5A16B 5K93A 3EYFB 4HG4J 3HBPA 3VGFA 3O9WB 2IQAA 2N1KA 5GZNA 3PGCA 1KGJA 3GMPA 4LU5H 4IIQA 3MPCA 4AYMC 2GT9B 1AGEA 1NGQH 2X2JA 4ZMXA 4BZYA 2YFNA 2X6CA 3C12A 3GHEH 2J2ZB 3H9HB 5ANMA 1K72A 2FO4B 4MAYB 1G5AA 4KK6C 2RH0A 4GBXD 3TGXA 4NQCE 4L8DA 2QGDA 5I30L 2Q1EA 3VE0B 1I3UA 2D3NA 1S7VB 1RIUH 4RGMC 1MN4A 1P5VB 5EOQL 3MGAA 1ZA6A 4IJTA 1F1GA 4F7EA 4MJ2A 1PLAA 3ZY7A 5B4MC 4HUWA 2UVEA 5IVXA 1XGPB 2P8LB 4FQ2H 5JHLA 4UIMA 3UMNA 3MRQA 3QDMA 1E2WA 3UTTE 5GGRA 3LQZB 1QQDA 4Q97A 2DTML 5SWZE 5CU9A 4F20A 1KF9B 5MP6L 2XTSA 3AW5A 1IILE 2VZ1A 2E6QA 2KQNA 4JM2B 2V2XB 1A47A 5IMOB 2DQ6A 4I4WB 4YBHA 3HLAB 3DTXA 3O8XC 4RGOL 4QD2E 4TTDD 1ORSB 3VAEA 1RUKH 3MR9B 4HPYL 4A39A 3CN1A 5KAQF 3Q5OA 4AL8H 3ZHLA 3HZKA 3HRZA 3KLDA 2VDLH 1YN7B 3B8YA 4TNVF 3FT4B 1I7TA 3Q3GB 1F11A 5F8QC 4PGDB 2PYFA 1PZUB 1CFBA 3LPFA 43C9A 2CHZA 3T6QC 1OHQA 3AB0B 1UOLA 2XPYA 3B5TA 2ZP0T 3QQ3B 2J5LB 5D72L 2YJQA 3WN5A 3PAYA 4FP8L 5T3ZL 1NC4D 2DM4A 4BFOA 2W60A 3VXMB 4DEUA 5AOIA 2J8OA 3W56A 3VM5A 2AQ3A 3G5YA 1HAUA 3C6SB 3FCTA 2O5ZL 1W6LA 3MROA 4ATTA 1N4XL 2G2PA 1Q1JL 1S9VA 1LILA 4NO3A 2DQHL 5CP3H 2GPZA 3QQ9D 4A2GA 4HG4K 3EKCA 4LVHC 4FI7A 1I8LC 1G9MC 3SGDI 4D9LH 3CFEB 2V17H 1TJHL 1DN2A 1XMEB 2CRYA 3CDYA 4HUMB 5F3BA 3H85A 2Y7QA 3RILA 3CSGA 4Z6AT 1MUJA 1AG0A 1T1WB 4N5UA 3D09A 4QXVA 4LESA 1UYWL 1T21B 2PYEB 3LIZL 1ZV5A 2X28A 2X3AA 5AUMA 2GK2A 1N6QH 5EZOL 1EHLH 4HJEA 2YD0A 3DSNA 4OQ1A 1WICA 2Y7MA 2GSIB 5TDOA 3OF6A 1D5RA 3QYMA 4M00A 3SE8H 2PPEA 1KIUB 3PF2A 4FERA 1C5CH 2BINA 3BSZH 3T3MB 2IAMD 1JGUL 1QRNB 4LRIA 3RL2B 5I73C 2DIJA 3LKSB 2DQEH 2P7TB 2A9MH 1IC4L 3CSBA 1CFTA 4GAGL 3OSVA 1HQRA 3VFRB 4AJWA 4DEPC 2YPLA 4M1GL 2VC2L 5LGHH 1TITA 4H13C 5KVFE 4L1DA 3FAWA 1FGNL 2QKIA 4G1MA 1KTKE 5CCHE 2V0AA 2R1XB 1PX4A 4I3GA 5IP4A 1YMMA 3PWLB 2XG4B 3FUNA 3O6ML 1J9SA 5D1XA 2G3ZA 3S37X 5EF3A 1KCSL 3HZMB 2ENJA 5K9QG 4OD1H 2WLLB 2B9BA 4PB0L 4WUUB 1OF2A 3BFOA 1K6QL 1G7PA 1F6AB 3L4YA 4I48A 4BFJA 1MSPA 2EE0A 3U7AA 3FS9A 1N3NA 4DP5X 5A16A 3EYFA 2Q10A 3TIEA 1WDAA 5FYKU 4EDWH 2CRMA 4HW6A 4QHKI 3WFZA 4MJIB 2MPVA 3IB4A 3ARFD 4YHKH 4BCXA 1E27B 2KYIA 1GPOH 1EJOH 2FEJA 3O6LH 2GT9A 3VNZA 4Y19B 1TJGL 4M61B 4OD2B 5I1JH 4NQXB 4Y2DC 5ILTL 2FO4A 5E9NA 4MAYA 1DO5A 2EDKA 1EDQA 3WHE1 1NCBL 4XPHL 2K4AA 4XO5A 2WLYA 1ZGLM 4N0FB 1AQ8A 1NJ9B 3VE0A 3IXAB 2WTPA 3CVHB 1PZBA 5C8JA 1IT9H 1P5VA 4ZX4A 4Q9QH 1IU1A 5CUSH 2YA2A 3D18B 3F12A 1XF2B 3PABA 3T0DA 1ZVHA 3PHOA 1DL7L 3BPNC 3V0GA 1N59A 2AK4E 3QJFB 1XGPA 1DQDL 2AKRB 2P8LA 1PW3A 4Y9GA 2FIRT 5C6PB 5D7LA 3H42L 3QXTA 3WBDA 1RI8A 4N86A 4MA7H 1IC0A 1KXQE 4IS6B 3SZKC 1YEGH 3NUKA 1PS3A 2VLMD 3BC9A 3O2VH 1SDYA 1QFWI 4NO5A 4TKWA 1WVZA 4KKLD 4I4WA 4J2XA 2FJHA 3HW7A 2J44A 3MUUA 4MDIB 2QLVB 1JGVL 4U1HA 2G3XA 3F62A 3QH3B 1G9NH 4U49A 4YE0A 4JFDE 1NFAA 3LZLA 3CU1A 4KUCF 3SDCD 3QRBA 3BN9C 2AJXL 3QZPA 4PGDA 1GS8A 4WGKA 1SEQL 1R34A 4D9QE 5D5MB 2EXWD 2N1TE 2XWDA 4FHBD 4A6YA 3PP3K 1EZSA 2C7UB 3AG1B 3FTUA 1PZ5A 4C83A 4K4KA 3VXMA 1HZKA 3SPJA 3NACL 4RISL 1Q38A 2EVJA 2EDEA 2BHYA 3B7UX 4TVPH 4U3SA 1JK9B 1I4FB 1MCEA 1LK2B 3IWVA 1D2PA 2XY1A 4BGDA 3A4DA 4K71C 1LEIB 4TULH 2PNDA 1NIDA 3NFSH 4X0KA 2DMKA 3I75A 1UM6L 4IMLA 4JPVL 3B9KD 3L9RB 3FONB 4NQUA 4ACPA 3IRPX 3CFEA 5JQHC 2PTUA 1YNLH 1K4DA 2GJPA 1JE6A 4B50A 2VW4A 1S7RB 1MOEA 1T1WA 2GJJA 3D39A 4M6ML 4WAFA 4H0HB 5EIIA 1T21A 2EJ1A 1J86A 1HWHB 3HE7B 4WV1A 3MN8A 5FHAL 2ENYA 4HXBL 4NHUA 5E95B 3T4AA 4LLUB 4OJFL 1BV8A 3AUVA 4YXKH 1T0OA 1KIUA 1NCAL 3ESUF 3IDGB 1DJIA 5DJ2A 3T5WA 4QT5B 4JFTA 3BT0A 3U6RB 4NP4L 3VFTB 4PJXB 3P4MB 1F3DH 5I66A 2A7BA 4P48A 3U7WL 3ML8A 1Q0EA 1KG0B 4H8WH 5FDWB 5CCGE 1G7LB 2EYTB 2X4UA 3CSFA 3FMGL 3VFRA 5IHZA 3KLQA 4UV7L 2IDTA 1P4IL 4F8QA 3KGUA 1F0LA 3I50H 3OB0H 4YHIA 1VFAA 1MI5E 4W4NA 5C0RH 4QRPA 4LEXL 2J25A 2WCGA 3EJZD 1TSHA 2Z1PA 3PWLA 4AT6B 2LTQC 2Q8AL 3OHMB 4UZUA 2QDVA 4X5XB 5DRWA 1TTFA 4XXDA 1P0SE 4UOJA 3SO3C 3I2CH 4AZ8A 3QZWA 3QULB 4KMTL 3WFEL 2VT0A 1IJ9A 2I27N 2WLLA 4GI8A 4FABH 1CWVA 4GAAA 4J3SA 3RGVA 4JFQB 2RR3A 1F6AA 1WD8A 2HKAA 1OGPA 2XVBA 2H6UA 3PQYE 1IGFH 5GS0C 1MLBB 3GKWH 4RLDA 2CGRH 2HX8A 1P9MC 4G80A 5L2JB 5IW1B 5A40E 4PRHA 4Y4FC 4MJIA 1MXGA 4IDLA 4V1DA 4KNUA 4APQA 1E27A 1EK3A 3BEWB 5I6KA 5F9JB 3TL5A 4ZMYA 3DURB 1P84J 1DBKH 4Y19A 1O6VA 1NGPL 2R51A 4OD2A 2EDOA 5FLVA 4FX5A 4JGJA 1G1YA 1GJWA 1ACXA 1NEZA 4A7QA 4N0FA 2R0KL 2JCWA 2XIDA 1EO8H 3NG5A 5EEUA 2AEOA 1U8MB 2X89D 4I2XE 2X42A 1BFSA 1MAMH 1ZWIA 5GS2D 2H1XA 4YHMH 3D18A 1KZQA 2D0HA 4P4KB 1ASOA 2R8SL 2GUOB 4J3TA 4FCHA 5BRZD 2AKRA 3NP3A 3HS8A 3FU5A 1OGTB 1DJHA 3HC0B 4IEFB 2GJ6D 4I0CC 4NO0D 2B8OT 4LCWB 2QMJA 4Z7VE 3FNKA 5F9OH 1FO0L 4OZHE 4RESB 2Z0UA 4S1DC 1ZJAA 2F58H 4MZRA 1B6DA 3E38A 4HUXB 4EDXB 7CGTA 4PHXA 2APSA 4U1IA 2PO6B 1KSRA 2IEPA 1LE5B 2BP0A 2WZAA 5BJTB 3KD4A 4KJPD 4ODSH 1BYPA 3MBEB 2YGQA 5FK9B 4OF8A 3P4OB 4XP6L 2AV1B 2FIKB 4P04A 4MASA 1BQLL 4ODTH 4F2EA 5D5MA 3NP4A 2H26B 3QQNA 1XGQA 4YL4A 4NRZA 3KWWB 4PGEB 1NTDA 2YWZA 5D6DA 5IEKB 2C7UA 12E8L 3JV4A 2DRUA 3JXAA 1WIPA 5JO5A 3GHPA 3LMJH 4KK8D 4GMTH 5D1QE 3WUWB 1YMHA 2AQSA 2R4SH 1NPUA 1JK9A 3GEWB 2DJSA 1LK2A 1OCZB 2FWOA 1HKLH 5GRXG 2CBPA 9CGTA 3LH2H 4WKXA 4MXVF 3RWHB 3ZDZB 1IBGL 1QEWB 4WGWB 4ZAKA 3E0GA 2CCWA 2D9CA 4KKAD 4M1DL 2HSIA 3N55A 1WLHA 2DIBA 4KKZA 4K3DH 1NIEA 4AYBA 1FAIH 4Z7QE 1P84K 4GO9A 4WTZG 2VLJA 3RVTC 1QFUL 1ZDSA 5B22A 1DSFL 3HE7A 4NCC1 4YSQA 1GOHA 2E5EA 2H8PA 1NCNA 4QKTA 3UP6A 5JXED 2OCFD 1TF4A 1D6VH 5GGRY 4BSVA 3DETD 1E5AA 1PSKL 3S5LG 4QT5A 1OCCB 4MQ7B 1IM9A 3VFTA 9PCYA 3Q2CA 1KN2L 1A3RL 1NAML 4X9IA 2ICWA 4I18A 1KG0A 4OU3A 1HDMA 1HE8A 2EYTA 5B1JC 1GHFL 1IC5H 2X6MA 3QCVH 5EF1A 1TVHA 15C8H 1KTLB 1ZGLA 1AIFA 3JTSB 1T89A 1LP9E 1U8PA 2YC1A 2X4TB 2EDBA 4X8JB 5EOCH 5DHYA 1YO4A 3T08A 1G0YR 3OKEA 2QVIA 4AT6A 1SFDA 3PREA 2NY0B 2OZ4H 3B34A 4CC0A 3D2TA 3SDAD 4FOMA 4N2MA 3FTWA 3FTSA 1ROWA 1MRDL 5FWRA 4PJ7F 5BOJA 4LPWA 2M26A 4JFQA 4WZ9A 3RWJA 2CGYA 4B5EA 2O5YH 5JLZB 3OKYA 4QHLB 3VXQB 4KY1H 1JNLH 1RZGB 3TS8A 1Z9SB 4EZLA 5IM7B 4QDGA 5LNGA 3W9EA 2C26A 3L3JA 4ORZC 2Z7YA 3JWOC 3BXNB 5IW1A 1PG7H 1D3CA 3QQXA 3I6GB 3E6FA 1B4JH 5ACMA 5FA3B 3QO1A 1QO3B 1DANT 1IBYA 3UIZA 3QBTB 5F9JA 4L5FL 4ODBD 2HKFH 1PIFA 1KIRB 4KX7A 4NQDE 4KHTH 2VDKH 1EIBA 2BRRL 5C0BD 3T4YB 4TUJB 3VFGL 2AK1L 3AG4B 4HKXB 1KN4L 3GSVB 1ZT1A 1HINL 3ZTDC 4M4RA 4GO8A 1NINA 1G1OA 2J21A 4E41D 2FNBA 1KBKA 4TVSa 4PJ8C 1URIA 1JUFB 1KGCD 1R3IH 3VFPB 2NXZB 2ZWKA 1DUZB 3L3OA 3LHPH 1J9RA 3N1MC 4GKOA 4ZDHB 3B7YA 4HIPA 1YPZF 5BNXD 3UZQA 1KENH 2YO3A 5HHMD 5AAWA 1QW9A 4GFXA 1OGTA 4UT9A 3QEUA 4I3SL 4IEFA 3W0WE 2EVIA 2HLFD 3NJKA 3QORA 2WWKO 5KW9H 3DUUA 3US9A 3WELA 2OJZH 5EDXA 4BZ2L 1RLWA 1PTZA 1QOKA 4L0YA 3B2UC 1CU4L 3SDXA 3UTSB 4HALA 4XP5L 2OMTA 5ETUA 1G1CA 3DUHA 1ZTXL 2OA9A 2VMJA 2X87A 3P9WB 3WU1A 1LE5A 3UZVA 4BSJA 1ZSHA 3ARGB 5DHVH 1KCRL 1KB5A 3UYRL 3KL5A 1O7VA 4UI2A 2FIKA 2HWZH 2BXYA 3FQUA 1AG6A 2H26A 1KBGL 3FT1A 4HS6B 3VGBA 4UQ2A 2QGBA 4FFZL 4H20L 4I1NB 1L9SA 3M86A 1FPTH 1A3LL 1BZ8A 2BOCA 3WUWA 4FNQA 2BNQA 5K59F 3QI9D 3BT2L 5E6ZA 4TUOA 1INDH 3B6SA 4KX8A 3FTZA 1F6FB 3RDTD 1FL5B 3RWHA 1BVNT 2ZXBA 4P4RB 4KDWA 1SDDA 3KGTA 3NJXA 4GKSA 2X3BA 3L3DA 3FQYA 2DQDL 4K7FB 5FO7B 4D8OA 2Y7LA 3IJ7A 1WF5A 3VXRD 1VESA 3BHBB 4IU3B 4QXUL 3ZE1F 1YJDL 1KY6A 1I8AA 5FCUL 2BZDA 4IQHA 4NEHB 5MERB 4BWWA 4OLXL 1JK8B 1A25A 4P05A 1R75A 5SX5K 4X6EA 2CD0A 1I31A 1WD9A 3N41F 1KYDA 2UZPA 3GB7B 4HGWB 4L9LB 4XP1L 1AIZA 1GYWA 3IXTA 3WJJC 2DJUA 3QC6X 3R4RA 4YHNB 1OW0C 2WWMC 2BNRE 5AALA 2YR3A 4OF6A 3LH9A 1F42A 1BVLB 3FCSB 3CU7A 1LO3L 1UENA 4K7PL 1NOAA 3HMWL 5LNEA 1EO7A 1KTLA 4K5OA 1MQKH 4N1EA 3JTSA 5JW3L 1SLXA 3RTLA 4PJCB 3PHSA 4P23B 4FG6C 2BY0A 3F84A 4X8JA 1E5ZA 2X4TA 3KEDA 4A66A 2JKXA 3C5SB 1KV7A 3L7EA 4ALAC 2E75C 3KCPB 3QIUD 3U46A 1DJWA 3KPRA 2WAQA 4PV9A 2JB5L 3N42B 4YZFF 5DQDL 4X6DE 1AMYA 1CFVH 2Z8VC 4TF4A 2FLMA 1NUDA 3SY0A 1T83C 2ZX6A 3LD8B 3ETBF 4Z3FA 4OFQA 2F61A 4PW3A 1FAKT 1BD2B 5DS2A 5HXMA 1A6VH 4RFNB 2FZ3A 1GGYA 2IH8A 3MKGA 1L4IA 3KPTA 4JFOB 4Q8BA 5F88A 5KJRL 1Z9SA 4LP5A 4TLUA 3TX4A 2HRGA 4B95C 3GJFH 3LSOA 1X4ZA 1AHKA 5FA3A 3WY2A 1W15A 4BQCA 1HYSD 5C0NC 2GSGA 4DO5A 2JJVA 3DX7B 1U36A 1MEXL 4ENED 4DFIA 3D85D 1KIRA 3U9WA 4S0HA 4U6VL 3IJ8A 1NBYA 2VDOB 2ZUTA 3T4YA 3RUGF 3OMNB 4XT1C 2VXVH 5IHLB 4E5XA 3GMOA 5I16A 4JPQA 4H0GA 5DJDA 3BSZA 5BPPA 5HPOA 1JUFA 1J5OL 5G4NA 5J7CC 1PDKA 3AS0A 2XETA 3S36L 4BE6A 2YUZA 4PW4A 1MJUL 5I1AA 1AR1B 3QB7C 2E46A 1ZLUK 1D6EA 5BRZE 1C8PA 3JBG7 1G94A 4QLWA 1DCLA 1QBAA 4Q6KA 4YDVB 2GJ6E 4MCYB 1S5HA 1VADB 3VU2A 4PW9A 1MHPH 3I02B 3CFMA 5KVEE 1WBZB 4HYTB 4N2IA 1UA3A 2G9HA 3EH5B 4XRCB 1FG2B 1AZRA 1DBAH 2AXHA 5J06A 4L8CB 2PXYA 1XDTT 3B1UA 3UTSA 1H5BB 1MFCH 5MHSE 4IHBA 2WN2A 3K8LA 5GJTL 1J88A 4CSTA 3WFCL 4W9CC 4R0LA 3JTTA 4OKDA 2EH7H 4JRYB 5IFHH 1HYRC 2QV2A 2M83A 2R2EB 5KSBF 1I7RB 3MNVB 3GINA 3JTBA 4N8CH 2G4EA 2HFTA 2CHWA 2KMWA 1ZT4B 4TNVK 2XQYK 2OSYA 3FU7A 1AXTL 1JZFA 4JM4L 3EFDL 3FU8A 3KS0J 5KSAD 4P2OC 1OQOA 1U2CA 2OMYA 4R7XA 2WANA 1LDPH 2F5BH 2WBJD 4NLAA 1XD0A 2ZKHH 3M6DA 3IJEB 4NRXB 3DLQR 4G1EA 1CGVA 3ABMB 3H1ZA 2GITA 2GJZB 3FKUS 3RKPA 3CFTA 2BSRA 5EIQA 2H2PC 4I9XA 3PHQB 4P3CH 5CZXD 1L0YA 3PDDA 1SLUA 3RL1B 1AKPA 3WKML 2Z4TA 2BIQA 3FO0L 2OMUA 2XTJD 5EUOF 1WS7A 4M5TA 3L4CA 4W9IC 3VWKA 3MV7B 5MEQB 3RVVD 4Z7UB 1HNGA 2W65B 3BHBA 2H4EA 4IU3A 4R84A 4HH9A 3ZU8A 2IOIA 3TV3L 3LQAL 1PIGA 1N8OE 4JY4B 4PJAA 2OMBA 3QZOA 5D7IE 2X1WL 5TE7H 1DJSA 2CDEA 4IBZA 4P9HC 1CPUA 5DD0H 3ME0B 2X6UA 1X5ZA 1WAAF 2F53B 3VGEA 1L7IH 4HGWA 4L9LA 3GB7A 1U8JB 4XBPB 4YDKL 5KBDA 4X4ME 1JHLL 4Y9FA 3T09A 2XFXB 3VGAC 5T3XE 4GKNA 4X80H 3VVWA 1J5CA 1J8HB 3QNZB 5A6MA 3S36X 1GGCL 3OGCB 1CD1B 5GQBA 2NYYC 4G42A 1MWAH 3QIWC 5CLWA 2DLGA 5BZDA 1P7HL 5AZ2H 1BQUA 4YDNA 5HJ3A 4GAFB 4HQQH 4KKBD 4RSVA 4KRNA 3QDGE 4PJCA 4TTDC 3O3UN 1DN0B 1RZ8B 1JV2B 3IF1B 4BDVA 1K5NB 3MRHB 1IQDA 2XVLA 3PUUA 1F4XL 5DZVA 1QBMH 4XWOD 3KCPA 4I0PC 3EOTH 2Z3FA 4CA4A 3FRPG 5EBLB 2Y5TB 4CVZA 3U4BL 4XTRD 4FQ1H 1Y1UA 3CFDA 3NABL 4WO4D 5ESQB 5D1QC 4OTXH 1F8TL 1INEH 8FABA 1HHIA 2ZX7A 1NCOA 1DFBH 3PAUA 1OB1A 1QWUA 3HC2A 1CDCA 5C0AD 1OKEA 2Q9OA 1TNNA 4XPTH 5EZJA 2CM6A 1W16A 3ML9A 1SGKA 4A7UA 1U6AL 3DRTB 3MXWL 4LSVH 1JFQL 3M7OA 2IOMA 3UYPB 1HZHH 2E9GA 2EYSB 3NMEA 3HI1B 3ZO0A 1SY6A 2GQHA 3SE3C 3IVKA 2VDLL 4Y2LA 2EICA 5BOZG 1FUNA 2V5MA 1W0VB 5JYLA 2ITDB 3DVIA 5LQBL 3K91A 2H47C 1PD1A 5IHHA 5GS3A 3ZVVA 4IIZA 2K78A 3TF7C 5K9QI 3REVB 1KGYE 1FYHB 4QTIL 3A6BL 3WNLA 1WH0A 4FQCH 5FGCB 4D0CB 4WNQB 2IAMC 4PRDB 4WJKB 4L4TE 4X7CC 2TRYA 3NH7L 6CGTA 4Z0XA 2VKWA 5DTFB 4PJBF 1D7BA 1AQKH 1WBZA 2UWEF 4EAEA 4N5EC 1QZNA 1FG2A 1WZMA 1X5MA 4PRNB 1U30A 1JPEA 3QWNA 4RMSA 2V17L 2YPVH 4JDVA 4WWKB 1H9VA 5D70L 5TGBB 3AGVA 3FRPB 3AU1B 1UGNA 2Z0BA 2HLAA 2VDPL 3GEFA 2BWIA 4JRYA 2R2EA 2PP7A 2X44D 3MNVA 4EN3C 1WEJH 3TT3H 4NPYA 3JWNH 4ODVL 5F89B 2EDLA 3F7PC 4M93C 4XOCA 3UEQA 3UTZA 4Z5RB 2NY2C 3JUZA 4TQ8A 3WJMA 3V95A 1E90A 4YSTA 2R15A 5EUKB 3SN6N 2HX7A 5F1IB 2DQEL 5GGVY 4L3ED 2F2HA 5DSCB 4WI9A 4XCFH 2ZCLL 3IE9A 2VDKB 1QYGH 4A38A 1I9JH 1JXJA 1J18A 3OLGA 1IEAB 4N0RA 5IKCA 3U2SB 1QNZL 4XMZA 4QGTA 5HDBB 3E7JA 3RL1A 2IFFH 3ZR5A 3JV6A 3HMXL 1EERB 3MV7A 3IGUA 1YQVH 3ORJA 2VLRD 2XT1B 1E50A 3VI4A 1LNUB 1EXGA 3B3IB 3D69A 4OFVA 4EI6A 2VISB 3ZQ9A 4DP4X 1JI1A 3LVTA 1XAKA 4Z0BH 4MAZA 1CGSH 5E9DD 1BFOB 2F53A 3NEXA 1ETA1 1S7WA 4O58H 1U8JA 2AXGB 1UM4H 4PH8A 2MWCA 2DV6A 5DF0A 5KN5A 1PL3A 3BQVA 3WSQL 4DN3L 2WAHA 2Y3AA 1DLHA 3QNZA 3PL6A 1INQB 1OAZL 3DYPA 1CD1A 1AO7D 4YHKL 2L7QA 4WFED 2ILLA 2H32B 2Z8RA 4G6JL 2W0FA 5DHVB 1MKFA 4WNJA 2B7DT 4FI8A 3WD5H 4Q2ZA 5KYXA 2O72A 4X7DC 2YPKB 1A3QA 1Q9OB 4OIFA 4MMYB 4PJ5A 1JV2A 4KVCL 1EVUA 3SYPA 3SDCC 1K5NA 2HT4C 3MRHA 4LGRB 2VH5L 4NGHH 1BG1A 1PEZA 5C0CD 2QSQA 3T6WA 4RDBA 2ZOKB 5HY9A 5E5LA 4J6RH 4FXLA 2HJFB 2HTKC 5EBLA 4ZS6D 1D5MB 2Y5TA 1G6RB 1QD0A 3TF4A 5ISZB 3QAQA 1RH8A 2N7BA 4ZFFB 4UDTA 4JQIH 3NA9L 2D3LA 2NY7L 1KFGA 3S35L 4IRZL 4MXVE 3PCYA 4NUMA 4QOKD 3VXTB 3BP5A 5LGKA 4CU8A 4N2OA 3EW3B 4FYRA 1M7UA 3KPSD 2OXHB 3FQNA 3MJWA 5GJSL 3ULUD 3ALWA 2C7FA 3L4ZA 4YO0B 1NCCL 1DZBA 5LBGA 1P6AB 1GIGL 2K6WA 3DRTA 1A4CA 3V0IA 2X1OA 4Y5XB 2DLFH 3VTMA 3ESNA 5IJVA 2NNFA 2UZYA 4M6NL 3EDKA 3VXSB 4DQOH 2BIOA 4WI0A 1HQ4B 4CC4A 1TTBA 3GSOB 3O8XB 4QHMB 5TD4A 4UIKH 5DVOA 1W0VA 1J9TA 2ITDA 4FAAB 3IMVA 3MRJA 2BVQB 3C8KB 3LRGA 1SJXA 1W2KT 4DP6X 4ERSH 32C2A 4MVBD 3IDNA 5JOEA 5GGSB 4B41A 3ZYJA 4YBQC 4HJGB 2BSCA 4FCAA 4GH7B 5FOBA 2X6AA 4D0CA 2OBGA 4WNQA 3GS4A 4PRDA 1OM3L 4YHOH 5EA0L 1Y6KR 1E9QA 4IOFD 5I8CB 3SKOB 5E8DH 3PP4L 4KX9A 1XB6A