1IB5A

X-ray 3d structure of p.leiognathi cu,zn sod mutant w83y
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
151
structure length
151
Chain Sequence
QDLTVKMTDLQTGKPVGTIELSQNKYGVVFIPELADLTPGMHGFHIHQNGSCASSEKDGKVVLGGAAGGHYDPEHTNKHGFPYTDDNHKGDLPALFVSANGLATNPVLAPRLTLKELKGHAIMIHAGGDNHSDMPKALGGGGARVACGVIQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Single mutations at the subunit interface modulate copper reactivity in Photobacterium leiognathi Cu,Zn superoxide dismutase.
pubmed doi rcsb
source organism Photobacterium leiognathi
molecule tags Oxidoreductase
molecule keywords CU,ZN SUPEROXIDE DISMUTASE
total genus 33
structure length 151
sequence length 151
ec nomenclature ec 1.15.1.1: Superoxide dismutase.
pdb deposition date 2001-03-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00080 Sod_Cu Copper/zinc superoxide dismutase (SODC)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.200 Mainly Beta Sandwich Immunoglobulin-like Superoxide dismutase, copper/zinc binding domain 1ib5A00
1OZTG 1MFMA 3GZPA 3H2PA 2WWNA 3GQFA 4MCNA 1L3NA 1HL5A 3QQDA 1IBBA 4N3UA 1AZVA 1SXCA 2Z7ZA 2WWOA 2NNXA 5KBLA 1PTZA 5CU9A 3F7LA 2AQSA 1FUNA 2VR8A 2ZKWA 2ZKXA 2C9SA 3L9YA 1JCVA 1P1VA 3QQDB 2Z7UA 2AQQA 2WYZA 4OJAA 1SXSA 2K4WA 2SODB 2XJKA 1S4IA 4BCYA 1QUPA 2GBTA 2JLPA 3MKGA 1UXLA 3CQPA 1HL4A 3ECWA 2C9UA 1YAIA 1E9QA 1YAZA 3PU7A 1XTLA 1TO4A 4MCMA 1TO5A 3GZOA 3CQQA 3MNDA 3KH3A 1B4LA 1SDYA 4OH2A 2AQPA 1SXZA 3GTVA 1N18A 1E9OB 1JK9A 2AQRA 1SXNA 2VR6A 1Z9PA 2Q2LA 1F1DA 1Q0EA 2E46A 3KBEA 2JCWA 1IB5A 1B4TA 3ECUA 2AF2A 3RE0A 2R27A 1U3NA 4B3EA 1XSOA 3F7KA 3KH4A 3KM2A 1SPDA 4A7SA 1UXMA 1KMGA 1DO5A 1E9PA 1OZUA 1E9PB 1F18A 2AQNA 3GTTA 2GBUA 3H2QA 4U4IA 1IBHA 2V0AA 4BD4A 2Z7WA 5KBMA 3HFFA 1N19A 2ZOWA 1OALA 4A7UA 1SRDA 1RK7A 2VR7A 1EQWA 4A7GA 2WZ5A 1F1AA 1COBA 4L05A 5KBKA 3SODB 3KBFA 1PU0A 3K91A 4A7QA 1YSOA 3CE1A 1OEZW 4A7GF 1CB4A 1JK9B 3GZQA 1E9OA 4N3TA 3LTVA 2C9VA 4A7TA 1DSWA 2WYTA 1SDAB 4A7VA 2Z7YA 3T5WA 2AEOA 2LU5A 1SOSA 2AQTA 1IBDA 2WKOA 1BA9A 1IBFA 2XJLA 2WZ6A 3KM1A 3S0PA 1SXBA 1E9QB 1F1GA 2E47A 3HOGA 1SXAA 1CBJA 3ECVA 3HW7A 3L9EA 1Z9NA 1PZSA 2WZ0A 2ZKYA 1BZOA 4BCZA 1ESOA 2GBVA 1XTMA 1EJ8A 4FF9A 2APSA 1OAJA 2WKOF
chains in the Genus database with same CATH superfamily
3ARBD 3TV8A 3HI5L 1HILA 1NCWL 2OMTB 5F3BA 4FQPA 4FI7A 1G1KA 3MNZB 3ZHDA 3HC3L 1KDIA 3EG9A 1A47A 4FQXB 2OMVA 5KBNC 2D8KA 1BOGB 1JGIA 4Y5XC 4L29B 1U8LB 3P30H 1F11A 3KMDA 4XNQA 2R2HA 1OARH 2OXHB 5BJTB 3K4DA 4YSRA 1C08A 1QBBA 1KULA 3N1FC 2QVMA 4AM0Q 3ZMRA 2BFGA 1A21A 3VFVB 5D1QB 1OGAD 1S78D 1A6ZA 1F45A 2WP3T 3BDYL 1BHGA 1JZ4A 4ZPTB 4E9WA 5JHBA 2I9TA 3GBDA 1PGRB 3ARBB 1DBBH 3BSGA 3D34A 4KITB 3EYQC 4R6UA 2BY3A 2UV3A 4Y2DD 4PQXA 1A0QH 3CFCH 4GY4A 4WO4B 3B9VA 4G80B 2KERA 2YFOA 3LSOA 4HZ1A 2HP4A 3ULSA 4N8VG 5I76A 1AZBA 1VADA 1DVXA 4POUB 1U95B 2TRYA 2F58L 1CIUA 4NQVB 3HMXH 2HTKD 4IBWA 2XG5B 2CO6B 3W5NA 4XVUD 3PDDA 2IPKB 2ZCHL 5KAQG 1X5HA 1R17A 3H7BA 1UZ8A 5AW1B 3WMPA 4U33A 2Q7AA 3QFJE 5HYQB 3PS6A 1V3KA 4PTTA 1OT2A 3UG4A 2UZIL 4B96A 2E76C 1KNOA 4N85A 3L3JA 1H0DB 1TQBB 1L5GB 1PMYA 1G1CA 5FB8B 2H4EA 4D0DB 1B0RA 1CU4H 1U91B 2DQEH 3T1WA 5AZ2H 4UUJB 3MRKB 4UQAA 5CCKL 2QPUA 1I1FB 1WTGT 2QADD 1K8DA 4ISVA 4Z0XB 4AKQA 2V2TB 3MV8D 3UABA 5KVEE 1CR9H 1U8OB 1VZGA 3MUGB 3K2MC 1N67A 2IAMA 2ILLA 2XKNB 5DI8B 1I82A 1MIEH 5IB2B 1C7SA 3RFZB 3GLEA 3F7YA 2RBLA 3A4AA 4IIQA 2VNCA 3QWOA 2ZYSA 1ZPLA 2IDUA 3CVIH 5DSCA 1DR9A 3I84A 4DEPB 3MV11 1K4CA 2BHYA 4NZTL 3UJJH 1L0PA 2MNUA 2QL1A 3CLFH 4HCRL 5C09A 3LVTA 4LPWA 4UMGA 4E0RA 2B9AA 1MIMH 2GJZB 3VSTA 3DMMD 3UMNA 2ENQA 4OJFH 4ZUWA 4L4VD 1S5HB 3C87A 3ME0B 3RVWC 2DQDH 3HE7B 3RHWK 3TN0D 3W0WE 4J6RL 4ACTA 1YDPB 4NGHH 5A16A 2Y5EA 1KEGH 3HLKA 4PP1D 3IFLL 4BFNA 3MBWA 3R8BB 2OBGA 2BZCA 3RJOA 2G4EA 1XMEB 1ZMYA 3A21A 3KDMB 1MLBA 2E7CA 2XJKA 4GRWH 4DT2A 2B4CH 3KBHE 3WS3B 4ZFQA 5CJXA 3WELA 5DK3A 1UG9A 2DQDL 1EWHA 5JIKA 4HUXA 1L4IA 4EDXB 4AIOA 3H9SE 3MJ9L 3O4LE 5I8EA 4F7PB 2O5ZH 2KDYA 3B2VL 2CMRH 3OV6A 1JHLL 4X98A 3UAJC 2P24A 2IH9A 3L7FA 3UTQB 4BUHA 4YDMA 5F96H 4Z3EA 5DK0A 4BXSV 1DUZA 1F02I 3FQXA 1DUYB 1QFHA 1BBDL 3VX0A 1GOFA 1UACL 3OXRA 5D6CB 1BQLH 5FKAA 3EHBC 1JG9A 1MJJA 4G6AC 4NM4L 2GK0A 5DFVD 3HC0B 3EZJB 4LEXL 1CDJA 1B4TA 1XCTA 4QEGA 1OOAA 1F3JA 2DWXA 2PXYB 3FT0A 2C9AA 3LQAC 2ED8A 3R1GH 1TTBA 3BP4B 4IIQC 1AP2B 3KM2A 2C1PB 5GS0L 1UJ3B 4AE0A 3PQYB 1TSHA 3FQWB 1KTLA 1GS7A 3RDTA 3HZVB 3EFDL 3WUWB 1UXSA 1QZNA 2BS9A 1EEYB 1U8IA 2WB7A 3HFFA 4X9BA 4JGNA 3APDA 2Z6FA 3QS2A 3VFWB 5HDWA 3S5YA 4POYA 1C5DA 3GMNB 3VRIB 1NIBA 1DQJB 4FI6A 1GOGA 4AYDC 5J9PB 4G42B 2X4RA 3K1DA 2E27L 3U4BL 4ZUSA 4XVTL 2MMXA 1S2EA 4HD5A 4NC2B 5C08E 4TULL 3U6XS 4FI8A 4IU2B 1P1ZB 4K5NA 1BEYH 2D3NA 2X1PA 4LSSH 1G7MA 1TVDA 1J10A 1BQ5A 2P80A 4RETB 3FFCE 5I6PA 4E42B 4YHMH 2X6VA 3FT1A 4ERSH 2LU5A 1D7FA 4GRLD 5I6MA 4N2LA 5E24E 2IPTL 1R6VA 4TSAL 3UL4A 4PREB 2BVQB 4ZT1A 3VD9A 5EBMB 1OP5K 3TZVB 2VN6A 4G43B 4NYLA 3DURB 3BVWA 4OZHB 1TZGL 3DSNA 4XMZA 1TU2A 2FSDA 4E9QA 5J6GB 2NY0C 4AXWA 2J3SA 1IAIH 2CH8A 4MX7A 1XCWA 5JXEA 3LRSB 3UYRL 4ANUA 3F7LA 5GS1C 1WS8A 1A5FL 4X4ZA 4G9FB 1ZLEA 4Q4IA 3NN8A 4NXKA 1JHTA 2IVFC 2CHZA 5GIRB 4EVNB 5FKPA 3T6QC 3II3A 3MV9D 2WO2B 3HPLB 1BOYA 3NIFE 1AO7B 3H9ZA 2BSTB 2PCPB 1YO4A 1R19A 1GW0A 3U0TB 2XETA 4FP8L 3SN6N 3CV5A 1OGAE 3ECWA 5DJXA 3NIFB 4EF3A 2JKLA 4MNGA 5I6XC 3V5KA 4ZFZA 5AD0B 1SM3H 1AD0A 4G8GD 1ZLVH 5LG6A 1HTYA 2O5NA 2FBJH 4PS8A 1ILUA 1T20A 3NRQA 4NZRL 1VGEH 5L9DH 1AXSB 5F0LB 4PJ7F 3NPSC 4JRXB 5E7FA 2LFGA 1U3HC 1E5CA 3EO1B 1D5RA 1YY8A 1VLXA 3CVHB 5EUOE 4MJ5A 2CIIB 2EACA 3MXWH 3AWEA 1BVKA 1KCBA 1T21A 1SXNA 1UM6H 1KJVA 3SBQA 4MRCA 3PDOA 1FL6B 4XX1E 5AW6B 3IJ8A 3O6LL 4Z76B 4R7NB 4LLQA 1IGTB 4RGNC 1SY6L 2HN7A 2UY7A 1GRWA 2A74C 3L1FA 3DROA 5KVFH 1E9PA 1I3RA 2P5WE 5D71L 1C5BH 2X9YA 2R0LH 3TWCL 1MNUL 3VJ6B 1JWMA 4AYFA 5EF3A 4JN1H 4NDMA 2FJHB 3ZYIA 3PPEA 4JDZA 3ESOA 4GMSH 1E5UI 1CICB 2A6IB 3NSCA 4F9LA 4U1NA 4P57A 4AK1A 1IGCL 5DS1A 4HH8A 5H94B 4JPWL 3Q2CA 5IT2L 2XWJB 3NJHA 4DQOH 4OJFL 4GOSA 4JL1A 3ZO0A 4QY8B 4GAYA 2MOGA 1FBIH 4V11A 3V9CA 3IJ9A 3D52A 4DKTA 3G7TA 1E2VA 1NKRA 1OP3K 2EO7A 3LPOA 1ZOXA 1LP9A 1KXHA 1RZJC 1E4KA 4UBDC 3QUXD 4F37K 2J56A 4PJEF 1CYGA 3DX1A 5I73B 2DEYX 2ZOUA 1R47A 1IZKA 5ESAA 3G6JE 3RHWF 4XI5D 1QFWH 1W9XA 1BQHG 2H6UA 3N44F 4ALAC 3U7YH 1WK0A 3PWJA 1K6QL 1WZ1L 2ZAGA 4LOEA 2Z4QB 1TSRA 1HL8A 3V0WH 3RVTD 4NO2B 4M7KH 2K3TA 5ADOH 2FYYB 3VXPA 1Q0XH 4NUMA 2QTEA 5JZ7D 4JN2A 5ESVB 4PJAE 3QEQB 3R0NA 1RZJL 5DJZB 4HIJB 4Q2ZA 4WI4A 4IKIA 5MP6H 3S34H 1CVRA 2EIKB 1ZWIA 3UTSB 2EH7H 4WUKL 3U36B 2WKLA 3TJPA 1PCSA 3BZ4A 3QZWB 3IGFA 4S1SH 1S78C 5FW7A 3NFNA 5SWQB 2EDFA 1YAZA 3DHUA 2YD2A 4FLOA 4P2RA 5CLTA 2XKUA 2WSDA 4YPJA 3WDIA 1N59B 2X6CA 3FFDA 4S2SB 3PJSB 2ARJA 2EXTA 3SYPA 1YNTA 3KL5A 4QTIH 3DYPA 3AQDA 2APXA 4ZMNA 1IZJA 1S7QA 4QRFA 2GIMA 1BD2D 4DH2A 2C3GA 2CZNA 1AKJB 2IANA 5LN8A 1NFDF 1M6UA 1RIUH 3BSZA 4PRPA 5BZDA 15C8L 5C0BE 2XBDA 2LVEA 1QVOB 3RWGA 4YHLL 1KPVB 1RIHH 1KIPA 3OBAA 1UXWA 2V17L 2C8NA 4GKNB 3SDXF 1D9KD 3L1OH 3Q48A 4HKJB 2NLJB 4X8GA 5CBEB 2XNAB 3KLAB 3SKOA 3MLYL 5D2LB 4F7EB 3A6BH 1EO5A 4EDWH 2FL5B 1CO1A 4KK9C 1A1MA 3BC9A 3PWUA 3HBPA 2FGWH 3RZCB 1HH9A 4X2UA 1ZE3H 2UUDH 5EA0L 5SWSE 4OF8A 4IDJH 3QC6X 2WLLA 4IEFA 4ODXA 4JX0A 5C08A 4UV4H 2EKJA 5I17A 1IBHA 1J8RA 1RJLA 2NPLX 2OR9H 1MFAL 1BQLL 2R7EB 1CT8A 2DB8A 2G75A 3RDTC 5DHVA 4LEXH 5EN2A 1JPEA 2YKLL 3CZSA 4FG2A 4AJWA 1R3LB 1ACYL 3IB4A 5DLLA 3HMWH 2YGOA 3ELQA 5TF0A 1YC8A 2UVFA 3CXFA 4PRHB 4OV6F 1K8IB 1U8KA 2WWKT 4KNUA 5F7KC 3FRPA 2Z3FA 1QFWM 3OKEA 1TVBB 3GUTA 2H32B 1WE5A 4KQ3L 4XO8A 2PR9A 2CNZA 2GUOA 3PHQA 3ZRSA 1CGTA 4JQIH 4ODUA 1GMEA 5D72H 2MNWA 2NY3B 3FH7A 1PLCA 4HIIA 2J4WH 2X1XR 5AB2A 2B59B 1PQZB 2CCVA 1QQDB 3UFIA 5J11C 5KYXB 4NNYA 4ICXA 3U4BH 4F7MB 5TE4H 1NCTA 3WIHL 3FCTA 2QZQA 4HD9A 1NLBH 1GY1A 3N42F 3QJXA 2EDNA 2JJTC 1OO2A 2VLJA 3VXMB 1T0NA 1G7QB 5IIEA 1DVTA 1FYTD 1YY9D 4H5SA 2VXVL 1RLBA 3EH2A 3ERXA 1R3JA 2OSYA 4LSQH 2VDMB 1LNUA 2K9FB 3MRLB 3Q8FA 3HHMA 4D94A 1NFDA 1FG2A 3MRBA 3JVGC 5CKGA 3SE8L 3TYFB 2IPTH 4YHNA 1WEJH 1VGKA 2LV4A 4YC2C 5SV4A 1W91A 3IN0A 4Y4KD 3CHRA 4CVZA 4PBWD 2YQBA 5GPRA 2VDMH 4MD4B 1HCFX 2JELL 1S7UA 2XFGB 3VG9C 4JFFB 1FVCB 1FN4B 2IFFL 3KYOA 3LKRA 3P73B 4E36A 1EJOH 4QRBA 3HI1A 2OW7A 1AGDB 1IEBA 1PLBA 2IADA 1OCWH 2R15A 3LX9A 1CTOA 1XGQA 2VWEC 1UB6A 1M3IA 2QLVB 4M5ZL 1B0GB 4UQBA 3BP5B 1JDAA 3JVFC 4ZUUA 5C08D 2BOCA 5HGBA 2QVIA 4HAKA 1YNKL 4IS6B 2QDVA 4TVPE 1BIIA 4UU9A 3WFBH 5BV7L 1G6RL 4GUQA 1NM9A 1IKOP 3WS6C 4EOWH 5HYSA 2HRGA 4OLYH 4ZW8A 1YZZA 2P5WD 1P0SE 5D7JB 1IKFL 3NIDF 2P42B 4L1SA 4V1DB 5AYUH 5HHQA 3T0ED 1HCYA 1LEKA 1R5VB 1FFQA 1HH6A 4FQIH 3K72B 3LZQA 4FD0A 2VJXA 3BAXA 1IFHH 4M43L 2ITFA 4MSWA 3UCRA 5J11B 3FHEA 1ODUA 2PTUA 3A24A 1F90L 4GQPH 1I8KB 4U6HA 3TVMC 4UT6A 5E2TH 1A1NA 1CK0H 2GSGB 1OAQL 4BKTC 2Y1YA 3KVDD 4JAMA 3B1TA 4M1GH 5T1MB 1IAIM 1NC2A 3ILDA 4PJDF 4HW6A 3FO0L 2A99A 4OCYH 3BT0A 3RTQD 1KB3A 2B77A 3S3PA 4NN7B 3WAKA 3DPBA 3CFKA 1T03H 1O7VA 5CZVL 4Y5XA 3T0EB 1JYWA 5DWPA 2VQUA 4L3CB 4OAWA 3MVSA 4Q56A 3V0WL 2ESVB 3QPXH 1LDSA 2CLZB 1Z5YD 2BDNL 2YKKA 5I8KH 1KBGL 1J87A 5IKCB 3P02A 2XKSA 4CBPA 4Z7AA 4NCDA 2HT2C 4MNQE 3F6IA 2E59A 3MXVL 4AG4H 5DMJB 3GSRA 3N41B 3PWVA 3DDFA 1LWJA 3GSWA 4EZJA 1QHQA 2W59A 4WV1B 4OZHE 3S9DB 1Z3GH 2OMYA 1OSEA 2OMWB 3G5WA 2PXYC 4PRDA 1AQDA 5FA3B 4Z7NB 1S9VA 4PGBB 5J56B 1QX1A 2QVFB 4NHUB 2W0PA 1BXVA 3BAYA 3EADA 1P9MC 3ARUA 5KVDH 4TVUA 2W9LA 4YDZA 1QABA 3HG1B 1J5CA 2J6WA 3L45A 5IM7B 5F89A 3S3SA 3VXNB 2BY1A 2YJQA 1OCOB 1KCLA 4PJ7E 4Y89A 5T5NG 2YD1A 5E6IC 3VFTA 3HZKB 5E6UB 1BAFH 3JT2A 5AW0B 1NBVL 1TTGA 2GQHA 4K9EC 1XB8A 2ZOOA 3H0TA 1WCBA 4UIKH 1W0WB 2HPTA 2P5WA 4FYQA 7FABL 3PP3K 3RI5F 3DX9B 1BMWA 5E95B 4YC2B 5GRUL 5J6HA 1H6FA 2YPLB 3BAJA 2KT6A 3SOTA 3GI8H 3MU3A 5GGUA 3AY4C 4AGMA 4JHWH 4RNRB 1S3KH 2A9CA 2JH2A 4N2OA 4PG2A 4GXUM 2EVHA 3ILPB 1UZGA 2WCGA 4ONHB 1U8PA 1OF2A 4UOW1 1V27A 2C9PA 3KPLB 2DTSA 1FI8C 1N6UA 2G2RA 1X9RA 3MJ7A 5IQ7L 3P2BA 1FZOA 3GGWA 2IO5A 1FNSL 2YMOA 4CBZA 3TXAA 4FC3E 3D0LA 3QWRA 2L3BA 1QBML 3WHXA 3O9WC 4G1EB 3B5GA 4EQ3A 3VH8G 5IOPB 5B39A 3B9KC 3KBFA 4FQJH 3LMJH 1SHMA 2BP0A 1BFSA 2L0DA 1P7KB 4QXUL 4QYAA 5D7JC 3REWB 2OL3L 4XAKE 5GGRY 5KW9L 3T0WA 1SBSL 2PWFA 3AGWA 1KOAA 1ZXQA 4Z0BH 3CK0H 1UURA 4A66A 3ZE0F 5ID0A 4OCRL 1T04A 4NRYA 2WHVA 5DYFA 1P2CB 3UTTB 3QPKA 3DV6A 1VFBA 3AU0A 5BO1L 2X4OB 2CRYA 3MV7A 3ZDZF 5CBAA 4MJID 3C2AL 4OFYD 3S0PA 4BFKA 3D18B 4FFYL 5KSAA 1QW9A 3T2OA 1FIEA 2X05A 1SHXA 4HKBB 1DCLA 3MLWL 1WISA 1NAMB 4QXTA 3C09B 3MRNB 4J8QA 3HN5A 4U1MB 4PY8J 4K73A 5KVMC 1DVYA 4JFEA 3SE4A 3VXSE 1X7SA 2NW3A 1U8CA 2P26A 3QXDB 2GKIA 4IBQA 2P5ED 2X4QA 1LE5A 4HZLB 3KYMA 4U6YA 4RAUB 4LNVA 1FIGL 4UDTA 5MI0B 1HNGA 1G6VK 2K4AA 3P4NA 3BLBA 5DS2A 5GS2H 3NZUA 1E4XL 3MLUH 1JIBA 1XAKA 4ZAKA 4DW2H 2IOMA 3OLEA 2V3DA 3A6CL 3GC3A 5DJAA 2HFEA 4I3GA 4WW2C 2X12A 5AENA 1NLBL 5DU7A 3Q3GA 3UYPA 3NPSB 2ZWKA 1KV3A 1E43A 2HA1A 5SWSD 5CLXA 1BFOA 4JVWA 5B3JF 4LDEB 4OLZH 3DJZA 3G5VB 3QIUD 5IEHB 2ZSVB 3C60B 4FQLL 5G4OA 3G6DL 1W8OA 4OZIE 2EIEA 3QJFB 5DRXB 1G4RA 2ZSWA 4DW2L 4FTVB 1VEPA 2H0FA 5L8JB 2NY4D 5IW6B 4QTHA 2OK0L 3NFPB 3VGHA 3LEXB 2VLRA 1Z32X 4QO1B 5A7BA 2IFFH 4R5TA 4HAFA 2AF2A 4ZQTA 3DOIA 4ALAH 3FOMB 4FKHA 4L2LA 1Z5LA 4MMXB 4WWID 4OCYL 2MWCA 3QHFH 1FGVL 4U1SA 5J6SA 4CC0A 1GGBL 3K5SA 4GRWB 3AT0A 4N9OB 5H35B 1RZKH 1PKQE 2R23A 5GRVK 5AAPA 4Z3JA 2JVUA 3LZFH 2FNBA 2N56A 3P0YH 5EOQH 5CLYA 5I1CL 3QDJB 4JRXD 1LD9A 1B4JL 1FRGH 3OZKA 5EEWA 1WAEA 1PAMA 4IOFC 3P4LA 1KB9J 2ATKA 5ERWA 3RVUD 3DIFA 1PZBA 1WZMA 1E9OA 1KC5L 1K4DB 1MG3C 2YGVA 3VB8A 1GGCH 4U3SA 4UM9D 2VXQH 3C9NB 2CO7B 2I5YH 1SVZA 4EZLA 1G6RB 4PCKA 3K8KA 5IK3A 1TEGA 4BIKA 4I85A 4LO9A 2FJFB 1FVDA 4EIZC 2XQYG 2SEBA 2EVGA 3NP4A 3L3HA 2MHAA 4PJAB 2Y07H 3SBWA 1WGVA 4PP2A 3MRIB 4QRRD 1XIWA 2VDPB 4FRWA 4HIEA 5FWRA 2WQAA 3DRTB 2B20A 3JYBA 5B1BB 3TP4A 1M7IA 3AMKA 3MODH 1ETZB 1K9TA 2GC4C 3ATBA 5DRWA 2B5IB 4F58L 2XYBA 2WIIA 4LASL 3K6SA 2Q5BA 1PCXA 3N2JA 4N3UA 4NRZB 5DXWA 4E68A 3TL5A 4YDKH 1QLEB 2BY0A 3TA3C 1ZE3C 3WNJA 2CMRL 3B2VH 1ZLSL 1KCUL 1LM8V 1MIEL 2JLLA 1JGLH 2H3XC 3W9DA 1J8SA 4PJCA 5I6OA 1OAYL 2BCKB 1QLRB 5F0PB 3RP1A 1FO0H 1HJBC 2VOTA 1ZGLP 4PY8I 5A2FA 2ALAA 2IMMA 1ZD6A 2OM5A 4G6FB 4WI7A 2C7UA 1L9SA 4GRWF 2WLYA 3KYNB 1WGOA 2EINB 4XPTH 3K6IA 1XVSA 4XX1G 3UZQB 1JNHB 3T2NH 2H2PD 3A67L 3Q8AA 3MCKA 1ETB1 4YHYC 1HAWA 4GW5A 4ABVA 4XX5A 4HWZB 1PF3A 3GMPA 4JO8A 5FV1L 1S7WB 4JFUA 4R7DB 2P48B 4TVPH 5HI5D 1KLFA 4NPJA 3V4UH 4XPFH 5GJSH 4DKDC 3SJVA 5LGYA 5IB1B 2LAAA 4CNIB 4F20A 2VMDA 4M7JL 3SIKA 1CLZL 3D39B 4B5ZA 1TZIB 4KI5C 4G8GA 4I5BB 2VDOL 4UIMB 4OKDA 1CE1H 2JI3A 1LDPH 1YNTF 3V6ZB 5BZWB 2WAHA 2AAAA 2XWZA 3CMGA 5AEAA 3W2DH 3FUDA 1I4FA 1JCKA 1KXVA 4U7MA 2BIOA 5CUSH 5F6HI 3V9FA 4IM8A 3NBNA 2Y0SA 5GZNA 2YD6A 4E41E 2OL3A 2PW1B 3OMAB 5KSUA 4BD4A 5KN5A 1IL1B 2A6DA 1G9HA 2IAMD 1M42A 1MELA 3I6GB 4GXVH 3VFSB 4A7UA 1M1XA 4P4RA 3P3RA 3RY6A 5D4IA 1AGCB 4K7FA 4X6BA 3KLHC 1MXDA 3X12B 4OLWH 4QXVA 5JORA 4LPYA 3A6BL 1EZVY 4HJGA 2JB5L 4Z7QE 5JMRA 2E9BA 5ACZA 4RA3A 1J1OH 3AU1B 1CC3A 3IBOA 5I26A 1UEMA 4Y5VA 2YAEA 6TAAA 2ZOLB 4BSVB 2A6KB 3HAEB 4HXBL 2PO6C 5AW5B 1W72L 2GAZB 4KK8D 5L4MA 2VDLB 5KANG 2JB6A 2NY3C 3GHPA 1M57B 3BP6B 3L17A 3V6FA 1NBYB 3KCWA 3ZO9A 1BZEA 2QKIC 4EJ1C 5FS5A 1CURA 3BXNA 4DEUA 1ZANL 4PJEA 1IE5A 4YN3A 3OLGA 3CC5B 4AGOA 4ZMVA 2FNWA 2AABH 4MJ4A 4C8XA 3IKCB 4N20A 1RZGB 3TBYB 3U48A 1KXTA 3M07A 4UYPA 5C07A 3RNKA 4QKTA 1XDTT 1HE8A 2VM3A 4PJ6A 4JR9L 4GQQA 3SKJL 5IROA 4OLXH 3ARTA 1C12A 1PZDA 3STZA 2OMUB 1MFDH 2JF1A 3BKYH 3ZIYA 1DBKL 43CAB 1DL7L 4JM0A 5FR3A 5IESH 1P7QA 3EJUA 2WXLA 3NJIA 3KD4A 3S5LA 1I9RL 3DRQA 3MV8B 3B2MA 3RAJH 4M6NH 4ZPVB 4QYOA 3BGMA 4GAAA 2RFXB 4AEHH 5C9JB 2H32H 2P47B 2R0WL 5F0JB 5IB3A 4BFBD 2IBGA 3ASNB 4JG1H 3IMWA 4KTDH 4FQCL 4XWOC 4OLXL 2DQJL 3BE1H 5E99L 4U0RB 3F83A 4L8CB 1YEFH 2D7OA 4LVHC 1UEYA 2FT7A 2ZF8A 4XNBA 1M7DB 2ZPKH 1WFMA 1SQ2N 1E8ZA 1HQ4B 2JELH 1MZYA 1BQHA 5FEBA 1UWEL 4JRYD 3TPUA 1EHLH 1QHPA 4UBDD 3DUSA 4YL4A 1JZ6A 1P53A 4BRVA 4FJZA 1SJXA 3RVVC 4M1GL 1NMBH 3RVUC 2HLAA 5I6XB 1JDCA 3FN3A 1PZ5B 3MLXH 1H3TA 4NKMB 5D7LD 5FOBB 2F18A 1FGNH 1DJGA 1MCBA 2NX5E 3TCLA 3D12B 1JAEA 2QADB 3VWJB 1CYXA 1TZHB 3O3BA 4WFHD 2A73B 3SCMB 1S7SA 3RL1A 4IRSD 1KIRA 2DD8H 2VUOA 3FO2A 3ULVH 3GSQA 2Y07L 1OAUL 4N1CA 4Y4FD 3LQMA 4GRLA 2B9BA 5DK2B 3GIZH 1JFHA 3FB8B 4MD5B 1ZLUK 1AZUA 5HDLA 3FSVA 3WY1A 3H3BC 2P5EE 2EYSB 4WW1A 2AQ1A 4K71B 5FX3A 5JIPA 4AOFA 2YA0A 1GGBH 1FAIL 1MCFA 3GBMH 4XN9A 5L7XL 1NMCC 4I8DA 3BWUF 1OP5H 4QWWC 3BKJL 4ZFOA 4BH7A 4HV8A 5DD1H 4PRAB 4J3OC 3VU1A 1DQKA 2J8HA 2UUDK 5DA0B 5JXED 2E7LA 5TQ0H 3HCVA 1QSFB 2FT8A 3RB7A 1LK2A 3FB6B 4JB9H 2XDHA 3S5ZA 4YS4A 3FTXA 5J3HD 3CLWA 4P9HL 1QWUA 5F7DB 1FV1A 1KIUA 3ES6B 1DVFC 5A43C 1DEEA 1KTBA 3CUPB 4JFDD 3L54A 4LVNB 4GEIA 3V7AE 5IP4A 5DUBB 3CZFA 1OGAB 2AHIA 3EXLA 1FVEB 3EYOB 1NFIA 3NZHL 1CDBA 3PIQA 3G04B 3JT0A 4Z7VF 3BT2L 2NUTA 1Z2KA 3ZTJH 4D8PB 5F97E 1E3XA 1NGXA 4FNLH 2D3JA 2TSBA 2ORBH 2D0FA 5CWSA 1KJ2B 2NRDA 3G6JB 1QI4A 3BPNB 1T5WB 3WFEL 1PZAA 2N7BA 2V7HB 4JRYA 2AV7A 4I0CC 4UT6L 1L9TA 3SB3A 2FJGA 2I07A 3ZHKA 3FUKA 4HULB 3OKKB 4FDWA 3UACA 3Q6GH 3THMH 3Q1EA 5CJ5A 3IS1X 2NTFB 4K5MA 4Q9QL 4PBXA 4PYHA 4G8AC 1Z9PA 4NQDB 2EYTB 5F44A 1ZGLB 5EZIL 1BVNT 2ZX8A 4P46C 4LHQB 1JF1B 1G7LB 2R4SH 2MCPH 4LSTH 4OFPA 1NMCB 32C2B 3S3DB 1IM9B 2AP2A 4OTXH 4P2QA 3VCLB 2QGDA 4Z7QB 2VM4A 1I8UA 5MERA 1EK3A 4PJGE 1H3WM 4I0PC 1KTKE 1XH1A 1BGXH 3HLAB 4R4FH 3PGDB 4GFTB 3C5XA 1RUKH 4B3VA 5HI4D 1JZDC 4XNYL 3TBSA 4X6DE 4YHLH 3WJLC 3QUYC 5C0FB 4H7VA 3B83A 3L1OL 1BREA 5GS3A 1V8HA 1H6UA 1ZANH 3IKKA 3OG6B 3QBTB 3CBRA 3ASWA 4KZCA 1MREL 4FXGC 1SBBA 1DLFH 1U21A 2XQBH 3CX2A 4HG4K 1VEMA 1GY2A 2BH0A 4DFIA 5E6IA 4N5UA 3X2QB 1KCKA 2X1QA 3I6SA 5HJGA 2R69H 3MNWB 5HYFA 1ZS8A 1ORSA 4OV5A 3T4YB 1Z6JT 4Y9EA 1JV2A 3ECVA 5JPMA 1UD6A 3CVHL 2N0KA 2BP8A 2P8LB 2Q86A 2ZUUA 3K7UA 4LRNL 4DK6A 1LYQA 1N4XL 2VJ0A 5EIQA 4CUCA 2PP7A 3MRRB 1LL1A 1M2VB 3EF4A 3H2PA 3NSDA 4J4PA 2GIXA 4PGEB 3ZKMC 5C0IA 5KYUB 4PWIA 4WKZB 3HNVH 4PCTA 1PJ9A 3OKOB 3ABMB 4F9PC 1ZAGA 4Q89A 1EFQA 1MCQA 2ZKXA 3DYOA 3IMRA 2XI9A 5E1GA 4H2AA 1JTOA 2V5TA 3AFLA 4HUWB 3ARGA 3DETD 3UBXB 3OX8A 4YFLI 4YWGL 4B0MB 3H55A 4X7EC 4BCYA 3BAIA 1KENL 3V8CA 2X40A 4GIPD 2CR3A 3HS8A 4W9ZA 4JS7A 2V4LA 2EKSA 2ZYIA 4PMFA 1X5KA 4ZNCD 4PB9L 5I1JH 3C75A 1PY0A 2WMPA 3CDFA 1CTNA 2EEDA 1F86A 3VD3A 1KLGB 2BNUA 2FQEA 3GHEL 3T4AA 2Y5QA 4RAVA 3WEXB 3VSQA 4TLKA 4JY6B 3IRCA 4PUBL 4TSCL 2J72A 4N2FA 2V3EA 2AQRA 1J0IA 2EDXA 1KENH 1LO4L 4JFFE 2VXUH 4BKLB 3FU7B 3F01A 3WKMH 2PXYD 4FXGB 5GGQL 2CK2A 3EJTA 4B5EA 5E08L 4KOBA 4JPSA 2E6JA 2JSFA 2AVGA 3WMSA 1AD9B 4CU6A 5KAQF 3ROLA 2MTAA 3GS0A 2WXNA 1CLYL 2NY4B 3Q43A 1QI3A 4LZKA 4N0FB 4N8VA 4A37A 4AJYV 4ETQB 5CNHA 1A2YA 1ITBB 5F7YC 4KC3B 4L9LA 5IVXB 1F4AA 3FUMA 3MRGA 1IVLA 4R5VA 1AJ7L 2BDNH 2XXFA 4DPBX 3EYVB 2ZX5A 4KTEH 1TTAA 2IGLA 1T83C 5TK4A 5DHYA 4ZFOL 1G94A 2NXZC 4FCHA 3ARDD 1YSOA 5KS9F 5DC9B 1NLDL 4DF9A 2BFVH 2NY6C 3BSZL 3CVBA 4PV8A 4Y7OC 2C9VA 5LXVA 3L7EB 3N55A 3HZYB 2DY2A 4PTUB 2J8OA 1CYWA 4P5MB 2APTA 1HXMA 3STLA 3X13A 3EGDA 1S8DB 5BW7C 3WY4A 2GY7B 1E6OH 4AH2B 1XF3B 4OFVA 1TPXB 3P2TA 5E8DL 2NY1B 5EFIB 1R34A 5I5IA 1ZHKB 5CP7A 1VF5C 2WTPA 4L4TD 3VACA 1TQCC 1T1XB 2VDKL 3FULA 1BVLA 3F7RA 3AY2A 1KCVL 4OJEH 5T1KA 5AB9A 1H3GA 3QFDB 2CHWA 4ZD3L 2WBXA 1W0YT 5FFLA 3IMBA 4N0UA 4FQ2H 4HCRA 5E00A 4H20H 4LKCA 3D08A 3FQ4A 2CR6A 2BNRA 4QUOA 3RG1C 3L48A 3ZKQD 2UZPA 4HCRH 4NFBA 4DJMA 1KGYE 2EXYD 2QFPA 4JZNB 5C0JA 3K2IA 1MNNA 5LN4A 2H1PL 2NQ3A 1YEGL 3K4AA 2DOCA 5FW6A 3ZE0E 1ZVSA 3BGFC 4HWBH 4OD2A 5KVGE 4AH2A 4F9LC 4MMZA 1MHCA 2DKUA 3DDGA 4P4KD 4OBSA 4HZAA 3JTBA 2EP6A 4GRMB 3ZZSA 1LMKA 5F2FA 2XN2A 1E5YA 2KPNA 4J3OH 3E7JA 3SCMD 4G7YL 1LEGA 2DLFH 1QPPA 3D0VB 3MLTB 1BVZA 3CH8A 5IBLC 3S96B 2VC2B 3MRPA 4XNYH 4XXWA 4HG4J 2X6AA 4L37B 4LOUC 4F7TA 4IBLT 5DFTA 2ZXGA 2NDGA 3ETBJ 3LS4H 2VMJA 4F15C 4Q6IA 5BW7A 3CTTA 5JPNB 2CRMA 2E27H 3ABKB 3RTQC 2FWOB 3Q1SL 2X4UB 2GK2A 5HHME 1DLHA 1NC2D 2G60H 1SUHA 3MGOB 4JPVL 5LBGA 4N0FA 4EE2A 2VERN 3OAWA 5K69A 5FYKD 2WD0A 1X9LA 2V0AA 4IKKA 1NCHA 1PLAA 2BPBA 1QFUH 3SQRA 3MA7B 3MUUA 3QDME 4I0PA 4NFDA 5D8JH 5T5FL 3SBRA 2R1XB 3TO4B 3AADB 3QDHA 4L05A 5IMLA 4RDBA 3V0FA 2EH8L 3PLYA 3DX4A 1JRHI 4EXKA 5F9WB 5K59F 4XVJL 2AVFA 4NQQA 1PPIA 4IKNA 3HIZA 4RESB 4YX2L 5JHLH 5EZLA 4W70A 5IUCA 4WI0A 4PJXE 4F37F 4CC4A 3OAYK 4JFZH 2VXVH 4WKXA 1ZHNB 4JM4L 5B39G 4WCYL 1U8HA 1EAOA 5DC4B 1K3IA 3NCYP 5LBSH 2XY1A 2XJLA 3DVFA 1MFDL 3BO8B 3FHQA 2GT9B 3NRPA 3ZTCC 2EKSB 3B2UC 2YO3A 4F1SA 2G9HB 2L7EA 4W9EC 2AXFB 1RUQL 2O6CA 3S37L 2GJ6B 4BE5A 3NK4A 2LVCA 4XVSH 2FYVA 4LESA 3TBTB 5HY9A 2YMTA 2EDDA 5A40E 1AMXA 4JG5A 1BP3B 3IDMB 4LLUB 4F3FB 3EDEA 1DDTA 3MBEB 1G7HB 1XIWD 3I6LD 3NFSH 3RLSA 3SGDI 1TPXC 3BE1L 3S36L 5B7MA 5LNDA 4M7LH 5C09D 5ALCL 3GMQB 5TH2B 1KXVC 3V4PA 4KROB 1UXLA 4L4VA 2MFNA 2NY2D 3U9PL 1HXKA 2YBRB 2A7BA 4YHIB 3TN0A 1TZ8A 3QAZB 3G6AB 4PJ5B 1ZS8B 2Q2EB 3MNWA 1G9NH 1I1RA 1UUNA 3H42H 5M95B 3UROR 4DSYA 3K46A 2QQNL 1NIEA 3LZLA 3MBXL 5T5FA 2QPFA 4DN4L 3O3AA 2F54A 1T4WA 3O4OB 4IRSB 4E9SA 3DX8B 3EOAA 2H3KA 4DCQA 3EOBB 3T65A 1MNUH 1AJ7H 3CFBA 4N6QA 3VG0H 4I4WB 2I25N 1H15A 1QSFD 1OW0C 2EQDA 3ALXA 1B3IA 2JMRA 3CXDH 1FC1A 5FGRA 5AZ2L 2VZ3A 3WFDL 1WA0X 1MW1A 2WSKA 3TBSB 4K3EL 3E3QE 5IZ7A 3LPGA 2JXMB 1Z66A 2WNXA 2AKRB 2A6JA 3QHTC 4EIUA 4OD3L 2Z93B 2Y36L 2GBUA 2MTPA 4FNQA 1VJSA 4LEEA 4OZ4A 5DO2D 3JWDC 3LZOA 2AZUA 3U2SA 3AW5A 1EHLL 3EYQD 3LNHA 2DN7A 3QXWA 3UTTE 2C3WA 1VESA 4AEEA 2B1HH 1PU0A 1R24B 3CLFL 3PPSA 5DRZA 4PJFE 1XGTA 5FYJH 2BXZA 3T0DA 3IETB 3CFTA 2NDFA 4Q0XH 3ABLB 3T65B 4ZO7A 3CWGA 3GO1H 1Z3GL 3SBWC 2HG5B 4DNLA 5HHPA 4XCNA 1HVXA 1RHHA 3S37X 3UCQA 1QASA 4M7KL 1H5BA 3C12A 5TPWL 1JHKL 4P46A 1TTFA 3TO4C 1QRKA 1RK1B 3DJ9A 4ZMXA 1ZIAA 2NY7L 2FEDC 2OMNA 1T5WA 3DX6A 3G5YA 4E9RA 5GQBA 3V5DB 4MAUH 1J5IA 2QVKA 5CWSB 4NLAA 2DLIA 2YPVL 3FQTB 4N9GB 5D2NB 4JUSA 2VAJA 3V0DA 2IV9A 1U3HD 1T6VN 3KPTA 4LHUG 4PPTA 1MHPH 4RBPH 3SGKA 1FO0A 2VLKB 4NZFA 4TUOA 3IDMA 3QCUL 3KPNA 3DETC 1UGNA 2FIKB 1OGAA 5DVLA 4TUUA 3TBTA 4ZMTA 1JGUL 1LQSR 3N1MC 4IDLA 1DEEB 4JFWA 4O02B 4P5TB 3FTUA 3X17A 1T7XA 4NM8H 5K5YA 3CQPA 4OGYL 3MODL 4G8EB 4BH8B 2VN3A 4OJCA 3QJZA 4NPYA 5MEQB 2F15A 3WEBA 2DQTL 4S1QH 4OIFA 3LS4L 2IDFA 2GT9A 2K45A 5HYIA 5KYWB 1IQDA 3TOPA 2MQCA 3D33A 4HOXA 4PRAA 4I9XA 1IGFL 3VQMA 1K72A 4FMVA 4L1TA 4KZ0A 2N0MA 4ZFOB 4O02L 1YG9A 2QLYA 2XY2A 5MHSE 3RGHA 1XGYH 5L2KD 4JFXB 1KCRL 1CF1A 1EMTL 4NZUH 2WV3A 2B1OA 4KJYB 3E0GA 5DK2A 3HRZA 2CBOA 4PHXA 5HHMD 2N1KA 3O8XD 4APQD 4JM2A 2NY0B 1J8HE 4I0PB 4DP0X 1DDHA 2EH8H 3BYYA 2XXGA 1KIRB 4WEBL 4B3EA 1GZQA 1MQ8A 3VNYA 1TZHA 3O3BB 1CFSA 1UXMA 5I24A 1XH2A 1I9EA 3ZDWA 2VLLA 5FDWB 5FCUL 5HI5C 4WFGD 3TCLB 1Q1JL 3KDPB 3MA9H 1L9PA 3L3KB 3GLAA 1U4EA 4A04A 1I7ZA 1Y0LA 2IDTA 5AW7B 5TK2A 5DJ8A 1NGWA 3A23A 3O2DL 5BOJA 2MOQA 4F7TB 5LUMA 4L37A 4N2HA 3CE1A 3FS9A 2APBA 5EO9A 2XA8H 5TE6H 3UTSD 1QEWA 3BJLA 1NGQH 4KKQA 3QXAB 2MQ3A 1OAXL 4JK0D 1ULVA 1BGXL 1IAIL 3L2NA 2X1WL 1UATA 1XD1A 3SDXA 3AQYA 5D4JA 1OAZH 1H3VA 2VJ8A 1FNFA 1KPUB 3D85A 5E2VH 2O6FA 2IC2A 3BGMB 3P69A 1IIIA 2WSPA 1YMHB 2FEEL 3DRQB 1QO3B 4UV7L 1WIOA 4JZNA 4KRPD 2A0LD 4YX2H 1L3NA 2W80C 1LTXA 1QA9B 2YA2A 4KDWA 5DD3L 2P28B 4FULA 5IHWA 2XZCL 3IDGB 1W0VB 3G6JF 4OBRA 3WNPA 2DYPD 1BG1A 1QA9A 1X5ZA 4N1HB 4C4UA 4H4NA 5KOMC 5DUMH 5GSVB 4J12A 3E8VA 3CC5A 2QVTA 5GRJL 4P23D 4LCWB 3US1A 1PLGH 2HH0L 5F7FA 1NBYA 1BXXA 3P9MB 4U3HA 5GGQH 1KV7A 2EYRA 2YQ2A 5C0CA 2DWDB 4PRPE 5I1EL 1MHEA 4Y5YB 4JM2D 4MCMA 2GAZA 3L3OA 1HINL 1S8DA 1BM7A 3O2DA 4BSVA 3PWLB 3QDJD 4PJBA 5CINL 4P5MA 4Z77B 1H9DA 1KBVA 4Y5VB 2WBJB 3QXAA 4HFWA 3HZYA 1IGYB 1NH6A 4A2GA 1QEWB 4GAGL 3WDHA 5J13C 2J6EH 3FQ2A 1BXAA 3M1OA 2YEVB 1RQ5A 3Q2NA 3QUMH 1ONQB 2WTRB 2XRAL 4YGVB 4YH6A 4ZUTA 3VWJC 4Q9CA 5JORB 3SCMC 4NUPA 4LCUB 4PM1A 3BH8A 4ZJ9A 1UM5L 4K7FB 1DQMH 3GI9L 4XNZC 5G4NA 2FZ3A 1YMMD 2GYSA 3FTGA 5FFOA 4GNKB 3VFSA 4K55A 1E4KC 1CN4A 4P0DA 1BD2A 1IAKB 2CUHA 3E2HC 3ATEA 1KMGA 3TV3H 4ORGA 4BA0A 1A8JH 3OWRA 3VAEA 3C09C 4OCLC 1K2DA 1U3ZA 3V4VH 3CFCL 2KQMA 4OM1L 3GSXA 3UJIH 5FV2A 4NI3A 1CFVH 1A64A 3NCMA 2PW2A 1GZQB 3PFUA 2ROXA 3EH5B 1J05B 2J5LC 1AHWA 1WD9A 3VXUA 3EF7A 1IGIL 1RI8A 2DYSB 1U6AL 3HRZB 4LDOB 4U49A 1EO7A 3D39A 4W6YB 3M88A 1RUPL 1CGXA 3RGBA 1O6SB 5IB1A 4C56A 2EE6A 4ELME 1WFIA 2XBZA 1S9XB 5E1QA 3ZKXB 2J12B 1J11A 3EHBB 3W9EB 2DL2A 3KR3L 3WKYA 2YPVA 2V8MA 4R7DA 3IWUA 3T4AB 1XGPB 2BNUB 2Y9RT 2CKBA 4W6XB 2RQEA 1UYWL 3D4GA 3NIFF 5HJBA 3T6VA 1E6JH 3Q9QA 3VYOA 2IALB 1JGUH 2WQXA 3JQOB 1PVHA 4G8EA 1EJ8A 1NBZA 3VXRE 4RQQA 3VUAA 5D7KD 3FB7B 4WUKH 3WJJA 3U0PB 4P5TA 5JXAL 3T6ZA 3OX8B 1QLRA 3IFOB 1QYGH 1JTPA 4N2EA 1WUZA 1KWKA 4IKJA 1S3RA 1RZKC 4PJXA 2VLKA 4LEBA 2F7RA 5F6IB 2Z91B 1ZVYA 3QI9C 1BSIA 4JFYA 3B8YA 1NCDH 1QSFE 1MI5E 2WYZA 4BZYA 2E9WA 1CXKA 3GS4A 3MRRA 1ETZA 1LQBC 3OF6D 4LBEA 1EMTH 4QR7A 4XPHL 5KVFE 4KNQA 4AQ1C 4DEWA 4MS8D 1X7TA 3T4YA 5FWQA 4TRPH 4B9YA 3TCXA 1A7NH 3CN1A 4I2XE 3L3HB 5BUAA 2W9DH 2AMUA 1QRNE 2V2XB 4P46B 1G4MA 5KS9E 3I02B 3W2DL 3JV4A 2YK1L 4HS3A 3WY2A 1BPLB 5IK3B 3EYFA 4WUUD 5L2KE 4ZYKB 4OH2A 5HHPB 5CJXC 4I9WE 4YJZL 1NCDL 2OA9A 3NJXA 3CMOL 4HUUA 4IQHA 3LS5L 3KS0H 5A1AA 3OKNA 4H8WC 3RI5K 3UTPD 1SVBA 3HI6H 1BBJB 2R39A 2ZCZA 2I60H 4DP1X 4Q9RH 4YAQA 3X14A 3BWSA 5LWYL 4C58B 1FORH 3O6FB 5L4JA 5CD5C 5D4HA 5C3TA 3LEVL 3ZK0A 1PDKA 4YSCA 2BXYA 2R9HD 4OZIB 3VI3F 1MREH 1QFOA 3B37A 3UOAB 3H7LA 4FHJA 3HLAA 2ZJSH 3SPHA 5K1NA 3UO1L 2HMIC 2DV6A 5EEZA 3RY4A 2AKRA 1QSVA 4F1ZA 5MERB 3D0AA 2E9GA 4OZIA 3V8OA 2VE6B 3JV0A 1EXHA 3NJGA 4OLVH 2J4WL 3PWPD 5IW1A 3BQUA 4PJGF 3QG7L 4LRNH 1DVQA 1Z7JA 2EYTA 2XG4A 3QG6A 3CFBB 4M4RB 1LEIB 3KPRE 4YSAA 1G9NC 1U8MB 4RA0C 1A14H 4L0PB 2GHZA 1TZOA 2K9UA 2IOIA 1MFUA 2ZSVA 2ZKHH 4KVNL 1RAMA 1IUZA 1BVNP 2D3LA 3O3AB 3KJ6L 5B1CA 5I16A 4JHVA 2BSSA 4PD4J 1BFOB 3A22A 1DVSA 1DE4A 2WZ0A 3HE7D 3TN0B 3MDJA 3N9GH 3IDYB 3NYKA 2GEEA 4XVTH 4L4VB 1AXTL 3ZDXF 4A55A 3IPBA 2WWMC 3I50L 4J2XA 2YAMA 2XWBB 3GMQA 1PG7W 5TH2A 2PYFB 3BW9A 1A3RH 2OJEA 4G1MB 1KGCE 2NUTB 3SE6A 4UTAL 2BS71 2E7LC 1HIMH 1KJ2H 3PIQB 1CICC 1CBVL 4JO2L 1NFIB 1KFGA 3PRZA 4UDTB 5DUBA 2YRLA 4KFMA 3V4LA 1PNDA 1WIPA 2EC9T 4MA7L 3ZHNA 2J1KA 4XB7A 2CGRH 1NJ9A 1YLBB 3A5VA 5CGTA 4FQXC 1HK6A 5F7DA 4LIQL 1VFOA 3WIHH 2R29H 4PRPD 2OXGB 4X0NA 4KKCC 2IALA 3O4OC 3D18A 3L1GA 4IRSC 5T1KD 3BO8A 2F74B 4MCZB 2Y5TA 4DOHE 5CBAB 1OSPL 3MV7B 5C0AD 1M71B 2X4OA 1Q8MA 4J3OF 2DIEA 4CVUA 3IU3A 1NCGA 3BVDB 3BMVA 4YQXL 2FGZA 2NNFA 3IBEA 4WI0B 4HJJH 2VDQL 4LK4A 1S9XA 3FK3A 5ALCH 2QQKL 1BLNA 1L6XA 5AKVA 5FHBH 1HNYA 4MQSB 4ODWB 2WVVA 2JJSC 3BUYA 3NPZB 2XN0A 1O6TA 3RX7A 1IB5A 5B7FA 4G7QB 3SYAA 4HSCX 4KXDA 3QVAA 3VXUB 4BWTA 3BQUD 3C5ZB 1ACCA 4P23C 4XNMB 3K6OA 1WBYA 2PW2B 3SCMA 1T66D 1V3LA 1PSKL 3VWJA 4YSUA 2MNJB 1BQRA 1X5XA 4ORGB 3S3CB 4HA1A 3D39E 5DCCA 3ZL4L 4K3JH 3LN4B 4XN7A 1Q0YL 4PWFA 1PZ5A 2W60B 2FWOA 2D7TH 1P4IH 4TUKH 1RK7A 2GSMB 5T3ZD 4RMWA 3EFOA 4LCUA 3D25A 2NZ9D 2ZE0A 1NMBL 3K3QA 4MQTB 4Y1SA 5BQ7A 2ZCHH 2B1AL 2NNCA 4FFZH 3S96A 1LP9E 2G5RA 3MLTA 2IDCA 4TUJB 4FA7B 2NXYC 3QHFL 1IGYA 2ZWZA 5J6HB 1TIUA 1XR8A 4WHTA 4AMKL 4DGIH 3V4PL 4S11A 2TRHA 4IOSA 4LQFL 2P5WB 1IT9L 4QF1B 4E41A 3H0TB 3KJ4B 1MJ7L 1PL3A 3Q01A 4KHTL 1DQLL 3APMA 4W4NA 1T1YA 1WV7T 3C5SB 5C0CB 5TD4A 4DQAA 3VMNA 3PXHA 2VERA 3P9MA 4QYOB 1NSNL 3H4FA 4AEFA 4W9KC 4LCWA 5CP3A 5C0JB 1P4BH 4NZDA 5I1IH 1IU1A 1I1YA 1QFWI 5F7WC 2X87A 4ES8A 3BVVA 3HG5A 2YD4A 2CJUL 1OCCB 3OQ3B 4LKCB 4WQOA 4P5TC 4LPVA 4OFYA 5T3XH 2CALA 3NG5A 1X5GA 3ATDA 3S98A 5KUKA 2OMYB 1UCBH 3CFQA 2DLFL 1U92A 2XSKA 4MA3A 2VABB 4PIBA 2AZAA 4PLKC 3GSRB 1YPZB 3RIAK 2ZCKL 1NWPA 1YMHA 5EFIA 2K8MA 1ZLVK 3J2PA 2XZQL 4Z23A 2ZF9A 4XZUB 2P44B 3BP6A 3IMTA 3V6FB 3KWWB 1KPUA 3K6FA 4PIRF 4TQEL 1ZLDA 4WNSA 1JXFA 1HX0A 2JB6B 4YZFF 4EMZA 2DIBA 2OSLB 4WW2A 2Z65C 4X6CF 4WZ9A 1DQDL 2FCBA 4TNWK 2PCYA 2XWEA 4AYID 1MEXH 1HXMB 3DUUA 4UWQB 3KGSA 5B8CC 3P54A 4Z7OE 4F8TA 1RSFA 1T4KB 4DPRA 4V1DE 1URIA 3PAVA 1RZJH 3HNTL 4ZTPH 1HOCB 5ACZB 2FH6A 4Z7VB 3G5XA 2DIJA 5I6KA 5DR5L 4HBQA 3L8QA 3RWFA 5BPPA 4OLVL 4D0CB 4OCXH 2NXYB 2EEBA 2YZ1A 2DH2A 1I8KA 4U6HB 3BD5A 4AK2A 1I7ZB 1Y0LB 3EYVA 1MCPH 4HS8H 5FM4A 1IL1A 2A6DB 3QK0A 2XTJE 3ARDA 5KN5B 3KH4A 3OHXC 4IHBA 4MSWB 4QHKI 1IGFH 2WYIA 3BPOB 4N8PA 1YEIH 2ICWA 3K72A 3CVCA 3DX7A 3NIGB 1NEPA 4N28A 4OCRH 1CFSB 1SLUA 2JKRM 3FYIB 3M17B 4N90D 3V52H 2QT6A 1OSZB 4Q14A 3VB9A 4M9OA 4KZEH 1RLWA 5FO2A 2FWLB 4Y9CA 2VLRD 3TU6A 3V6ZA 2R59A 4JM2B 1UCTA 4XMWA 2VDOH 1H19A 5HDBB 1P84K 3UMTA 4HUVA 5GS1B 1FORL 3FU7A 1YYCA 3FU8A 4BKLA 1I9IH 2L04A 1CB4A 3N5AA 4BHUI 4JFXA 2RR3A 2XTSA 1CDIA 4LCWD 1XGQB 1N6QL 5D6DA 1SDAB 2JJVA 2RQ8A 1EA9C 4E2OA 4I18C 4JY6A 1DANT 3HNSH 1KLFB 3SDYH 3RVTC 1NKOA 1FNSH 4KZEL 5EUOA 2FX7H 3EH1A 2WMPB 4JRWA 3WFCL 1JNHA 2P5EB 3UZQA 4QT5B 4Z7WA 4H8WH 2QQLL 2Q8AH 1XBRA 2QGBA 2ZKYA 1GZHA 4NPYB 4A6YL 2C7UB 3ZTEA 5IROC 1OAJA 3MO1A 4FERA 1GSMA 1A4JB 2Z31D 3LD8C 3WIFB 4R2GD 5C6WH 4PJCE 1MFMA 4BFIA 4KAQL 3ARGB 2BCKA 3BGAA 1C9SA 1FG2B 2Z7ZA 3MRBB 4L8DA 5SWZA 3MOBL 4HJ0D 3KL0A 3HFMH 5AG9A 1NCBH 4LLYA 5C0BB 2VLJB 5HVFB 5KYUA 4PGEA 4H8WL 2Q8AL 2QQKH 5DRWB 4CN4A 2O93L 2WK2A 3FQTA 4N9GA 5D2NA 2YBGA 2FX9L 5ES4B 2MPVA 5TQ2L 4W9LC 4YBLB 4PV9B 4NIKB 1P7BA 3ISRA 1ZY9A 1BJ8A 4YSSA 4FEIA 4RGNE 1WBXA 2EDLA 5IVNA 2EDJA 1Q9WB 3HC4H 2ZTBA 1H5BB 4DVRL 1CCZA 4KJPC 2BJMH 1G6RA 4L0ZA 3QZPA 5A2CA 5IJVB 3DGCR 5MENE 5AYTA 1EUUA 2BVYA 3ILQD 3JUZA 4YMPA 2EUVA 4M6OH 1WLHA 1JWUA 1XGTB 5KVEL 3DGDA 2AXJA 2HKAA 5JQ6H 1R24A 1BIHA 3ZOAA 1CFBA 3WJMA 5EN2B 1KEML 2W1NA 3GB7A 2CJ3A 4HT1L 2NUPA 2F68X 2OCJA 5C0FA 5I75B 2JJWA 4UMSA 3N43F 2R7EA 5DJCB 3NSFA 3S35X 5I17B 4ODXB 4GRLC 4NQEA 3VXRB 3AVEA 4XBGB 5AOIA 5C2UB 1PG7L 1QTSA 1ZDQA 4PJAF 3AABA 3TBCA 4MMXA 3GIVA 4Z95H 3UGUA 32C2A 5D2LA 3QRGL 3WENA 1EQWA 1JF1A 1G7LA 4W9GC 2R2EA 2PR4H 4MJIA 4JB9L 4GKNA 1YRKA 1ZGLA 1HWWA 1VFUA 3WNNA 4A67A 2CWRA 1H15B 1W80A 4NQDA 4ALAL 4CSSA 1ZK5A 2DI9A 5ANMB 5GZND 5CAYB 1KYUA 3R06B 5DDHB 3V0AC 2VLMD 2CSPA 4MRBA 4BM7A 1DBAL 2WYTA 4RFOL 1OGSA 1FG9C 5D2NC 1LO0H 4U3XA 4PJ9C 1UD5A 4YE4H 5IEHA 5LJYH 4X4YB 3G5VA 5DZNA 1YNTB 1DFBH 2NY0D 5KUMA 3AG4B 2LABA 3FFDB 3Q5TA 4S2SA 3FUHA 5JOPE 2WNKA 4ZODA 3OR6B 5ICYA 2Y3AA 4MKMA 4HK3N 3L6FA 4XP5L 4UQ3A 4CC4C 3LKSA 2YBRA 4YHIA 3P77B 5L2KB 5B22A 3BUDA 4FG0A 1UWXH 3O6ML 4QLRA 2PLTA 4WWPA 4ZAKD 2E7MA 3J27A 1FFPA 2FDBP 3T3MF 2B2XH 2BSEA 4BV1A 3PGFH 2DDQH 1G7HA 5SWSA 2PYEE 4FXLA 2V5YA 3EYOA 5AVZB 1GL4B 3KYMB 4PW9A 5L6YH 4YSTA 4X5LA 5I1LB 3RVXC 1S7XA 2W91A 5F96L 12E8H 3BHBB 1FCCA 3TONA 2F19L 5F88B 5F9AC 8CGTA 5J7CC 1WH0A 3BPOC 1S46A 1MIML 1I9JL 5ESAB 3T77B 4ENED 4MFHA 4NM4H 1RPQA 3FB6A 1LK2B 4ACPA 4DZBA 3AG1B 5C7XL 1A6UL 2ZD0A 1QSFA 1U8HB 2E4TA 2QSVA 4TPRL 1NZRA 5JHDE 5ITBL 2I7SA 4RLDA 2BO0A 3TO2A 2FGWL 4RFNB 1P7QD 3E6FA 3AXIA 4AL8H 2IDQA 5JHDB 3J8F7 2HTLD 3GHBL 2DQ6A 3O11B 4X7SL 1N7MH 1OSYA 2ZKMX 3VVVA 5H94A 5C6PB 3MJ9A 3CHXA 1IAOA 1L0XA 3APCA 3PP4L 3FB8A 2HCZX 1NA8A 5B39B 4IRZA 4S1QL 1RIVL 2WP3O 2MJWA 2R1XA 2X4PB 3L5HA 1I7TA 2E6PA 4XMXA 1E42A 2A38A 2FJHA 3K6NA 2WQUA 2A73A 1NDGA 3VRLF 3VFMB 4XBEL 3L3DA 3ZW3A 1KGJA 3MJ7B 1TETH 1MW2A 3HRPA 1CDGA 1E9PB 1ET5A 4R4NC 4PVMA 1DLHB 2Y2WA 4L9DA 3KJ6H 1INEH 3LS5H 1NUDA 4YSDA 1NKGA 3ZL2A 1ZHBA 3IJHB 3MLSH 3JWNE 4Z76A 2WZ5A 2YUWA 1EVUA 3DUSB 4Z1PA 4RNRA 4U1HB 4BXVA 1KJVB 1AGEB 2Y23A 2CXGA 4N0CD 3VI3A 1RUMH 1OEZW 3H6AA 4GUPA 3SQBB 3T0VA 1N0XL 3BH9A 3D0VA 3OJMB 4N2IA 2HRPH 2K6WA 3CVHA 1CLVA 4OIIL 4P3DA 3EJZC 4L3AA 4UINL 3EO1A 1EGJH 4GRMA 3BAWA 3RJDA 3V52L 1CGUA 1ZRUA 2NY6D 2R4RH 1PX8A 4MMZB 4ICWA 2ED7A 5AQ0A 3LNIA 1UFUA 5IB3B 4MZRA 1QTPA 2B08A 1N3NA 4OGQC 4P2QE 4OT1H 2QPEB 5CXPA 3ZU8A 3Q9PA 3HE6B 4YFEA 1NBQA 3OGOE 4WFEE 5I8OL 1ET7A 2FEDD 2Y2TA 5FHAH 3B3IA 5KW9H 5JIDA 2F53E 1KF9B 3FUFA 4FNRA 2M1KA 4NHUA 4PB9H 1T5KA 2OMUA 3K2KA 3STZB 4FFVC 3SDCB 5AZEL 1ZJBA 3REVA 3FT3A 1AQDB 1W72H 4LIQE 1X5YA 4KNTA 4PRDB 1UM4H 5T1KB 1IFGA 2R69L 5DJDB 2XC8A 4ODHL 4PI2A 1TU2B 3B2DC 1YEFL 3GSWB 4LCVA 1T1XA 2YXWA 3OSVA 3QEUB 3TX4A 1MHHB 4F93B 1Y6MR 4FMKA 3QUML 4DUWA 5DHXB 1ZHKA 1DJSA 1X7QB 3BXNB 3FHAA 4AKPA 4PREA 5K93A 1I7RA 4YVUA 3UXFA 4NBZB 4ATWA 3H9SB 3O4LB 4HETA 1CF8H 5E03A 5FIEA 4YDLB 3LZRA 1SY6H 1SEBB 2Q3XA 3STLB 3HAEA 5KVFL 4OAWB 4XPBH 4BFFA 2D03H 4HUKB 1A6VH 3SGEH 2QZ5A 6CGTA 1HEZB 2R0LL 3D7PA 4H8HA 3V4VL 3W11C 5DUML 4PG9B 1SHWA 4YK4B 1IMHC 2Z8WC 2VIRA 1CZ8H 1HOEA 1T2QH 4OCWH 4PV8B 5DEFB 3MKKA 4HJGB 1NC2B 2A1WL 2W8CA 1ZT4A 2DKSA 1Z0NA 3N85L 3IPFA 1EO8H 2A4ZA 2OTWB 1DQJA 1MCOH 4P4RB 4LVNC 3OC5A 2WUBL 1H3PL 2A74B 1P5UC 2GTZA 3ZE0B 4EPSA 2FJSA 3BUIA 3PY9A 2RD0A 3FN9A 1T03L 2NSXA 4PUBH 1HNFA 5LDUA 1CD0A 2TAAA 3I75B 4XCFH 2VC2H 4MWFA 3QJRB 5HHQB 4V1DA 5E9DB 1I4FB 4FNPA 1RVFH 2W9EH 4IGBC 4ZMOA 4ZI8A 2YAQA 4MXVE 6PCYA 1F1AA 1MCNA 1VKXB 1DJWA 4UU9B 2VZOA 3QR2A 5FKAB 3EH4B 2YPVH 1U8NB 3T2QA 4MXQC 2HRHA 5LXGL 4IHOA 1ECYA 5LG1A 3Q0HA 3RUGB 3BAEH 2WGNB 3SYCA 4FQIL 1FLRL 2DZEA 1VAHA 4RAVB 3WEXA 4JKNA 2X4NA 1OTUC 3OB0H 1U42A 4ANVA 4WNQA 4ORZC 1ZLSH 3L4TA 1AQKL 4BFEA 4CL7A 3RKPA 2HT2D 3PWPA 2JKIS 3AC0A 3BISA 4Y8DC 4EDXA 2IBZY 2FR4B 4HALA 4PJIF 3L9EA 1FVCA 1Z9SB 3WLBB 4GSDL 3CN3A 4QGYA 3GSUB 3GZKA 4WO4D 2NNRA 2FJUB 2KBGA 4GIOA 3RWJA 1VGKB 4XCYA 1SOXA 4HUWA 3S3JA 5MEND 4PJCB 4FNSA 2PETA 1SXCA 1AYOA 3ZTNL 1IT9H 2ADGB 4MNHA 1CIDA 2AQSA 4X9YA 5ALBL 2ZXCA 5AAWC 5IIEB 2FO8A 2VISB 2R8SH 5TQ0L 1RP9A 3HE7A 3NJNA 4BGDA 3KZ8A 3DARA 3UC2A 1RUAL 4UDUB 3FCTB 2GJZA 4J8RB 1EZVX 4NZUL 1F2XK 1DVZA 3NK3A 3BN9D 4ZW3A 4OF5A 4W9DC 3NCBB 4HWNA 1JV2B 3W81A 1YC7A 2J1ZA 1FYTE 2X41A 4PS4H 3LZPA 4PJDE 3WXVL 2SEBB 3F58L 3PHQB 4CU7A 2FJFA 4ZAKC 1YMMA 5FOJA 2ITCA 5E6IB 1DQQA 4LF3A 2R8SL 4O5LL 5IB4B 3GUTB 3MUGA 4JQXC 1Q1JH 2DQGL 3BUBA 1LO3H 1J88A 3BSHA 5EIIG 1NANH 3DIFB 3UGEA 3ZX1A 1HHGB 1I3GL 2BHFA 2ZYRA 3MRQB 4L8SB 3UZEC 4IOFD 1XXFC 2Q6WA 2Q8BH 1H0DA 3L3JB 1TXKA 1H3UA 2BRRH 1MFNA 2O5ZL 2R27A 2IH8A 2D7PA 3OHXB 1BX2A 5F1KC 4XMKH 1SPDA 1O9WA 4K4KA 5GGVY 1BCIA 1XF5A 1ETA1 3HE6C 5H35A 4LSUL 1HH9B 1WSST 3L2LA 3MMEB 3E8UL 4NWTH 4HJ1A 4YHML 4IOIA 3FOMA 3L4VA 3OQRA 4GO6B 1HXYB 1RV6X 1I1AD 3QAQA 4X6EB 5A2KH 4PJIE 4PRID 3SDDA 5CEZL 5JW3L 1OAZL 3KGRA 1UOKA 4GQ9L 5CJ8A 4MAYD 1LMIA 3EJSA 3VH8A 4G7RB 4OGXH 4XPGL 2BIHA 3HBZA 1CXIA 1DVFD 3U4EA 4A6YH 1CE6B 1UXWB 1VADB 2ICES 4I18B 3MLYH 1QVOA 2DBLH 2ERJC 5IW6A 1F41A 3LSOB 1AKJA 4R8WL 4TTDD 4WO4A 4Z7UF 4YDVB 2XWTB 2E7DA 5F3HA 2V5RA 2Z7YA 4X7DC 4I77L 4TNEA 3GNML 4JO2H 2NT1A 2X9XA 3UYRH 4Y4HB 3EOTL 3BP7B 4K8RH 2AEWA 2IBBA 4P2RB 1LHZA 2V7HA 2HFTA 4GAJL 4WJ5A 3BZ4B 1QTYT 5BJTA 2OXHA 3WGVB 2X4SB 5D93C 1KJ2A 5DD5L 2HFEB 5AKTA 3RNQB 2Z35B 3JTSA 4KU1A 4R97C 1NGXB 5JHDD 1IO4C 1BOGA 3LRLA 3ZQWA 3VGDA 3MUHL 4D8PA 2R0WH 1LGVA 4B60A 2ICEA 5JR1L 2OS7A 2WXMA 3EG9B 4E5XG 3KNBB 4JFPB 4ZXBC 1SLXA 2DQMA 1FVEA 3BDYH 5GS2D 4EN2A 3UP6A 9CGTA 1CMOA 4ONGH 2YXFA 2Z0UA 5I6LA 3VE0A 5LAPA 2JJTA 2XU9A 1U8CB 3C2AH 1INQB 1MCKA 5HI3C 3CUPA 1WT5A 2CHNA 5DMYA 3GKWH 4YHKL 1S4IA 4NO3A 4QXTB 3LZNA 4FZ8L 1DVUA 2VO5A 1LO4H 2ZG3A 1SJEB 3FQ1A 5GGVL 3RA7L 3QQ9C 2AJXL 4URKA 3SBPA 2VZSA 2P1YA 3QC5X 3VRLE 1MFCH 3O41B 1CBVH 5I23A 4AIXA 1A3QA 3U0WH 1YEJL 1VFBB 3PXJA 5GGTH 1JN6A 2DL9A 3HKFA 4HHGA 4MTMA 1C16B 4BH7B 4CSPA 5I71B 1T04B 4L1BA 4NCC1 4GLRH 2JV6A 5GGSY 5TDNB 2OMXB 3U79A 4WWOA 4DP8X 5I0VA 5DWUH 1J5DA 2UZIH 2EYSA 4WW1B 2ZZUT 2ZXEB 3V0IA 1MCSA 1P7KA 3REWA 1SFDA 1MRCL 1S6NA 3D05A 2RIKA 4Y5YC 3S7GA 4GRLB 5FK9A 5IHUL 4HPOH 3EYSH 1ND0A 3N3EA 1UQSB 3SGJC 5LCVH 1R3KA 1IGCH 4Z5RB 3QCTH 5A3IC 4ZMYA 3D0LB 3CHQA 4NDMB 1MH5B 1S7SB 4JHAH 5MEOA 2RB8A 3VDAA 5F1NB 4UQDA 5L4IA 3D9AH 4AQOA 4R83A 4U1GB 3BESR 5CR1A 2I5YL 2EE9A 3GSNL 2CBTA 4LP8A 2HLFC 2CU9A 4CC1A 3B56A 1G9ML 1MWAB 1T2QL 3EDKA 4NKMA 1OF2B 4OCWL 4PD4K 4Y0GA 1D2OA 3GK8L 1HDMA 1SDDB 5GGRA 1U8QA 1X3DA 1YJDH 1RZFL 5AW4B 4PRIB 1FL6A 4GSRA 3RTLA 2DEWX 4MMYB 4U1LB 4K7PY 1EH9A 5E08H 4PJHB 4XNUL 1S7TA 3SPVB 2CIIA 4G8FA 5BZZA 4L8CA 2DQFA 2ATPB 1KBWA 3GSVA 3FPXA 3DX9A 3SO5A 2X0UA 4GKOA 4HJUA 4YUEH 4OKVA 5HBBA 4I87A 5D2LF 3TBBA 2XPGA 2XQYA 3P4OA 2ZUWA 4S1RL 5CP3H 5I66B 1JZGA 1JGLL 1D6EB 5AOJA 3EJZD 3NA9H 4YIQA 1F1GA 1SXAA 1G43A 2RFXA 3FN0H 4MQ7B 5HPOA 2HVJB 2PABA 1QLEL 3HG1A 5FXCH 3R7RA 1WRFA 1BZDA 1H9VA 1LK3H 3QYCA 4OZGB 3H3KA 5EOTA 5K9QI 3MCYA 4OSUH 4AVHA 2WLHA 5FKPB 5I18L 2WWNA 3TA3D 1WP6A 3T2NL 3QH3B 1S9VB 2Y4SA 3BIKA 5KBLA 1MCDA 2GW5A 5ELIA 3GXTA 2G3NA 5C07B 1CDYA 1ZDSA 3RNKB 4MX7B 1YEHL 3F6JA 3QUZC 3H3PL 5C71A 1OE2A 3LV3A 3A4EA 2WQRA 3CNKA 1HZLA 2ZX6A 3KXFD 4DGUA 5E4OA 3PWVB 2Z31A 1HHHB 4P9ML 4XMUA 5I74C 5DVNA 3QQNA 2EDYA 4OIBA 1F4HA 1TJGL 4FXKC 2X3AA 2QPSA 3GSNA 1F6AB 5A6LA 4H25B 3KE0A 4C47A 2O26U 2PCXA 3QAZC 5DGRA 3WTSA 3JWNC 3R18A 2DLHA 2VGLM 2ZWLT 2A77L 4XMKL 3LKNB 2A6KA 1P6FA 1P69B 4XCEA 1CPUA 4L3CA 4AT6B 4ZS7L 4Y5XB 3T0EA 1KTJA 3VWJD 3AU1A 3QYMA 3WDJA 5GISH 5J12B 2WJ5A 5FUZL 5LAXA 4HJIA 1GCFA 3RX9A 2X4RB 1QW8A 4G42A 4ZZKA 5L4FA 1IBGL 3KWTA 1QKZH 2NY5H 1A1NB 2F6AA 3CQFA 4JREB 3VRIA 3KLQA 3K81A 3GTNA 2NXYD 1JZJA 3I6GA 5J1AA 5JTWA 2FQGA 3F8UB 5D1ZB 1NDMB 2PW1A 4XN2A 5JIQA 5E94A 3HZVA 1KTLB 1HQRB 2H5UA 4XPFL 2Y69B 2OPCA 1T66C 5AWNH 4Y2DB 5F21B 2C1PA 4PRNA 4JHUA 1U2HA 2Z7WA 4S0TD 3BZFB 3SEPA 1FZKB 5HGHA 1OALA 4KJWD 4TS6A 5HYSB 1ES0A 1JPGB 5L2JB 3UH8A 3HC0A 5IQLA 3VSVA 5EUKA 1HZKA 4XXDB 4HPHA 1KZQA 1TZIA 1G7IA 2BOCB 3BQVA 1FJ1B 3I50H 1CD8A 4BFGA 1D5XA 2YPLE 4NS0A 4XOEA 1WZLA 2IADB 4JRXE 1EZUA 2AJYH 1T5XA 2CK0H 5IQ7H 1X4XA 5F7NC 4XBPB 3V0VA 2DQIH 2F7OA 3AXHA 2FBRA 2AGJH 3OG4B 3RGVA 4HWZA 1QI5A 1CFMA 1JNNL 4ZMWA 3A47A 3C6SB 3MLSL 1NCBL 3OMIB 5B7EA 3MCLH 3P73A 3HOGA 4HFUH 5CO1A 1EHXA 4WO4C 2A9MH 3D09A 3KYNA 4CJ1A 1AY1H 1R5WA 2GTWA 1O7DC 3KWVA 4CVZB 2K6YA 3BWAB 5TE6L 2KLTA 1KG0A 3EIFA 2FVNA 4YHNB 1MY7A 2CM5A 2WTOA 3BZEA 3O45B 4MQXC 1A7RL 3GMRB 3GNMH 5I1EH 5D5MB 1OWWA 4NENA 1MPAH 4N86A 5AW3B 4QRRE 1T1WA 5AG8A 1E5BA 3OGCB 3APFA 4U1JA 5DQJB 3K6SB 4Y1TA 2AS5M 3EDJA 2K4WA 2FO4B 4GP5B 4JKLA 4M6OL 4UOQA 2XV6B 1M7IB 2ZCLH 4M5ZH 3VXQB 4E0RB 1WQVT 4WW2F 3RGVC 5DFWH 5FYJE 5KYXA 2J88L 3LRKA 4PP2B 3BDXA 3ARGC 3PL6D 4W81A 5DD3H 5CF3A 3KVPA 1T89C 5EMYA 3N41F 5AAMA 2XKNA 2F1EA 1R0AL 1A4AA 3D3VD 4TN9A 1ZS2A 1K4DA 4OQTL 1K8IA 3EGXA 4HVBA 2GVYA 1UB5A 1Q94B 1R3LA 2P45B 1TJXA 2IAAC 1U91A 2PP8A 1D5BB 4LL4A 1B0RB 1E27A 5ACMA 4I1RA 4AEHL 5B3SB 5DHVB 1L5GA 1AYRA 2G75B 4M02A 2XWCA 2ESVD 3OPZL 3QJQB 2HJFA 4KO9A 2OMBA 4HDIB 3OM3B 3OHMB 5E51A 3P9WB 4PJ8D 4CVWA 3ZDYE 3I3DA 1A6VL 4MXQD 4YEEA 1NFKA 2HWZL 3Q8EA 1XHHA 1GYVA 1UZ8B 1CI3M 4F2MB 2R1YB 3EJYD 4PJIB 1MAKA 3LIZL 5J1TC 2YLKA 3U83A 2XNAA 3KLAA 5EU7C 5DMGD 4F7EA 2WXHA 4HKJA 4PWJA 2PWEA 4PP1C 4HCGA 1JBJA 5KYYB 3FN0L 4NQVA 5B38A 2IWGA 4ZNEA 1UJ3C 1HI6A 1DSYA 4KMQA 2IANB 4G80A 3X1NA 3ARYA 2OJZH 3QIBA 2LQRA 4RMVA 1F6LL 4J6IA 4KPHL 2CLVB 4D9LL 4XCFL 1JXJA 1A6ZB 5DEGB 4GFXA 4KKBC 4KK5C 4ODSL 2E47A 3S35L 1JVKA 3N04A 2GFBA 3QZNA 1ZWIB 4XNQB 3UTSA 3S34L 3MV9E 3NJKA 5F7EH 1W6LA 2PN5A 3GJFA 5IMOA 4JO4H 4XWOD 4MJ6B 4PJDB 4HIXH 5GGSA 4OQTA 4UQ2B 3MGTB 4XHJD 3ISYA 2FYYA 3VXPB 4PR5B 2VXTH 2W0FA 5GRYA 2X4QB 1LE5B 2AV1B 2BNQA 4L1DA 2Y24A 1RZPA 2DM2A 4LLDB 5GRUH 3H4HA 3T9WA 4JMNA 4J3BA 3TFKD 4ZXBD 1RK0A 1J18A 1J9CT 1P5UA 1LILA 1QUPA 1R5IB 1YJDC 1NAMA 4WGKA 1OPOA 4YZWA 4Q9RL 1MVUB 2Y1ZA 3VX1A 4QHLB 1USZA 3RWHB 1MHPL 3OVUB 4GP4B 1ZVNA 1FA4A 1HN1A 3MACH 1NGYA 4OUUA 3DV6B 4UAHA 3VXMD 2J8UB 4WWKA 3IE9A 3FFCB 4WI8A 2DI7A 4F27A 4GAYB 4IRZH 4PJ8A 4P23A 1G7JA 2ARJQ 2X88A 3NCWA 4ZFGL 4KKNA 3QR1A 1OP3H 4H1LA 1M05A 2ICCA 2YMXL 4LLVB 5CSZB 4P57B 1BZQK 4ZOEA 2VLKE 5ADPH 1HYSD 1UT1A 3IXAB 1A7NL 4P2AA 5AUMA 1CGSL 4E9XA 4Z7UB 2FLMA 4LPXA 5G5DB 4BRJA 1NINA 2R51A 3RFRA 4G9DA 7FABH 4RMBA 4B9CA 4K3DH 2MSPA 4JJHA 3L4XA 2NYZA 4M3HA 4TTDC 3THML 3LH2L 3DROB 1WWWX 5I1GH 2AGJL 4XP6H 3TTSA 1U8PB 4UTBH 4ONHA 4D0BA 5E9DE 2HTLC 1HWGB 1UA6H 4ELMA 1CLOL 4TTGA 3CVHH 1HEHC 3JYCA 2QPDB 4MBOA 5FECB 5C9KA 2GBAA 4M7ZC 3NACH 3NGBC 1Y6NR 4AM0B 4G8IA 3ZR6A 2LE9A 4MB1A 3IDIB 3SD5A 2GI0A 2XPYA 4K9EH 3AM8C 4GI9A 1D6VH 5T1LA 3WTUA 1N2RB 4E5XA 1MPAL 4JM2C 1I31A 1RPKA 2IH3A 3DV4A 2FB4H 35C8H 1NUGA 1QOKA 4FFZA 3D69B 3D8MA 3NEXA 2IBZX 1AD0B 4GQ9H 2VZVA 5AD0A 5LVEA 1SXBA 2O5XH 4RH4A 3V5KB 3MPCA 2XIIA 2Z4TA 1I1CA 4CSTA 1DJZA 3VXNA 3FRPG 2BZ7A 3LVEA 4CMHB 4CN1A 1CFQA 4ZUVB 3IGAB 2DBLL 2BSTA 3ZPDA 5IHHA 3HPLA 4I48B 5AOMA 5AVSB 5FO8A 3N0PB 4N2MA 2Y6TE 3QHZL 3DTDA 5DJ0B 5JHLL 4PRBB 2I85A 3CBKB 4AJ0A 2DQIL 3ARVA 5PCYA 3RL2A 2ADJA 4WJG3 2EC8A 1IEAA 2OMWA 4YQXH 3UBFA 3KGTA 4JKWA 2AQ2A 5D9SA 4MA8H 3INUL 3S88H 1IGJA 4Z78A 5A2IH 4ZMQA 3RZWA 3DURA 1JPFA 1W15A 3JSSA 1AY1L 2Z0BA 2JKWA 4OY9A 2ZPKL 4G43A 4H40A 4RISH 4NNPL 5EBMA 3GMOA 1NEUA 1EO8L 5JLZB 3U2JA 3GBEA 3T04D 3LRMA 2PCFA 3O8XA 1UUSA 2ZXWB 3DTUB 4IKLA 4APQA 5E8PB 3KLKA 4KRPC 3VYNA 3FBKA 4XAWH 3ZUCA 1UGKA 2X2YA 4JRLA 5I2IA 3BKCL 3BRGC 4R7LA 1T1ZB 5DURD 2BP5M 4UB0H 3G9AB 2KHAA 3ZSTA 1A9BA 3TPKA 5EB9A 3RDTD 5J3HC 1GH7A 2DIAA 1BM3L 2EDKA 4F2ME 1HKLL 3DTXB 3DVGB 3QUXB 1OAUH 2ESVE 5HHOA 4XCCH 2HH0H 4JAMB 4LHUD 4JDEA 5JNYB 1C5DB 1GYWA 3GMNA 4U1GC 1AR1B 4LVOB 3VFWA 1VZHA 3OZ9H 4HPYH 1EEYA 1U8IB 1XSOA 3EXJA 1FFOA 1WA1X 5BRZE 4A7SA 2QHLA 2WXQA 3RIKA 2YD8A 2JIXD 1SMAA 4U31A 1OCWL 1ZEAL 2AQNA 2VDPH 2ZG2A 5IBTH 2EXSA 1LEKB 1AP2A 2Q7YB 5KBMA 3NZSA 3V4VB 1U0QA 4KHTH 3Q05A 3V6OA 4QRQA 1UWEH 1XGRA 3CVIL 3N85H 1NGPH 1XXDC 1KYOK 3VRJA 1AANA 1QZ1A 1T2JA 4PB0L 2WZPD 2VZUA 2CPUA 4PJ7A 4A63A 5IR1B 3RZCC 5IV2A 3OXRB 2H8PB 1A4KB 4FXTA 2B2XL 1DUZB 2EDOA 4HIXL 1A6WH 3VD4A 1C5BL 3CSYB 4ZD3H 2Z8RA 2XWRA 1G9MH 2K7PA 3BVNA 4Y4FC 5CSGA 5I8EB 4AIEA 1Z1WA 4KJQC 1P4IL 5BUGA 4F33A 3ULVL 1DVFA 3P3SA 1ZA3B 3ZMEA 5IROD 2BW5A 2DYPA 3HW7A 4IMLA 4P48A 3NSJA 4NKQB 4LLMA 4WGVB 2EEFA 2C4FU 4FF9A 2B4CL 4L8BA 2FLBT 3PHOB 2EILB 2HJKA 3SOBL 2CCLA 1MLBB 5CIPA 4F7CB 4XC1L 3BAEL 2DQTH 3FQYA 3LAFA 1MRDH 4RFOH 1FLTX 3TA4D 4OQ1A 4JQVC 1QRNA 2AJUH 1GAFL 3GD1C 4OD1H 1TFHA 1TQSA 4PFEA 5EOCH 4AYGA 1UOVA 1CD1A 2YC1A 4APXA 2JWYA 2ADIB 4U6VL 4F91B 4N22A 2WUCH 4NHCH 5CIPB 2R1WB 1ZTXE 4BZ2A 3QIBC 2VDNB 4W6WB 3ZT7A 4RCAA 3O9WD 2B59A 1K6QH 3DC0A 4EUPH 1S9WA 1XSJA 3QWOB 4KHXH 4U6XB 4J1UA 5HPMB 3L4CA 2X6BA 2CQVA 3HUJF 5F8RC 3QNXA 2QKSA 3AREA 4M7LT 2FEEI 4PLJC 2CA4A 3CSYA 4NKIL 2D7QA 3MRCA 3QARA 4OVVA 4IDJL 3DHJA 4OCSL 4Z3TA 4DKFL 2H8PA 3HN8A 2JIXA 1E5AA 2G5BA 1TQWA 4PRHA 2I26N 2YQGA 3HG4A 3GRGA 3LEYH 3MRKA 5IV2B 2ODHA 2E46A 2UWEE 1XQ4A 3B7RL 4GO9A 1UWXK 3QIWA 2C3VB 4Y4FA 3LMJL 4N0CC 1KWGA 4MJJA 4E9YA 3SD2A 3M46A 4YSEA 1VACA 4R7VA 5TGBB 4F92B 4QI3A 1KLUA 3CDGB 3RTQB 4A2EA 4LSSL 5HYQA 3VXOA 5DTFA 4XGZB 5GSRA 2Y06H 3QORB 5GISL 4M7JH 3MUZ1 2DTMH 3VD0A 5C0NC 4XMLH 4JDEB 4Y19A 4WK2B 1U95A 1MDAA 1MI5D 3K91A 4HHAB 3HHSA 5HHOB 5E1IA 3WE6A 5FHAL 4AVKA 2MOVA 5IQ9B 1XAUA 3TTYA 3ULSB 3MC0A 5TFSL 4R0LB 4AEIL 4KAQH 4OZFA 2HVKB 1FAKT 4MJ2A 4AVJA 2NSMA 5CZKA 1MFVA 5IG7A 3TZVC 1SYVB 3CG8A 3O2WL 4EAEA 4X99A 1MCWM 4PLKD 25C8L 2IMNA 4YDIH 3QUGA 1JRHH 4FTVE 1B0WA 2PCFB 3MV7E 2XACC 1JSYA 3VFVA 3CLEL 2X0VA 4I9WD 1EFXB 1CBJA 2CIKB 5SWQA 1KGXA 5IY5B 3EBGA 3U36A 2R2HB 1O75A 3VQ1C 1SYSA 3SQOL 4HIJA 4KKBD 1JPSL 4XP1H 5DJZA 3ECBB 1GOHA 1IGJB 4Z78B 1JS4A 2C1OB 3ESNA 3FMGH 3PGCA 2DQUH 3QQ4A 4J2QA 5ANME 1LLAA 2E0PA 1YNLH 3IJYB 1FL3B 2X7LA 2X9WA 3GSOA 3WAJA 4M62L 4NN5C 1A0QL 4Q52A 2EXWD 1FPTL 1E4HA 2O5YL 3P3UA 1BJ1J 2GBTA 1SNRA 1CFQB 3UJTH 3T4AC 1A6TB 3K80A 3HVNA 3SDCC 3UPRB 1UADC 3CXDL 2ZXBA 3L9BA 1A7RH 2WQVA 4PGCA 4HK0A 3L81A 2IH3B 1EEQA 3QZWG 4ENEC 2B3RA 1FFNB 1Y1UA 1FGNL 1SDYA 4UAOB