1IB5A

X-ray 3d structure of p.leiognathi cu,zn sod mutant w83y
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
151
structure length
151
Chain Sequence
b'QDLTVKMTDLQTGKPVGTIELSQNKYGVVFIPELADLTPGMHGFHIHQNGSCASSEKDGKVVLGGAAGGHYDPEHTNKHGFPYTDDNHKGDLPALFVSANGLATNPVLAPRLTLKELKGHAIMIHAGGDNHSDMPKALGGGGARVACGVIQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CU,ZN SUPEROXIDE DISMUTASE
publication title Single mutations at the subunit interface modulate copper reactivity in Photobacterium leiognathi Cu,Zn superoxide dismutase.
pubmed doi rcsb
source organism Photobacterium leiognathi
molecule tags Oxidoreductase
total genus 33
structure length 151
sequence length 151
ec nomenclature ec 1.15.1.1: Superoxide dismutase.
pdb deposition date 2001-03-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00080 Sod_Cu Copper/zinc superoxide dismutase (SODC)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.200 Mainly Beta Sandwich Immunoglobulin-like Superoxide dismutase, copper/zinc binding domain 1ib5A00
1UXLA 2V0AA 3GZQA 1TO5A 3K91A 3KH3A 4A7GA 3GZPA 1SXNA 2Z7ZA 1XTMA 3MKGA 3CQPA 1SXCA 1SXBA 2GBVA 3KBEA 1IB5A 2C9VA 3ECVA 1OEZW 4FF9A 1SDYA 1SOSA 3L9EA 1IBDA 2ZKWA 1OAJA 4OJAA 3T5WA 3HFFA 1COBA 4BCZA 1SRDA 1YSOA 4A7GF 1JCVA 2AEOA 2LU5A 1B4LA 1U3NA 3GZOA 3KBFA 3KM1A 1F1AA 1OZTG 1HL5A 4BCYA 1SPDA 2AQNA 5KBLA 1F1DA 2ZKXA 4A7QA 1SXZA 1IBBA 4L05A 1PZSA 1KMGA 3SODB 4B3EA 2AQQA 4A7VA 1SXAA 1E9OA 1YAIA 4MCMA 2GBTA 2XJLA 4A7SA 1PU0A 3QQDB 1PTZA 1XSOA 2APSA 3ECUA 2XJKA 3F7LA 2AQTA 3KH4A 1QUPA 4N3UA 1IBHA 2VR6A 1E9QB 3F7KA 1OALA 2AQSA 5CU9A 1B4TA 3HW7A 3KM2A 1E9OB 2AQRA 2C9SA 3GTVA 1Z9PA 3QQDA 1F18A 1BZOA 1JK9B 2C9UA 2E46A 3HOGA 3GQFA 4MCNA 1DO5A 1HL4A 1CBJA 3CE1A 1E9QA 3RE0A 1EQWA 1YAZA 2Z7WA 1ESOA 2WWNA 2E47A 1S4IA 1JK9A 1F1GA 2ZOWA 2WYZA 4A7TA 4BD4A 1N18A 3PU7A 1L3NA 1TO4A 1MFMA 2Q2LA 2JCWA 2WZ5A 1E9PA 2WZ0A 5KBMA 4N3TA 2SODB 3CQQA 1SDAB 2ZKYA 2WZ6A 1N19A 1RK7A 1EJ8A 2AF2A 3S0PA 2WKOA 1FUNA 2JLPA 2Z7UA 5KBKA 1OZUA 3MNDA 2K4WA 1CB4A 2AQPA 2R27A 1XTLA 2WWOA 2Z7YA 2VR7A 3GTTA 1SXSA 1E9PB 3H2PA 2WYTA 2VR8A 4U4IA 1UXMA 2NNXA 3H2QA 1IBFA 3ECWA 1BA9A 1AZVA 1Z9NA 4A7UA 2GBUA 1P1VA 2WKOF 1DSWA 3L9YA 4OH2A 3LTVA 1Q0EA
chains in the Genus database with same CATH superfamily
2J56A 4N6RA 4DP8X 4F7PA 1KGUA 5E9NA 1AYRA 2H2SC 3L3HA 2NUPB 4OLUL 1HEZA 1OGPA 4PJDB 4HC1A 4RCAA 5I8KH 1GY1A 2W91A 4LVHC 1NMAL 1YNTA 3RWDA 3MXVH 5D6CA 3WHXB 4JO2H 3LOWA 1ZTXE 3ZTNL 4S11A 2G2NA 5I0YA 2ZXBA 3B43A 2JJSC 5GZOA 2CHXA 1WHPA 3MLZH 5FYKE 2MH4A 1RUML 3BWAA 2K3TA 2VLJB 3OMZA 4MNQB 5TE6L 4ZOBA 1BP3B 3B2PA 3M1OA 1AGCA 2VLLA 5EU7E 3NN8A 3KEHA 4M9OA 5D5MF 5KOVC 3S8FB 3VSUA 1GYVA 3GK8L 1T5KA 2AJUH 3G04B 2H2SD 2CLZA 1W80A 3FAWA 1CICB 2X4SB 5GGUA 3ZE0E 4AC4A 1A6ZB 1KCLA 2EDOA 2HH0H 2GITA 4Q4EA 2CHNA 5ESVB 3TURA 3GMQA 1Y6MR 4L4VD 1EJOL 1EZVX 3QCUL 3GC3A 4XB8A 3AGWA 1ZCRA 3FSZA 1OPOA 3A47A 5HGDB 4NT6A 3LZFL 1HWHB 5E23A 1FO0B 1WCBA 3KHOA 4C4UA 1MDAA 2AERT 5FYLH 2CDEB 1JK9B 1G7IB 4J27A 4NZDA 4QRPD 4ZFOB 3VMOA 2BY2A 3QPXH 4FP8L 1QR1B 5SWSD 4M7JL 5LCVL 2E59A 4OIBA 3WEXB 1MIEL 5B7MA 1NGWB 5HJBA 1CDBA 1YO4A 2VC2B 4PJCB 2RFXB 3RVUC 4L8CB 2WWNA 4ZW8A 3MR9B 3EYOB 4LHUD 4N2CA 1TVBB 4BWTA 5D55A 5L9DH 3AAZB 5FLVA 1NLDH 1J11A 4UDUB 4AENA 3PP4H 2WKGA 3SPVB 3MLYL 4D7PA 2RA1A 2EO9A 1EO8H 3VFWB 5F1SA 3JVGC 5D7SH 4X5RA 3B8YA 4DO6A 1IIIA 3V95A 3RL1A 2FJFA 3ZDYB 2FO1A 1RUQL 3CQQA 2VJ8A 4K3GA 4KKCC 4HUVB 3T0ED 2FZ3B 4Q56A 5F9OH 4L4VB 3WDIA 1AHKA 1TLKA 4QXGH 1ZS8A 5E6YA 3L45A 3PJSA 3RVUD 5LQBH 3TX4A 3I74A 4GRWE 2F54E 5KVDL 3WFZA 1NJ9A 4QRPB 2EE9A 1AQDB 1G5AA 5F88A 5C09D 3IDIB 5SWSB 1T22A 3GF8A 4JZNB 5IOPB 1OSEA 1R5IA 2VZOA 3Q8FA 1TU2A 1DTUA 2PWHA 5ID1B 1EPFA 3BZDA 4LHUB 4N6QA 4KKCD 1T83A 1V3JA 3CXDL 3HC4L 1DVXA 5B3JE 5ID0B 1A22B 1P6WA 3EJRA 4AQ1C 4Y4FA 3JWNC 1UH2A 2M1KA 2C9VA 1X9UA 5D72H 4MX7A 2FRGP 2FGWH 3BKYL 2B77A 3T0EB 2D7TH 1HAWA 1ZK9A 3O6KH 1K4CB 4OZGB 2OZ4A 1YDPA 5I9QC 3UDWC 1COBA 3RKPA 2FNWA 4OLWL 3ZTDC 3OKKA 4DKDC 4O51A 4YHNA 4CN6A 4GT0A 2FD6H 1MF2L 2A6JB 3P4NA 2Z1PA 3PJLA 1VGKA 4KI5C 3H7BB 4XHJC 5IV2A 2WV3A 4ZMNA 1IEAA 2O5XL 3BEWB 4YDMA 4G8AC 5C09B 5TE4H 1T0OA 4PJAB 2Y5EA 4PUBL 5DK0B 4Q89A 3SDDD 4LHJB 3U4KA 4TSBH 1JI1A 5CSGA 2EKJA 4IIQA 3ES6B 5IHZA 1H3UA 2ZZUT 1MHHA 3K80A 2VXUH 3AFLA 3WNJA 1QUPA 4KXBA 4P05A 4X0KB 3P4OB 4FNLH 3CHRA 4MXQC 2DQFA 4WQOA 5DT1H 5DVPA 2JCCE 3QZWB 3KPSA 2YPKB 1BM3L 4HCRL 2BNUB 4P2QD 3ULVF 4MAUL 3MNZB 4XHJD 1RFDH 3H9HB 5IREA 1AI1L 4HUUA 3VRJB 4HIEA 3RLSA 1GGUA 3LIZH 2YA0A 1DQVA 2QHLA 5F7MC 5LGHL 2DTML 3B2VL 3H9SE 1D5MA 3LKOA 4N2DA 4GSUA 5HHXL 3MJGX 3SGJA 1VKXA 2E0PA 1YY9C 4JPVL 4XO4A 3X3FH 3VH8G 5AW5B 2AJ3B 4IK7A 4HGWB 1KGIA 5D93C 5B39B 3NBNA 3L8QA 4LU5H 4YBLC 3ZDWA 3SDDB 1G7MA 2HRLA 4MXQD 4AQ1B 1TTGA 1YYMH 3CXHJ 3MJ9L 3U1SL 1NDTA 5CD3B 2X0WA 1AJ7L 1IBGH 1GGTA 1NCWL 5I9QB 1FFOB 5KS9E 4YSDA 5F89A 2O6CA 2J21A 3II2A 5EEVA 1C08A 1YY9D 5FLUA 2C3XA 1MCEA 4P2QB 3RQ3A 4HT1L 5CMAB 3WTSA 5JYLA 1UOLA 3P3TA 3ARPA 4KK8C 4K9EC 1T04A 2HFTA 1T2QH 3ECWA 4Z7IA 2XIIA 5E1GA 2FTAA 3V4PH 3EYQC 3CDZB 3ZDXE 2IWKA 4EDWL 5DR5H 3WNOA 1NPUA 3L3OA 3S3JA 1UASA 2MTPA 5CCHE 4QF1B 5ABDE 1CGVA 4D3CH 5C0CD 1UZ8A 1PLAA 3F3HA 4PJGF 4ZMVA 4NO2B 4HC1L 1OO2A 3AXHA 1UKQA 1K8IB 3IKCB 4Z78A 1NMBH 4NYLA 4KK8D 4DVRH 1B0GA 4TULL 3HEIB 3O2VL 3HMXH 1W0VA 2DWDA 1Z9SA 1DVSA 3EYQD 3W81A 2BXZA 1A7OH 4HAFA 3CBRA 1U91A 1KPVA 1HIML 3W39A 4XCFH 4M5SA 4FTVA 1S7UB 2EP6A 5D93B 5DD3L 5FM5O 1P4BH 5T1KD 1DDTA 3O3EA 4YBLB 5EOTA 1CG9B 2UZIH 1OP5K 2AEIT 4NFBA 2VDLB 3S3PA 1MFAH 1KLUB 4QTFA 1K6QL 3NPSC 5CIPA 5I1JL 3EG9A 2XIBA 1AGBA 3BKJH 1DUZA 1FVEA 3QRFM 3FB6B 1H3WM 5CJOH 4F9LC 4GKZB 4L9LA 4AJYV 3ABKB 3E9TA 5C0CB 1NLBH 3DRQA 1GCYA 3QH3A 2BC4A 4CMMB 5D96C 3VI3F 3KBHE 4B9IA 3ETSA 4HBCH 5FKAA 4LLVB 4O2EA 1EBPA 5IQOA 3TYFB 1M9SA 2CIKB 2AKRB 3CSPA 1E30A 3NJVA 4Y5XC 5DYOB 2Y2YA 2NLJA 2E46A 2F1BA 1ORQA 1PMYA 2OX5A 3F8UB 3FTWA 1P7QA 1MJ7H 1OF2B 3GMOA 3JV6A 4LBEA 3VDAA 5CLTA 4U05A 1R1CA 3JV4A 4FG2A 4J4PC 2XWDA 5T1KB 1QNIA 3G9VA 5BRQA 1EAOA 1U8HB 3EXLA 4RVBA 1EUUA 5E56A 1VACA 2MJWA 3TPKA 3I2CH 4HYTB 4E5XA 1OARL 1IFHL 4NZTL 2AQ3A 2FATH 2MOGA 2WXPA 2ZKMX 3C6SB 2AEQL 2XWEA 3U6XA 2OMZA 4HG4J 4WI4A 2VM3A 5JIDA 4ABQA 1ZHNA 3S37X 2WBXA 3KPNB 4MWFB 2ATPA 4J3UA 5DS8B 5LO7A 2DBLL 4BK4A 5KVEH 2CQVA 2P44B 4M3KB 3CZGA 1KWKA 1E9PB 3KYMB 3ZMNA 4J4PD 4P3DB 3ME0A 5B38G 3N1MC 1BZEA 3SD2A 3QORA 3R7QA 1UZGA 1JGUL 4JFDE 4JX0A 4NERA 4XNZC 5F7BA 1OM9A 5I1DB 1MWAL 3NPSB 3V9FA 4DW2L 4Y88A 3L4CA 4QNPF 1HXKA 1ZA6A 5DJ2B 3CUPA 3LS5H 4MA3A 1AQ8A 5CGBA 1IFRA 4GG6B 1MVUB 2KQNA 5D96B 3VWKA 3NCWA 4Y9BA 4V33A 5K39A 3COOA 4IRZA 1T03H 3V0VB 4BSVB 3NCFB 2W9EH 1YEKL 2LHAA 4PJ5A 4Y5XB 4G80A 4L8SA 4P59H 4AY0A 2ZKWA 1ZLUH 4C4KO 5FW7A 1ECYA 3U2JA 3V8OA 4CSSA 2C4FT 2I7OA 5EU4A 4O5LL 1NBYB 1WISA 1T1YB 4H26A 5EG6C 1CFNB 4HOXA 4QOKD 4M3JA 5HYSA 2OZ4L 1MFNA 3T8XB 4P06A 2K7QA 3CSYA 2GHZA 4L8DA 3FQNB 1WS8A 3LNDA 1D9KC 3H56A 4RX4D 5KVGH 5KTEH 4H5SA 3GSNL 1A1MA 1ORSB 3C5ZA 4M6OH 4NP4H 1D2OA 1N59A 2QVTA 3RB5A 4HLZG 2KERA 3TBTA 2DJUA 3KCPA 2FVNA 3UC0H 2OKMA 3QWOB 1PD1A 3VWJA 4NQEE 3D69B 3WL9B 5AQ0A 3QCTH 3FHEA 1KB5B 4XB3A 4U6XB 4APXB 3MRNA 2Y23A 2CG9X 4IKIA 3KPQB 1TJXA 3RBSA 3MV8B 4WW2C 2VLKE 4DESA 4K94H 1IBHA 3A6CL 1QNZH 1RUKL 2X4PA 2VDKH 2XPGB 3BPCA 3RWFA 4PV8A 2CIIA 3TO4C 4X6DF 5C0IA 1D9KD 4JN2B 5I8CB 4YH6A 1ZWIA 2N1TE 5C0FA 4JRFA 1HHHA 1UFGA 4QOKB 1IAIL 4XNZB 1AE6L 1Q0XL 4XGZB 3G9AB 1UYWL 1WIPA 1NM4A 1PLGH 4Z77B 5IQ7H 1E8WA 3BRGC 1GW0A 2RB8A 1VFMA 3A4FA 3OPUA 1ZLWK 4PY7A 4OGXH 5DJCA 4MA7L 5JO5B 3HBQA 1RIHH 4WFFD 5EIIB 1S9WB 1M6OA 3IDGA 1O7VA 3SQBA 4JNXA 4AYSA 4B27A 3ZW3A 4OLEA 4FFZA 1RU9H 2R4SH 5ISZD 5CNHA 1NEUA 1Y1DA 2IDTA 3CZFB 3I3DA 2J1WA 1KTKE 4GAAA 3RWCA 1U3HA 2KLTA 4DETA 1E4KA 4GAJL 4Y1SA 4RGOL 2R4RH 3VAEA 4PRHA 1PG7W 4HJGA 3QDME 3NSXA 4PJGB 4QWWC 1ZHBA 4HWBA 4JKNA 4KGJA 1TEYA 1UD4A 4F7CA 3SKOA 1D9KB 3P73B 4Z9KB 5E6IC 2FQEA 1LEKB 2HFFB 4K2UH 1EAQA 1BVKA 3WN5C 4DKAA 2AXFB 3N5AA 5AVZB 4UT6A 1RK0B 5JW5B 4IDLA 3QJRB 1LNUA 5F1IB 4GEJA 4MVBC 3K71B 3FT3A 1J88A 2AFNA 1IQDB 4R90L 1FPTH 1CU4H 4M5TA 4OFYA 5ADOH 2J2ZB 4S1QH 4E9XA 3VX1A 2NXZC 3MJ7A 1OAQH 5BCAA 5J6GB 1DR9A 2NX5E 4QWWD 1MIML 3BPOC 3GSXA 4MA1B 4D9LH 4EIZC 3KLHC 3VO0A 2QVKA 2CJ3A 3QPKA 3HG1E 2C7FA 5ISZB 4W6XB 2EH8H 5E6ID 2P52A 4DZBA 2NY3C 4OR1A 4EN3C 1YECH 3VI4E 4HJIA 3IYLW 4IU2B 5JXEA 3TEYA 2YUWA 4GO9A 4F33A 5I16B 3FT9A 1I1AA 5CN2A 2X6MA 4MVBD 4DFIA 2ZYIA 2VXSL 1H6UA 1T80A 2OTUB 5F7UA 5KVMC 1YNTF 2Z65C 2MSPA 1UB6A 5CJ5A 2FBRA 4G1MB 4L1HA 1A7RL 1IKNC 3EFOB 5IGXL 3H85A 3KLHD 4TSCL 5EV7A 2J4WL 3K3QA 2KS0A 3KLQA 5B1BB 2NY3D 5HHVH 1VFBB 3QQDB 4G42B 3NCXA 4GQ9H 4EN3D 4IBSA 2I60L 1BJ1J 3BGAA 1WWWX 2G30A 4KOCA 2B0SH 4X6BB 1R3JB 4A67A 4C55A 1KWGA 4DP1X 5MEOA 5J9PB 4JLRB 4QHKI 2HJFA 3O11B 4KX7A 4JHWL 2Q7YA 5E6IB 4QHMB 1LP9A 1M42A 2WTPA 3HR6A 2EO7A 1U8KA 3MTRA 5D1ZA 1R5VB 2HRPL 3WN5B 1PX3A 4FLHA 3Q0HA 2P49B 1HL4A 1JPST 1RZPA 1ILSA 2BDNL 5DMJB 2R0ZL 4K3HA 1BLIA 3WE6A 2NCMA 3MRDA 2DQMA 3DJSA 4HX1A 4NWTH 2K45A 4WHCA 3CDCA 1NFAA 3DSFL 3QDGE 3RRQA 4DPCX 4GRMA 5D70L 3ERXA 1EJFA 3G5XB 3FUJA 1I3GL 4NUGL 4ZFFB 2R9HC 2Y1ZA 4QDGA 2NY3B 3H9YA 5D6DC 5FUOL 4HCIA 3BH9B 4DEUA 3UTSE 4EN3B 1GJIA 1E4WH 1XCQB 4QJ3B 1GOGA 4IS6A 3TT3H 5KJ7E 4G9FD 5KVEE 4ELMA 1JUFA 1KV7A 4JDTL 2OJEA 5EOCJ 2NNFA 2Y7OA 3LN4A 3MA9L 5AUMA 2ZCZA 1ERNA 1EHNA 4QXUH 1I1FB 4LP5A 4NEHB 4WDIB 4G11A 1I75A 5FUZL 2ARWA 1CD1B 3LB6C 2X0VA 5CILH 5E8DH 1F4WL 5GQBA 5IG7A 2NT1A 3SBRA 1I8LA 5IMMB 1OSZB 4F7MB 4RQQB 5KSBE 1BAFH 2WN3A 4B53A 3WFDH 3EBHA 2Y7QB 3DGCR 1PFCA 2R9HD 2QTEA 3IMUA 1SMAA 3IDJA 2WCGA 1NGPL 5LAXB 4UINL 12E8H 3A4DA 1YHPA 1Z3GH 3JT0A 3IU3A 2YPLD 3GBLA 5GGTA 1SUHA 3S9DB 3DTXA 4DGWC 2CO7A 2R2HB 4N9GA 1MLBA 3L13A 4ORGB 5C08E 1LO0L 4DERA 3ML8A 1KTCA 4CKQA 1KGWA 4ZAKA 2ID5A 4URTB 2IG2L 3T6VA 1G9NL 3LB6D 2ODIA 1I8KA 2EKSA 5D7IA 1TENA 2BWQA 2CBQA 4G9FB 4XN4A 4X7FC 1RJLA 5HHPB 4PFEA 4WTQA 1GPOL 3KM1A 4X6DB 5KVGE 3O3BA 2QHRL 3HC3L 1GC1L 3ECBA 4PCSA 1JGDA 3S5LG 1YEEH 4PGCB 1ZSHA 2J71A 4UAHA 4H20L 1D5IH 1V7NH 1SNRA 4JY6B 2WIIB 1OANA 4Q58C 3V10A 3HNTH 1PNCA 4LLMA 4DEPC 1YEGH 1T7VA 4F3FA 2APFA 7CGTA 2XKSA 1NCAH 4LHQB 1FFNA 5DQ9A 1U8OB 1PU0A 4PJBB 1PTZA 3QJQB 2F58L 1U8JA 2A9ML 4KRNA 1JPSL 1KYDA 2YPLB 1TNNA 4FI6A 5GZOC 4S10A 43CAB 4ALAC 3HNSH 5DDHA 2RACA 2VDOL 4OFIA 1C7TA 1GIGL 2Q86A 3GSVB 5LBSL 3ZZLA 4CU7A 1PNDA 2ZP0T 2AQRA 4R4FH 5CLZA 2VSKB 4PIRF 4XNYH 4JPIA 4N0YL 1HNGA 4R3SB 2OTWB 4QT5A 5IB1B 1N6QH 4KZEH 3IFNH 1ZT4A 2WSPA 2W0PA 3C6LC 1LWJA 1RPQA 3ZSTA 2ZG2A 4F5CA 4HJEA 4NM8H 4A6YA 4KTEH 2ZIDA 4DKFH 4FGMA 4XO8A 4LPYA 1MEXL 4FHKA 4XCEB 3U9UA 1UCBL 4X9BA 5F7DA 4KAQL 2I07B 2OP4L 5GZOD 3O3UN 3ESOA 4I9WE 3D06A 2DQ6A 1W9XA 3OQRA 1F97A 2YA2A 3RJDA 3LQAL 1Q9WA 3OVUB 2XN9A 1NAMA 1P5UA 4FFZL 2OSWA 4OFQA 3FQ2A 3KPOA 5AVYB 3S2CA 3C6LD 3E7JA 3ARUA 3P9MB 2AK4E 3DX6B 1EXGA 3FSWA 2YD5A 4C58B 2P9RA 3F64A 4HWBL 4XNQB 1FG9C 5DUBA 4WHYG 4UTBH 3VXOA 1DO6A 4F7PB 3CZUB 3ZGHA 3VSQA 2K78A 4JKLA 4DEPB 3CVHA 1WC7A 4X8XA 1GKOA 4P23A 3BN9C 3ASOB 1DCLA 1FP5A 3OXSB 4RBPH 5D6CB 5KSAA 2BWDA 1J8RA 3T2QA 3QHFH 2DJSA 1OW0A 4ZYKA 5AL0A 3MRLB 3B5TA 3LRSA 3D25B 3V4VA 4L29A 4XBGA 4AYEC 4XXDB 5GPRA 1SUJA 3ECVA 2WNWA 4XNXH 1AGCB 2VLLB 3NN8B 3OKYA 3BH8A 1UD3A 5CAYB 3SOTA 4QHPA 4N2FA 2G9KA 2XY2A 2R0LH 4YHOH 5ERWB 5CP3A 3IJHA 2CLZB 3SE3A 4NNPL 4E9YA 3C6LB 3HG5A 4OM1H 1I9IH 5GGUB 2ZCLH 5BV7C 3T0DA 3P4MA 1M56B 3WJMB 3BN9D 1X5LA 4KRPC 4HMEA 1JK8B 2GITB 2CWRA 4W9JC 1E50A 1FNFA 3X1FA 3E8UL 3LSOB 3GMQB 1CGWA 3T4AA 1AFVH 1IGMH 5DFWH 1U8IB 2I85A 5FX3A 4B3EA 3AVEA 3Q8BA 4IKLA 3KVQA 4KUCD 4PB0L 4PWEA 1WCBB 4PJFA 1O6SB 3FQ4A 1MCJA 1Q0YL 1RQ5A 3CZJA 4Y1TA 4H7VA 4OLYL 5ESQB 5F7KC 1OALA 2AQSA 2YD1A 4MGXA 1ZDSA 3UOAB 4KRPD 2Y1VA 4X80H 2DTSA 3RUGB 1BFOA 2P46B 2BIHA 1CGYA 1TSRA 1DJSA 1V10A 4OQTH 4KC3B 3MJ6A 4MCNA 3QO0A 3MYJA 4AENB 4DKEH 3STZA 3CH1B 1CLZH 5DRWA 3TLRA 5B1JA 5EU3A 4Q8BA 5HYQA 5FXCH 5KZCD 1DLHB 4QGYA 4F7TA 4XN9A 1U33A 4IIQC 3BUYB 5IM7B 3O45A 3GHBL 3BGFC 2ZOWA 2Q9OA 4EBQL 1MNUH 4ZFGH 4NLHA 2DM7A 5IJKA 2VXQA 3MFFA 2XNAA 2XN2A 4KHTH 4JFEE 3WY2A 1N6VA 4NIYE 1C8QA 1KCSH 2BERA 1RIVH 1QWNA 1Q9LB 4O4YL 1NJ9B 4GSDH 4JB9L 4MB4A 4YDNA 3APNA 4MKTA 5F88B 4FQ2L 2AF2A 1T0MA 1NFIA 5ETUB 2QQLL 5BV7B 4XVJH 3DPBB 4ZMTA 3SGJC 1UTDA 2YD9A 1TU2B 4G5ZL 4XP4H 3OLIA 4KRPB 4YC2C 5F6IC 2BFVL 2LTQC 3ZDZF 3DETC 5ICZB 4LNRA 1F90H 4F8PA 3DXAE 1JGEA 2MWCA 4YXLH 4LDEB 4P5SA 1IGFH 2VSDA 2MPAH 3LDBC 4HJUA 4NLAA 2DWXA 4HPOH 3UAJC 1ACZA 1J12A 5KZCB 3KPSD 4MX7B 3ZT5A 5CM1A 1DJYA 2BVPA 3AT8A 4I8DA 1MJJA 5CSBA 1YDPB 3OG4B 1S7XB 4FLRA 2ZCHL 4IU3A 3OKKB 1J8KA 3FT2A 4O51B 2FX9H 3F65A 1P84J 5GGTL 2Q3AA 1SDYA 1VGKB 5HGHA 5IV2B 1WAPA 4JKWA 3LIUA 1IX2A 2IQ9L 4YSPA 2PPDA 4IEFA 4U3SB 4R7VA 2BVOB 3MOAL 5JW3H 2DLTA 2DYPA 4IKJA 3UAJD 3PAVA 1MREH 3L4TA 3SBWC 1KJ2H 1YN7A 4IIQB 3CLFL 2FSEA 3B1TA 5IHZB 2EDEA 4UQ9A 5TK2A 3S8WA 1KIRB 1F6LL 1A7NL 2GIYA 3RIAK 4YFLI 4YHYC 5I2IA 2DQFB 1MFDL 1IGTB 3DGGA 3HKFA 3KPSB 3UG3A 1J1XL 3RHWK 3SQOH 5C0EA 3D85A 3Q1SH 1QRND 3QQ3A 3CX5J 2APSA 2X6VA 3SQRA 4IK6A 2W65A 3WNMA 1JZ6A 4HUUB 3LRMA 1S5IL 4HIEB 4AGLA 3WKML 3K6IA 4IKKA 4XBPA 1S9VA 1AIFA 3HI1A 3M8OL 1CDIA 2CKBB 2YMTA 3LKOB 5CFHA 4XC3H 4YC2B 2QZQA 2LTQB 2JKJA 5F6IB 1J5CA 4K7PL 1B9KA 1MHPL 1QSEE 3WKPA 1TCMA 4RFNC 4ZUWB 4G8IB 5D4HA 1VERA 1BD2D 4HEPA 4LSRH 4NUMA 2XPYA 4IBQA 5BXFA 3RE0A 3ATFA 1IMHC 1MCPL 3DX8A 3H0TA 5TGBA 1TEGA 1RAMA 4G8GA 4A6YL 4L9LC 1R0AH 2LT9A 2G3NA 1MFBL 4Z7QF 1HNFA 4AM0B 3EIFA 3FN0H 4ONHA 1OE2A 3F58H 3S3CB 2X2JA 1TKWB 4NI3A 4EIUA 1UC6A 3D0VA 1KXHA 1UM5H 3AM8C 1QEXA 1QRNB 3ZIMA 2IFGA 3ZTEA 4FKKA 3MDJA 3DO7A 4S1SL 5IVNA 1Q90A 1I31A 2VDNH 4P3WA 2KZBA 3TCXA 7FABH 4I3RH 3BWUF 5G5DB 2DI9A 5IUSA 3GXTA 4TV3A 1BQHB 3HS0C 4JZOB 2NY7H 4Z6AT 2CLRA 3A3YB 1BLNA 3EZ8A 3L3OB 4GRLC 1W72B 1BD2B 3DTUB 3ILPA 3L7FA 4YHYB 3GIZH 4JDVB 4A37A 2YRLA 5F96H 2DM4A 2J5LB 3UTPD 3ZKXC 4IGBC 1QFUH 1WUNT 4JREC 4Z78B 2Z31A 4L3CA 4YX2L 1WYJA 3B6SB 1ADQA 3OZKA 5DLML 1B0GB 4C56A 1YEFL 2FBOJ 3LNFA 1W0VB 2DWDB 1Z9SB 4FHJA 1I7RB 3BLBA 4TUKL 4IBLT 1U91B 1XGQA 2WMPA 3W39B 4RFEB 2V5YA 1Q9OA 4RFNB 3TV8A 5LKNA 1DQLL 1PZBA 4LSPH 3UYRH 1S7QA 4B9ZA 1IGJA 4WTZA 3IKKA 1OQXA 2OXGA 1ND0B 5JNYB 1HWGB 4IGBD 4NI6A 3MQIA 1AGBB 2GY5A 2R1YA 4ZW6A 1DUZB 3KLDA 2Q8BH 5CCGE 3U6XS 4GH7B 4L9LB 1F0LA 4Q7DA 1PZSA 3DRQB 3QH3B 2WBKA 5I18H 2YAFA 3S37H 5FKAB 5IWLA 2BNRA 2E7MA 4O2EB 3L7EB 4U1NB 2TRHA 2QTVA 4CSTA 4QHNB 1L0PA 1Y1UA 4L8SC 2HN7A 4EEEA 2DPKA 1ZVNA 4HU8A 1ORQB 4ODTL 5GGRY 2J8HA 5E70A 1S8DA 3B7TA 1H8OA 1JZJA 2PWFA 1QLFA 3HS0B 3GMOB 3MLRL 5F7EH 5ABZA 3JV6B 3NJIA 3WHE1 4WNQB 3HG3A 3RIAF 3JV4B 1GGIH 2A77H 3C5ZC 5JIHA 3ULUF 4S1RH 2AJVH 4P46A 4YNYB 3RHWF 1HINL 4PJ8A 4K3EL 1KJ3L 3VWJC 2QJDA 2YRZA 1BHGA 1VACB 4IGBB 1A0QH 1AS6A 4JREB 4PJ5D 3T3PF 3QXWA 1JF6A 1WK0A 1SEQH 3G08A 4JGMA 1LP9F 3SD5A 3SO3C 2VITA 4YIQA 3F6JA 2WP3T 3B3BA 1ZHNB 3REWA 2HYMA 1L7IH 2EIZB 5JA9A 4DQOH 1KLFA 5SV3A 3W0WE 5EBMA 1KIPA 2OR7A 2HKHL 2VLME 3P0YL 1N26A 5KOMC 3C5ZD 4I48A 2F7RA 2VQ1A 3MRKA 3GSWA 3VFVA 2WZPA 2PWDA 2H3KA 5E00B 3ET9F 3MFGB 4P2RA 2FJGA 2ZNWA 3HNVL 1BOGA 1UWXH 3VWJD 1AY1H 1T5XB 5F70A 2OQJA 4RFOH 5I0VA 1E40A 5T5FL 3MBEA 3E8VA 4P5MA 3WXVL 4E36A 2HFGL 2PTUA 1OTSC 2CGRH 5DMIH 3ORJA 3G3LA 1DBBH 1AQKH 2EYSB 2N7BA 1G6RA 2BX5A 4TRPH 5D2NE 5H94B 4W4OA 3S5YA 4ELMF 4FG4A 4PJ5B 3X11B 1NAKL 5GGSA 4L8SB 2OK0L 1JP5A 2VR3A 2OV0A 1OCOB 4WFGE 5EU4B 1E4KC 1MCDA 2EXTA 3GGWB 4DN3H 1TJGL 1OGSA 1FV1A 4YL4A 1BEXA 4OT1H 5FIEA 2R1XB 5G4OA 1JTTA 2QGDA 1SOSA 1A1MB 1ILUA 3C5ZB 3FQUA 5BOZG 1H5BA 1OTSD 3HPJB 3NGBC 2BS9A 4QYOA 2NSXA 2DQUL 3TWCL 5E5MA 5L4FA 3VWJB 1J8HA 2DD8L 4KHXH 1QFOA 3FTYA 2G60L 3D50A 4F57H 5ECJE 3MRNB 4JK0D 5T33H 2OXHB 4QHUA 4CBPA 3SO3B 2Y5TA 1OOAA 3K8MA 1SHXA 1IM9A 4HAKA 3KL5A 2X4PB 5D7IF 4HIJA 1F58H 3BPCB 4K15A 2JWYA 5EZIL 2B8OT 4FXGA 1EXHA 2ZXGA 3TNNB 1RVFL 3R7RA 3D5OF 3TZVA 3WYRA 2HJLB 4NO5A 1ZWIB 5C0FB 5DURD 3SYCA 1RJZB 1OM3L 1HHHB 3U4BH 1HHKA 2PPFA 5EUKA 5SV4A 4WAFA 3SOBL 2AJYH 2PO6A 1JRHL 3LPOA 4NX0A 4ETQA 4M4PA 5J4MA 5CU9A 1BJMA 2W0KA 2XU9A 3E80A 5IVZB 5AVXB 3EJUA 4LSVH 1PZAA 2EDXA 3LS4H 2ARJQ 4PJDE 4PY7B 5DJCB 3BUQA 2C3GA 4PGZA 3DARA 3S88H 1M6OB 3OXRA 3F04A 3SQBB 4B5ZA 2NZ9D 2OI9C 3UZEA 4WEBL 5AW3B 3H55A 1GR7A 5AW0B 3ULUC 2EDBA 4ZTPL 4JR9H 2ICWJ 1U3HB 3ZUNC 3V0WH 2IAMA 1J7VR 4OIAA 4PY8J 4KY1L 3JWDH 2VLJE 4MNQE 4HJGB 4RIRB 1Z9MA 1ZHBB 3CFKA 1O7DC 2UZYB 3UBXI 5KAQF 1XGYL 1X5HA 1N12A 1IGIH 5DURB 1BVKB 2BP8B 3NGBB 1WPCA 5IMLA 2VMCA 1E5AA 1LNUB 2JJTA 1YMHA 2FL5A 2WLJA 3B7YA 3EJSA 4GINA 3ROLA 4Z3GA 3MRIA 2D4FA 3ULUD 2O1AA 4R96B 1F4XH 1KULA 2PYEA 3MJ7B 4K3JH 1XGPA 5JQ6H 1JOIA 4U0QB 3TBWA 5ITFA 1KN2L 1JF1A 2B3IA 1E27B 2CMRH 1KELH 3B9AA 4M6NL 4DZBB 3UTZA 2V0AA 4K9EH 4EIBA 3BX7C 1MDTA 3LQZA 4JL2A 4RA0C 2VDPB 1P7KB 4PJCE 1ADQL 1OB0A 3AG2B 5BS0A 4ODHL 4PEEA 5I6MA 1DVZA 4XPGH 1UD5A 3WUWG 4H0GA 4JHAH 1DQML 2A83B 4OY9A 2GPZA 4X4YB 3EJYC 2VDQH 3H9ZA 4OJAA 4N86A 4OZHA 1MXGA 4ZSOE 1HH9B 3FB8B 1YMMA 2E4FA 2VABB 1I8LC 1QSFD 3VW3H 4U1KB 2IBGA 1JD9A 3IFPB 3O2WL 1CD9B 4QRTB 4QLRA 3NH7H 2B1AL 3ZDYE 5KJRL 3KPMA 2OI9B 4JBSA 1NIFA 2GJ6A 2ZOOA 4CUCA 4YVUA 1YEJL 3KCWA 4HEME 5IVXA 4PRIE 4L4VE 5T5NF 4MAYC 4NC2B 3SPCA 2HKAA 3KDPB 3KYNB 2B39A 4ODSL 5TK4A 1JL8A 5MEOB 3MKKA 4HQQL 4L3EE 1LP9B 3UEQA 3EJYD 1U8KB 1WZ1H 3BRFA 5SWSE 1VFAB 4YSSA 3ARBC 1N70A 5CUSH 1CFVL 4OCNC 4PBWD 1CLYH 5IFJA 3VGDA 5I76B 3WIAA 5C0GB 1SEBA 5IROA 3DDFA 1A3RL 1ULVA 5C3IA 2AC0A 1CT8B 3VXRA 4KROC 4PJFF 3FN3A 1QSFB 1MG3C 2HX9A 5AW6B 4GRMB 4UV7L 4ERSH 4H1LA 4ACPA 3BD5A 2DL2A 3SCMC 3T8MA 1JF5A 3OMAB 5D2LB 4ZAKD 2YJLA 5AKVA 4Z7VA 3ARBD 5DTFA 5FS5A 1MQKL 5I30L 2OJEB 1G43A 3LN4B 5AUMB 5IR1A 4PRNB 5AVTB 3P02A 2F19L 3O8XA 3HG0A 5C09E 4EDXB 4PJAE 2RCSH 3GMPA 3TV3H 2XTLA 4M1CD 4BFBD 4KROD 5IG7B 3BYTA 3BHBB 4Z7AA 3WN6A 2YK1H 3CVIH 1RZIB 5J6HA 4GUCA 4JY4A 1NOAA 4KTDL 1XTLA 4ODUA 3UO8B 4NRXB 3SCMD 2BO0A 2ZWNA 3T0WA 4CNIB 3IDJB 4AL8H 3WIIL 4ZMOA 2JJVA 4ZNCD 3IU3B 1FI8C 3CDYA 3WTTA 5J3HC 5DWUL 4A55A 1FRGH 4MZRA 1NBQA 4KU1A 2CO7B 4NO0A 4OH2A 1R3IL 4X7TA 3TWYA 1BQUA 4FQXA 4L3FA 4PJEB 1G6RL 4S2SA 2IDUA 4ZAKB 3DVGA 2GSIA 1N0LB 4UQ2B 4WWKC 5CZXC 5IOKA 1UM4L 3QUGA 3ARBB 4FDWA 1BQLH 1A9EB 1RJLB 4X83A 3TBSA 1ONQB 5B3SB 5CZRA 3DVFA 4NZUH 4QRRA 2H32H 3O3BB 2WXNA 3ECBB 2FYYA 4HXBH 3OZ9H 2YEZA 4M7KL 1BQRA 2YAEA 4HVBA 4AYFB 1ASQA 2VAAA 4KROB 3I9IA 4GP8B 3JWNE 4NC1C 2RR3A 4M48L 4U2ZA 1H15B 1MELA 3L3GA 4PSRA 4E9WA 2C9AA 3HZMA 1D7CA 4JVUA 4BRJA 1NGQH 1FFNB 3PXLA 3Q43A 3RVTC 3SCMB 3TPUA 1WV7T 4M1DL 3QW9A 2XN9D 1NIEA 2X4TA 2XX0A 4C83B 4WWKD 1U8JB 5CZXD 3FMGH 2IOOA 5MEQA 2XFGB 3WENA 3DI2B 3UTTA 1R34A 4LASH 2AQQA 3BAKA 3F5WA 4KI5E 2Q86B 3V0FA 1RV6X 1L9RA 2Z91A 4N0UB 1DSFL 5F6HJ 3K4DA 5JIIA 4KNUA 1JYXA 3FU7A 4WK2B 3U0TB 1GTFA 1ZT4B 1NUDA 4X5XA 1RI8A 2QPSA 3ABMB 3L3DA 5I1IH 4OLXL 3RVTD 2XFXB 3BEVB 1HK6A 3UC2A 3HOGA 3U9UB 3X1BA 2VDRB 1OF0A 5F7DB 1R24A 1XMWA 1YEIH 3CFCL 3AROA 4X8JB 3EADA 4X7SL 1KJVB 1RERA 5KYXB 4WF7A 2XN9B 1U4FA 5HDBE 1NAMB 4JFSA 3MVSA 4WWKB 1ZY9A 3L08A 1FFPA 3KPOB 3QA3B 4NJ9L 1BVZA 1GRWA 5DO8A 1OOWA 2Q2LA 1DP0A 2VGLM 3GXDA 4OFDA 5PCYA 4HOWA 4HG4K 4KZDL 4XOBA 3CZLA 1A25A 4U49A 1TZGH 3APCA 2XQYA 4MJ5A 4UT9A 5DUBB 2YGVA 4XMPL 3VXOB 2DKSA 4F58H 4U1HA 2FUQA 3CVHB 2XTSA 1WC7B 1NOLA 3ZU8A 1SN2A 1TJIL 1IC1A 4MZ3A 2YZ1A 1JPTH 3J7HA 3MRJA 4JM2C 4HWZA 2EAEA 2CO1A 2YMXH 3NZHL 2O61A 2TSBA 1BQKA 4ZYKB 3LRSB 1XSKA 2OJ1A 2G2RA 3V4VB 4L29B 4B41A 2ZOTA 2WXIA 4XCCL 1ZGLP 4UWQB 1EX0A 4U1MA 1A4AA 4ZUUA 3BH8B 4UNVA 1JFQL 3EFDL 4HF5L 2ENYA 5HY9A 5TE7L 3IJHB 2XN1A 4Z0BL 4XBEH 5AVUB 4BFNA 4LIQL 2PP9A 3P4MB 4HS8H 1B3IA 1G1KA 3OL2A 3U7YH 1KYOK 1T0NA 4JM2D 3QZMA 3QR1A 3TA3A 3FCGA 3MLSH 1IQWL 2GJRA 5F3HA 1R3HA 4YXKH 3EAKA 2KQMA 1QI3A 2C3HA 4NQCD 4O00A 3HR5A 3NABH 3PREA 2IGFL 1F4AA 3IVKA 2NR6A 2C1OA 2HUHA 2F54A 4G6KL 1JN6B 5FA3A 1BBDL 2AEPH 4MDIB 4RWHA 2CBPA 2V9RA 1T21A 5DA0B 1KJMA 4FQJH 5IM7A 3FF7A 1I7TB 1DZ0A 2DQEL 4R26H 1ZRUA 2QEJA 3MYJB 1HSAB 3IXTA 5EEZA 3CZEA 3D48R 3TP4A 3IBOA 5EU3B 3KHQA 4EQ3A 5C0JA 1BYNA 1KPRA 1TXKA 3HFMH 4JM2B 2JTYA 3DV6A 2ZX7A 4GG6E 3L5XH 1R3LA 3QPQC 3Q01A 2WY3B 3DX3A 4OCYL 3FYEB 3D34A 4N2GA 4A2LA 3MFFB 4NQCB 4NGHH 4BK5A 5C0RL 2VISA 3K6NA 5C0BD 2NY5H 2LOEA 3GTNA 5I24A 3FRUB 3LQMA 3UJJL 5FFOA 1XGZA 4P8QA 3GXIA 3VVWA 1OE3A 1RL1A 2IBZY 3SGDI 5DFTA 4TYUA 4X5QA 4XCYA 4X4ME 4D0BA 3QBTB 1NFIB 1EGJA 1T1WB 5D7LD 5AFAA 3ASWA 3HMWH 3QC5X 2C1PA 4JS7A 4RDQG 3VE0A 3ETBJ 1DVFC 1JGEB 3QPQD 4ABVA 4KUZL 2QGBA 4HWEL 5EF0A 1I85C 2H1PL 5AB0A 5K69A 5DC9B 1CB4A 5FGRA 4MMXC 2JCCA 2WLLA 1BMWA 5EOCL 4R8WL 1CFTA 2BVPB 3D85D 3TN0C 3LYRA 4QTIL 3S35X 4B7LA 3HBZA 3HI6H 3TM6A 1JNHA 3C9NA 3CHOA 1YRKA 3MBWA 1CPUA 4ZTOH 1DDHA 2HVBA 3FT2B 2Q0ZX 3V5KA 3EDKA 1FGVL 1KF9B 2P3YA 2X4RB 3MUHL 3UROR 3NFPB 4LP8A 2E27H 2E7LA 1DVFD 4QOKE 5DHMC 2X1XR 2NW3A 3FCBA 3IFLL 4QRUA 2RJMA 5D7LB 1QBAA 4YXHL 5EBLB 3E6FB 4UT7L 4H8VA 2I5YH 2J88H 1YN7B 3KPRD 2EXWC 1R9FA 3CLEL 3CN1A 3US9A 4JGUA 1ZIBA 4UM8A 3ABZA 2CHWA 2VSCA 1JCVA 4UQAA 4CVUA 6FABH 2L7QA 5KS9A 3V6ZA 2C3WA 1MAJA 5I8OH 4KFZC 3UIYA 3V9CA 1N2RB 1SY6H 2R69H 3LD8C 3VTTA 5C0EB 2Z31C 3D85B 2X05A 5KYUA 1SXZA 3HKZA 3QUYC 3TO2A 5HHQA 5J7CC 5JOFA 3MRGB 3PCYA 3JYCA 4ZO8A 4HISA 4GEIA 2QVFB 3HI1B 3VFOB 1EEQA 1VDGA 3MYZA 2JMRA 4MZIA 2MKLC 3BZ4B 4OQ1A 1FYTD 1I9JH 3NAAH 1DVFB 2EXWD 4KJYB 4UMGA 2XZCH 1XV8A 2F7QA 5BXFB 1HHGA 2XI9A 4KZCA 3VD0A 2A1WH 3DPDA 2AMGA 3DX8B 3GBNH 2XXFA 4LOUC 2BRRH 4Z7UB 2Z31D 3KPRB 4LLDA 1WZMA 4C56D 1YYLH 5CO1A 4L4TD 3BLKA 3L5IA 2IFFL 4XPTH 4ONHB 1JZIA 4JJ5A 4U7SA 1OWRM 1RIUH 3D6GA 5IWLC 1RKRA 2EEDA 4KMQA 3SEPA 4TLTA 4DCQB 5T3ZD 5K9KB 2A6KA 2AI0L 3O6LH 1E5YA 2Z0UA 2DICA 5DJDA 4OI7A 1L9QA 3UAEA 3DO7B 4UMSA 2B4CC 4ZUTB 2H47C 1HHIA 5EOQH 4LLWB 4F9PA 1VJSA 1FYTB 2CLRB 4LOUD 1JG9A 2CXKA 3GSOA 1RMFH 1R33A 1FHNA 4WU5B 3D18A 4O02H 2EIBA 3SE9H 2DWYA 4M5YL 3B56A 1P1ZA 4ZX3A 5DF0A 1HESA 3AMKA 3LD8B 2Z31B 4L3CB 3I02A 5E7BA 3IEAA 2KPNA 4C56B 4L4TB 1RZQA 3L9BA 4TPRH 5A1AA 5T3XD 1B90A 5B7FA 3NIFB 3GEWB 2FEJA 1E0OB 1S7QB 3BAEH 4LL1A 5F1KC 1AMYA 2ZICA 1LO3L 1QLEB 4PJ8D 1EO7A 1MCLA 1DBKL 4AQAA 4DGVH 5BUPA 1BXUA 2OXGB 2IPUG 1C9SA 3T2PA 4PRBB 1UUNA 1V3MA 4JAMB 2D31A 2R1YB 1EANA 3G5ZA 4K3DL 5DHYA 1G7LA 2CK0H 2W59A 1E2ZA 5LXGL 3AZUA 1RY7B 4JVWA 1Q9KA 1SOQA 4W4OC 4U6VL 2HN7B 3X3GH 4U2YA 4A2FA 1QPKA 4K23L 4UU9A 3INUL 3G5WA 3AREC 4OZHF 4FYQA 5BV7H 3DWTA 4JFDA 2WNXA 1QLFB 3JTTB 3OB0K 1HKLL 4NFCA 2H26A 5E4IA 3QAQA 5IB5B 4GBXC 1OHQA 5CGYC 5IVXF 1H5BC 3QHTC 4MHHI 1IC4H 2IV9A 4PJ8B 1QMUA 3K0YA 3S96A 3NFSH 4GNKB 1A6AA 5AB2A 3GJEA 4NNXA 5DEGA 4BQBA 4Q2ZA 5IBUB 4DPBX 3S4SA 3UBXG 1ITBB 1KCUH 3G08B 3MGAA 4B7IA 2DMHA 2G3ZA 2UYLA 3QR2A 4FI8A 4YIQB 2ADFL 3ARED 3QFJD 4ZK8A 3TESA 2A74A 3DI3B 5DSCB 2APVA 4FXGC 1KLFB 4UNUA 2KT6A 3OAYK 3UJTH 4OKVA 1E6JH 1KIPB 1OAUH 5EBMB 1LK3H 4GBXD 4WJ5B 3RB7A 4TSAH 2WO4A 35C8H 3MRQA 5H35A 3QUXC 4I48B 2VQ1B 3VFVB 3EH2A 3GMLB 4MBRA 4NKDB 5CGYD 1GW6A 2D7PA 5FYJL 1X3DA 2XQYK 4NQEA 4F2EA 4NQVA 1SBSH 2CR0A 3MRFB 1K2DA 1EGJL 4JO8A 3LKSA 4G7RB 4WV1C 1LJMA 4RA3A 2HKFL 2VLKA 1SLXA 2QZ5A 4BWUA 1B88A 4Z7VF 4UQIM 4PJBE 5GSVA 4PYGA 2NCEA 1OAYL 3TZVD 1C5DA 3ARVA 3UCRA 4MQ7A 4ZUVA 1L9NA 2ZSWA 2B1HH 3QUXD 2O93L 3MGTA 2FWLB 4GFTB 4PGEA 3ZN6A 3AREB 3QFJB 4I77L 2VRKA 4LSSL 2R8SL 1ZLVH 1AZVA 1MW1A 3MLWL 4PM1A 5EU5B 3SGDH 3MJ8B 1FV1B 2BP0B 2BVQA 3P3YA 2GABA 4J3SA 3ML9A 2IH1B 4GBXB 4YSOA 2XWCA 2JI3A 1F41A 3FQUB 4EE2A 1H5BB 4Q0XH 5AB9A 1SXNA 1SVCP 2IDFA 1U30A 1M05A 3CU1A 4WI3A 5AYUL 4MSWA 1PZUB 5DRXA 2Z1KA 1TQCC 2P24A 1FG2A 3PIQB 3PRZA 2YMOA 3QJOA 2FDBP 4QHUB 4AMKL 3IB4A 1WWCA 1VADB 5JORA 4J39A 3OPZH 3QDMA 5IBTH 4FXGB 3FW6A 5J1TC 3LRGA 3TZVB 1X9RA 4MJ6A 3WEMA 1F1DA 1INDH 3QUXB 1NDMA 4JRWA 4WSKA 2GUOB 2B15A 3V4PA 2HJKA 3EOAA 2O6PA 1BVLA 2P7TA 5HGAB 5ALCL 2Z4TA 4CMHC 2E8ZA 3BH4A 4H2AA 4JDEB 3N50A 3SKJL 1W72H 4WV1B 2CCWA 1NCOA 2X28A 2W8CA 4S1DC 3SGKA 4N2IA 3Q6GL 3I6LD 1VFOA 4QRAA 1Z0NA 4TL4A 2NX5A 4GI8A 5INDA 4ZZKA 1P53A 4NENA 5DJYA 4DP6X 4Z95H 2WB7A 3WS6C 3QULB 3VI4A 4QXTB 3HMXA 3WIHH 2BVEA 1T6WA 4PAZA 2XWJA 4R6UA 2FE0A 3OKNA 5HDRA 4AYBA 3DMMC 2R2CA 2VRQA 4HS6A 5E8PA 3L5WA 1RZKH 3EBAA 4S1DD 3AU1A 3ULSB 5MHSD 4GP4B 1YMMD 1RHHA 2AJUL 1TTAA 1KTDA 3OGCA 3HAEH 3SJVD 4U6TA 1J05B 4XH2A 1W6LA 2FL5B 1A2YA 2F1AA 3ROLB 2APTA 2DMCA 2GJ6D 2HH0L 2GIMA 5KVFL 5GS0L 5K59E 3K72B 1N0XH 4I0PA 4BE6A 1XGPB 4ONOA 1WA2X 1WFOA 5MP6L 1M71B 2F68X 3O6FC 4IKNA 2K4WA 1JF1B 3DMMD 4DK6A 3QXDA 3ZE0F 1UZ6E 4ONGH 4DEWA 1D2PA 1B6DA 1DQDL 5IMKB 5I19L 3PHAA 2YN5A 5KUMA 1A7PL 2VZUA 4AMWA 3RUGE 2X9WA 2J6EL 1CGSH 4CMHB 1QA9A 1W8NA 1JGVH 2R23A 2A9DA 4OZHB 2WANA 1Z5LA 4W4NA 1OAXH 3QDGA 2H45A 4XNMB 4LSQL 4KQ4H 1YMMB 5IB3A 2IIJA 2FX7L 1NLDL 3SJVB 1NMCC 3PP4L 2V3EA 3O6FD 3ZQWA 3KPMB 3RFZA 4N1HB 5I1LB 4HMDA 3ZE2E 2GJ6B 1NINA 3MODH 2FYVA 1FLRL 2K0RA 4NUQA 5DJXA 3U0WL 3UTSA 3V8CA 1C12B 4AE0A 1RZJH 4K8RH 4NKMA 4M43H 1B4RA 2L0DA 4YHPA 1HJCA 4PWFA 5B8CC 3WO4C 2ZX9A 2JLLA 4JFWA 3C5SA 3DMMB 1CDUA 1OZTG 2MQ3A 3HRZC 4FQQA 1RZFL 3I3EA 1KTJA 1EEUA 3Q5YA 3RAJL 5FKPB 1HZHL 4HZAA 2XZQL 4JDZB 1ZPUA 2J72A 3P40A 4EUPG 5KSBA 3K4ZA 4CGUB 5C2BH 4OTXH 5IHLB 4MCMA 1SEBB 2ED7A 1QUNB 1I1YA 4YDIL 5C0AD 4AIZB 3WHE0 5GJSH 3OKEB 4HCGA 1MJUH 2AXGB 4GRWF 3ZL1A 1X6NA 3UXFA 3FQTA 3O6FB 2XSKA 5DO2C 3B2MA 1UA7A 1NCTA 5C08A 3JWOH 4FQXD 4OLZH 3VNYA 3NJMA 2YD4A 3RNQB 2ZOUA 2AJXH 2Z34A 4Z7VB 2WPGA 2J7LA 5DTFB 1WA0X 2C4XA 4HXAH 2CDFB 1MSPA 5B3JF 4QRRD 3ZL2A 2M83A 1AZZC 1WUZA 2FBJH 2PW1A 2OW6A 3CSTA 1NFDE 3FUMA 3IN0A 2P48B 2Y7MA 4JG1H 5TE4L 1DFBH 4XMKH 1NMCB 1J18A 2Y0SA 1QACA 5J6HB 2BJML 3V5HB 4UB0L 3DRTA 1J1PL 1LHZA 2QADC 2DQDH 3IS1X 4TSBL 5DO2D 3RY4A 4NHCL 5C0AB 4OM0H 4ODVH 3V4UH 4N8VA 4P4KC 3FTXA 1JPEA 3QQ4B 4UV4L 5FDWB 3HE6C 4K73A 4LLQA 3RDTA 3WO4B 1BF5A 4L9DA 1GHFH 3HRZB 4J3OF 4KVPA 4URKA 4FQXB 4S2SB 1L5GA 3ESNA 2ZOKA 4FABH 3CU7A 4QTHB 4GXVL 4OD1H 3I50L 5HHNA 3IF1B 1M3IA 3DJ9A 2LE9A 1MRFH 3K4AA 1PX4A 3TBSB 4M61B 2GSGB 4QRRB 5LAPA 5TF0A 2BS8A 2QADD 1RLBA 2FYYB 5JDJA 2YEZB 2MKWA 2JCCF 4P4KD 3L17A 2KDYA 1DCEA 3RBGA 3LKRA 1UT9A 3MRHA 1T7ZA 2X70A 1S5HB 1Y6KR 2NQCA 2QR0B 1CXHA 3FQRA 3HE6D 4LU5L 3L3GB 2BNQD 4FZEL 4PTUA 4ECNA 1ANUA 5FYKD 5TF1L 1LK2B 4G72B 4NM4H 1W15A 4HIXH 3BW9A 4LCUA 4DGYL 5C9JA 3ZHLA 4FJ6A 2X4TB 1E5BA 2EDRA 2FLBT 3GB7A 5DD5L 5MEQB 2OA9A 4X4XA 4HH9A 3KBFA 3HJ0A 1EHLL 1QRNE 2AK4A 5DD0H 1IKFL 3O6MH 2HAZA 3BP5B 5FM5M 5IFAL 1A6WH 3FU7B 5GZNA 3WAKA 4B9JA 4JFPA 1AOHA 3QUMB 2I9LA 1XGUA 4UTAL 3GMRB 2OULB 1RURL 4X5XB 2QADB 4AH2A 1A47A 3V4PL 5JHLH 2FH8A 2W38A 3HS9A 4N85A 5KS9F 3TF7C 1DVYA 1P9MA 1G7QA 3I6KA 3RG1C 1B2WL 1BD2E 3MO1A 4P4KB 2ZXCA 3B2XA 5IIEB 1ZSDA 4D3CL 5I1EL 3HE6B 1RZ7H 1RZGA 2MNJB 2BNQB 3DROA 4Q97A 2D0HA 4ZJ9A 5D7JA 3IDXH 2FNBA 2VERN 4BZ2A 3ZDXF 4RRPM 2NR6C 3QP3A 3NTCH 4L3AA 1NMBL 4B0MM 1UVQB 1FFPB 2VDPH 4DN4H 4I18A 1U6AL 3QG6A 2NDGA 5EN2A 4HUWA 2A9BA 1A6PA 1KBKA 2OL3H 1QRKA 3WJLA 4DIXA 2QKIA 1VENA 1H6FA 1WTGT 2WQXA 4E0RA 4MJ5B 2OMWB 2EEXA 1IJ9A 1JD7A 1HL9A 3B3IA 5E1AA 2R29H 3TA3D 2VQ4A 4Y2DA 2R2BB 4JG9A 4TVPH 4XCFL 5IQMA 1A6UH 1F11A 3T65A 32C2B 4U1HB 4HOZA 5GRUH 3EO0A 1L3NA 3ROOA 3UG4A 3G6DL 3W1ZA 3FHQA 1AZBA 3W9EA 4MXWH 2PCXA 1W6WA 4XTRC 3CN2A 1U8NA 5J1AB 6PCYA 4KKPA 2WBJA 5EBGA 2QQNH 2NR6D 2XZAH 3QZPA 2F54D 3PFQA 1FNHA 4Y5VA 4ZOAA 3SDXB 4A38A 1BECA 2IPKA 5BRZE 2FT6A 3UTPE 4G8EA 4M7LH 1TF4A 3BFWA 2G2RB 2H0PA 4P2CG 2AQPA 1S9XB 2WLZA 1IL1A 3WJJA 1IV8A 5FHAL 4ZUUB 5CINH 1E4XL 4FQCL 3EOTL 2MCPL 2ZUYA 3M7FB 3BSZH 4OAWB 4XTRD 5AAWC 3W9DA 4N8CL 1LO4H 1UXLA 3TA3B 4PRPE 1IBZA 2HX8A 1XBDA 5F3HB 3KR3H 5DU7A 4BZ1A 5E9DE 4XWGH 1FF5A 1IB5A 4JFEA 3HR5B 5EU6D 3MLUH 5JPMA 3J8F7 4X5PA 4FXLA 1R17A 5D4IA 4BSWA 3TIDA 3IVKB 2C1OB 2EE6A 2F54B 1Z2KA 4GRWB 2X6AA 1CXKA 2ZAIA 4ABWA 3HAEG 3UP1A 4WO4C 4LF3B 1CE1H 1UWFA 1FCGA 1T21B 3Q9PA 3FTGA 1KJMB 4CAGA 5D71L 4UIKH 3WTVA 2QQKH 2QV2A 2XLLA 3EGDA 3PLYA 2HLAA 4PB9L 1HN1A 3QXAA 1M9WA 2B2XH 3C09C 3HLKA 2DQCH 5EULV 3B9KC 3V7AG 1K3IA 1HILB 3EO1B 1UACH 4NZ8A 4U7KA 3DXAA 2DQGL 3IXTB 4N68A 3UJIL 4P9HH 4X98A 1X4XA 1GCFA 4JKPH 1EFXA 5A2AA 5C0JB 1I8IB 4XT1C 3U46A 1YPZB 4FQLH 3KVPA 1FVDA 3VH8B 4AX3A 2XWZA 3DV6B 4V2BA 4K5OA 2A6IA 1N3NA 4N22A 3LS5L 1KN4L 4WO4D 1BREA 4KNSA 1I9RL 2EYTA 4WSJA 2VISB 3PWNA 2ICCA 2Y6SD 4XBMA 4K7FA 5EU6B 4DWHA 2E9GA 5H37H 3A67H 4PJHB 4I3SL 5A6LA 4PVNA 3OM3B 4UYPA 3B9KD 3H6JA 2Q6WA 3RWGB 4P59L 4YSUA 4P2OC 1PBYA 3EGSA 5FW8A 4Y2LA 3QCVH 5E4EC 3VG9C 4D0BB 1FZJB 4BBWA 2C1PB 4JPSA 2EUZA 3ARWA 2ICEC 1IJNA 2YSTA 3RDJA 1V8HA 4N90D 2GAZA 1C1EL 1UA6L 4R4BA 4RWYH 1OCCB 1CXFA 4QRFA 1R3KB 4OD2A 5KBMA 2JCCB 3K6DA 3NSJA 3FUNA 1CFTB 5LWYL 1P4IL 5ILTL 4J2QA 4U1JB 4P2OD 2APWA 4N0FA 4WO4B 2Z7UA 3DYPA 2ADJB 3SHSA 4GY4A 4WJKB 4TMPA 5FGBA 3C09B 3B9KB 1A5FH 1QSEA 3NPZB 1GA2A 3OLGA 2Q10A 2FECI 1TFHA 1KC5L 4NKIL 3VXNA 3U0PA 2DIAA 2D8KA 3WY1A 3L1OH 3GRWH 3QUKA 2DIBA 5AWNL 1DEEA 2PWGA 4U6YA 5DJ0A 3IJSB 1RUPL 3MLXH 4XVTH 3ILEA 1JZ2A 3CCHA 5KS9B 2XBDA 3NCMA 1T6VN 4LQFH 2HTKC 3UZVB 5DZLA 1F2XK 3MROB 4DFHA 4E68A 4GKNA 4DVBA 4YFEA 5ACZB 1FE8H 3S3SA 3LKQA 1MCFA 5E4EB 3VG9B 3VYNA 1WEJL 3AWEA 3IFOB 1B6UA 3MRCA 4N26A 4Z18A 2X89D 3VQMA 4KMTH 2J3SA 3N06B 1NDGB 2RQ8A 2ICEB 3QRGH 5ICUA 1TIUA 5I1KL 3KWWA 1QI5A 5GGRA 3GYRA 1YEHL 2WUCH 1M2VA 4K5PA 3QYMA 1AO7D 1BIIB 3UBHA 2F6AA 4G3YL 5BO1H 4OV5A 4P3CL 2HTKD 5FYLD 4LLDB 1URZA 3L4VA 4NC0B 4IDJH 3BO8A 4OGQC 2MEJB 2JIXA 4H88H 1J9TA 1ZLUK 1TMQA 4UAOC 2YBRA 4M62H 3UG5A 3KM2A 1U93B 2DYRB 4MRCA 2J8UB 3TEUA 3WIFB 4MAZA 4HLEA 5A40E 1QZ1A 4BZ2L 3GBEA 4KXAA 3BE1H 4P9ML 3UAAA 2WXFA 4Q9QH 2X4UA 4NXSA 5F1OB 2DQTH 3HS8A 1NEZG 3BFOA 1RXLA 2VDMH 3SDAC 4TVPE 1OP3H 3NDZE 5E99L 4FA7B 1PW3A 5B38B 3GSOB 3MNWA 3X2QB 5JXAL 3WFCL 2P5ED 4AITA 3D18B 1I3RA 3ULAB 3VI4F 3QQ9C 3S7GA 2FQFA 1P1ZB 2G4EA 2X88A 3ZTCC 2OS7A 3MV01 1B0WA 5CZKA 2ITDA 4M02A 4WI0B 2E4TA 4HDIB 1PSKL 3ZUCA 1AZNA 3PS6A 4HA1A 1KBPA 4XZ4A 2F5BL 3KDMA 4D0CA 3FRPA 3CFNA 1KNOA 2DAVA 2OSXA 3VB9A 4JFDD 4OCXL 1X4ZA 2R59A 4PRDB 3SDAD 2P43B 4WKXA 3SKMB 4OQTA 3TH3T 1A4BA 1YJDL 4FZ8H 4G7VH 2DV6A 3NJJA 1XF3B 1A1OA 1XXFC 4AQAB 1DSWA 3QQ9D 1GJUA 4XE5B 3N43F 2EIDA 3LEVL 4CA4A 5TQ0L 4OSUL 4N9OB 1IZJA 1QSFE 5C6TL 3VXPA 5CP7A 2VOTA 2P5EB 1UJTA 1G7LB 5ENWB 4W9FC 3BP4A 1KIQA 2Z8RA 5KEZA 1OE1A 4HHAA 2YEVB 4UAOB 1X5AA 2QSCL 2CA3A 2XG5B 5F1NB 5D2LE 3VA6A 4BZ1L 4R4NC 4F1ZA 4GMSL 3W0WA 1WD9A 3SE4C 4HOMA 3CGTA 4OZFH 3VFMB 1YEDB 2CLVA 4U4BA 2CDGA 5ADPH 1ZEAL 1E4WL 5DMKB 2R2EB 1I1RA 1TTUA 2WINB 1U3NA 1YC7A 2JB5L 3FU0A 3QEUB 4JFDB 1HQ4A 1AZUA 1HX0A 4XP6L 1OWWA 3F12A 3SDAB 4WFEE 3OJDA 4PG9A 4DP9X 1FNSH 5IBLC 5DZJA 3NA9H 4LOEA 2VLKD 4GW1B 5HDWA 3GBML 1QBLL 2E9JA 5ICYA 3RURA 5D2NA 3BAWA 3THML 4J8QA 4Q2ZB 4IOSD 4ZFZA 1E3FA 3S4SB 4R4ND 4U1LA 5DHVH 2ZP8A 4KXZI 4Z3IA 2IQAB 5IJDC 5KW9L 1I82A 2P5WE 3PGCA 4G6JH 5GJTL 1XCTA 5F9AC 1Z3GL 5DVLA 4PJEE 3FFCD 3BVTA 5KSBF 3U36A 1SHSA 5SX4I 5H35B 3MRQB 1NCUA 5F71A 1AKJD 3IGFA 2Z64C 2Q8AH 4BXVA 1HCZA 4TLKA 1AXSA 1GZPA 5EDSA 4J3BA 3QIBA 4LRIC 2VAJA 2CRZA 4NQVB 2N01B 1K2DB 1KXVA 3V52H 5I74C 2KZ1B 3KYOA 5LNGA 4OB5H 3WNKA 3LKSB 4YUEH 4F2MB 1NCDH 4UIMA 1D5IL 2UWEE 2VLKB 4I1PA 3HNTL 2WXOA 2VO5A 2PP7A 3RU8L 1J9SA 3QDMD 1YEGL 3SKNA 3FCTB 5GSVB 4N2HA 1E3XA 5INCA 5AAMA 5CD5C 4M03A 2WW8A 3U9PL 1DVTA 1DBJH 1C5DB 1NCAL 2VT0A 4MQ7B 4JPQA 4ZUVB 3MV7D 2ZSWB 1ED3A 3MGTB 1RULH 4JKMA 4N0UE 1G0XA 4JFQB 1QPPA 2BVQB 3FFCB 1IGCL 1KEMH 1MFEL 3O3DB 4PH8A 3AABA 1AKJB 1UXWA 3L2LA 1JPGA 4PJDA 5G4MA 4X9GA 5DD6A 3OKDA 1M05B 1VZGA 1JGLH 4AYID 3NACH 2WQVA 4XE0A 5H37G 5CD5D 4I7ZC 4MSWB 3B9DA 2Y25A 4WW1B 2P24B 2WIMA 3DJZA 3PGDA 5I1GH 2D03H 5AZEH 2VH5H 3GDBA 1WF5A 3NEOA 4M6AA 4MB3A 3FUFA 1ES0A 4I0PC 4N1CA 2VLJA 4UI2A 4QRSA 3WFBL 1OTTC 3QDMB 3I9GH 4KK5C 3OJ2C 2JI2A 4XAWL 5FW6A 3PWPD 1DANT 4YJZL 3MV7B 1NDMB 4NPJA 5C8JB 2X4SA 1T20A 2HJKB 3IJ9A 1PX8A 1A6ZA 1BVLB 4HIQA 2Z8VC 2BOCB 4WGKA 4XX1G 2FWUA 4DGUA 5JHMA 3ULVH 2ZSVB 5ESVA 5DEFA 4Y4KC 5I74B 4RGNC 1H8SA 4NC1E 1LDPH 1GS6X 4U6HB 1HZLA 5DUPH 4I0PD 3LN9A 4FEMA 5MENA 1WFNA 4OCSH 1OTTD 4MCYA 4C54A 3APMA 4KK5D 5INDB 3SPHA 4CDHA 1UEMA 4W9CC 4ZFOA 1O75A 4ZQKB 4J5VA 3PHSA 4EI0A 5IT2L 5K9JL 1K4DB 3VI4B 1QR1A 1S3RA 3WEXA 1JHKH 1VRSA 3C8DA 4XAKD 3JTSA 5FYKU 2XWJB 4PJCA 4Y0GA 4L8CA 2R1WB 2AJSL 5EUOE 3MR9A 1FAKT 3KNBA 2WVSA 3HI5H 1TVBA 5AYTA 3PWPB 4LHUG 3D0AA 4Y4KD 3AAZA 3L5WB 3MRRB 4RGND 1E6OL 4UDUA 1XQ4A 4ZS7H 1N8ZB 4ZSOA 4AKQA 1D6VH 3J27A 1RHHB 3VFWA 1CYXA 2R0LL 1H3XA 1KTDB 1GH7A 1OHZA 3LV3B 4OJFH 4XH2B 1A2YB 4JZJC 5DZPA 1U42A 4HUVA 4FC3E 4QRBA 3SE6A 4HEMA 3SBPA 4PRIA 4L4VA 4BQ8A 3UTSD 3NEEA 3VFRB 5I71B 1KCVL 3DA0A 1V27A 4KVCH 4I0PB 3N43B 1DBMH 4AE1A 3RPIB 1Z9OA 1AFVL 1MFUA 4WUKH 2CZNA 3VUAA 3VXTB 4G70B 4L3EA 1N19A 15C8H 2N4IA 1N64H 4JZNA 5SWSA 3H42L 3IWVA 4HHWA 2CJSA 3ZIYA 5EZOL 4KJWC 5ID1A 5FO8B 3FO0L 1QA9B 3FHAA 2GVYA 3NZSA 5FWRA 5K33A 4Y4KB 4NN5C 3U83A 4RGNB 8CGTA 2O72A 1A9VA 5F0LB 3HLAA 4OLUH 4Y19D 1Z5LB 5ID0A 2OYMA 4EVNA 1BGXL 5IB2B 1BIHA 3A23A 1NMAH 5EO9B 4RMUA 3W3BA 3QVAA 4WU7B 3L95B 1LYQA 1XF5B 3ZTNH 3S5LB 1FL5A 5C08D 1IVTA 2EDKA 3AS3A 1Z7JA 3UTSB 5DJXB 3BMVA 4NQCE 4K94C 3EJZC 1RUMH 4YHPB 2B5IC 4OGAC 3ARDC 3OWRA 1D3CA 5HVWA 5H2BB 4KJWD 2A6JA 3IDNA 2F15A 3R4DA 1WSST 4KHTL 3FOMA 2BH0A 3BEWA 3GK8H 1IBDA 1IAIM 5C09A 3V9EA 4MD0B 2ZWLT 3CHPA 4FJYA 4PJAA 5IVOA 5B39G 2OLDA 2X53A 4A1RA 3JVGA 1MRCL 4GKLA 5KSBB 2WBWB 1U8CA 4NZJA 4JZJB 1Q72H 3ES6A 4XVJL 2D2OA 3NA4A 1I1YB 4JM4L 4Q9RL 1EWHA 4Y19B 5HYFA 2AANA 1EJOH 3QCUH 2FH6A 3EKCA 3EJZD 4RBPK 1AHWC 4OGAD 2JK5A 3FQTB 3QZWA 3LZFH 2CBOA 3NCBB 5DUML 2C4FU 5L7XL 3MNZA 1GGBL 3H9HA 5C08B 5B1KA 3VRJA 4FP8H 2X6CA 1CURA 1GAFH 4M7JH 3BZFB 2VCOA 5LCVH 1MIEH 5C0BE 2BSED 1JWUB 3F7QA 3QDJD 4EJ1C 3OBAA 5DZ9A 2AJ3A 2VR4A 4XVSL 2R51A 4HGWA 1MW3A 4NN5B 4F8LA 3T2OA 3UAFA 4I5BA 3MLYH 5C92A 5I0XA 3EOBB 5D7LE 2WXHA 2WVUA 3WGVB 4AQ1A 4AGOA 1F86A 1F3DH 5EC2A 2CO6A 2XXGA 3T09A 2W5PA 5I28A 2OPCA 3DRTB 1RUQH 4I9WD 1ZE3C 2YUVA 2OMYB 4J6IA 5L6YL 1G0YR 4P57A 4KXZH 2VDKB 3MLVL 5AW9B 1O5PA 2B5IB 2BSSA 3K6OA 4LLQB 4L18A 5IY5B 4XPBL 4AUYA 5CMAA 5KVDH 2AK4D 5CCKL 1HVXA 2FK9A 3BDBA 1L5GB 1KOAA 1T6BX 1OKEA 1YUHA 5SX4H 3Q1SL 1J10A 5GZND 5IHBA 1Z3RA 4OBSA 1PD0A 2WWMC 3QDJB 3CDZA 4YDKH 3SGEH 2Y3AA 2R0KL 4Y9FA 1J0YA 4HFUL 4CC4A 2YWYA 4QF1A 1T4WA 3CXDH 1IE5A 1RPKA 3FO2A 1TZHB 2BVTA 3LKRB 2E6QA 1AHWB 3P4LA 2ENPA 4IW4C 3FQRB 2HPTA 4NO2A 4Z3JA 3FAXA 4PTUB 1XXDC 3KPRE 4Z7UE 3BKYH 5BJTA 2ZG1A 3BW9B 5C9JB 1FAIL 1LO2H 3RVWC 4D7BA 3ASNB 2WXRA 1A3ZA 1Z1WA 3GS7A 3GB7B 4OLWH 2WWMD 5L8KB 3D3VE 4X4XB 1R19A 2ZXAA 3SYAA 3HUJB 1MF2H 4DO5A 4ZTEA 3GKZA 2AK4B 5CJBA 4AC2A 2O5XH 1V3LA 4JHZA 4PUBH 5HYIA 1CG9A 2HG5B 5FV2A 1ZMYA 4IMKC 5AKSA 3TXAA 1T1ZB 2I9LB 1XGUB 5ICXB 1FYTE 1HDMA 1ZVHA 5EWIL 3I6KB 1G7QB 4GKZA 3OSVA 1KEGL 3GLEA 2WOYA 3RVWD 4KK6C 1NBVL 2VN5A 1WFMA 3GO1H 3Q8EA 4RRPG 3S34L 2DM2A 3S35L 4A7QA 4CMMA 4L05A 3VXMD 1ZSDB 1AVAA 1RZGB 3TONA 1BM3H 1HHJA 3DROB 4HCRH 3NSDA 2AKRA 1LQBC 3QS2A 5TQ2L 4MAUH 3K8KA 5JPMC 4C56E 4A2DA 2YGOA 5LVEA 4L4TE 3LMJL 1FO0L 4JO3L 5LGHH 2DTMH 3B2VH 4F20A 5EA0L 4ZFOL 1F3JB 1OF2A 4L1TA 2BSTB 1G9ML 4L5FE 1PG7X 3TJPA 2G5RA 3NIFE 5T3ZE 3BAYA 4JPVH 3ABLB 5EN2B 4HUWB 5DHEA 1B0RA 3OLDA 1WFJA 3EBGA 4E0RB 2VC2L 4LCWE 4ZNEE 3CWGA 1N10A 5T1KA 5DC2A 3ZYIA 4HKBB 4H25B 3V0EA 1GSKA 1AR1D 2PLTA 2G5UA 3D12B 3VTAA 1F11B 3P0GB 3T65B 3WG7B 4U1GC 2UZPA 1WZAA 2V5TA 3GSUB 3LN5B 3MJ9H 3UYRL 4FLQA 4DH2A 3U1SH 3W9EB 3POHA 2A6DA 2DEWX 5JPNC 1UJ3C 2HT3C 4HS3B 4JFED 1DVQA 3N91A 2IMMA 5AZ2L 1AJ7H 4W6YB 1SYVA 2B16A 3QUZA 3AADB 3T4YB 1IZKA 2Q8BL 3ZMEA 1CIDA 1U8LB 1QEWA 3KPNA 3FQWA 3VXMB 1ZT1B 4OCLC 4G8EB 3D08A 1AGEA 2W1NA 2CBMA 1HI6A 4HT1H 2F5AH 1E9PA 3KYMA 4I87A 4ZO7A 1ZJBA 3RVXC 5I18L 1IL1B 2RTTA 3CK0L 4P3DA 4TM9A 1QTYT 1SLUA 4PLJD 1MFCL 2WKOA 3DXAD 5DD1L 4Y7OC 4HKXB 4OVVA 5KBKA 4EDWH 1EFXD 4PW3A 5MEPA 2A9NL 3C2AL 1MNNA 2HT3D 1GY2A 3VGHA 3W9DB 3GJFB 5DJ2A 4DTGL 1KT2B 3MRBB 3P30L 4F9LA 2CNZA 3FQYA 5E6RB 5B1AB 4GG6A 1AR1B 4WGWB 1M53A 3HC0B 4NQTA 2F74B 4S1RL 4UOZA 4BSVA 4HC1H 2O5YL 4JFEB 3RVXD 2J1ZA 5JPMB 4TLUA 5D8JL 3TIDB 3O2VH 4YSEA 1NBYA 1T1YA 3HZKB 3T8XA 2Y07L 3OHXC 1SXBA 4X4MA 1BVOA 2O5NA 3FTGB 5KJ4A 1HIMH 2OBGA 3EGDB 1ORSA 1SJHA 4J4PA 4M7ZC 4OVUA 2VLRD 3W37A 5T1JA 5DD3H 1UOVA 3CZSA 2JKXA 2WGNB 3OC5A 5FA4B 3C75A 4GQRA 3DXAB 3QWOA 4U1GB 1K6QH 4X98B 3V55A 3WL9A 4DQAA 5I1JH 1EFXB 1KB5A 1P4UA 3II3A 4U6XA 4PPTA 4APXA 5JPNB 4N28A 1UJ3B 4LT7A 3TBYA 3N3EA 1ZLDA 1MCNA 3OR7B 5I5RA 2A6IB 3QO1B 3ZHDA 5C71A 3ZHKA 1P6AB 2XPGA 1N3NB 4FQIL 5A7EA 5CEXB 1MCOL 4OCWL 2CNYA 4Y9EA 3P3UA 3WNPA 2EYTB 5H8DA 1DBBL 3PWNB 4JN2A 3PUUA 2EZ0C 3LHPL 3AUWB 1EXUA 4OV6F 2XYCA 3AGVA 3QFJE 5IHWA 4XRCA 2Q6WB 1QSED 4QOKA 3W56A 3EGSB 2EUVA 3WFEL 2A99A 4RX4A 4Z77A 4N2KA 4RGMC 1WAAE 1BYPA 3ZY7A 2VLRB 1BG9A 3C08L 3F6LA 4JFVA 4CVZA 3QC6X 1SM3H 4OT1L 3TBBA 1Y7VA 2EJ1A 5EIIA 1S9WA 1M7DB 4JQXC 4JQIA 1PKQB 4IRJA 1OARH 1IFHH 1NCIA 1SJEB 2EZ0D 3CZFA 1CGUA 3DOSB 4NZTH 4KHXL 5TDOA 2AEQH 3P3SA 3X12B 2Q3ZA 4NJAH 1ECZA 5IEKB 1XD0A 2IOIA 1SJXA 2DBLH 4XI5D 1KTRL 3OHXB 1D9KA 1MG2C 1IT9L 2HFFA 1TQVA 1NC2D 1WBXB 3DURB 1KXQA 1JHLL 1R5WA 3CC5B 4ZMPA 2AXFA 1XGTB 5HVFB 1QSEB 1RK0A 3GXPA 4ANWA 1B2YA 1JGUH 5D9SA 2DWEA 4XMZA 5F1IA 5BNXD 3SZKC 1MWAH 3U0PB 3IMSA 1T7WA 4DW2H 3QXTA 1IQDA 4D9QD 4DOHB 2BVUA 3ELAT 4CRPA 1BQ5A 3QUKB 1CL7L 4WW2A 4U6YB 5GGQL 2NY1C 5DJ0B 5BMFL 2YD7A 3K2KA 1UWEL 5J6GA 2KBGA 3CCHB 2BSRB 2DY2A 1IU1A 3TO4A 2YKLL 3LPWA 1YEKH 4BSJA 5HVGB 4AUUA 4ZXBC 4EI5A 1FDLL 3DUSA 5FR3A 4O5LH 4IU2A 4GKNB 4PSPA 4DVBB 5IW1A 2OZ4H 5I16A 1BXXA 2FR4B 4EOWL 2OMXB 3WFHA 4PJDF 3ZXAC 4D0DA 1JXFA 2ZKHL 4XWOC 4RGMB 2J44A 1OPGL 5E1QA 2ZCKL 1HZKA 3MRCB 3GSNH 1L9OA 5HGGS 1PL3A 2NY1D 1QBBA 4G1MA 1HC1A 1UWXK 3EFOA 5TPWL 1UG9A 2IDCA 4RZCB 1QKZL 3B34A 2X1OA 2VDLL 1M2VB 1MCBA 1MHCB 1EK3A 1KBGH 1WT5C 4G42A 4ZXBD 3SYOA 3QEHA 4R9HA 3AQXA 1F8TH 4NRYB 2VXVL 3A6CH 1RUKH 5IJCC 2ADIB 3PV6A 2BCMA 5GS1C 1XT5A 1R3JA 3VU2A 2J1KA 1SHWA 3L1GA 4XWOD 5E6IA 5KYWA 1AG6A 2GJJA 2MOQA 3QZNA 5IUCA 2ETWA 1GGCL 1R5VA 3MMEA 4GW5B 3WN5A 2CMRL 1KELL 1M1SA 2G3XA 3GI8L 4OD3L 3FQ1A 1IAIH 4FL4C 1AE6H 1Q0XH 4K9EL 3RPKA 1UYWH 4C4KT 4KRMB 1WCQA 5F7AA 3BSGA 5EF2A 4A66A 1O7SA 2QGEA 5FDYA 3POCA 5EO1B 1TEFA 1QSZA 4MA7H 5BVJA 2NY1B 2XVGA 5MHSE 3IWUA 3MNWB 3SJVE 3OGOE 3G5XA 4RESB 1SN5A 3NCJH 1GVIA 2YXVA 1Q38A 3MTXA 4GG8A 4PJCF 4F24A 4ZXBB 4ANXA 1OK8A 5MI0C 1XCQA 1VGEL 4GAJH 3ARGC 5DFVC 4RGOH 4CN1A 3NJFA 4IIZA 3TTSA 3KDMB 1KLGB 4PGJA 4NS0A 4N2LA 1ET7A 2AQ2A 1I1FA 4WDIA 1LTXA 1QBML 2F8OA 3I85A 2PW2B 4N0CC 4PJXE 1CD1A 3ZDYF 1CR9L 5IMMA 1IKNA 1T89C 4XP1L 1OSZA 4F7MA 4RQQA 1WZ1L 4MJJA 1A1OB 3QIBC 3LH2L 2GEEA 4D2NA 4I0KA 3OKMA 3BIAX 2Z7YA 1QVOB 5LAXA 3CN4A 2RD0A 5EEWA 3KS0J 4PTTB 4X6EB 3VXPB 4M9PA 1S3KL 5GS1B 2A3TA 2PPEA 1MIMH 4WFGD 2JJWA 2V8MA 2BZCA 1KIQB 2R2HA 3UYPB 4ORGA 2ZE0A 4HHAB 1NCBL 4Q6IC 4N0CD 2YRPA 4HJSA 3MUZ1 3D87B 1D6EA 2JSFA 5JQIB 2CLVB 4FL4B 5HHPA 1TLMA 1THCA 4KO9A 4UUJB 2VXSH 3AMLA 3QIBD 3RGVC 4Z3TA 4L1BA 1HQ4B 5GISL 2DWSA 4LCYB 4MRBA 4HKJB 4PGCA 4XOAA 1LMIA 2WIIA 3MXWL 2DQHL 4PG9B 5D1ZI 4LEEA 1A7RH 1I7UA 3D09A 5IGXH 4DUWA 2XA3A 3QXVA 3QHZL 4TSCH 2XWBB 3QFDB 2EIEA 2J4WH 5C0AE 1L9MA 3G5VB 1I4FB 1U8OA 4PJBA 5MI0B 2I60H 3R0NA 4U1LB 5FFGA 1KB5L 3EH3B 1IE4A 2EC9U 4PBXA 2QDVA 3KW8A 3PGCB 4PJAF 5J1SC 4KH9A 1YCSA 1KIUA 1E90A 2OZNA 2NW2A 4V1DD 1NICA 3D33A 4JHWH 5EZPA 3RGVD 4A7VA 1SXAA 1FH5L 1KGYE 3U36B 4R3SA 2HRPH 2OTWA 5FECA 1UWYA 2BDNH 5CR8A 2R0ZH 1L7TL 3LRLA 4W9EC 3FUEA 5CLYA 3T1WA 1Q1PA 3L3IB 3QIBB 4LAJH 1JXKA 4UNTA 2CBTA 1BQLL 3QDAA 5MERA 1KJ2B 3DSFH 5E4OA 4PRAA 3C6EA 1QFWL 4ZFQA 5FPIA 2X3BA 2OSYA 2VWEE 5D70H 2H3XC 4LK4A 4NUGH 1I3GH 3B2UC 1E7UA 1MFVA 2YFNA 4YDJA 3B7UX 1JYWA 1V7ML 1DQIA 1SY6A 2R69A 4JQIL 4P49A 4Q6IB 3DGDA 5FUOH 1N5YL 1NBCA 4HW6A 3NCEB 1T3FA 4KDWA 1ED3B 5I6OA 4JDTH 1PLBA 1UM6L 4H13C 3MA9H 5BW7C 1TO4A 4I3GA 3MUGB 4V1DB 3RGVB 1IC7L 3CZKA 4XNQA 1DQKA 1HKFA 5FUZH 3ZO9A 5BZDB 2QPEB 2D3LA 3K2UL 5CZVL 1SZNA 4LEOB 3IGKA 1UXWB 1JPGB 3QQNA 2DN7A 5DD6B 1TJMA 3OKDB 1F3RB 2JLPA 3BDXA 5MEND 3ESVF 3ZKNC 3OXSA 1Z9LA 3RX8A 1NGPH 4UINH 5L2JA 4KI5F 3Q7JA 3N44B 5HI4C 3MRLA 3PGDB 3GXNA 3D25A 5B7EA 2BNQE 1SF5A 3U6RA 3RI5K 2B59A 1ES0B 1E67A 4XXDA 4QRSB 2Z3FA 2ALWA 4XN1A 1LO0H 3FZUC 1BZ9A 4GAGL 1HXMA 4MNHA 4GT7A 2IG2H 1PZ5B 3B2DC 5ERWA 1MUJA 2AJZA 4E9TA 5GGVY 2VDNB 3C6LA 1N7ML 1GPOH 1T20B 5T1DL 2QHRH 3HCVA 3V6BR 3WJMA 3HC3H 1GC1H 4N2MA 3ZKND 1JK8A 2NY0C 4TQPA 1O9ZA 2NTFB 4H20H 5DEFB 3QIUC 1X5ZA 1OAJA 5HI4D 3EUDA 1N6UA 1U92A 3AJ7A 3LSOA 3NMEA 4PRID 3HZYA 3WTUA 1UKTA 4O02A 3DHUA 1U8IA 4RSVA 5HDBF 3WELA 5MENB 4I85A 3FZUD 4MCYB 5JIKA 2Y7LA 1QO3B 1O6SA 3SDXE 2F58H 2A9MH 1JPSH 4L3ED 4W9DC 4NPYA 2Z8SA 4RISL 4OW6A 5BZXA 5C3TA 2VDOH 1UCTA 4PHXA 1GIGH 5J8OA 2DLGA 5LBSH 3HN8A 3JTSB 5ESQA 2JV6A 2NSMA 3IGLA 2NY0D 3KNBB 3RUGA 1IFGA 3PPSA 3QEGL 1OAKL 5KSVB 4N0YH 2H0EA 1ZD6A 3QIUD 4XP9L 3U82B 2AQTA 3CH1A 4ZG1A 4ZSOB 4LVHB 2YAHA 2VR6A 1BWMA 5I0WA 3MPCA 4FFYA 3V6FB 4DJMA 1DLHA 3R1GL 5T1LA 2GB2A 1MEXH 2DIJA 3BUYA 3D39D 4HS8L 4N24A 2BIPA 5CBAA 5FOBB 2GI0A 1XZ0A 1UCBH 4KAQH 4PRIB 3G7TA 2D7NA 4HLZH 1RJYA 1MJ8L 3CFIC 1ZV5A 1TSHA 3LQAH 4K71C 4Y4HC 1Q9LA 2LVEA 4LVNC 3NABL 4L3EB 5CCJA 3FB7A 5ETUA 3ZYOA 3DPBA 3DSNA 1A6TA 3UL4A 1FZMB 2AEPL 4PP1C 2FHCA 2NY0B 2L7UA 2TSAA 4HWBH 5ICZA 2W07B 2V3DA 3QIUB 4OJEH 5FCUL 3HLAB 3MCKA 3D4GA 4HH8A 2N3JA 4EVNB 1JZGA 1JIBA 3B7RL 4ELDA 2PNDA 1YPZE 2J1XA 3DX4A 1FL6A 4MNGB 4B60A 3D39B 4FFVC 1AD0B 2YN3A 1FL5B 4FEIA 5C97A 4FQPA 3K1DA 5A2IH 4NAMA 3KWVA 3NVQA