1IBKK

Structure of the thermus thermophilus 30s ribosomal subunit in complex with the antibiotic paromomycin
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
119
structure length
119
Chain Sequence
b'KRQVASGRAYIHASYNNTIVTITDPDGNPITWSSGGVIGYKGSRKGTPYAAQLAALDAAKKAMAYGMQSVDVIVRGTGAGREQAIRALQASGLQVKSIVDDTPVPHNGCRPKKKFRKAS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S RIBOSOMAL RNA
publication title Recognition of cognate transfer RNA by the 30S ribosomal subunit.
pubmed doi rcsb
molecule tags Ribosome
total genus 29
structure length 119
sequence length 119
ec nomenclature
pdb deposition date 2001-03-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
K PF00411 Ribosomal_S11 Ribosomal protein S11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.80 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribosomal protein S11 1ibkK00
4KHPK 2UUCK 4DR5K 4JI5K 4LFAK 2UXCK 4DR3K 4X66K 4LF5K 1N34K 2UUAK 5LL6Z 4K0KK 4DV1K 4JV5K 3JAMO 4V19S 4CW7B 4JYAK 4JI7K 4NXMK 1XNQK 1I94K 4DR2K 1XNRK 1HR0K 4YY3K 4DUYK 4LF9K 4AQYK 4X64K 3J7YP 4B3TK 3J7AP 3T1YK 3T1HK 1IBKK 5IT9O 4JI2K 3OTOK 4CVNE 4B3MK 4B3RK 2UXBK 1IBMK 2F4VK 4DR1K 4GKKK 4YHHK 3J80O 4DV3K 1N32K 5FLXO 4B3SK 1HNXK 4DV7K 1XMOK 4DR7K 1FJGK 1HNWK 1XMQK 5A2QO 1N36K 4JI8K 4LFCK 4LFBK 4JI6K 4DR6K 2HHHK 4JI4K 4JI3K 4LF7K 5BR8K 2ZM6K 1N33K 4LF6K 4DV2K 2VQFK 5LMNK 4NXNK 2UXDK 5AJ3K 4LF4K 2E5LK 4GKJK 4X62K 4OX9K 1HNZK 4DR4K 4DV6K 2VQEK 2UU9K 4X65K 4DUZK 4LF8K 1IBLK 4DV5K 1J5EK 4JI0K 5IWAK 4DV0K 4DV4K 5LMUK 3J81O 2UUBK 4JI1K
chains in the Genus database with same CATH superfamily
4FK4A 4CFAA 3O9QA 2YHBA 4JEPA 1IG9A 4B1XB 4OPAA 3ZT1A 5CR4A 4U67L 4I6MB 4M3UA 1LAVA 5DK5A 3QFUA 3DOKA 4XIUA 4O55A 4DTXA 1T05A 4EP5A 1QE1A 2WFBA 3LDNA 1TAUA 4FM1A 4PKIA 4JI7K 3LALA 4CF2A 3WNGA 1LV5A 3FFKB 4W5QA 3MDQA 2GELA 3MEGA 1VSKA 3TABA 3CJBA 3M1FA 3TR8A 1ZC6A 4CECA 4DFPA 1HYSA 4JRPA 1YJWN 4CHPA 4MLEA 3VQ5A 2E2PA 3WXJA 1BI4A 1GOCA 3VETA 1GLEG 4GVMA 3VQ6A 1BA0A 2F4VK 1VAZA 4E7KA 1VQMN 1NNEA 3DLBA 4B1VA 4FVMA 4H5WA 1N32K 3J8AA 5CY4A 3M8RA 4YOYA 2NZTA 3CQYA 4QOZB 1W2BM 4JHDB 3DLHA 3QLHA 5EY4A 1U6ZA 3AVLA 3C0BA 4ELUA 4XH4A 4CZKA 3VEVA 2X74A 4FCYA 2O8FA 5KQ8A 1N33K 3LP2A 4LSLA 3BDPA 4E3SA 4DV2K 3HTVA 1UOCA 1VHXA 1U4BA 2IS3A 1MU2A 5BRDA 2P1JA 1Q9YA 3G6EN 2Y1IA 4B9SA 2P9KA 3QEVA 3GG4A 3A2FA 1ATNA 4IOXA 4OPJA 1KAZA 1TKZA 2YCHA 4NLBA 4IXCA 5HRNA 4BDZA 1R0AA 2D0OA 3DLEA 2FBXA 4DV0K 1ITGA 4H0OA 3QIOA 1HQUA 3C95A 3J81O 3HXMA 3K0SA 1DT9A 1EKEA 2D4WA 1P90A 3E9PA 3VESA 1S9EA 3JS6A 2XO7A 4FZYA 3L3UA 3NH0A 2WOMA 1CXQA 2P9IB 1NGEA 4ID5A 1RDBA 4K0KK 1IKXA 3VGLA 1V4TA 3VGMA 4A57A 4C8NA 4G1QA 3O8MA 3I56N 3HM8A 4MDBA 1S1VA 4FW2A 1C0TA 5HLFA 4PA1A 3THXA 1HR0K 3M8PA 4BR7A 4DSEA 2NNWA 2QXLA 1VQON 2IDOA 3J7YP 3S9HA 3RR7A 1QTMA 1D9FA 4O0JA 3OBYA 3MXMA 2WBNA 3GOIA 2RE2A 3SBTA 3V81A 4IEIA 2FXUA 3MN6A 2W6KA 1MA9B 3L4QA 4CJPA 4DTRA 1KRPA 3UKRA 4AHSA 4KTWA 4M3XA 3KWGA 4DV7K 4DR7K 3C6HA 3ASMA 5C42A 1HYVA 2YJEA 3VQAA 1OH5A 5GAEP 4JS5A 4KH5A 4W5RA 4CFDA 4AHCA 1BOTO 3VENA 2ASMA 3AO1A 4KBOA 4BR5A 1ZBUA 4H5NA 3AVJA 1Y64A 4CJ3A 2VGNA 4JKBA 4Q5VA 2Y1JA 3NGIA 2Q1NA 4EZ9A 1SKRA 2JWKA 2RHKA 1BISA 4MO5A 1QSYA 3K9KA 3H3NO 3VEXA 2VQEK 3CC2N 2W42A 3CC7N 1XC3A 4CJFA 3EYZA 3AO4A 4LF8K 1KVAA 1IBLK 3HPGA 1NJZA 1Y97A 1YXQA 5AQTA 4CJVA 2IVNA 3FE1A 4BRDA 4KHYA 1WUAA 4F3TA 4Z4CA 4BC5A 1WOQA 5GINA 3EEQA 4BC4A 3VF6A 1ATSA 1U04A 2HHTA 4FK0A 3O9SA 5AQVA 3OYIA 3V9WA 1GLFO 3WQUA 3JAMO 3NMUA 4UQGA 2GBZA 1YHQN 2ATQA 2E4LA 3VERA 4CJSA 1XNQK 3R9PA 2P5OA 1QVFM 4M3RA 1NBWA 5KGXA 3NGZA 3TSQA 3M5RA 3SZ2A 1KCFA 3KLFA 1MWKA 4AQYK 1JLGA 4X64K 3VQCA 3UE5A 3OJUA 3BY5A 3T1AA 3AVAA 1ASVA 3T1HK 1TV6A 2B6AA 3TAPA 2WTUA 1Q7YO 3L6QA 3W0LA 4CD1A 4GV9A 3HP9A 1GLDG 3CXCM 3RMAA 3M6GA 3K5NA 1TYQA 3QEIA 4BROA 3IRXA 2R7YA 2YHYA 5CYQA 4B8AB 4IJAA 4H03B 4DF8A 3P5JA 3MN5A 4DFMA 4ELVA 1IV0A 4FW1A 3AA4A 3PX4A 1VQ4N 3VQ4A 3ITHA 4N5SA 2O8EA 5AQQA 3LPUA 4CJKA 2A40A 2Q31A 3CJ9A 3SNNA 2ZGZA 3ENOA 4OGEA 1ASUA 2KKZA 2KW4A 3C6UA 1JCGA 4A61A 4GKJK 3IDHA 5HRSA 4H8KA 3AVNA 3D2FB 2XY6A 2UU9K 3VQ7A 5ELZA 4ZTJA 5EOYA 2P9UB 3HVTA 3U6FA 1OVQA 3B6OA 3SMPA 4E19A 2UUBK 5DM7L 5HRPA 1TKXA 3BEXA 2KQ2A 1NGCA 1S3XA 4NB4A 4FZXC 1RFQA 3CF5L 3ZSRA 4DS4A 1KC8O 5KGWA 1J54A 2XY8A 1SL0A 1ASWA 3V9ZA 2IGIA 4JNEA 3SAHA 2Q0UA 3JXUA 4FOEA 3A8YA 1K6YA 1GOBA 1TVRA 3CCLN 3CQXA 3V1QA 3P83D 2V51B 3FZLA 1RDCA 1HKGA 1YUWA 5AQXA 3ZX0A 4CHNA 4F2RA 1A5XA 2J4RA 3RR8A 4BDPA 4LF9K 3AVBA 4BG9A 4DSLA 3GBTA 3VOVA 4Z4GA 4AHUA 2GV9A 4JLHA 3E01A 3AVFA 4BACA 2IC3A 4PQUA 1EWQA 2ZWHA 3J80O 1R59O 3U8XA 3TSPA 4M41A 4YOTA 3D6RA 2D0AA 4IDKA 4RW9A 4J2DA 3PY8A 3VEYA 1O1WA 1FJGK 4CJ7A 3SQ0A 2E8AA 4C8OA 4DR6K 1RDUA 4OPHA 1NK4A 3G71N 1B92A 3ZETA 3SJJA 3M8QA 2X6SA 1GLJO 1T3VA 4LF7K 4B9MA 4YDUA 4FJXA 4ILJA 2UYTA 2YKMA 2PBDA 3F2KA 3U9DA 3OYCA 3DLLL 4HTUA 1N5YA 3HYFA 1GLCG 1RBTA 4FLWA 5AQWA 2OZSA 1QS4A 1SQKA 3KLGA 5AQSA 5BPMA 1NGDA 1S6QA 2QI2A 4JKDA 2BH1A 2Z1HA 4BRCA 4CEEA 3P4IA 3VMFB 4CK3A 5K14A 1BI4B 1H1VA 2I7NA 3DLGA 3O80A 3TAEA 3MN7A 4O8UA 4M7XA 1E3MA 1RT1A 3VQQA 3DOLA 4X66K 3OYBA 1HJOA 4J8FA 4C1NK 1WLJA 3CJAA 4BVPA 3WNEA 3SPYA 3QIPA 4ZTFA 5J2QA 4YNQA 4V19S 3TAQA 2HBKA 4B8CA 1JLCA 4NCGA 4GY2B 1I94K 2O8FB 4FK2A 1EWRA 1NG9A 1TKTA 3KJVA 3A5MC 1RBRA 3QNOA 4B9TA 4BR0A 4WYBA 2D0PA 2FSKA 3O1WA 3H46O 3KK7A 4FJ9A 2NRHA 1HKCA 1LWCA 1RBSA 2P9KB 1REVA 2GUPA 4JI2K 1JLQA 1S1TA 4CZIA 5EX5A 1XHZA 1WSJA 4E7LA 2UXBK 1IBMK 4E0DA 1D4XA 3SAFA 5JMVA 2IVPA 3ZSZA 4C8LA 3NH2A 5DM6L 1XWLA 3NE6A 1N36K 3AVGA 4JI6K 2KFNA 1W97L 1N8RO 3SLCA 3AVMA 1RDDA 2QKKA 2A1RA 4LH5A 3V6DA 1SV5A 4CEAA 3SCXA 3M3ZA 3THVA 4HUFA 3QNNA 4DSFA 5FPMA 4BDYA 4WQ5C 1B9DA 2XY7A 1U48A 2YX6A 1OH8A 2G8IA 5KPTA 4E7IA 3LZIA 4OX9K 1WBBA 4CIFA 3THXB 1TK5A 4MLHA 4DTOA 4WE1A 1HJRA 2WC9A 3AO5A 4CEDA 4KHNA 3L8BA 4DQ8A 1VQLN 3O5BA 2P9SA 5C2DA 1MWMA 3AY9A 4FJ8A 4NLCA 1YJ9N 2HF3A 4K8XA 4DQSA 2ZJPL 4RW4A 4J2AA 4JK7A 1YITN 2D0CA 2F96A 4ILHA 5AQNA 2E1YA 4PL8A 3ID6A 4BRIA 1J6ZA 3OYFA 3UKRB 1P8ZA 4H0VB 1BL3A 2QWQA 3IG1A 3KK3A 5M1OA 2B5JA 1T7PA 4BQZA 5I42A 1ESVA 2O8DA 4NYFA 2Q3SA 4ID1A 4Z4HA 2NRZA 3OS0A 3KK1A 3TI0A 3IAYA 3ZT2A 4FJIA 4GV3A 4DU1A 3ATVA 3DYAA 4CHYA 4BY9C 3MWPA 3HO1A 4CF1A 4CGHA 2V52B 1WBDA 3E66A 3ULEA 1BA1A 2E2QA 3KD5E 3QB0A 2PAVA 2A5XA 3VQDA 3HOSA 1BIZA 3O6WA 4I9QA 3LAKA 1SUQA 4KTZA 3HSTB 4DV3K 3S41A 1C0GA 3TWHA 2B4JA 1IKVA 1C1BA 3R1XA 1S6PA 4W5TA 4BE2A 3L2QA 2XHBA 3D45A 3QO9A 4AF1A 3NDKA 2FF6A 4OPKA 5CE3A 1U47A 3SQ1A 1Q82O 4DSKA 4BC2A 2LSNA 1RDWX 4IKFA 3CCUN 2YJFA 5FPNA 5CYMA 4LF6K 3O4QA 1JKHA 1E4FT 3ZSXA 2QK9A 1EX4A 1DEJA 1ZBHA 3H1QA 4LF4K 2VG5A 3HP6A 4A5BA 5BR9A 3V9SA 2DFEA 2JLEA 3B6PA 2EHGA 4DR4K 2VG7A 2QA4N 1SL2A 3RSEA 1J9AA 1QQMA 2BUPA 3N4PA 3PO4A 3CI5A 5IWAK 1HPZA 1JLFA 1JJ2M 4HCCA 2DTUA 3MX5A 2VGMA 2UUCK 4DFKA 1VSIA 2V7ZA 3TAFA 4JI5K 5I3UA 5M1FA 4DG1A 2E1ZA 3CMAN 4DR3K 3FGUA 3KTQA 1TYQB 3W3DA 2OTJN 5AZJA 3JSMA 3KWIA 1GLBG 3QINA 4IG3A 4DQPA 3VF2A 4JYAK 1ZYQA 4ISEA 5F1XA 3LDQA 4C8KA 3L4IA 3QEXA 3CJ1A 3VPZA 3KZBA 4I9LA 3QESA 4R79A 1BHLA 1IJJA 2O8EB 2Z1GA 3CCQN 4KRFA 1WSIA 3U3YA 1S1WA 4JS4A 3A5OC 1TL3A 3H45C 4XH1A 4WFBL 1WAJA 3H6EA 3O9TA 3LDOA 4FJ7A 1S22A 3MCPA 1ZXOA 1TUYA 5KPZA 2O8CA 4DU3A 4O4GA 2HSTA 3LDLA 3MAQA 1YF5L 2HMPA 3QICA 3IUCA 4QS7A 4DQIA 2KFZA 5J2NA 1Q9XA 5GIOA 4W5NA 5FPDA 2YHWA 2NRVA 4BRMA 2HHHK 4JI4K 3RVCA 3SJHA 4CEFA 4JI3K 3FZKA 4MQ3A 3LDSA 3CCEN 1LCUA 2ZM6K 1XHXA 5KRSA 3UIQA 2F8TA 1XQSC 5LMNK 2CH6A 2UXDK 4WFNL 1KLMA 1HKBA 4BRFA 4Y0WA 2CGLA 4HWIA 4NO7A 3CJCA 1EQYA 3OA9A 4CGDA 4DUZK 3T19A 5AQOA 4ISFA 4JKGA 3CCVN 5BN8A 2FF3B 3SUQA 1JLAA 5KRTA 1X9JA 3ZT0A 1RNHA 3DWLA 4MO4A 2YKNA 3O4WA 4Z4IA 1NGJA 3OYLA 4JRQA 4WF9L 2PY5A 5LJVA 1VQ5N 2W41A 3V9UA 4N56A 2HHSA 3G0ZA 4KKOA 2A41A 3DRSA 4E7HA 1K8KA 5HROA 5J1EA 4CESA 1RILA 4CF9A 4K25A 3WEEA 3LWMA 4DHYA 3ZETB 3VQPA 4FJHA 2P9PA 2ETJA 1VQ9N 3IS9A 1X9MA 4FZZA 4KV8A 4YOVA 4O44A 1J53A 1QSLA 1UAXA 1NKEA 1LWFA 1NMDA 3J7AP 4TSXA 4H0YB 4BC3A 3T1YK 4XEIA 4FLXA 3G10A 4LY7A 4DLGA 4JAXA 4RTFD 2ASOA 2HHUA 4YFUA 3ZT3A 2RF2A 4CZHA 4BRKA 4E89A 3E9LA 4XH5A 1N6QA 4CEOA 3AGRA 4PKGA 5T7BA 2P9NA 4C23A 3OY9A 4BE0A 3HRGA 3AAPA 5FRNA 1NJXA 3AARA 4HCBA 2OPSA 3ZYYX 1JLEA 1XMQK 4JKHA 3SMSA 5GAHP 3VGKA 1WSEA 3OVNA 1YJNN 3A5LC 4AH9A 3BZKA 3THYA 3H1VX 1A5VA 2RKIA 4KI4A 2VWBA 5GAGP 4NXNK 2DPNA 4AHVA 2W6LA 4U7BA 4A62A 3HI0A 2Q36A 4X62K 1TUUA 3THWA 1T6DA 4KHQA 1WSHA 1L3UA 4K8ZA 1SAZA 1X9WA 4I2QA 2Q97A 3HT3A 3D2EA 2QM1A 2E20A 4A2BA 4JI0K 4FWRA 1EO1A 5AQUA 3DMJA 4M3TA 1IKWA 4KHPK 1K8AO 2OCEA 3L0QA 2UXCK 5BREA 4BWJA 5FPEA 3KIOA 2BANA 4CJLA 1TK8A 4PKHA 4Z0UA 4PHTX 5BRHA 2RPIA 3BF3A 3KD1E 3I0SA 2E2NA 3Q7CA 2HHVA 1C0UA 4E1NA 1X1PA 1WN7A 1ATRA 4HHTA 4CF8A 5EU7A 1VQ6N 2OZMA 4FO0A 3DJCA 5EVZA 1NOZA 3FZHA 3CM5A 3A0IX 5HBMA 2VCPA 4DUYK 4KREA 3TTCA 4O5BA 1RTDA 3WNFA 4O0IA 1Z05A 3HBTA 3ATUA 3CIPA 2F8SA 3HPOA 3ZX2A 1YTUA 5JICA 4DTJA 1I3AA 2YI1A 4YOUA 4GKKK 2P9SB 3KLIA 3AA2A 3LM9A 3CPEA 5M1QA 4IOCL 5BN9A 1RCHA 4BQLA 3O3GA 4JN4A 1U2VA 3DXMA 2NRRA 4H4MA 1Q18A 4M42A 1JLBA 3F9MA 3OYGA 1QHTA 4DTSA 2IOCA 4H0TB 2A3ZA 1XUPO 5CZ1A 4FJJA 1YIJN 4Z4FA 3DLKA 4OVLA 5F0XA 5M1NA 4UY8O 2DY4A 1FK9A 5FRMA 3OYHA 1GOAA 2O8DB 2H3GX 3TU5A 3MWTA 1LW0A 3O1BA 3EZWA 2QWOA 3P38A 1QQNA 3BGRA 1VRUA 1IO2A 3P31A 4CJUA 4DS5A 1A5WA 4CBWA 2ASPA 3MCAB 4CZFA 5LMUK 3ULEB 1JCEA 3I8DA 4BRQA 4CEZA 3RRHA 3G4SN 1VSHA 4CZLA 1TAQA 4CJQA 5E41A 3FZMA 4LFAK 4EIAA 4OKKA 2VWKA 3VEOA 3I33A 5LL6Z 2FSNA 4DV1K 4CZEA 1ZBLA 2OPQA 1S1XA 3ALYA 4KO0A 3MECA 3S3OA 4H5VA 4NXMK 4IFYA 4CF0A 5AQJA 1EXQA 4A59A 2HB5A 4RWTA 2HBJA 3QERA 3SPZA 4M63C 4B9LA 4NCAA 3K57A 3L2UA 4OGCA 5JVGL 4DQQA 2A6AA 2HVHA 3VA0A 3KKSA 4CERA 3MMVA 1VQPN 3C65A 4BRHA 1V4SA 1VSMA 1RT3A 3KK2A 2X6NA 4FXDA 4ZHRA 5AZIA 3ZCMA 3ENHA 2HNDA 3BF1A 5CZ2A 4WCEL 3SI6A 3LL3A 3RSEB 4C8MA 3OYDA 1BQNA 4BGAA 4N41A 4FPBA 3VQEA 3U3GA 5AQIA 3TARA 1NK7A 4RW8A 3H3OB 4J2BA 3WXLA 3RMBA 1I39A 2E6LA 1YI2N 2G8KA 3ZX3A 1RGIA 4I7FA 3OS1A 3OYJA 4OJRA 1WAFA 2NLXA 4LFBK 4B08A 1YT3A 3EE8A 5AZJB 1E4GT 1RTHA 1RTJA 1TGOA 3UKUA 3DM2A 4H0XB 4FLZA 3C94A 4BRPA 1NGAA 3CC4N 2PZSA 1VSDA 4G9ZA 3WXKA 3IMXA 1EETA 3WQTA 3CMEN 3O3HA 1YTAA 1VSEA 3GDQA 4FWNA 1QZ5A 3HK2A 1CLQA 3ZSWA 3AV9A 4DV4K 1C1AA 2FBTA 1RTIA 4BR2A 1Q86O 3AGKA 4O8KA 4HUEA 4FJ5A 2O8CB 4ISGA 4HUGA 1U49A 3CM6A 2ITMA 1ZBSA 4CHOA 4CCHA 4AHTA 4NCBA 4K41A 4CD3A 5TKWA 4FL9A 1N34K 2UUAK 1C6VA 2JGUA 1JXEA 3NF9A 3TSUA 4BRLA 2YNGA 4KH6A 1VQNN 4IZ9A 4IFVA 3G25A 5CHIA 4KFBA 3RMCA 5BPLA 3CCRN 3SV3A 5AQZA 1OVYA 1NK6A 4FJMA 4YY3K 1WB9A 4FLUA 3PV8A 1K9MO 4B3TK 4FJLA 5JS1A 3BZCA 2KZMA 1B9FA 4EHTA 2QWPA 3DI6A 3LM2A 3AA3A 3LP0A 2DFFA 3DXKA 2YNIA 2HNYA 2HOEA 4WQ4A 4DCHA 3OS2A 3T3FA 3TANA 3TAMA 2HW3A 2YHAA 3QBWA 4CZJA 4CIEA 2KTQA 3HL8A 4IDHA 3CETA 3GL1A 3BP8A 3CYMA 1UWBA 1L3TA 3ZSQA 4PWDA 4KPYA 3QETA 3L2RA 2I7PA 3SQ4A 4KHSA 4CGFA 4BG8A 3IKMA 4GW6A 4M3ZA 2HMIA 2O8BA 2Q0RA 3AVCA 4CJ4A 3K5LA 5BR8K 3K2PA 1KLNA 4KAZA 2OPPA 1K8KB 4EAHD 1UA1A 4I2PA 1O13A 2GEMA 3SK3A 3WEEB 4M3WA 5M1PA 4QAGA 1BIUA 3OYNA 3C7NA 4AM6A 1NK5A 3TTFA 1JXBA 4H5TA 1VRTA 2P9PB 2VWJA 1WNSA 5DMRA 3V4IA 4IJNA 4B9UA 2G8WA 1HRHA 2FLOA 2EX3A 3F5TA 4BRAA 1LWEA 2O4IA 4QS8A 1CXUA 3ID8A 3PX0A 3SUOA 3ZEUA 3NVMA 3U9ZA 4KB1A 2QKBA 1M90O 1HMVA 4JK8A 4JD2A 4OO1J 4B1UB 2QXFA 3DLRA 1ZBIA 4EFHA 1HLUA 3LP3A 4DR5K 1ILYA 2P9NB 2WUSA 4LF5K 2ZJRL 4KI6A 1KSPA 1F21A 3ZSVA 3PX6A 3WXMB 4BR4A 5ADXA 2CGKA 3CERA 1VQ8N 2PYLA 4NYNA 3NBPA 4CEBA 1T6CA 4PL7A 5HOOA 5M1KA 2AJQA 3RMDA 4H0PA 3THYB 1QSSA 4IBNA 3DRRA 5LJWA 4DF4A 2GTDA 3V9XA 2YNFA 2ZF5O 2XY5A 5JLFA 1VSFA 3NGYA 2OTLN 2GX9A 1IBKK 1RBVA 3MEDA 3THWB 4K43A 4FWMA 3WUHA 4CVNE 5AQLA 3CCJN 3SUPA 2GUIA 4OKJA 3F73A 1NJWA 3VEWA 1KXPA 1HYZA 4F3OA 3PIPL 3D2EB 4LSNA 3GE1A 3SYZA 3UB5A 5FROA 1X9SA 5FLXO 1S5JA 1NOYA 3R3LA 1FXXA 4H4OA 3AVIA 3KLHA 4CGGA 4KHUA 3EKSA 2ZJQL 2P51A 4JI8K 4BRGA 3VEZA 1SZ2A 4FSVA 3B8AX 3AAQA 5JLHA 3P1GA 4EZ6A 3HPHA 4LD0A 5AQMA 3DRPA 2HVIA 2VQFK 5J2MA 2BE2A 4EHUA 3CHWA 4CHQA 3S3NA 1BO5O 4CJTA 1K73O 3MK6A 1J5OA 2P9LA 3AO3A 4CI6A 2HHWA 2FBYA 4OKEA 3K9JA 3LWLA 1DLOA 2X78A 2GWJA 1XI1A 4F9OA 3OW2M 4E7JA 4FWLA 4AHRA 4CZGA 5D3GA 1QVGM 2G8HA 4R5PA 3K59A 4MDAA 1NU0A 1T8EA 3EN9A 4QS9A 1UA0A 3FZFA 3CQ8A 1GLLO 5AQKA 1WSGA 3O9UA 4M45A 4Y1CA 3A5NC 4YDUC 3NF7A 5ADXH 1KVCA 2OANA 3ISNC 1D8YA 1JL1A 4KHWA 2HHQA 2FSJA 1JCFA 1U2VB 3DXMB 4DTUA 3OYMA 5KQDA 1NK0A 2HF4A 3HVRA 4PUOA 4B3OA 3CFOA 4CE9A 4WQ5A 3OHRA 3S3MA 4GNIA 1Z6RA 5AQPA 4FJNA 3F9KA 3SUNA 4MFBA 4JK9A 1RDAA 1SKWA 3K5MA 3SBGA 4B3RK 3Q7BA 4ILGB 4IOAL 2KHOA 3TAGA 4YHHK 1L5UA 3C6AA 2QEXN 4RW6A 4CHZA 4JKCA 4I6MA 3ENBA 3NVKA 4Y1DA 2NRWA 3L2VA 1FKPA 3K58A 1OH6A 1XMOK 3PSFA 4FWKA 1NJIO 4GV6A 2ZE2A 1M1KO 3MXJA 1HX1A 2HNZA 1FW6A 2AA4A 4ICLA 3RTVA 1X3NA 3E1YA 3J7ZO 3ZSOA 4CJ5A 2KZZA 3QDKA 4BWMA 2ZGYA 3U4LA 3EZ5A 2HHXA 1X3MA 4L8RB 3EKUA 1YVUA 4O5FA 1HUXA 5MLCQ 5I9EB 1NGIA 4CK1A 5KTQA 1DTTA 3HOTA 1DKGD 5AQRA 2OPRA 4FM2A 1G15A 1J5EK 4GMJB 4GVEA 4JKEA 5FDLA 3QFPA 3NF6A 3VN5A 4FLVA 1G99A 3CCSN 1LAWA 3KKRA 4JKAA 4DTNA 5AZIB 5B8HA 5SWMA 5AQYA 4M3YA 1CZAN 2IAJA 4JHDA 3LDPA 1U45A 1Q81O 4F8RA 3EE9A 3VF4A 4FJKA 1QHAA 3PUFA 1NK8A 3RRGA 1KFSA 4EP4A 1TK0A 4K42A 5BRFA 4PY5A 4RCHA 3D7EO 5H1SQ 1S1UA 3HM9A 4N76A 4M7YA 3MN9A 3VTHA 3OJSA 2FBVA 4B9QA 1DGKN 3O9RA 1BGXT 2AP1A 3CCMN 4DR2K 3UKUB 3NF8A 1XNRK 1BU6O 2F9TA 4IG0A 2KLAA 4DFJA 3HZ6A 3O4NA 4FWSA 1BUPA 4FWPA 5E26A 1XC9A 2QTDA 4RG8A 4B1YB 1W9HA 3H08A 1YVNA 3MXIA 3NCIA 3FFIA 3VTIA 5J2PA 2QWMA 4IWVA 4RW7A 1KAXA 1HNIA 3JYTA 3PSIA 5C24A 4B3SK 2P9IA 1GLAG 1FKOA 5GIPA 1HNXK 1RT4A 3E9OA 1VK0A 2QWNA 1HNWK 3D0PA 4B1WB 4QCLA 4CIGA 4DWIA 2E2OA 4FWQA 4WQ4C 4IO8A 4C1NI 1W7AA 3HSCA 3C6TA 1RT2A 2I5JA 5AFUA 4CJRA 4FM0A 1NKBA 1Q8IA 4FPAA 2ITGA 1Z25A 3KLEA 3O08A 2VG6A 2HBMA 1C0MA 1IH7A 4DB3A 4HVJA 3ZLJA 1BCOA 5AQGA 3LZJA 2Z1IA 2PYJA 4CJWA 3OBWA 2DFHA 1L3SA 3FR0A 2YNHA 3LANA 3SV4A 3VQ9A 3VQ8A 4IO9L 4CGJA 1BWFO 1LOTB 4DKWA 2CGJA 3VQBA 3SQ2A 3CPWM 2G8UA 3QEPA 4A5AA 3I8BA 3DXKB 2P5GA 2HBLA 4IEEA 5BPNA 1D9DA 3SAGA 4A2AA 1KD1O 4DTPA 4L3QA 3I0RA 4YOXA 3AVHA 4FLYA 1NK9A 4CJEA 1KQSM 4B9VA 3PIOL 1OH7A 1SS6A 1NLVA 4FVUA 3OYEA 5C25A 3EY1A 4KH4A 1RT6A 4F4KA 4AILC 2EWSA 4FJGA 1OKJA 4Z4EA 3KVGA 1RT5A 1QZ6A 2O8BB 2BGGA 3M8SA 5JVHL 3ZSYA 5C12A 4AM7A 4KB0A 2XRIA 4JKFA 3OYAA 3OYKA 1NGGA 3C7NB 3EO3A 5AR0A 3NFAA 1NGHA 3OTOK 4CK2A 1KTQA 5KI6A 1QQCA 4E1MA 2RN2A 5HRRA 4B3MK 2CH5A 2NRTA 3CFPA 2E88A 4BR9A 1L3VA 3P39A 2FC0A 2ZD1A 3ZEUB 3ZT4A 1NWKA 1SKSA 5C2FA 2A1SA 2D0BA 4YOWA 4JD2B 3QMLA 2G8VA 1D5AA 1BQMA 2PFUA 2Q2RA 2F7TA 5A2QO 4FYDA 4DTMA 1NJYA 3CFRA 3ULDA 4FWOA 4CFBA 1SL1A 4E1JA 1S72N 1DTQA 2D5RA 5AFUH 3MX2A 1HQEA 3L3VA 1RT7A 3CD6N 4CBUA 4B9NA 3WXIA 1VSJA 3KHYA 3QEWA 1NGFA 4WFAL 2ZQBA 1VSLA 5AQFA 5C0YA 2W40A 4Q0BA 1YAGA 3CG7A 1T03A 3TPQA 4DV6K 2YHXA 3NHGA 2G8FA 1KVBA 2GWKA 4X65K 3WNHA 4Z94A 4DV5K 5C15A 1ZBFA 1KFDA 1QQOA 4BRNA 1BG3A 1NMNA 5EXWA 3NAEA 3LPTA 2IIRA 1IG8A 4JI1K 4J2EA 3T69A 2BTFA 4ELTA 4DLEA 1C1CA 3DAWA 1RBUA 2A42A 4N47A 1MDUB 3AO2A 4HTLA 4CFCA 3LAMA 1C0FA 1IKYA 1VQKN 4LH4A 3AA5X 5HP1A 1HPMA 2E6MA 2YV0X 4OLBA 4JV5K 3AVKA 4CW7B 2O4GA 1S9GA 2V7YA 2WONA 3BUZB 3K5OA 2D1KA 2F9WA 4CEQA 1NM1A 1LW2A 5JS2A 1TL1A 4LC9B 3D2FA 4W5OA 2JWLA 3CJ7A 5E84A 5LY3A 2OYQA 3N4QA 3MEEA 2P9UA 3IFRA 5C10A 4DU4A 5HL7L 4KTQA 3V1RA 5IT9O 2P9LB 1EP4A 4BREA 2QW9A 2VYPA 1BCMA 1TKDA 4DQRA 3O3FA 3PO5A 5KPRA 4FOIA 4BVOA 3L2WA 4DR1K 1HNVA 4H5RA 2OA8A 3R6MA 1Z26A 5TKYA 3TTDA 4BE1A 1CZBA 1JL2A 1W0HA 4FLTA 5GADP 4YORA 3NH1A 4DSJA 3I55N 4B1ZA 4CGIA 1T44A 2BDPA 3QBXA 4LFCK 1NGBA 4F2SA 3WT0A 5SZTA 1CZ9A 5AJ3K 3EL2A 1NKCA 5F2RA 1WSFA 4JKGB 3T7ZA 2E5LK 1BDGA 2NUBA 2QWRA 2IVOA 4BGBA 1HNZK 1VQ7N 3PLAA 3RWUA 3HJFA 4OLAA 3R8EA 4CBXA 1KAYA 4CZMA 2Z1JA 4DMNA 5AQHA 3LP1A 3FLCO 3VA3A 2NRXA 3V1OA 2QWLA 4DSIA 4IFEA
chains in the Genus database with same CATH topology
4KHPK 2UUCK 4DR5K 4JI5K 4LFAK 2UXCK 4DR3K 4X66K 4LF5K 1N34K 2UUAK 5LL6Z 4K0KK 4DV1K 4JV5K 3JAMO 4V19S 4CW7B 4JYAK 4JI7K 4NXMK 1XNQK 1I94K 4DR2K 1XNRK 1HR0K 4YY3K 4DUYK 4LF9K 4AQYK 4X64K 3J7YP 4B3TK 3J7AP 3T1YK 3T1HK 1IBKK 5IT9O 4JI2K 3OTOK 4CVNE 4B3MK 4B3RK 2UXBK 1IBMK 2F4VK 4DR1K 4GKKK 4YHHK 3J80O 4DV3K 1N32K 5FLXO 4B3SK 1HNXK 4DV7K 1XMOK 4DR7K 1FJGK 1HNWK 1XMQK 5A2QO 1N36K 4JI8K 4LFCK 4LFBK 4JI6K 4DR6K 2HHHK 4JI4K 4JI3K 4LF7K 5BR8K 2ZM6K 1N33K 4LF6K 4DV2K 2VQFK 5LMNK 4NXNK 2UXDK 5AJ3K 4LF4K 2E5LK 4GKJK 4X62K 4OX9K 1HNZK 4DR4K 4DV6K 2VQEK 2UU9K 4X65K 4DUZK 4LF8K 1IBLK 4DV5K 1J5EK 4JI0K 5IWAK 4DV0K 4DV4K 5LMUK 3J81O 2UUBK 4JI1K
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4KHP K;  2UUC K;  4DR5 K;  4JI5 K;  4LFA K;  2UXC K;  4DR3 K;  4X66 K;  4LF5 K;  1N34 K;  2UUA K;  5LL6 Z;  4K0K K;  4DV1 K;  4JV5 K;  3JAM O;  4V19 S;  4CW7 B;  4JYA K;  4JI7 K;  4NXM K;  1XNQ K;  1I94 K;  4DR2 K;  1XNR K;  1HR0 K;  4YY3 K;  4DUY K;  4LF9 K;  4AQY K;  4X64 K;  3J7Y P;  4B3T K;  3J7A P;  3T1Y K;  3T1H K;  1IBK K;  5IT9 O;  4JI2 K;  3OTO K;  4CVN E;  4B3M K;  4B3R K;  2UXB K;  1IBM K;  2F4V K;  4DR1 K;  4GKK K;  4YHH K;  3J80 O;  4DV3 K;  1N32 K;  5FLX O;  4B3S K;  1HNX K;  4DV7 K;  1XMO K;  4DR7 K;  1FJG K;  1HNW K;  1XMQ K;  5A2Q O;  1N36 K;  4JI8 K;  4LFC K;  4LFB K;  4JI6 K;  4DR6 K;  2HHH K;  4JI4 K;  4JI3 K;  4LF7 K;  5BR8 K;  2ZM6 K;  1N33 K;  4LF6 K;  4DV2 K;  2VQF K;  5LMN K;  4NXN K;  2UXD K;  5AJ3 K;  4LF4 K;  2E5L K;  4GKJ K;  4X62 K;  4OX9 K;  1HNZ K;  4DR4 K;  4DV6 K;  2VQE K;  2UU9 K;  4X65 K;  4DUZ K;  4LF8 K;  1IBL K;  4DV5 K;  1J5E K;  4JI0 K;  5IWA K;  4DV0 K;  4DV4 K;  5LMU K;  3J81 O;  2UUB K;  4JI1 K; 
#chains in the Genus database with same CATH topology
 4FK4 A;  4CFA A;  3O9Q A;  2YHB A;  4JEP A;  1IG9 A;  4B1X B;  4OPA A;  3ZT1 A;  5CR4 A;  4U67 L;  4I6M B;  4M3U A;  1LAV A;  5DK5 A;  3QFU A;  3DOK A;  4XIU A;  4O55 A;  4DTX A;  1T05 A;  4EP5 A;  1QE1 A;  2WFB A;  3LDN A;  1TAU A;  4FM1 A;  4PKI A;  4JI7 K;  3LAL A;  4CF2 A;  3WNG A;  1LV5 A;  3FFK B;  4W5Q A;  3MDQ A;  2GEL A;  3MEG A;  1VSK A;  3TAB A;  3CJB A;  3M1F A;  3TR8 A;  1ZC6 A;  4CEC A;  4DFP A;  1HYS A;  4JRP A;  1YJW N;  4CHP A;  4MLE A;  3VQ5 A;  2E2P A;  3WXJ A;  1BI4 A;  1GOC A;  3VET A;  1GLE G;  4GVM A;  3VQ6 A;  1BA0 A;  2F4V K;  1VAZ A;  4E7K A;  1VQM N;  1NNE A;  3DLB A;  4B1V A;  4FVM A;  4H5W A;  1N32 K;  3J8A A;  5CY4 A;  3M8R A;  4YOY A;  2NZT A;  3CQY A;  4QOZ B;  1W2B M;  4JHD B;  3DLH A;  3QLH A;  5EY4 A;  1U6Z A;  3AVL A;  3C0B A;  4ELU A;  4XH4 A;  4CZK A;  3VEV A;  2X74 A;  4FCY A;  2O8F A;  5KQ8 A;  1N33 K;  3LP2 A;  4LSL A;  3BDP A;  4E3S A;  4DV2 K;  3HTV A;  1UOC A;  1VHX A;  1U4B A;  2IS3 A;  1MU2 A;  5BRD A;  2P1J A;  1Q9Y A;  3G6E N;  2Y1I A;  4B9S A;  2P9K A;  3QEV A;  3GG4 A;  3A2F A;  1ATN A;  4IOX A;  4OPJ A;  1KAZ A;  1TKZ A;  2YCH A;  4NLB A;  4IXC A;  5HRN A;  4BDZ A;  1R0A A;  2D0O A;  3DLE A;  2FBX A;  4DV0 K;  1ITG A;  4H0O A;  3QIO A;  1HQU A;  3C95 A;  3J81 O;  3HXM A;  3K0S A;  1DT9 A;  1EKE A;  2D4W A;  1P90 A;  3E9P A;  3VES A;  1S9E A;  3JS6 A;  2XO7 A;  4FZY A;  3L3U A;  3NH0 A;  2WOM A;  1CXQ A;  2P9I B;  1NGE A;  4ID5 A;  1RDB A;  4K0K K;  1IKX A;  3VGL A;  1V4T A;  3VGM A;  4A57 A;  4C8N A;  4G1Q A;  3O8M A;  3I56 N;  3HM8 A;  4MDB A;  1S1V A;  4FW2 A;  1C0T A;  5HLF A;  4PA1 A;  3THX A;  1HR0 K;  3M8P A;  4BR7 A;  4DSE A;  2NNW A;  2QXL A;  1VQO N;  2IDO A;  3J7Y P;  3S9H A;  3RR7 A;  1QTM A;  1D9F A;  4O0J A;  3OBY A;  3MXM A;  2WBN A;  3GOI A;  2RE2 A;  3SBT A;  3V81 A;  4IEI A;  2FXU A;  3MN6 A;  2W6K A;  1MA9 B;  3L4Q A;  4CJP A;  4DTR A;  1KRP A;  3UKR A;  4AHS A;  4KTW A;  4M3X A;  3KWG A;  4DV7 K;  4DR7 K;  3C6H A;  3ASM A;  5C42 A;  1HYV A;  2YJE A;  3VQA A;  1OH5 A;  5GAE P;  4JS5 A;  4KH5 A;  4W5R A;  4CFD A;  4AHC A;  1BOT O;  3VEN A;  2ASM A;  3AO1 A;  4KBO A;  4BR5 A;  1ZBU A;  4H5N A;  3AVJ A;  1Y64 A;  4CJ3 A;  2VGN A;  4JKB A;  4Q5V A;  2Y1J A;  3NGI A;  2Q1N A;  4EZ9 A;  1SKR A;  2JWK A;  2RHK A;  1BIS A;  4MO5 A;  1QSY A;  3K9K A;  3H3N O;  3VEX A;  2VQE K;  3CC2 N;  2W42 A;  3CC7 N;  1XC3 A;  4CJF A;  3EYZ A;  3AO4 A;  4LF8 K;  1KVA A;  1IBL K;  3HPG A;  1NJZ A;  1Y97 A;  1YXQ A;  5AQT A;  4CJV A;  2IVN A;  3FE1 A;  4BRD A;  4KHY A;  1WUA A;  4F3T A;  4Z4C A;  4BC5 A;  1WOQ A;  5GIN A;  3EEQ A;  4BC4 A;  3VF6 A;  1ATS A;  1U04 A;  2HHT A;  4FK0 A;  3O9S A;  5AQV A;  3OYI A;  3V9W A;  1GLF O;  3WQU A;  3JAM O;  3NMU A;  4UQG A;  2GBZ A;  1YHQ N;  2ATQ A;  2E4L A;  3VER A;  4CJS A;  1XNQ K;  3R9P A;  2P5O A;  1QVF M;  4M3R A;  1NBW A;  5KGX A;  3NGZ A;  3TSQ A;  3M5R A;  3SZ2 A;  1KCF A;  3KLF A;  1MWK A;  4AQY K;  1JLG A;  4X64 K;  3VQC A;  3UE5 A;  3OJU A;  3BY5 A;  3T1A A;  3AVA A;  1ASV A;  3T1H K;  1TV6 A;  2B6A A;  3TAP A;  2WTU A;  1Q7Y O;  3L6Q A;  3W0L A;  4CD1 A;  4GV9 A;  3HP9 A;  1GLD G;  3CXC M;  3RMA A;  3M6G A;  3K5N A;  1TYQ A;  3QEI A;  4BRO A;  3IRX A;  2R7Y A;  2YHY A;  5CYQ A;  4B8A B;  4IJA A;  4H03 B;  4DF8 A;  3P5J A;  3MN5 A;  4DFM A;  4ELV A;  1IV0 A;  4FW1 A;  3AA4 A;  3PX4 A;  1VQ4 N;  3VQ4 A;  3ITH A;  4N5S A;  2O8E A;  5AQQ A;  3LPU A;  4CJK A;  2A40 A;  2Q31 A;  3CJ9 A;  3SNN A;  2ZGZ A;  3ENO A;  4OGE A;  1ASU A;  2KKZ A;  2KW4 A;  3C6U A;  1JCG A;  4A61 A;  4GKJ K;  3IDH A;  5HRS A;  4H8K A;  3AVN A;  3D2F B;  2XY6 A;  2UU9 K;  3VQ7 A;  5ELZ A;  4ZTJ A;  5EOY A;  2P9U B;  3HVT A;  3U6F A;  1OVQ A;  3B6O A;  3SMP A;  4E19 A;  2UUB K;  5DM7 L;  5HRP A;  1TKX A;  3BEX A;  2KQ2 A;  1NGC A;  1S3X A;  4NB4 A;  4FZX C;  1RFQ A;  3CF5 L;  3ZSR A;  4DS4 A;  1KC8 O;  5KGW A;  1J54 A;  2XY8 A;  1SL0 A;  1ASW A;  3V9Z A;  2IGI A;  4JNE A;  3SAH A;  2Q0U A;  3JXU A;  4FOE A;  3A8Y A;  1K6Y A;  1GOB A;  1TVR A;  3CCL N;  3CQX A;  3V1Q A;  3P83 D;  2V51 B;  3FZL A;  1RDC A;  1HKG A;  1YUW A;  5AQX A;  3ZX0 A;  4CHN A;  4F2R A;  1A5X A;  2J4R A;  3RR8 A;  4BDP A;  4LF9 K;  3AVB A;  4BG9 A;  4DSL A;  3GBT A;  3VOV A;  4Z4G A;  4AHU A;  2GV9 A;  4JLH A;  3E01 A;  3AVF A;  4BAC A;  2IC3 A;  4PQU A;  1EWQ A;  2ZWH A;  3J80 O;  1R59 O;  3U8X A;  3TSP A;  4M41 A;  4YOT A;  3D6R A;  2D0A A;  4IDK A;  4RW9 A;  4J2D A;  3PY8 A;  3VEY A;  1O1W A;  1FJG K;  4CJ7 A;  3SQ0 A;  2E8A A;  4C8O A;  4DR6 K;  1RDU A;  4OPH A;  1NK4 A;  3G71 N;  1B92 A;  3ZET A;  3SJJ A;  3M8Q A;  2X6S A;  1GLJ O;  1T3V A;  4LF7 K;  4B9M A;  4YDU A;  4FJX A;  4ILJ A;  2UYT A;  2YKM A;  2PBD A;  3F2K A;  3U9D A;  3OYC A;  3DLL L;  4HTU A;  1N5Y A;  3HYF A;  1GLC G;  1RBT A;  4FLW A;  5AQW A;  2OZS A;  1QS4 A;  1SQK A;  3KLG A;  5AQS A;  5BPM A;  1NGD A;  1S6Q A;  2QI2 A;  4JKD A;  2BH1 A;  2Z1H A;  4BRC A;  4CEE A;  3P4I A;  3VMF B;  4CK3 A;  5K14 A;  1BI4 B;  1H1V A;  2I7N A;  3DLG A;  3O80 A;  3TAE A;  3MN7 A;  4O8U A;  4M7X A;  1E3M A;  1RT1 A;  3VQQ A;  3DOL A;  4X66 K;  3OYB A;  1HJO A;  4J8F A;  4C1N K;  1WLJ A;  3CJA A;  4BVP A;  3WNE A;  3SPY A;  3QIP A;  4ZTF A;  5J2Q A;  4YNQ A;  4V19 S;  3TAQ A;  2HBK A;  4B8C A;  1JLC A;  4NCG A;  4GY2 B;  1I94 K;  2O8F B;  4FK2 A;  1EWR A;  1NG9 A;  1TKT A;  3KJV A;  3A5M C;  1RBR A;  3QNO A;  4B9T A;  4BR0 A;  4WYB A;  2D0P A;  2FSK A;  3O1W A;  3H46 O;  3KK7 A;  4FJ9 A;  2NRH A;  1HKC A;  1LWC A;  1RBS A;  2P9K B;  1REV A;  2GUP A;  4JI2 K;  1JLQ A;  1S1T A;  4CZI A;  5EX5 A;  1XHZ A;  1WSJ A;  4E7L A;  2UXB K;  1IBM K;  4E0D A;  1D4X A;  3SAF A;  5JMV A;  2IVP A;  3ZSZ A;  4C8L A;  3NH2 A;  5DM6 L;  1XWL A;  3NE6 A;  1N36 K;  3AVG A;  4JI6 K;  2KFN A;  1W97 L;  1N8R O;  3SLC A;  3AVM A;  1RDD A;  2QKK A;  2A1R A;  4LH5 A;  3V6D A;  1SV5 A;  4CEA A;  3SCX A;  3M3Z A;  3THV A;  4HUF A;  3QNN A;  4DSF A;  5FPM A;  4BDY A;  4WQ5 C;  1B9D A;  2XY7 A;  1U48 A;  2YX6 A;  1OH8 A;  2G8I A;  5KPT A;  4E7I A;  3LZI A;  4OX9 K;  1WBB A;  4CIF A;  3THX B;  1TK5 A;  4MLH A;  4DTO A;  4WE1 A;  1HJR A;  2WC9 A;  3AO5 A;  4CED A;  4KHN A;  3L8B A;  4DQ8 A;  1VQL N;  3O5B A;  2P9S A;  5C2D A;  1MWM A;  3AY9 A;  4FJ8 A;  4NLC A;  1YJ9 N;  2HF3 A;  4K8X A;  4DQS A;  2ZJP L;  4RW4 A;  4J2A A;  4JK7 A;  1YIT N;  2D0C A;  2F96 A;  4ILH A;  5AQN A;  2E1Y A;  4PL8 A;  3ID6 A;  4BRI A;  1J6Z A;  3OYF A;  3UKR B;  1P8Z A;  4H0V B;  1BL3 A;  2QWQ A;  3IG1 A;  3KK3 A;  5M1O A;  2B5J A;  1T7P A;  4BQZ A;  5I42 A;  1ESV A;  2O8D A;  4NYF A;  2Q3S A;  4ID1 A;  4Z4H A;  2NRZ A;  3OS0 A;  3KK1 A;  3TI0 A;  3IAY A;  3ZT2 A;  4FJI A;  4GV3 A;  4DU1 A;  3ATV A;  3DYA A;  4CHY A;  4BY9 C;  3MWP A;  3HO1 A;  4CF1 A;  4CGH A;  2V52 B;  1WBD A;  3E66 A;  3ULE A;  1BA1 A;  2E2Q A;  3KD5 E;  3QB0 A;  2PAV A;  2A5X A;  3VQD A;  3HOS A;  1BIZ A;  3O6W A;  4I9Q A;  3LAK A;  1SUQ A;  4KTZ A;  3HST B;  4DV3 K;  3S41 A;  1C0G A;  3TWH A;  2B4J A;  1IKV A;  1C1B A;  3R1X A;  1S6P A;  4W5T A;  4BE2 A;  3L2Q A;  2XHB A;  3D45 A;  3QO9 A;  4AF1 A;  3NDK A;  2FF6 A;  4OPK A;  5CE3 A;  1U47 A;  3SQ1 A;  1Q82 O;  4DSK A;  4BC2 A;  2LSN A;  1RDW X;  4IKF A;  3CCU N;  2YJF A;  5FPN A;  5CYM A;  4LF6 K;  3O4Q A;  1JKH A;  1E4F T;  3ZSX A;  2QK9 A;  1EX4 A;  1DEJ A;  1ZBH A;  3H1Q A;  4LF4 K;  2VG5 A;  3HP6 A;  4A5B A;  5BR9 A;  3V9S A;  2DFE A;  2JLE A;  3B6P A;  2EHG A;  4DR4 K;  2VG7 A;  2QA4 N;  1SL2 A;  3RSE A;  1J9A A;  1QQM A;  2BUP A;  3N4P A;  3PO4 A;  3CI5 A;  5IWA K;  1HPZ A;  1JLF A;  1JJ2 M;  4HCC A;  2DTU A;  3MX5 A;  2VGM A;  2UUC K;  4DFK A;  1VSI A;  2V7Z A;  3TAF A;  4JI5 K;  5I3U A;  5M1F A;  4DG1 A;  2E1Z A;  3CMA N;  4DR3 K;  3FGU A;  3KTQ A;  1TYQ B;  3W3D A;  2OTJ N;  5AZJ A;  3JSM A;  3KWI A;  1GLB G;  3QIN A;  4IG3 A;  4DQP A;  3VF2 A;  4JYA K;  1ZYQ A;  4ISE A;  5F1X A;  3LDQ A;  4C8K A;  3L4I A;  3QEX A;  3CJ1 A;  3VPZ A;  3KZB A;  4I9L A;  3QES A;  4R79 A;  1BHL A;  1IJJ A;  2O8E B;  2Z1G A;  3CCQ N;  4KRF A;  1WSI A;  3U3Y A;  1S1W A;  4JS4 A;  3A5O C;  1TL3 A;  3H45 C;  4XH1 A;  4WFB L;  1WAJ A;  3H6E A;  3O9T A;  3LDO A;  4FJ7 A;  1S22 A;  3MCP A;  1ZXO A;  1TUY A;  5KPZ A;  2O8C A;  4DU3 A;  4O4G A;  2HST A;  3LDL A;  3MAQ A;  1YF5 L;  2HMP A;  3QIC A;  3IUC A;  4QS7 A;  4DQI A;  2KFZ A;  5J2N A;  1Q9X A;  5GIO A;  4W5N A;  5FPD A;  2YHW A;  2NRV A;  4BRM A;  2HHH K;  4JI4 K;  3RVC A;  3SJH A;  4CEF A;  4JI3 K;  3FZK A;  4MQ3 A;  3LDS A;  3CCE N;  1LCU A;  2ZM6 K;  1XHX A;  5KRS A;  3UIQ A;  2F8T A;  1XQS C;  5LMN K;  2CH6 A;  2UXD K;  4WFN L;  1KLM A;  1HKB A;  4BRF A;  4Y0W A;  2CGL A;  4HWI A;  4NO7 A;  3CJC A;  1EQY A;  3OA9 A;  4CGD A;  4DUZ K;  3T19 A;  5AQO A;  4ISF A;  4JKG A;  3CCV N;  5BN8 A;  2FF3 B;  3SUQ A;  1JLA A;  5KRT A;  1X9J A;  3ZT0 A;  1RNH A;  3DWL A;  4MO4 A;  2YKN A;  3O4W A;  4Z4I A;  1NGJ A;  3OYL A;  4JRQ A;  4WF9 L;  2PY5 A;  5LJV A;  1VQ5 N;  2W41 A;  3V9U A;  4N56 A;  2HHS A;  3G0Z A;  4KKO A;  2A41 A;  3DRS A;  4E7H A;  1K8K A;  5HRO A;  5J1E A;  4CES A;  1RIL A;  4CF9 A;  4K25 A;  3WEE A;  3LWM A;  4DHY A;  3ZET B;  3VQP A;  4FJH A;  2P9P A;  2ETJ A;  1VQ9 N;  3IS9 A;  1X9M A;  4FZZ A;  4KV8 A;  4YOV A;  4O44 A;  1J53 A;  1QSL A;  1UAX A;  1NKE A;  1LWF A;  1NMD A;  3J7A P;  4TSX A;  4H0Y B;  4BC3 A;  3T1Y K;  4XEI A;  4FLX A;  3G10 A;  4LY7 A;  4DLG A;  4JAX A;  4RTF D;  2ASO A;  2HHU A;  4YFU A;  3ZT3 A;  2RF2 A;  4CZH A;  4BRK A;  4E89 A;  3E9L A;  4XH5 A;  1N6Q A;  4CEO A;  3AGR A;  4PKG A;  5T7B A;  2P9N A;  4C23 A;  3OY9 A;  4BE0 A;  3HRG A;  3AAP A;  5FRN A;  1NJX A;  3AAR A;  4HCB A;  2OPS A;  3ZYY X;  1JLE A;  1XMQ K;  4JKH A;  3SMS A;  5GAH P;  3VGK A;  1WSE A;  3OVN A;  1YJN N;  3A5L C;  4AH9 A;  3BZK A;  3THY A;  3H1V X;  1A5V A;  2RKI A;  4KI4 A;  2VWB A;  5GAG P;  4NXN K;  2DPN A;  4AHV A;  2W6L A;  4U7B A;  4A62 A;  3HI0 A;  2Q36 A;  4X62 K;  1TUU A;  3THW A;  1T6D A;  4KHQ A;  1WSH A;  1L3U A;  4K8Z A;  1SAZ A;  1X9W A;  4I2Q A;  2Q97 A;  3HT3 A;  3D2E A;  2QM1 A;  2E20 A;  4A2B A;  4JI0 K;  4FWR A;  1EO1 A;  5AQU A;  3DMJ A;  4M3T A;  1IKW A;  4KHP K;  1K8A O;  2OCE A;  3L0Q A;  2UXC K;  5BRE A;  4BWJ A;  5FPE A;  3KIO A;  2BAN A;  4CJL A;  1TK8 A;  4PKH A;  4Z0U A;  4PHT X;  5BRH A;  2RPI A;  3BF3 A;  3KD1 E;  3I0S A;  2E2N A;  3Q7C A;  2HHV A;  1C0U A;  4E1N A;  1X1P A;  1WN7 A;  1ATR A;  4HHT A;  4CF8 A;  5EU7 A;  1VQ6 N;  2OZM A;  4FO0 A;  3DJC A;  5EVZ A;  1NOZ A;  3FZH A;  3CM5 A;  3A0I X;  5HBM A;  2VCP A;  4DUY K;  4KRE A;  3TTC A;  4O5B A;  1RTD A;  3WNF A;  4O0I A;  1Z05 A;  3HBT A;  3ATU A;  3CIP A;  2F8S A;  3HPO A;  3ZX2 A;  1YTU A;  5JIC A;  4DTJ A;  1I3A A;  2YI1 A;  4YOU A;  4GKK K;  2P9S B;  3KLI A;  3AA2 A;  3LM9 A;  3CPE A;  5M1Q A;  4IOC L;  5BN9 A;  1RCH A;  4BQL A;  3O3G A;  4JN4 A;  1U2V A;  3DXM A;  2NRR A;  4H4M A;  1Q18 A;  4M42 A;  1JLB A;  3F9M A;  3OYG A;  1QHT A;  4DTS A;  2IOC A;  4H0T B;  2A3Z A;  1XUP O;  5CZ1 A;  4FJJ A;  1YIJ N;  4Z4F A;  3DLK A;  4OVL A;  5F0X A;  5M1N A;  4UY8 O;  2DY4 A;  1FK9 A;  5FRM A;  3OYH A;  1GOA A;  2O8D B;  2H3G X;  3TU5 A;  3MWT A;  1LW0 A;  3O1B A;  3EZW A;  2QWO A;  3P38 A;  1QQN A;  3BGR A;  1VRU A;  1IO2 A;  3P31 A;  4CJU A;  4DS5 A;  1A5W A;  4CBW A;  2ASP A;  3MCA B;  4CZF A;  5LMU K;  3ULE B;  1JCE A;  3I8D A;  4BRQ A;  4CEZ A;  3RRH A;  3G4S N;  1VSH A;  4CZL A;  1TAQ A;  4CJQ A;  5E41 A;  3FZM A;  4LFA K;  4EIA A;  4OKK A;  2VWK A;  3VEO A;  3I33 A;  5LL6 Z;  2FSN A;  4DV1 K;  4CZE A;  1ZBL A;  2OPQ A;  1S1X A;  3ALY A;  4KO0 A;  3MEC A;  3S3O A;  4H5V A;  4NXM K;  4IFY A;  4CF0 A;  5AQJ A;  1EXQ A;  4A59 A;  2HB5 A;  4RWT A;  2HBJ A;  3QER A;  3SPZ A;  4M63 C;  4B9L A;  4NCA A;  3K57 A;  3L2U A;  4OGC A;  5JVG L;  4DQQ A;  2A6A A;  2HVH A;  3VA0 A;  3KKS A;  4CER A;  3MMV A;  1VQP N;  3C65 A;  4BRH A;  1V4S A;  1VSM A;  1RT3 A;  3KK2 A;  2X6N A;  4FXD A;  4ZHR A;  5AZI A;  3ZCM A;  3ENH A;  2HND A;  3BF1 A;  5CZ2 A;  4WCE L;  3SI6 A;  3LL3 A;  3RSE B;  4C8M A;  3OYD A;  1BQN A;  4BGA A;  4N41 A;  4FPB A;  3VQE A;  3U3G A;  5AQI A;  3TAR A;  1NK7 A;  4RW8 A;  3H3O B;  4J2B A;  3WXL A;  3RMB A;  1I39 A;  2E6L A;  1YI2 N;  2G8K A;  3ZX3 A;  1RGI A;  4I7F A;  3OS1 A;  3OYJ A;  4OJR A;  1WAF A;  2NLX A;  4LFB K;  4B08 A;  1YT3 A;  3EE8 A;  5AZJ B;  1E4G T;  1RTH A;  1RTJ A;  1TGO A;  3UKU A;  3DM2 A;  4H0X B;  4FLZ A;  3C94 A;  4BRP A;  1NGA A;  3CC4 N;  2PZS A;  1VSD A;  4G9Z A;  3WXK A;  3IMX A;  1EET A;  3WQT A;  3CME N;  3O3H A;  1YTA A;  1VSE A;  3GDQ A;  4FWN A;  1QZ5 A;  3HK2 A;  1CLQ A;  3ZSW A;  3AV9 A;  4DV4 K;  1C1A A;  2FBT A;  1RTI A;  4BR2 A;  1Q86 O;  3AGK A;  4O8K A;  4HUE A;  4FJ5 A;  2O8C B;  4ISG A;  4HUG A;  1U49 A;  3CM6 A;  2ITM A;  1ZBS A;  4CHO A;  4CCH A;  4AHT A;  4NCB A;  4K41 A;  4CD3 A;  5TKW A;  4FL9 A;  1N34 K;  2UUA K;  1C6V A;  2JGU A;  1JXE A;  3NF9 A;  3TSU A;  4BRL A;  2YNG A;  4KH6 A;  1VQN N;  4IZ9 A;  4IFV A;  3G25 A;  5CHI A;  4KFB A;  3RMC A;  5BPL A;  3CCR N;  3SV3 A;  5AQZ A;  1OVY A;  1NK6 A;  4FJM A;  4YY3 K;  1WB9 A;  4FLU A;  3PV8 A;  1K9M O;  4B3T K;  4FJL A;  5JS1 A;  3BZC A;  2KZM A;  1B9F A;  4EHT A;  2QWP A;  3DI6 A;  3LM2 A;  3AA3 A;  3LP0 A;  2DFF A;  3DXK A;  2YNI A;  2HNY A;  2HOE A;  4WQ4 A;  4DCH A;  3OS2 A;  3T3F A;  3TAN A;  3TAM A;  2HW3 A;  2YHA A;  3QBW A;  4CZJ A;  4CIE A;  2KTQ A;  3HL8 A;  4IDH A;  3CET A;  3GL1 A;  3BP8 A;  3CYM A;  1UWB A;  1L3T A;  3ZSQ A;  4PWD A;  4KPY A;  3QET A;  3L2R A;  2I7P A;  3SQ4 A;  4KHS A;  4CGF A;  4BG8 A;  3IKM A;  4GW6 A;  4M3Z A;  2HMI A;  2O8B A;  2Q0R A;  3AVC A;  4CJ4 A;  3K5L A;  5BR8 K;  3K2P A;  1KLN A;  4KAZ A;  2OPP A;  1K8K B;  4EAH D;  1UA1 A;  4I2P A;  1O13 A;  2GEM A;  3SK3 A;  3WEE B;  4M3W A;  5M1P A;  4QAG A;  1BIU A;  3OYN A;  3C7N A;  4AM6 A;  1NK5 A;  3TTF A;  1JXB A;  4H5T A;  1VRT A;  2P9P B;  2VWJ A;  1WNS A;  5DMR A;  3V4I A;  4IJN A;  4B9U A;  2G8W A;  1HRH A;  2FLO A;  2EX3 A;  3F5T A;  4BRA A;  1LWE A;  2O4I A;  4QS8 A;  1CXU A;  3ID8 A;  3PX0 A;  3SUO A;  3ZEU A;  3NVM A;  3U9Z A;  4KB1 A;  2QKB A;  1M90 O;  1HMV A;  4JK8 A;  4JD2 A;  4OO1 J;  4B1U B;  2QXF A;  3DLR A;  1ZBI A;  4EFH A;  1HLU A;  3LP3 A;  4DR5 K;  1ILY A;  2P9N B;  2WUS A;  4LF5 K;  2ZJR L;  4KI6 A;  1KSP A;  1F21 A;  3ZSV A;  3PX6 A;  3WXM B;  4BR4 A;  5ADX A;  2CGK A;  3CER A;  1VQ8 N;  2PYL A;  4NYN A;  3NBP A;  4CEB A;  1T6C A;  4PL7 A;  5HOO A;  5M1K A;  2AJQ A;  3RMD A;  4H0P A;  3THY B;  1QSS A;  4IBN A;  3DRR A;  5LJW A;  4DF4 A;  2GTD A;  3V9X A;  2YNF A;  2ZF5 O;  2XY5 A;  5JLF A;  1VSF A;  3NGY A;  2OTL N;  2GX9 A;  1IBK K;  1RBV A;  3MED A;  3THW B;  4K43 A;  4FWM A;  3WUH A;  4CVN E;  5AQL A;  3CCJ N;  3SUP A;  2GUI A;  4OKJ A;  3F73 A;  1NJW A;  3VEW A;  1KXP A;  1HYZ A;  4F3O A;  3PIP L;  3D2E B;  4LSN A;  3GE1 A;  3SYZ A;  3UB5 A;  5FRO A;  1X9S A;  5FLX O;  1S5J A;  1NOY A;  3R3L A;  1FXX A;  4H4O A;  3AVI A;  3KLH A;  4CGG A;  4KHU A;  3EKS A;  2ZJQ L;  2P51 A;  4JI8 K;  4BRG A;  3VEZ A;  1SZ2 A;  4FSV A;  3B8A X;  3AAQ A;  5JLH A;  3P1G A;  4EZ6 A;  3HPH A;  4LD0 A;  5AQM A;  3DRP A;  2HVI A;  2VQF K;  5J2M A;  2BE2 A;  4EHU A;  3CHW A;  4CHQ A;  3S3N A;  1BO5 O;  4CJT A;  1K73 O;  3MK6 A;  1J5O A;  2P9L A;  3AO3 A;  4CI6 A;  2HHW A;  2FBY A;  4OKE A;  3K9J A;  3LWL A;  1DLO A;  2X78 A;  2GWJ A;  1XI1 A;  4F9O A;  3OW2 M;  4E7J A;  4FWL A;  4AHR A;  4CZG A;  5D3G A;  1QVG M;  2G8H A;  4R5P A;  3K59 A;  4MDA A;  1NU0 A;  1T8E A;  3EN9 A;  4QS9 A;  1UA0 A;  3FZF A;  3CQ8 A;  1GLL O;  5AQK A;  1WSG A;  3O9U A;  4M45 A;  4Y1C A;  3A5N C;  4YDU C;  3NF7 A;  5ADX H;  1KVC A;  2OAN A;  3ISN C;  1D8Y A;  1JL1 A;  4KHW A;  2HHQ A;  2FSJ A;  1JCF A;  1U2V B;  3DXM B;  4DTU A;  3OYM A;  5KQD A;  1NK0 A;  2HF4 A;  3HVR A;  4PUO A;  4B3O A;  3CFO A;  4CE9 A;  4WQ5 A;  3OHR A;  3S3M A;  4GNI A;  1Z6R A;  5AQP A;  4FJN A;  3F9K A;  3SUN A;  4MFB A;  4JK9 A;  1RDA A;  1SKW A;  3K5M A;  3SBG A;  4B3R K;  3Q7B A;  4ILG B;  4IOA L;  2KHO A;  3TAG A;  4YHH K;  1L5U A;  3C6A A;  2QEX N;  4RW6 A;  4CHZ A;  4JKC A;  4I6M A;  3ENB A;  3NVK A;  4Y1D A;  2NRW A;  3L2V A;  1FKP A;  3K58 A;  1OH6 A;  1XMO K;  3PSF A;  4FWK A;  1NJI O;  4GV6 A;  2ZE2 A;  1M1K O;  3MXJ A;  1HX1 A;  2HNZ A;  1FW6 A;  2AA4 A;  4ICL A;  3RTV A;  1X3N A;  3E1Y A;  3J7Z O;  3ZSO A;  4CJ5 A;  2KZZ A;  3QDK A;  4BWM A;  2ZGY A;  3U4L A;  3EZ5 A;  2HHX A;  1X3M A;  4L8R B;  3EKU A;  1YVU A;  4O5F A;  1HUX A;  5MLC Q;  5I9E B;  1NGI A;  4CK1 A;  5KTQ A;  1DTT A;  3HOT A;  1DKG D;  5AQR A;  2OPR A;  4FM2 A;  1G15 A;  1J5E K;  4GMJ B;  4GVE A;  4JKE A;  5FDL A;  3QFP A;  3NF6 A;  3VN5 A;  4FLV A;  1G99 A;  3CCS N;  1LAW A;  3KKR A;  4JKA A;  4DTN A;  5AZI B;  5B8H A;  5SWM A;  5AQY A;  4M3Y A;  1CZA N;  2IAJ A;  4JHD A;  3LDP A;  1U45 A;  1Q81 O;  4F8R A;  3EE9 A;  3VF4 A;  4FJK A;  1QHA A;  3PUF A;  1NK8 A;  3RRG A;  1KFS A;  4EP4 A;  1TK0 A;  4K42 A;  5BRF A;  4PY5 A;  4RCH A;  3D7E O;  5H1S Q;  1S1U A;  3HM9 A;  4N76 A;  4M7Y A;  3MN9 A;  3VTH A;  3OJS A;  2FBV A;  4B9Q A;  1DGK N;  3O9R A;  1BGX T;  2AP1 A;  3CCM N;  4DR2 K;  3UKU B;  3NF8 A;  1XNR K;  1BU6 O;  2F9T A;  4IG0 A;  2KLA A;  4DFJ A;  3HZ6 A;  3O4N A;  4FWS A;  1BUP A;  4FWP A;  5E26 A;  1XC9 A;  2QTD A;  4RG8 A;  4B1Y B;  1W9H A;  3H08 A;  1YVN A;  3MXI A;  3NCI A;  3FFI A;  3VTI A;  5J2P A;  2QWM A;  4IWV A;  4RW7 A;  1KAX A;  1HNI A;  3JYT A;  3PSI A;  5C24 A;  4B3S K;  2P9I A;  1GLA G;  1FKO A;  5GIP A;  1HNX K;  1RT4 A;  3E9O A;  1VK0 A;  2QWN A;  1HNW K;  3D0P A;  4B1W B;  4QCL A;  4CIG A;  4DWI A;  2E2O A;  4FWQ A;  4WQ4 C;  4IO8 A;  4C1N I;  1W7A A;  3HSC A;  3C6T A;  1RT2 A;  2I5J A;  5AFU A;  4CJR A;  4FM0 A;  1NKB A;  1Q8I A;  4FPA A;  2ITG A;  1Z25 A;  3KLE A;  3O08 A;  2VG6 A;  2HBM A;  1C0M A;  1IH7 A;  4DB3 A;  4HVJ A;  3ZLJ A;  1BCO A;  5AQG A;  3LZJ A;  2Z1I A;  2PYJ A;  4CJW A;  3OBW A;  2DFH A;  1L3S A;  3FR0 A;  2YNH A;  3LAN A;  3SV4 A;  3VQ9 A;  3VQ8 A;  4IO9 L;  4CGJ A;  1BWF O;  1LOT B;  4DKW A;  2CGJ A;  3VQB A;  3SQ2 A;  3CPW M;  2G8U A;  3QEP A;  4A5A A;  3I8B A;  3DXK B;  2P5G A;  2HBL A;  4IEE A;  5BPN A;  1D9D A;  3SAG A;  4A2A A;  1KD1 O;  4DTP A;  4L3Q A;  3I0R A;  4YOX A;  3AVH A;  4FLY A;  1NK9 A;  4CJE A;  1KQS M;  4B9V A;  3PIO L;  1OH7 A;  1SS6 A;  1NLV A;  4FVU A;  3OYE A;  5C25 A;  3EY1 A;  4KH4 A;  1RT6 A;  4F4K A;  4AIL C;  2EWS A;  4FJG A;  1OKJ A;  4Z4E A;  3KVG A;  1RT5 A;  1QZ6 A;  2O8B B;  2BGG A;  3M8S A;  5JVH L;  3ZSY A;  5C12 A;  4AM7 A;  4KB0 A;  2XRI A;  4JKF A;  3OYA A;  3OYK A;  1NGG A;  3C7N B;  3EO3 A;  5AR0 A;  3NFA A;  1NGH A;  3OTO K;  4CK2 A;  1KTQ A;  5KI6 A;  1QQC A;  4E1M A;  2RN2 A;  5HRR A;  4B3M K;  2CH5 A;  2NRT A;  3CFP A;  2E88 A;  4BR9 A;  1L3V A;  3P39 A;  2FC0 A;  2ZD1 A;  3ZEU B;  3ZT4 A;  1NWK A;  1SKS A;  5C2F A;  2A1S A;  2D0B A;  4YOW A;  4JD2 B;  3QML A;  2G8V A;  1D5A A;  1BQM A;  2PFU A;  2Q2R A;  2F7T A;  5A2Q O;  4FYD A;  4DTM A;  1NJY A;  3CFR A;  3ULD A;  4FWO A;  4CFB A;  1SL1 A;  4E1J A;  1S72 N;  1DTQ A;  2D5R A;  5AFU H;  3MX2 A;  1HQE A;  3L3V A;  1RT7 A;  3CD6 N;  4CBU A;  4B9N A;  3WXI A;  1VSJ A;  3KHY A;  3QEW A;  1NGF A;  4WFA L;  2ZQB A;  1VSL A;  5AQF A;  5C0Y A;  2W40 A;  4Q0B A;  1YAG A;  3CG7 A;  1T03 A;  3TPQ A;  4DV6 K;  2YHX A;  3NHG A;  2G8F A;  1KVB A;  2GWK A;  4X65 K;  3WNH A;  4Z94 A;  4DV5 K;  5C15 A;  1ZBF A;  1KFD A;  1QQO A;  4BRN A;  1BG3 A;  1NMN A;  5EXW A;  3NAE A;  3LPT A;  2IIR A;  1IG8 A;  4JI1 K;  4J2E A;  3T69 A;  2BTF A;  4ELT A;  4DLE A;  1C1C A;  3DAW A;  1RBU A;  2A42 A;  4N47 A;  1MDU B;  3AO2 A;  4HTL A;  4CFC A;  3LAM A;  1C0F A;  1IKY A;  1VQK N;  4LH4 A;  3AA5 X;  5HP1 A;  1HPM A;  2E6M A;  2YV0 X;  4OLB A;  4JV5 K;  3AVK A;  4CW7 B;  2O4G A;  1S9G A;  2V7Y A;  2WON A;  3BUZ B;  3K5O A;  2D1K A;  2F9W A;  4CEQ A;  1NM1 A;  1LW2 A;  5JS2 A;  1TL1 A;  4LC9 B;  3D2F A;  4W5O A;  2JWL A;  3CJ7 A;  5E84 A;  5LY3 A;  2OYQ A;  3N4Q A;  3MEE A;  2P9U A;  3IFR A;  5C10 A;  4DU4 A;  5HL7 L;  4KTQ A;  3V1R A;  5IT9 O;  2P9L B;  1EP4 A;  4BRE A;  2QW9 A;  2VYP A;  1BCM A;  1TKD A;  4DQR A;  3O3F A;  3PO5 A;  5KPR A;  4FOI A;  4BVO A;  3L2W A;  4DR1 K;  1HNV A;  4H5R A;  2OA8 A;  3R6M A;  1Z26 A;  5TKY A;  3TTD A;  4BE1 A;  1CZB A;  1JL2 A;  1W0H A;  4FLT A;  5GAD P;  4YOR A;  3NH1 A;  4DSJ A;  3I55 N;  4B1Z A;  4CGI A;  1T44 A;  2BDP A;  3QBX A;  4LFC K;  1NGB A;  4F2S A;  3WT0 A;  5SZT A;  1CZ9 A;  5AJ3 K;  3EL2 A;  1NKC A;  5F2R A;  1WSF A;  4JKG B;  3T7Z A;  2E5L K;  1BDG A;  2NUB A;  2QWR A;  2IVO A;  4BGB A;  1HNZ K;  1VQ7 N;  3PLA A;  3RWU A;  3HJF A;  4OLA A;  3R8E A;  4CBX A;  1KAY A;  4CZM A;  2Z1J A;  4DMN A;  5AQH A;  3LP1 A;  3FLC O;  3VA3 A;  2NRX A;  3V1O A;  2QWL A;  4DSI A;  4IFE A; 
#chains in the Genus database with same CATH homology
 4KHP K;  2UUC K;  4DR5 K;  4JI5 K;  4LFA K;  2UXC K;  4DR3 K;  4X66 K;  4LF5 K;  1N34 K;  2UUA K;  5LL6 Z;  4K0K K;  4DV1 K;  4JV5 K;  3JAM O;  4V19 S;  4CW7 B;  4JYA K;  4JI7 K;  4NXM K;  1XNQ K;  1I94 K;  4DR2 K;  1XNR K;  1HR0 K;  4YY3 K;  4DUY K;  4LF9 K;  4AQY K;  4X64 K;  3J7Y P;  4B3T K;  3J7A P;  3T1Y K;  3T1H K;  1IBK K;  5IT9 O;  4JI2 K;  3OTO K;  4CVN E;  4B3M K;  4B3R K;  2UXB K;  1IBM K;  2F4V K;  4DR1 K;  4GKK K;  4YHH K;  3J80 O;  4DV3 K;  1N32 K;  5FLX O;  4B3S K;  1HNX K;  4DV7 K;  1XMO K;  4DR7 K;  1FJG K;  1HNW K;  1XMQ K;  5A2Q O;  1N36 K;  4JI8 K;  4LFC K;  4LFB K;  4JI6 K;  4DR6 K;  2HHH K;  4JI4 K;  4JI3 K;  4LF7 K;  5BR8 K;  2ZM6 K;  1N33 K;  4LF6 K;  4DV2 K;  2VQF K;  5LMN K;  4NXN K;  2UXD K;  5AJ3 K;  4LF4 K;  2E5L K;  4GKJ K;  4X62 K;  4OX9 K;  1HNZ K;  4DR4 K;  4DV6 K;  2VQE K;  2UU9 K;  4X65 K;  4DUZ K;  4LF8 K;  1IBL K;  4DV5 K;  1J5E K;  4JI0 K;  5IWA K;  4DV0 K;  4DV4 K;  5LMU K;  3J81 O;  2UUB K;  4JI1 K; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...