1IBKK

Structure of the thermus thermophilus 30s ribosomal subunit in complex with the antibiotic paromomycin
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
119
structure length
119
Chain Sequence
KRQVASGRAYIHASYNNTIVTITDPDGNPITWSSGGVIGYKGSRKGTPYAAQLAALDAAKKAMAYGMQSVDVIVRGTGAGREQAIRALQASGLQVKSIVDDTPVPHNGCRPKKKFRKAS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Recognition of cognate transfer RNA by the 30S ribosomal subunit.
pubmed doi rcsb
molecule tags Ribosome
molecule keywords 16S RIBOSOMAL RNA
total genus 29
structure length 119
sequence length 119
ec nomenclature
pdb deposition date 2001-03-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
K PF00411 Ribosomal_S11 Ribosomal protein S11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.80 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribosomal protein S11 1ibkK00
4DV3K 4DV1K 4K0KK 4DUYK 1N32K 1FJGK 4JYAK 5LL6Z 5IWAK 4GKJK 1XMOK 4JI2K 2UUAK 4OX9K 4CVNE 4KHPK 2VQEK 1HNWK 2UU9K 4X66K 1HR0K 3J7AP 4JI3K 4LFCK 4V19S 4X64K 4B3TK 4DV2K 4NXMK 4LF7K 4LFAK 1N36K 4DR4K 4DV5K 4DUZK 1HNXK 3T1YK 1N34K 2UUCK 2UXBK 3T1HK 2UXCK 3J7YP 2HHHK 4DR3K 4JI1K 2F4VK 4X65K 5IT9O 4LF9K 1J5EK 4JI5K 4DR7K 4LFBK 2UUBK 5LMUK 1I94K 4JI4K 4DR6K 3J81O 1XMQK 4LF8K 4AQYK 4B3RK 4JI8K 4DV6K 4NXNK 4B3MK 5FLXO 5AJ3K 5LMNK 4DV0K 4DR1K 1N33K 2E5LK 1IBKK 3JAMO 1HNZK 2UXDK 4JI0K 4DV4K 4JI6K 4LF5K 4LF4K 1XNRK 5A2QO 3OTOK 4DR2K 4B3SK 1IBMK 2ZM6K 1IBLK 1XNQK 4X62K 4DR5K 4JV5K 4YY3K 5BR8K 4CW7B 3J80O 4GKKK 4LF6K 4JI7K 4YHHK 2VQFK 4DV7K
chains in the Genus database with same CATH superfamily
1QZ6A 3QICA 4FL9A 4FZXC 2A1SA 4HVJA 4BY9C 1G15A 3I33A 4BRKA 2JWLA 3QO9A 3P83D 5FDLA 3MAQA 1ESVA 3V9WA 4R5PA 4OKKA 1NMNA 1VAZA 1RTDA 1VQ4N 2HNZA 3ASMA 4DSEA 3PIPL 4H4OA 1WBDA 3OYEA 2QWPA 3Q7CA 4EP5A 3MEEA 4CF8A 3SUOA 3OJUA 4BQZA 4B9MA 4LF7K 1T6DA 4OGCA 3D0PA 2IVNA 1XUPO 1NWKA 1NGHA 1TUUA 2NLXA 3OYAA 5GADP 2FSJA 2HHHK 1YVNA 3KTQA 1T7PA 1NM1A 4XH1A 3TAMA 1RT6A 5C2DA 1S1TA 1D9FA 2KHOA 1CLQA 1KFSA 3EE8A 3O9QA 4IOCL 3HRGA 3A5MC 3I0RA 1I94K 4CJSA 3G10A 5HLFA 1EKEA 3NFAA 1TK0A 3QEWA 3O5BA 4LD0A 1U04A 3THYB 4HUGA 4NCGA 4WYBA 1RTHA 1S9EA 3CPWM 1TYQA 3OYCA 2ZF5O 4H0OA 3BF3A 3GL1A 3M8PA 4DTUA 3L6QA 4IDKA 4HTLA 3H46O 3LDOA 1YF5L 3EN9A 3LM2A 1B9FA 4DV4K 2FXUA 1HQEA 3PUFA 3R6MA 4OPHA 1ZBSA 4PKGA 3K0SA 1BIUA 5BRDA 3AVLA 1NMDA 2G8HA 1WBBA 3TAFA 4KHSA 2ZM6K 3G71N 1Q18A 3HPOA 4PKIA 4YY3K 1MU2A 2QKBA 2NRRA 2E1YA 4CZIA 4A2AA 2FLOA 3VQ9A 4BE0A 2ZGYA 4DUYK 3CXCM 2P9KA 4HWIA 3M6GA 4YOTA 2ZWHA 1FXXA 3C0BA 3VF2A 4FLWA 1NGCA 1IG8A 4OVLA 1CZAN 5HOOA 4K8ZA 1RTIA 3E01A 1BU6O 4K25A 4CIFA 3PX4A 1VSMA 1IKYA 3VQEA 4NO7A 1C1BA 4X66K 3U6FA 4CIGA 1UA0A 3RTVA 2F9WA 1KLNA 1HKCA 3FLCO 1NGDA 3HOSA 2IVPA 4FVMA 3VQ5A 4BROA 1S5JA 3CCEN 3O6WA 1UWBA 3KZBA 4AHUA 3T1YK 2HHVA 4CF2A 3PSFA 4W5NA 5GIOA 1DEJA 2IOCA 3AO3A 4JEPA 3CC4N 2B5JA 3PIOL 4GV6A 1WSIA 1L3SA 4DQQA 4YORA 3MDQA 2I5JA 1SL0A 4C1NI 4I6MA 3L2QA 3QFPA 4DSLA 3TPQA 2FBXA 1D5AA 4MDBA 1GOCA 5AQXA 3CFOA 4DCHA 4B3RK 3C7NB 4IG0A 5LMNK 1GLBG 4CJVA 1FK9A 4E7LA 4N76A 3MCPA 1JCEA 1HUXA 5I9EB 4O0JA 3DOKA 4YFUA 3TU5A 2PYJA 4FZYA 4BE2A 5GAGP 5J2MA 5C0YA 4IFVA 1NJXA 1D9DA 4F8RA 4CJ7A 2E2NA 3OYHA 1JLQA 2VCPA 2Z1GA 4NCAA 3KK1A 1ATRA 2AA4A 1M1KO 5T7BA 1NGGA 2P9PB 3KLGA 3SMPA 2KW4A 2XY5A 1J6ZA 3KK3A 5BR8K 5KI6A 4GKKK 1ATNA 4FPAA 1HNVA 3HYFA 5BPLA 3NDKA 3ATUA 2NRXA 2GV9A 3WXKA 3HPHA 4FOEA 2HHTA 3UKUB 3QEVA 2P9UA 3O1WA 3L2WA 3VTIA 4FJ5A 3VQBA 1BG3A 4LC9B 2O8BB 2AP1A 5M1KA 1T05A 3L0QA 3C94A 3CG7A 1KVCA 4KHYA 3VEWA 4CVNE 5KQ8A 2X74A 1HYZA 1SV5A 2XO7A 1VQPN 1UAXA 3IAYA 1Z05A 3VQ6A 3THVA 3L8BA 1HYSA 4BWMA 4ISFA 1S1UA 2EWSA 2A3ZA 4DHYA 4DQ8A 1NG9A 3CM6A 3U3YA 3PV8A 2P9LB 4DLGA 2NRTA 2Q36A 3AVMA 5K14A 3OYNA 3H1QA 3J7YP 4ZHRA 4CHZA 4JI1K 2E8AA 4KKOA 2FSKA 2HHQA 3FZLA 5KPZA 3KK7A 1IJJA 3SMSA 4KHQA 2YV0X 3LANA 5FPMA 4B8AB 3LAKA 3CETA 4DQRA 3WXMB 2OA8A 1ZXOA 3RRHA 3CMEN 4QS8A 2Y1IA 3VQ8A 3LM9A 1BUPA 4K41A 4PQUA 2YKNA 3I8BA 3PLAA 4M45A 1YIJN 4DTJA 2PY5A 3QB0A 4DFKA 1YAGA 4FJLA 5TKWA 1VSKA 4FPBA 4DTOA 1BQNA 5C25A 3DXMA 4H5TA 3AARA 4Z4CA 4KTQA 3OYBA 3H3NO 1EO1A 3FZMA 4LF5K 4LF4K 1EX4A 2HVHA 5HRPA 2GWKA 2GELA 4U67L 3S3OA 1J9AA 3EZ5A 4BRIA 4B3SK 3VF4A 1ASWA 4CEBA 3FR0A 3NF7A 4Y1CA 3IG1A 4QAGA 3HJFA 1BA0A 3OYMA 4NYFA 4CZLA 4EFHA 3QFUA 2JWKA 2B6AA 3LPUA 3KD1E 2Q0RA 1VQ8N 4E3SA 4KTZA 3LP0A 3MN5A 4K42A 4BR2A 1KXPA 1TK5A 2A42A 1B9DA 4JYAK 1GOAA 3W0LA 1VSHA 3AA5X 3AVNA 4F2RA 2YNFA 3QIPA 5DM7L 2OPPA 1C0GA 1QQOA 2CH6A 5F0XA 1JLFA 1EWQA 2A6AA 1IKWA 5EY4A 4CFDA 2Q1NA 4E19A 4JNEA 3ZSYA 1HX1A 2D0BA 2XY7A 4JKHA 1SAZA 3NAEA 1BCMA 3L4IA 5BPNA 4CK3A 1HNXK 3QDKA 2YHYA 2YNHA 4NLCA 2PBDA 1L3VA 2O8DA 2P1JA 1W97L 2F4VK 4BRCA 5AFUH 4RG8A 3KVGA 4H5RA 3T69A 1HLUA 3BP8A 3CCVN 1BOTO 3A5OC 3T19A 2NUBA 2QWLA 5LMUK 3TTCA 4CGGA 2W42A 3E9LA 2Q97A 4IWVA 5AQGA 2O8EB 4KH6A 4XH5A 1YITN 1QS4A 3QBWA 4J2EA 4FWMA 3AVBA 3AA3A 4Z0UA 5GIPA 1U6ZA 5CZ1A 3WEEB 4GV3A 4HTUA 4PY5A 3ID8A 5CY4A 2XY6A 4EAHD 4NCBA 4L8RB 4BDYA 1SQKA 4HUEA 1MDUB 4DFMA 3V9SA 5ADXH 2KZZA 3NCIA 2P9UB 5A2QO 4DR2K 2BTFA 4KHNA 1DTTA 1XNQK 1C0MA 3H6EA 3CCSN 2J4RA 3ZT2A 1Z26A 4BG9A 3J80O 2O4IA 4KHUA 3H1VX 2YI1A 4B9LA 2E88A 4WE1A 4JD2B 1KTQA 1HPZA 1W7AA 1YT3A 1KCFA 4OLAA 4B1ZA 4BRMA 1YJWN 4B9SA 5DK5A 3VQ7A 1BL3A 2GBZA 4XIUA 1Z6RA 5AQWA 5KGWA 2I7NA 1Z25A 3VERA 2ETJA 5I42A 3LWLA 3AO1A 4DQSA 4H03B 3I8DA 4DSIA 1BISA 1E3MA 4CEOA 3DLLL 3ATVA 4DR4K 1N36K 3LDPA 3G6EN 3MX5A 3VEOA 4M3ZA 2GX9A 4CFCA 4AHVA 3WXLA 4BR7A 2Q31A 4DTRA 3DWLA 2O8DB 3WNFA 4W5OA 3KIOA 3NVMA 4WQ4C 2RE2A 3P5JA 1D4XA 5FRNA 4BC4A 3AAQA 4WCEL 4BE1A 3DI6A 2YX6A 4KI6A 1W0HA 3TWHA 4FLTA 1Q7YO 3SK3A 2E2PA 1WAJA 1BCOA 4IZ9A 1JJ2M 4CF9A 3JYTA 4DFJA 4AHRA 1JLCA 4ICLA 3O4QA 4JI8K 5CHIA 4QS7A 2FF6A 1OVQA 2QW9A 4DU1A 4Y1DA 1QQNA 4DTNA 1BHLA 3P4IA 3JAMO 3SUQA 3QEIA 3LPTA 2KTQA 3NBPA 1ASUA 5HROA 2YJFA 2ZE2A 1U48A 5CYMA 2RHKA 2F7TA 1XNRK 5E41A 1C0TA 1K8AO 3FFIA 4WQ5A 5SWMA 5MLCQ 2F96A 3KJVA 3NGYA 4JV5K 5C2FA 4FK4A 1YHQN 3E9PA 3B8AX 1KAZA 5LL6Z 1GOBA 1JXBA 2QKKA 4DV1K 1TL1A 2X6SA 4KB0A 1KAYA 1RT3A 3O9RA 3DLGA 4IG3A 3QBXA 3V4IA 1FJGK 1RBTA 4C8OA 2YHAA 4ILHA 5KPTA 3DLHA 1HNIA 5AQKA 2FSNA 4CHNA 1OVYA 3V9UA 4M3UA 1S6QA 4JRPA 1RDAA 5KQDA 2QWQA 4GMJB 1WSGA 5AQVA 4I2PA 5AQLA 2VWBA 1SL1A 3A5NC 3J7AP 3L3VA 2QXFA 3PO4A 4DF8A 4FVUA 3O4NA 3EKSA 4JHDA 3AA4A 1D8YA 2O8FA 3VGMA 5AQJA 1ZBFA 3O9TA 5KRTA 4DUZK 4CJTA 2A40A 5SZTA 4OGEA 3FGUA 3CERA 3OJSA 4A5AA 3QNNA 4CK2A 2WOMA 5AQUA 4BDZA 3IRXA 4CJ5A 1T44A 1X3MA 2YKMA 4GVEA 4CJFA 4DTXA 4KO0A 3THXB 1BQMA 1L3UA 3MMVA 4J2AA 1DKGD 3T1AA 3C6TA 1VHXA 3P31A 1FKPA 3DLRA 4AH9A 1NGJA 3THWB 3HSTB 3J7ZO 4DV6K 4DS4A 1LWCA 5CZ2A 3FZKA 4O0IA 3DXKB 1QSLA 1O13A 5C12A 4LH5A 1CXQA 5TKYA 3V1RA 4DV0K 3CJ1A 2Q0UA 2QXLA 2D0AA 1VSIA 2WUSA 4EHUA 4M3YA 3UKUA 4JHDB 3OVNA 2HHXA 3RMBA 1RBVA 2V7YA 4CFBA 4DB3A 1SKRA 4CJ4A 3B6OA 4O8UA 3RWUA 4B8CA 3KLIA 5E84A 4TSXA 2HNDA 2IIRA 4IDHA 4CJEA 4AM6A 4JI7K 4A61A 4ZTFA 1LAVA 4BR5A 3CCJN 3S41A 3LWMA 4FJXA 2WTUA 3NVKA 1BI4A 4FOIA 4IEIA 4K0KK 1ZBIA 4CGIA 3WXIA 3K57A 4CBXA 2A1RA 2CGJA 4FJJA 1OH5A 4BC3A 4JK8A 4CZFA 3CHWA 2W6LA 2UU9K 3D2FA 3O80A 1JLGA 5EXWA 4A59A 1L3TA 1YJ9N 1C1AA 4A2BA 1RT7A 1C0UA 3W3DA 3DLBA 1G99A 1K8KA 4DS5A 4DWIA 3TTFA 4FJKA 4PWDA 5EU7A 3H45C 4O44A 4FM2A 3CC7N 3SJHA 5JLHA 2RKIA 2RPIA 4E7JA 2GWJA 4AILC 3E1YA 3HK2A 3A0IX 2OPSA 2DFEA 2HBLA 3P38A 3TABA 4MQ3A 1ITGA 2EX3A 4FO0A 4X65K 3TSPA 3SBTA 4LY7A 4B9UA 4JI5K 4FK0A 5FPNA 2O8FB 3HL8A 1NU0A 4FLUA 2CGLA 4JKGB 1VQ5N 3DRSA 3CD6N 4FCYA 4CHOA 1WSJA 5M1PA 3B6PA 4IBNA 4JI4K 3RMCA 4GVMA 3DOLA 2QA4N 2O4GA 4NXNK 4B3MK 4DFPA 1TK8A 2V7ZA 3DM2A 1RDDA 3OYDA 3CJAA 2OZMA 1GLCG 4JAXA 1IBKK 2FBTA 1Q81O 3GE1A 1VSEA 1TVRA 1EXQA 2OCEA 3CQ8A 4CE9A 4IEEA 1T3VA 4G9ZA 1Q82O 5AFUA 4JKBA 4WFBL 2QI2A 3O9SA 1HYVA 3SLCA 4HHTA 4GW6A 1VSDA 4CHYA 4FLZA 1N8RO 1MWKA 1HPMA 4UY8O 1S1WA 3AGRA 1RDUA 1C1CA 4DG1A 4DV3K 4DSFA 3VENA 3ALYA 3D45A 4CI6A 3N4PA 4NLBA 3O1BA 3CJ7A 5AQHA 3H08A 3AV9A 4BR4A 4FLXA 4NB4A 4Z4FA 1I39A 1IKXA 1RT2A 4I2QA 5M1QA 3K58A 3CPEA 3MXMA 5BRFA 1SKSA 3DLKA 2XHBA 4FSVA 3S9HA 4C1NK 4DKWA 3V81A 1SL2A 1XHZA 1NKBA 3K5NA 4B1WB 1C0FA 2CH5A 4V19S 2DFFA 4X64K 5KPRA 2XY8A 4WF9L 1W2BM 4QOZB 4BVOA 3HXMA 1FKOA 1UOCA 2HMPA 5AQRA 1Q9YA 1OH6A 2IGIA 1BGXT 2P5OA 3AVFA 3ENOA 4M42A 4H5NA 4IJNA 4CEQA 4KH4A 3L2UA 5FRMA 3I0SA 1DLOA 4L3QA 4YNQA 4J8FA 4FJHA 2KLAA 4FJ9A 3CQXA 3RMAA 1S1VA 1TKXA 4M3XA 2YNGA 5ADXA 4QS9A 5EVZA 5H1SQ 4BREA 4LFBK 3F73A 2VG7A 4ILGB 4CGJA 3I55N 3SJJA 3CFRA 4AQYK 1TAUA 4FLVA 3L2RA 2BDPA 4KPYA 5FLXO 3ZLJA 1R59O 1EP4A 5B8HA 5AJ3K 4BC5A 3OS2A 2NZTA 4DR1K 1N33K 1RT5A 2HB5A 4W5QA 5AQPA 3AVGA 4JKAA 4KH5A 5D3GA 2BGGA 1CZ9A 1O1WA 4WFAL 5JS1A 4B1UB 2FC0A 2FBYA 3DLEA 4RW9A 3SI6A 5HBMA 4CJUA 4IXCA 1XQSC 1IBMK 3F9KA 3KWGA 1DTQA 3VEVA 1HKGA 2E6LA 1NJIO 3EZWA 1YUWA 2WBNA 3T3FA 1JL1A 4LF6K 3HO1A 3ZSZA 3PSIA 3U4LA 3HPGA 4DQPA 3CCLN 3G25A 4CZKA 4BR0A 4FW1A 3E9OA 4M41A 1P90A 1UA1A 1VQ9N 4DF4A 2P9KB 3CIPA 4W5RA 1KC8O 5AQOA 4F4KA 3VN5A 3QNOA 3WXJA 4FWRA 5IWAK 2G8VA 3TTDA 3CCQN 3SV4A 4GKJK 3RSEB 1HJOA 1SS6A 2ZD1A 4FJ7A 2VQEK 3LALA 4JN4A 1S72N 3VOVA 1HR0K 2PYLA 2PFUA 2QWRA 3ZT1A 4BRLA 1KFDA 2G8WA 1YTAA 1ASVA 4ELTA 1IKVA 3RRGA 3BZCA 2RF2A 1RBRA 2IC3A 3MXIA 1NGBA 1Q8IA 2G8IA 5AQYA 3OYJA 1WSEA 1X9MA 4CEFA 2P9LA 5F1XA 1NNEA 3LZJA 4GY2B 4RWTA 3IDHA 4JS5A 4ISGA 2YNIA 3G0ZA 4JRQA 2P9IA 3VTHA 4Z94A 1S6PA 3EY1A 3TSUA 3K9KA 3KLHA 1U45A 4YDUC 3J81O 3SZ2A 2P9PA 3AVHA 1XMQK 2WFBA 2P9IB 4CD3A 5EX5A 3IS9A 4IO8A 4K8XA 1SUQA 1R0AA 2OPQA 2HW3A 5J2PA 1H1VA 3ID6A 3LP2A 2D0CA 3SQ0A 2YJEA 2PAVA 1RILA 1TKZA 3M1FA 3ULEA 4CHPA 2OPRA 1QHAA 3CI5A 4BDPA 1X3NA 5CE3A 1WB9A 1RT4A 1X9JA 1E4GT 1V4SA 4M3TA 1HKBA 3MEDA 4E0DA 4BRPA 3NE6A 1BWFO 1RDBA 3D2FB 1RNHA 3PX6A 4HUFA 2A41A 4DR5K 3VEXA 4CEAA 3WNGA 3BZKA 4H4MA 3DXKA 3BGRA 3WT0A 1OKJA 4ZTJA 5AZIA 2ITMA 4FWNA 3HI0A 2QWOA 4C8MA 2ATQA 3THWA 4AM7A 1YI2N 4CZEA 2OYQA 3AO4A 4B08A 4DTMA 4E7IA 1XC3A 4KHPK 1U49A 3CCUN 1GLAG 5AR0A 1KQSM 3HOTA 3EKUA 2D4WA 1NJWA 3SQ2A 2OTJN 4OKJA 3ZX3A 3LDSA 4NXMK 2Z1HA 1S9GA 1TUYA 4O5FA 4QCLA 1VQNN 2P9SA 1LCUA 5M1NA 2UUCK 4KI4A 1SKWA 5KTQA 3V1QA 4KB1A 2IVOA 2VG5A 2P9SB 4H0XB 5JICA 3ITHA 1T03A 3ZCMA 1NKEA 3VMFB 1JKHA 3NMUA 4BRAA 3TAEA 5BR9A 3MN7A 2E20A 2ZQBA 3ENHA 3SCXA 2JGUA 1IO2A 2HBKA 3DJCA 3Q7BA 4BR9A 3PY8A 4ILJA 1TAQA 4M7YA 3SAHA 1P8ZA 3M8QA 2KZMA 2YHWA 1QSSA 3DXMB 3O4WA 3F9MA 3DRRA 4E7HA 4PA1A 5J1EA 3ZYYX 1U2VA 3WUHA 3VEZA 1RDCA 3K5MA 4I9QA 3F2KA 4DMNA 4B1VA 1VQ7N 1W9HA 4DV7K 1WUAA 4A5BA 4CEEA 4M63C 2OANA 3JS6A 4DSKA 1LAWA 2G8FA 3UE5A 2QEXN 4E7KA 4CJQA 4BGBA 1NGFA 3SBGA 2RN2A 3ZSQA 2V52B 3M5RA 4RW4A 3WEEA 3GBTA 4AHSA 3VGKA 4CF0A 1JCFA 4LFCK 1RDWX 1EETA 4B3TK 1LV5A 2WC9A 4FLYA 3VA3A 2Z1JA 4FYDA 1NKCA 3QLHA 4CECA 2NRWA 1DT9A 1NBWA 3RSEA 1NK8A 3OA9A 1REVA 1BO5O 1WNSA 3VF6A 3RVCA 3L2VA 3F5TA 1HQUA 2I7PA 3CFPA 4OPJA 2ASOA 3L4QA 1JL2A 2WONA 1KD1O 2HBMA 3IFRA 2E6MA 1Q86O 3P1GA 1GLEG 4DR7K 1WSFA 4A62A 3M3ZA 1VSLA 4I9LA 1VQ6N 4JK9A 4JKGA 4R79A 1LOTB 3AVIA 2BE2A 2O8CB 1X1PA 1U4BA 2HNYA 3OYFA 5JVHL 3TSQA 5KGXA 4Q5VA 5DMRA 4MO5A 3OS1A 3S3MA 2FBVA 1V4TA 2GEMA 1HNZK 3C6AA 3RMDA 4CIEA 3LP3A 4E1MA 5HP1A 4JI0K 4JI6K 1BI4B 3C65A 4ID5A 3AY9A 3EYZA 2HMIA 3OTOK 3N4QA 3HVRA 2HHUA 2ZJRL 2ASPA 3D7EO 4B9VA 2X78A 1X9SA 3MXJA 1KRPA 4YHHK 4FJ8A 2VQFK 3WQUA 3AO5A 2F9TA 2ZGZA 3LZIA 5EOYA 1LWFA 1NJZA 4DSJA 5AQTA 4F3TA 2GUPA 3HBTA 1T6CA 3QMLA 5KRSA 1VQON 1JXEA 2NRZA 2QWNA 3KKRA 3M8RA 1J53A 3NF9A 4E1NA 5FPEA 4H5VA 4CGHA 3OYKA 3O9UA 1YJNN 2OZSA 2VWKA 1Q9XA 4LH4A 3O3GA 3T7ZA 4H0VB 5BN9A 5BN8A 4JI3K 1K8KB 4YOUA 3QEXA 4DV2K 4F3OA 1TGOA 3MX2A 4J2DA 3VQCA 2F8TA 4ID1A 1L5UA 3C95A 3KLEA 2O8BA 2UXCK 4FXDA 4B9NA 4DTSA 4W5TA 3D6RA 3SAFA 4E89A 5DM6L 4I7FA 4DLEA 2P9NA 3O3HA 2VG6A 4CD1A 3VETA 4CBUA 3EEQA 5J2QA 1ZBLA 2P51A 1RBSA 1YXQA 3DRPA 3GG4A 3MWPA 4EZ6A 4M3WA 5FROA 4J2BA 4CJLA 2H3GX 4CBWA 2QM1A 3CM5A 1XWLA 4RW7A 1NK4A 4C8KA 3HVTA 1TYQB 4KTWA 1VQLN 5JLFA 4GV9A 3KD5E 3HTVA 4BC2A 3V6DA 1IV0A 4FWPA 1LWEA 4EP4A 3DAWA 3ZT0A 4JD2A 4FM0A 1CZBA 3CCMN 5C10A 4CEDA 2OTLN 2O8EA 2BUPA 3CF5L 3OY9A 3WNEA 2ZJPL 4CK1A 2B4JA 2X6NA 3HM9A 3MK6A 4PL8A 3EL2A 3KLFA 3RR8A 2HHWA 4CW7B 3UKRB 1QVGM 3HM8A 3P39A 3SAGA 3A5LC 4LSLA 1U47A 5GAHP 3M8SA 1TKTA 4IOXA 2E4LA 4ELVA 1WSHA 3AO2A 2HOEA 1M90O 3ZSXA 4BG8A 4BRFA 1YTUA 3H3OB 3KKSA 4PHTX 4IOAL 1A5XA 1NK9A 1NGAA 2KFNA 3R9PA 4YOVA 1XMOK 4BWJA 4Z4HA 3SUNA 4FJIA 1DGKN 1QTMA 4WQ4A 1OH8A 3HP9A 2ASMA 4CEZA 1HMVA 2O8CA 4KBOA 1LW0A 3EO3A 1QE1A 3TAQA 3K5OA 1XI1A 4EHTA 4DV5K 5AQMA 4CZMA 4OJRA 3R8EA 1EWRA 4BRDA 2DPNA 4KRFA 4FW2A 5C24A 2UXBK 3VGLA 3AVKA 3GOIA 1VSFA 3VQAA 4DR3K 1S3XA 5IT9O 4FJMA 3UIQA 1WN7A 1J5EK 4FWKA 3VQ4A 3V9XA 2FF3B 2QK9A 5JVGL 3KK2A 3QERA 3DYAA 3NF6A 3WNHA 2Y1JA 1K6YA 2HVIA 1U2VB 4H8KA 3BDPA 4ELUA 3ZSRA 1S22A 3VQDA 4BRQA 2E2OA 3C6UA 3CQYA 1NK6A 3BF1A 4KFBA 4CGDA 1N5YA 3MWTA 4M3RA 3SQ1A 3FE1A 5AQSA 3NGIA 2Z1IA 2E5LK 4F9OA 3TAGA 3LDQA 4O8KA 4DU4A 1BDGA 1GLJO 3R3LA 3O8MA 4CZJA 2VWJA 5JS2A 1NK0A 1GLFO 1VRUA 2DFHA 4Y0WA 4XEIA 1BIZA 3MECA 4N47A 4CFAA 4CCHA 2NNWA 4FM1A 4EZ9A 5HL7L 3KWIA 3IUCA 1A5VA 3AVCA 2BH1A 2LSNA 3UKRA 4Z4EA 4KAZA 4O55A 1GLDG 1X9WA 3PO5A 3HT3A 4Q0BA 4MFBA 4XH4A 2ZJQL 3ZT3A 3OBWA 3CJCA 4JKCA 3KHYA 1ZC6A 1NOYA 4B9TA 3QETA 2D0PA 3OYIA 3AAPA 2G8UA 5C15A 4KHWA 3K59A 4F2SA 4FWQA 4BVPA 3ZETA 4I6MB 4EIAA 3S3NA 4N41A 4IFYA 1E4FT 4OPAA 4OX9K 4E1JA 4JS4A 3TANA 4CZHA 3U9ZA 3MN9A 1QVFM 2VYPA 4H5WA 1IG9A 1NK7A 4FWLA 4RTFD 5LJWA 4LFAK 1I3AA 3QINA 1J5OA 4JKFA 1NJYA 1HJRA 2NRHA 5AQQA 3ZETB 3QEPA 4IO9L 2E2QA 3C7NA 3U3GA 4MLHA 2KQ2A 4DU3A 3FZHA 1KAXA 3VA0A 1NOZA 3NH2A 3ZEUA 3LP1A 1NLVA 1TKDA 1K73O 3SQ4A 5F2RA 5JMVA 2VGMA 5HRSA 4ISEA 4YOYA 1K9MO 3BUZB 3IMXA 3K2PA 3ZSOA 3DMJA 1VQKN 2D1KA 2EHGA 1QSYA 4C8NA 2V51B 3WQTA 4GNIA 3J8AA 4B9QA 1CXUA 3EE9A 5M1OA 1MA9B 4O4GA 4OLBA 3ULEB 2HBJA 3OYGA 2GUIA 3C6HA 1ZBHA 4FJGA 2UXDK 1KVBA 3AGKA 3V9ZA 3V1OA 3QESA 1HRHA 4BACA 2Q2RA 1VRTA 4OKEA 3TARA 4MO4A 4CESA 5BREA 4M7XA 4HCCA 1WAFA 3THXA 2HSTA 5BPMA 4WQ5C 3NGZA 4FWOA 5C42A 3ZSWA 1XC9A 3CJBA 4IKFA 4B1YB 4BGAA 4Z4GA 5BRHA 3FZFA 2YHXA 4CGFA 2R7YA 1EQYA 1OH7A 3CC2N 1JLAA 1N32K 4CJPA 3TR8A 3L3UA 1YVUA 1SZ2A 3GDQA 4JI2K 1RT1A 3O08A 4B1XB 1HNWK 2HF4A 2YCHA 4O5BA 1Y97A 3NH0A 3JSMA 5GINA 1JLBA 2W40A 4CJKA 3AVAA 3D2EB 4RCHA 3VQPA 2IAJA 3UB5A 3ZEUB 2Q3SA 1ZBUA 5LY3A 3O3FA 2F8SA 4Z4IA 1JLEA 3OBYA 2D5RA 4IJAA 1F21A 3NH1A 1Y64A 3BY5A 4DTPA 5J2NA 2E1ZA 2XRIA 4B3OA 3U9DA 4CJWA 3NHGA 5AQIA 2UUBK 5M1FA 3A8YA 4PL7A 1QQCA 4JK7A 1J54A 3VEYA 5AQZA 4LF8K 3HSCA 3NF8A 4FK2A 1S1XA 1VK0A 4CZGA 1XHXA 1RBUA 5HRRA 4FJNA 2HHSA 3K5LA 5ELZA 4C8LA 5HRNA 2KKZA 4CHQA 2ITGA 2DTUA 2NRVA 3IKMA 4BRGA 5CR4A 1N6QA 1VQMN 2KFZA 3ZX2A 4YDUA 1VSJA 2QWMA 5I3UA 1FW6A 5CYQA 3LDLA 2W41A 4PKHA 4C23A 4CJ3A 4RW6A 3MCAB 1IBLK 3TAPA 2DY4A 3LL3A 2GTDA 3VQQA 4MLEA 3SUPA 2P5GA 1KSPA 5AZJB 1IH7A 2YHBA 1A5WA 4HCBA 1MWMA 3LAMA 5LJVA 1NGEA 1NGIA 1GLLO 3RR7A 2D0OA 3G4SN 2A5XA 2UUAK 1QZ5A 3R1XA 3E66A 1TL3A 1RCHA 4CJRA 1C6VA 1TV6A 5FPDA 3AVJA 3SPZA 2IS3A 4UQGA 4AHTA 2HF3A 1KVAA 5AQNA 4U7BA 2UYTA 4YOXA 4N5SA 4OO1J 3MEGA 1RFQA 5AQFA 3CCRN 4DQIA 1JCGA 1T8EA 4NYNA 3OHRA 3BEXA 1N34K 3HP6A 1RGIA 1QHTA 1LW2A 3K9JA 3T1HK 2AJQA 2W6KA 1B92A 4H0TB 3ZSVA 3OS0A 4K43A 5E26A 2QTDA 4AF1A 3THYA 4LF9K 3AA2A 4BRNA 1NK5A 1ZYQA 3VESA 4KREA 3I56N 3OW2M 4BRHA 1BA1A 1ILYA 2BANA 3JXUA 3FFKB 4CERA 1RTJA 4RW8A 4LSNA 4DR6K 3QIOA 4FWSA 2IDOA 4JKDA 3SV3A 3MN6A 4G1QA 4KV8A 4H0PA 4A57A 3LDNA 1KLMA 4FZZA 4CF1A 4JLHA 3ENBA 4MDAA 5GAEP 2P9NB 2CGKA 5AZIB 4BQLA 4IFEA 3PX0A 2G8KA 3U8XA 3CJ9A 3ISNC 3TI0A 3VPZA 3ZT4A 2JLEA 2VGNA 3SNNA 4H0YB 3OYLA 4YOWA 5AZJA 4PUOA 3SPYA 1WOQA 3D2EA 3ZX0A 4N56A 4OPKA 3ULDA 1ATSA 3HZ6A 2PZSA 4AHCA 4X62K 3SYZA 4WFNL 1WLJA 4JKEA 1QQMA 3A2FA 3CYMA 3CMAN
chains in the Genus database with same CATH topology
4DV3K 4DV1K 4K0KK 4DUYK 1N32K 1FJGK 4JYAK 5LL6Z 5IWAK 4GKJK 1XMOK 4JI2K 2UUAK 4OX9K 4CVNE 4KHPK 2VQEK 1HNWK 2UU9K 4X66K 1HR0K 3J7AP 4JI3K 4LFCK 4V19S 4X64K 4B3TK 4DV2K 4NXMK 4LF7K 4LFAK 1N36K 4DR4K 4DV5K 4DUZK 1HNXK 3T1YK 1N34K 2UUCK 2UXBK 3T1HK 2UXCK 3J7YP 2HHHK 4DR3K 4JI1K 2F4VK 4X65K 5IT9O 4LF9K 1J5EK 4JI5K 4DR7K 4LFBK 2UUBK 5LMUK 1I94K 4JI4K 4DR6K 3J81O 1XMQK 4LF8K 4AQYK 4B3RK 4JI8K 4DV6K 4NXNK 4B3MK 5FLXO 5AJ3K 5LMNK 4DV0K 4DR1K 1N33K 2E5LK 1IBKK 3JAMO 1HNZK 2UXDK 4JI0K 4DV4K 4JI6K 4LF5K 4LF4K 1XNRK 5A2QO 3OTOK 4DR2K 4B3SK 1IBMK 2ZM6K 1IBLK 1XNQK 4X62K 4DR5K 4JV5K 4YY3K 5BR8K 4CW7B 3J80O 4GKKK 4LF6K 4JI7K 4YHHK 2VQFK 4DV7K
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4DV3 K;  4DV1 K;  4K0K K;  4DUY K;  1N32 K;  1FJG K;  4JYA K;  5LL6 Z;  5IWA K;  4GKJ K;  1XMO K;  4JI2 K;  2UUA K;  4OX9 K;  4CVN E;  4KHP K;  2VQE K;  1HNW K;  2UU9 K;  4X66 K;  1HR0 K;  3J7A P;  4JI3 K;  4LFC K;  4V19 S;  4X64 K;  4B3T K;  4DV2 K;  4NXM K;  4LF7 K;  4LFA K;  1N36 K;  4DR4 K;  4DV5 K;  4DUZ K;  1HNX K;  3T1Y K;  1N34 K;  2UUC K;  2UXB K;  3T1H K;  2UXC K;  3J7Y P;  2HHH K;  4DR3 K;  4JI1 K;  2F4V K;  4X65 K;  5IT9 O;  4LF9 K;  1J5E K;  4JI5 K;  4DR7 K;  4LFB K;  2UUB K;  5LMU K;  1I94 K;  4JI4 K;  4DR6 K;  3J81 O;  1XMQ K;  4LF8 K;  4AQY K;  4B3R K;  4JI8 K;  4DV6 K;  4NXN K;  4B3M K;  5FLX O;  5AJ3 K;  5LMN K;  4DV0 K;  4DR1 K;  1N33 K;  2E5L K;  1IBK K;  3JAM O;  1HNZ K;  2UXD K;  4JI0 K;  4DV4 K;  4JI6 K;  4LF5 K;  4LF4 K;  1XNR K;  5A2Q O;  3OTO K;  4DR2 K;  4B3S K;  1IBM K;  2ZM6 K;  1IBL K;  1XNQ K;  4X62 K;  4DR5 K;  4JV5 K;  4YY3 K;  5BR8 K;  4CW7 B;  3J80 O;  4GKK K;  4LF6 K;  4JI7 K;  4YHH K;  2VQF K;  4DV7 K; 
#chains in the Genus database with same CATH topology
 1QZ6 A;  3QIC A;  4FL9 A;  4FZX C;  2A1S A;  4HVJ A;  4BY9 C;  1G15 A;  3I33 A;  4BRK A;  2JWL A;  3QO9 A;  3P83 D;  5FDL A;  3MAQ A;  1ESV A;  3V9W A;  4R5P A;  4OKK A;  1NMN A;  1VAZ A;  1RTD A;  1VQ4 N;  2HNZ A;  3ASM A;  4DSE A;  3PIP L;  4H4O A;  1WBD A;  3OYE A;  2QWP A;  3Q7C A;  4EP5 A;  3MEE A;  4CF8 A;  3SUO A;  3OJU A;  4BQZ A;  4B9M A;  4LF7 K;  1T6D A;  4OGC A;  3D0P A;  2IVN A;  1XUP O;  1NWK A;  1NGH A;  1TUU A;  2NLX A;  3OYA A;  5GAD P;  2FSJ A;  2HHH K;  1YVN A;  3KTQ A;  1T7P A;  1NM1 A;  4XH1 A;  3TAM A;  1RT6 A;  5C2D A;  1S1T A;  1D9F A;  2KHO A;  1CLQ A;  1KFS A;  3EE8 A;  3O9Q A;  4IOC L;  3HRG A;  3A5M C;  3I0R A;  1I94 K;  4CJS A;  3G10 A;  5HLF A;  1EKE A;  3NFA A;  1TK0 A;  3QEW A;  3O5B A;  4LD0 A;  1U04 A;  3THY B;  4HUG A;  4NCG A;  4WYB A;  1RTH A;  1S9E A;  3CPW M;  1TYQ A;  3OYC A;  2ZF5 O;  4H0O A;  3BF3 A;  3GL1 A;  3M8P A;  4DTU A;  3L6Q A;  4IDK A;  4HTL A;  3H46 O;  3LDO A;  1YF5 L;  3EN9 A;  3LM2 A;  1B9F A;  4DV4 K;  2FXU A;  1HQE A;  3PUF A;  3R6M A;  4OPH A;  1ZBS A;  4PKG A;  3K0S A;  1BIU A;  5BRD A;  3AVL A;  1NMD A;  2G8H A;  1WBB A;  3TAF A;  4KHS A;  2ZM6 K;  3G71 N;  1Q18 A;  3HPO A;  4PKI A;  4YY3 K;  1MU2 A;  2QKB A;  2NRR A;  2E1Y A;  4CZI A;  4A2A A;  2FLO A;  3VQ9 A;  4BE0 A;  2ZGY A;  4DUY K;  3CXC M;  2P9K A;  4HWI A;  3M6G A;  4YOT A;  2ZWH A;  1FXX A;  3C0B A;  3VF2 A;  4FLW A;  1NGC A;  1IG8 A;  4OVL A;  1CZA N;  5HOO A;  4K8Z A;  1RTI A;  3E01 A;  1BU6 O;  4K25 A;  4CIF A;  3PX4 A;  1VSM A;  1IKY A;  3VQE A;  4NO7 A;  1C1B A;  4X66 K;  3U6F A;  4CIG A;  1UA0 A;  3RTV A;  2F9W A;  1KLN A;  1HKC A;  3FLC O;  1NGD A;  3HOS A;  2IVP A;  4FVM A;  3VQ5 A;  4BRO A;  1S5J A;  3CCE N;  3O6W A;  1UWB A;  3KZB A;  4AHU A;  3T1Y K;  2HHV A;  4CF2 A;  3PSF A;  4W5N A;  5GIO A;  1DEJ A;  2IOC A;  3AO3 A;  4JEP A;  3CC4 N;  2B5J A;  3PIO L;  4GV6 A;  1WSI A;  1L3S A;  4DQQ A;  4YOR A;  3MDQ A;  2I5J A;  1SL0 A;  4C1N I;  4I6M A;  3L2Q A;  3QFP A;  4DSL A;  3TPQ A;  2FBX A;  1D5A A;  4MDB A;  1GOC A;  5AQX A;  3CFO A;  4DCH A;  4B3R K;  3C7N B;  4IG0 A;  5LMN K;  1GLB G;  4CJV A;  1FK9 A;  4E7L A;  4N76 A;  3MCP A;  1JCE A;  1HUX A;  5I9E B;  4O0J A;  3DOK A;  4YFU A;  3TU5 A;  2PYJ A;  4FZY A;  4BE2 A;  5GAG P;  5J2M A;  5C0Y A;  4IFV A;  1NJX A;  1D9D A;  4F8R A;  4CJ7 A;  2E2N A;  3OYH A;  1JLQ A;  2VCP A;  2Z1G A;  4NCA A;  3KK1 A;  1ATR A;  2AA4 A;  1M1K O;  5T7B A;  1NGG A;  2P9P B;  3KLG A;  3SMP A;  2KW4 A;  2XY5 A;  1J6Z A;  3KK3 A;  5BR8 K;  5KI6 A;  4GKK K;  1ATN A;  4FPA A;  1HNV A;  3HYF A;  5BPL A;  3NDK A;  3ATU A;  2NRX A;  2GV9 A;  3WXK A;  3HPH A;  4FOE A;  2HHT A;  3UKU B;  3QEV A;  2P9U A;  3O1W A;  3L2W A;  3VTI A;  4FJ5 A;  3VQB A;  1BG3 A;  4LC9 B;  2O8B B;  2AP1 A;  5M1K A;  1T05 A;  3L0Q A;  3C94 A;  3CG7 A;  1KVC A;  4KHY A;  3VEW A;  4CVN E;  5KQ8 A;  2X74 A;  1HYZ A;  1SV5 A;  2XO7 A;  1VQP N;  1UAX A;  3IAY A;  1Z05 A;  3VQ6 A;  3THV A;  3L8B A;  1HYS A;  4BWM A;  4ISF A;  1S1U A;  2EWS A;  2A3Z A;  4DHY A;  4DQ8 A;  1NG9 A;  3CM6 A;  3U3Y A;  3PV8 A;  2P9L B;  4DLG A;  2NRT A;  2Q36 A;  3AVM A;  5K14 A;  3OYN A;  3H1Q A;  3J7Y P;  4ZHR A;  4CHZ A;  4JI1 K;  2E8A A;  4KKO A;  2FSK A;  2HHQ A;  3FZL A;  5KPZ A;  3KK7 A;  1IJJ A;  3SMS A;  4KHQ A;  2YV0 X;  3LAN A;  5FPM A;  4B8A B;  3LAK A;  3CET A;  4DQR A;  3WXM B;  2OA8 A;  1ZXO A;  3RRH A;  3CME N;  4QS8 A;  2Y1I A;  3VQ8 A;  3LM9 A;  1BUP A;  4K41 A;  4PQU A;  2YKN A;  3I8B A;  3PLA A;  4M45 A;  1YIJ N;  4DTJ A;  2PY5 A;  3QB0 A;  4DFK A;  1YAG A;  4FJL A;  5TKW A;  1VSK A;  4FPB A;  4DTO A;  1BQN A;  5C25 A;  3DXM A;  4H5T A;  3AAR A;  4Z4C A;  4KTQ A;  3OYB A;  3H3N O;  1EO1 A;  3FZM A;  4LF5 K;  4LF4 K;  1EX4 A;  2HVH A;  5HRP A;  2GWK A;  2GEL A;  4U67 L;  3S3O A;  1J9A A;  3EZ5 A;  4BRI A;  4B3S K;  3VF4 A;  1ASW A;  4CEB A;  3FR0 A;  3NF7 A;  4Y1C A;  3IG1 A;  4QAG A;  3HJF A;  1BA0 A;  3OYM A;  4NYF A;  4CZL A;  4EFH A;  3QFU A;  2JWK A;  2B6A A;  3LPU A;  3KD1 E;  2Q0R A;  1VQ8 N;  4E3S A;  4KTZ A;  3LP0 A;  3MN5 A;  4K42 A;  4BR2 A;  1KXP A;  1TK5 A;  2A42 A;  1B9D A;  4JYA K;  1GOA A;  3W0L A;  1VSH A;  3AA5 X;  3AVN A;  4F2R A;  2YNF A;  3QIP A;  5DM7 L;  2OPP A;  1C0G A;  1QQO A;  2CH6 A;  5F0X A;  1JLF A;  1EWQ A;  2A6A A;  1IKW A;  5EY4 A;  4CFD A;  2Q1N A;  4E19 A;  4JNE A;  3ZSY A;  1HX1 A;  2D0B A;  2XY7 A;  4JKH A;  1SAZ A;  3NAE A;  1BCM A;  3L4I A;  5BPN A;  4CK3 A;  1HNX K;  3QDK A;  2YHY A;  2YNH A;  4NLC A;  2PBD A;  1L3V A;  2O8D A;  2P1J A;  1W97 L;  2F4V K;  4BRC A;  5AFU H;  4RG8 A;  3KVG A;  4H5R A;  3T69 A;  1HLU A;  3BP8 A;  3CCV N;  1BOT O;  3A5O C;  3T19 A;  2NUB A;  2QWL A;  5LMU K;  3TTC A;  4CGG A;  2W42 A;  3E9L A;  2Q97 A;  4IWV A;  5AQG A;  2O8E B;  4KH6 A;  4XH5 A;  1YIT N;  1QS4 A;  3QBW A;  4J2E A;  4FWM A;  3AVB A;  3AA3 A;  4Z0U A;  5GIP A;  1U6Z A;  5CZ1 A;  3WEE B;  4GV3 A;  4HTU A;  4PY5 A;  3ID8 A;  5CY4 A;  2XY6 A;  4EAH D;  4NCB A;  4L8R B;  4BDY A;  1SQK A;  4HUE A;  1MDU B;  4DFM A;  3V9S A;  5ADX H;  2KZZ A;  3NCI A;  2P9U B;  5A2Q O;  4DR2 K;  2BTF A;  4KHN A;  1DTT A;  1XNQ K;  1C0M A;  3H6E A;  3CCS N;  2J4R A;  3ZT2 A;  1Z26 A;  4BG9 A;  3J80 O;  2O4I A;  4KHU A;  3H1V X;  2YI1 A;  4B9L A;  2E88 A;  4WE1 A;  4JD2 B;  1KTQ A;  1HPZ A;  1W7A A;  1YT3 A;  1KCF A;  4OLA A;  4B1Z A;  4BRM A;  1YJW N;  4B9S A;  5DK5 A;  3VQ7 A;  1BL3 A;  2GBZ A;  4XIU A;  1Z6R A;  5AQW A;  5KGW A;  2I7N A;  1Z25 A;  3VER A;  2ETJ A;  5I42 A;  3LWL A;  3AO1 A;  4DQS A;  4H03 B;  3I8D A;  4DSI A;  1BIS A;  1E3M A;  4CEO A;  3DLL L;  3ATV A;  4DR4 K;  1N36 K;  3LDP A;  3G6E N;  3MX5 A;  3VEO A;  4M3Z A;  2GX9 A;  4CFC A;  4AHV A;  3WXL A;  4BR7 A;  2Q31 A;  4DTR A;  3DWL A;  2O8D B;  3WNF A;  4W5O A;  3KIO A;  3NVM A;  4WQ4 C;  2RE2 A;  3P5J A;  1D4X A;  5FRN A;  4BC4 A;  3AAQ A;  4WCE L;  4BE1 A;  3DI6 A;  2YX6 A;  4KI6 A;  1W0H A;  3TWH A;  4FLT A;  1Q7Y O;  3SK3 A;  2E2P A;  1WAJ A;  1BCO A;  4IZ9 A;  1JJ2 M;  4CF9 A;  3JYT A;  4DFJ A;  4AHR A;  1JLC A;  4ICL A;  3O4Q A;  4JI8 K;  5CHI A;  4QS7 A;  2FF6 A;  1OVQ A;  2QW9 A;  4DU1 A;  4Y1D A;  1QQN A;  4DTN A;  1BHL A;  3P4I A;  3JAM O;  3SUQ A;  3QEI A;  3LPT A;  2KTQ A;  3NBP A;  1ASU A;  5HRO A;  2YJF A;  2ZE2 A;  1U48 A;  5CYM A;  2RHK A;  2F7T A;  1XNR K;  5E41 A;  1C0T A;  1K8A O;  3FFI A;  4WQ5 A;  5SWM A;  5MLC Q;  2F96 A;  3KJV A;  3NGY A;  4JV5 K;  5C2F A;  4FK4 A;  1YHQ N;  3E9P A;  3B8A X;  1KAZ A;  5LL6 Z;  1GOB A;  1JXB A;  2QKK A;  4DV1 K;  1TL1 A;  2X6S A;  4KB0 A;  1KAY A;  1RT3 A;  3O9R A;  3DLG A;  4IG3 A;  3QBX A;  3V4I A;  1FJG K;  1RBT A;  4C8O A;  2YHA A;  4ILH A;  5KPT A;  3DLH A;  1HNI A;  5AQK A;  2FSN A;  4CHN A;  1OVY A;  3V9U A;  4M3U A;  1S6Q A;  4JRP A;  1RDA A;  5KQD A;  2QWQ A;  4GMJ B;  1WSG A;  5AQV A;  4I2P A;  5AQL A;  2VWB A;  1SL1 A;  3A5N C;  3J7A P;  3L3V A;  2QXF A;  3PO4 A;  4DF8 A;  4FVU A;  3O4N A;  3EKS A;  4JHD A;  3AA4 A;  1D8Y A;  2O8F A;  3VGM A;  5AQJ A;  1ZBF A;  3O9T A;  5KRT A;  4DUZ K;  4CJT A;  2A40 A;  5SZT A;  4OGE A;  3FGU A;  3CER A;  3OJS A;  4A5A A;  3QNN A;  4CK2 A;  2WOM A;  5AQU A;  4BDZ A;  3IRX A;  4CJ5 A;  1T44 A;  1X3M A;  2YKM A;  4GVE A;  4CJF A;  4DTX A;  4KO0 A;  3THX B;  1BQM A;  1L3U A;  3MMV A;  4J2A A;  1DKG D;  3T1A A;  3C6T A;  1VHX A;  3P31 A;  1FKP A;  3DLR A;  4AH9 A;  1NGJ A;  3THW B;  3HST B;  3J7Z O;  4DV6 K;  4DS4 A;  1LWC A;  5CZ2 A;  3FZK A;  4O0I A;  3DXK B;  1QSL A;  1O13 A;  5C12 A;  4LH5 A;  1CXQ A;  5TKY A;  3V1R A;  4DV0 K;  3CJ1 A;  2Q0U A;  2QXL A;  2D0A A;  1VSI A;  2WUS A;  4EHU A;  4M3Y A;  3UKU A;  4JHD B;  3OVN A;  2HHX A;  3RMB A;  1RBV A;  2V7Y A;  4CFB A;  4DB3 A;  1SKR A;  4CJ4 A;  3B6O A;  4O8U A;  3RWU A;  4B8C A;  3KLI A;  5E84 A;  4TSX A;  2HND A;  2IIR A;  4IDH A;  4CJE A;  4AM6 A;  4JI7 K;  4A61 A;  4ZTF A;  1LAV A;  4BR5 A;  3CCJ N;  3S41 A;  3LWM A;  4FJX A;  2WTU A;  3NVK A;  1BI4 A;  4FOI A;  4IEI A;  4K0K K;  1ZBI A;  4CGI A;  3WXI A;  3K57 A;  4CBX A;  2A1R A;  2CGJ A;  4FJJ A;  1OH5 A;  4BC3 A;  4JK8 A;  4CZF A;  3CHW A;  2W6L A;  2UU9 K;  3D2F A;  3O80 A;  1JLG A;  5EXW A;  4A59 A;  1L3T A;  1YJ9 N;  1C1A A;  4A2B A;  1RT7 A;  1C0U A;  3W3D A;  3DLB A;  1G99 A;  1K8K A;  4DS5 A;  4DWI A;  3TTF A;  4FJK A;  4PWD A;  5EU7 A;  3H45 C;  4O44 A;  4FM2 A;  3CC7 N;  3SJH A;  5JLH A;  2RKI A;  2RPI A;  4E7J A;  2GWJ A;  4AIL C;  3E1Y A;  3HK2 A;  3A0I X;  2OPS A;  2DFE A;  2HBL A;  3P38 A;  3TAB A;  4MQ3 A;  1ITG A;  2EX3 A;  4FO0 A;  4X65 K;  3TSP A;  3SBT A;  4LY7 A;  4B9U A;  4JI5 K;  4FK0 A;  5FPN A;  2O8F B;  3HL8 A;  1NU0 A;  4FLU A;  2CGL A;  4JKG B;  1VQ5 N;  3DRS A;  3CD6 N;  4FCY A;  4CHO A;  1WSJ A;  5M1P A;  3B6P A;  4IBN A;  4JI4 K;  3RMC A;  4GVM A;  3DOL A;  2QA4 N;  2O4G A;  4NXN K;  4B3M K;  4DFP A;  1TK8 A;  2V7Z A;  3DM2 A;  1RDD A;  3OYD A;  3CJA A;  2OZM A;  1GLC G;  4JAX A;  1IBK K;  2FBT A;  1Q81 O;  3GE1 A;  1VSE A;  1TVR A;  1EXQ A;  2OCE A;  3CQ8 A;  4CE9 A;  4IEE A;  1T3V A;  4G9Z A;  1Q82 O;  5AFU A;  4JKB A;  4WFB L;  2QI2 A;  3O9S A;  1HYV A;  3SLC A;  4HHT A;  4GW6 A;  1VSD A;  4CHY A;  4FLZ A;  1N8R O;  1MWK A;  1HPM A;  4UY8 O;  1S1W A;  3AGR A;  1RDU A;  1C1C A;  4DG1 A;  4DV3 K;  4DSF A;  3VEN A;  3ALY A;  3D45 A;  4CI6 A;  3N4P A;  4NLB A;  3O1B A;  3CJ7 A;  5AQH A;  3H08 A;  3AV9 A;  4BR4 A;  4FLX A;  4NB4 A;  4Z4F A;  1I39 A;  1IKX A;  1RT2 A;  4I2Q A;  5M1Q A;  3K58 A;  3CPE A;  3MXM A;  5BRF A;  1SKS A;  3DLK A;  2XHB A;  4FSV A;  3S9H A;  4C1N K;  4DKW A;  3V81 A;  1SL2 A;  1XHZ A;  1NKB A;  3K5N A;  4B1W B;  1C0F A;  2CH5 A;  4V19 S;  2DFF A;  4X64 K;  5KPR A;  2XY8 A;  4WF9 L;  1W2B M;  4QOZ B;  4BVO A;  3HXM A;  1FKO A;  1UOC A;  2HMP A;  5AQR A;  1Q9Y A;  1OH6 A;  2IGI A;  1BGX T;  2P5O A;  3AVF A;  3ENO A;  4M42 A;  4H5N A;  4IJN A;  4CEQ A;  4KH4 A;  3L2U A;  5FRM A;  3I0S A;  1DLO A;  4L3Q A;  4YNQ A;  4J8F A;  4FJH A;  2KLA A;  4FJ9 A;  3CQX A;  3RMA A;  1S1V A;  1TKX A;  4M3X A;  2YNG A;  5ADX A;  4QS9 A;  5EVZ A;  5H1S Q;  4BRE A;  4LFB K;  3F73 A;  2VG7 A;  4ILG B;  4CGJ A;  3I55 N;  3SJJ A;  3CFR A;  4AQY K;  1TAU A;  4FLV A;  3L2R A;  2BDP A;  4KPY A;  5FLX O;  3ZLJ A;  1R59 O;  1EP4 A;  5B8H A;  5AJ3 K;  4BC5 A;  3OS2 A;  2NZT A;  4DR1 K;  1N33 K;  1RT5 A;  2HB5 A;  4W5Q A;  5AQP A;  3AVG A;  4JKA A;  4KH5 A;  5D3G A;  2BGG A;  1CZ9 A;  1O1W A;  4WFA L;  5JS1 A;  4B1U B;  2FC0 A;  2FBY A;  3DLE A;  4RW9 A;  3SI6 A;  5HBM A;  4CJU A;  4IXC A;  1XQS C;  1IBM K;  3F9K A;  3KWG A;  1DTQ A;  3VEV A;  1HKG A;  2E6L A;  1NJI O;  3EZW A;  1YUW A;  2WBN A;  3T3F A;  1JL1 A;  4LF6 K;  3HO1 A;  3ZSZ A;  3PSI A;  3U4L A;  3HPG A;  4DQP A;  3CCL N;  3G25 A;  4CZK A;  4BR0 A;  4FW1 A;  3E9O A;  4M41 A;  1P90 A;  1UA1 A;  1VQ9 N;  4DF4 A;  2P9K B;  3CIP A;  4W5R A;  1KC8 O;  5AQO A;  4F4K A;  3VN5 A;  3QNO A;  3WXJ A;  4FWR A;  5IWA K;  2G8V A;  3TTD A;  3CCQ N;  3SV4 A;  4GKJ K;  3RSE B;  1HJO A;  1SS6 A;  2ZD1 A;  4FJ7 A;  2VQE K;  3LAL A;  4JN4 A;  1S72 N;  3VOV A;  1HR0 K;  2PYL A;  2PFU A;  2QWR A;  3ZT1 A;  4BRL A;  1KFD A;  2G8W A;  1YTA A;  1ASV A;  4ELT A;  1IKV A;  3RRG A;  3BZC A;  2RF2 A;  1RBR A;  2IC3 A;  3MXI A;  1NGB A;  1Q8I A;  2G8I A;  5AQY A;  3OYJ A;  1WSE A;  1X9M A;  4CEF A;  2P9L A;  5F1X A;  1NNE A;  3LZJ A;  4GY2 B;  4RWT A;  3IDH A;  4JS5 A;  4ISG A;  2YNI A;  3G0Z A;  4JRQ A;  2P9I A;  3VTH A;  4Z94 A;  1S6P A;  3EY1 A;  3TSU A;  3K9K A;  3KLH A;  1U45 A;  4YDU C;  3J81 O;  3SZ2 A;  2P9P A;  3AVH A;  1XMQ K;  2WFB A;  2P9I B;  4CD3 A;  5EX5 A;  3IS9 A;  4IO8 A;  4K8X A;  1SUQ A;  1R0A A;  2OPQ A;  2HW3 A;  5J2P A;  1H1V A;  3ID6 A;  3LP2 A;  2D0C A;  3SQ0 A;  2YJE A;  2PAV A;  1RIL A;  1TKZ A;  3M1F A;  3ULE A;  4CHP A;  2OPR A;  1QHA A;  3CI5 A;  4BDP A;  1X3N A;  5CE3 A;  1WB9 A;  1RT4 A;  1X9J A;  1E4G T;  1V4S A;  4M3T A;  1HKB A;  3MED A;  4E0D A;  4BRP A;  3NE6 A;  1BWF O;  1RDB A;  3D2F B;  1RNH A;  3PX6 A;  4HUF A;  2A41 A;  4DR5 K;  3VEX A;  4CEA A;  3WNG A;  3BZK A;  4H4M A;  3DXK A;  3BGR A;  3WT0 A;  1OKJ A;  4ZTJ A;  5AZI A;  2ITM A;  4FWN A;  3HI0 A;  2QWO A;  4C8M A;  2ATQ A;  3THW A;  4AM7 A;  1YI2 N;  4CZE A;  2OYQ A;  3AO4 A;  4B08 A;  4DTM A;  4E7I A;  1XC3 A;  4KHP K;  1U49 A;  3CCU N;  1GLA G;  5AR0 A;  1KQS M;  3HOT A;  3EKU A;  2D4W A;  1NJW A;  3SQ2 A;  2OTJ N;  4OKJ A;  3ZX3 A;  3LDS A;  4NXM K;  2Z1H A;  1S9G A;  1TUY A;  4O5F A;  4QCL A;  1VQN N;  2P9S A;  1LCU A;  5M1N A;  2UUC K;  4KI4 A;  1SKW A;  5KTQ A;  3V1Q A;  4KB1 A;  2IVO A;  2VG5 A;  2P9S B;  4H0X B;  5JIC A;  3ITH A;  1T03 A;  3ZCM A;  1NKE A;  3VMF B;  1JKH A;  3NMU A;  4BRA A;  3TAE A;  5BR9 A;  3MN7 A;  2E20 A;  2ZQB A;  3ENH A;  3SCX A;  2JGU A;  1IO2 A;  2HBK A;  3DJC A;  3Q7B A;  4BR9 A;  3PY8 A;  4ILJ A;  1TAQ A;  4M7Y A;  3SAH A;  1P8Z A;  3M8Q A;  2KZM A;  2YHW A;  1QSS A;  3DXM B;  3O4W A;  3F9M A;  3DRR A;  4E7H A;  4PA1 A;  5J1E A;  3ZYY X;  1U2V A;  3WUH A;  3VEZ A;  1RDC A;  3K5M A;  4I9Q A;  3F2K A;  4DMN A;  4B1V A;  1VQ7 N;  1W9H A;  4DV7 K;  1WUA A;  4A5B A;  4CEE A;  4M63 C;  2OAN A;  3JS6 A;  4DSK A;  1LAW A;  2G8F A;  3UE5 A;  2QEX N;  4E7K A;  4CJQ A;  4BGB A;  1NGF A;  3SBG A;  2RN2 A;  3ZSQ A;  2V52 B;  3M5R A;  4RW4 A;  3WEE A;  3GBT A;  4AHS A;  3VGK A;  4CF0 A;  1JCF A;  4LFC K;  1RDW X;  1EET A;  4B3T K;  1LV5 A;  2WC9 A;  4FLY A;  3VA3 A;  2Z1J A;  4FYD A;  1NKC A;  3QLH A;  4CEC A;  2NRW A;  1DT9 A;  1NBW A;  3RSE A;  1NK8 A;  3OA9 A;  1REV A;  1BO5 O;  1WNS A;  3VF6 A;  3RVC A;  3L2V A;  3F5T A;  1HQU A;  2I7P A;  3CFP A;  4OPJ A;  2ASO A;  3L4Q A;  1JL2 A;  2WON A;  1KD1 O;  2HBM A;  3IFR A;  2E6M A;  1Q86 O;  3P1G A;  1GLE G;  4DR7 K;  1WSF A;  4A62 A;  3M3Z A;  1VSL A;  4I9L A;  1VQ6 N;  4JK9 A;  4JKG A;  4R79 A;  1LOT B;  3AVI A;  2BE2 A;  2O8C B;  1X1P A;  1U4B A;  2HNY A;  3OYF A;  5JVH L;  3TSQ A;  5KGX A;  4Q5V A;  5DMR A;  4MO5 A;  3OS1 A;  3S3M A;  2FBV A;  1V4T A;  2GEM A;  1HNZ K;  3C6A A;  3RMD A;  4CIE A;  3LP3 A;  4E1M A;  5HP1 A;  4JI0 K;  4JI6 K;  1BI4 B;  3C65 A;  4ID5 A;  3AY9 A;  3EYZ A;  2HMI A;  3OTO K;  3N4Q A;  3HVR A;  2HHU A;  2ZJR L;  2ASP A;  3D7E O;  4B9V A;  2X78 A;  1X9S A;  3MXJ A;  1KRP A;  4YHH K;  4FJ8 A;  2VQF K;  3WQU A;  3AO5 A;  2F9T A;  2ZGZ A;  3LZI A;  5EOY A;  1LWF A;  1NJZ A;  4DSJ A;  5AQT A;  4F3T A;  2GUP A;  3HBT A;  1T6C A;  3QML A;  5KRS A;  1VQO N;  1JXE A;  2NRZ A;  2QWN A;  3KKR A;  3M8R A;  1J53 A;  3NF9 A;  4E1N A;  5FPE A;  4H5V A;  4CGH A;  3OYK A;  3O9U A;  1YJN N;  2OZS A;  2VWK A;  1Q9X A;  4LH4 A;  3O3G A;  3T7Z A;  4H0V B;  5BN9 A;  5BN8 A;  4JI3 K;  1K8K B;  4YOU A;  3QEX A;  4DV2 K;  4F3O A;  1TGO A;  3MX2 A;  4J2D A;  3VQC A;  2F8T A;  4ID1 A;  1L5U A;  3C95 A;  3KLE A;  2O8B A;  2UXC K;  4FXD A;  4B9N A;  4DTS A;  4W5T A;  3D6R A;  3SAF A;  4E89 A;  5DM6 L;  4I7F A;  4DLE A;  2P9N A;  3O3H A;  2VG6 A;  4CD1 A;  3VET A;  4CBU A;  3EEQ A;  5J2Q A;  1ZBL A;  2P51 A;  1RBS A;  1YXQ A;  3DRP A;  3GG4 A;  3MWP A;  4EZ6 A;  4M3W A;  5FRO A;  4J2B A;  4CJL A;  2H3G X;  4CBW A;  2QM1 A;  3CM5 A;  1XWL A;  4RW7 A;  1NK4 A;  4C8K A;  3HVT A;  1TYQ B;  4KTW A;  1VQL N;  5JLF A;  4GV9 A;  3KD5 E;  3HTV A;  4BC2 A;  3V6D A;  1IV0 A;  4FWP A;  1LWE A;  4EP4 A;  3DAW A;  3ZT0 A;  4JD2 A;  4FM0 A;  1CZB A;  3CCM N;  5C10 A;  4CED A;  2OTL N;  2O8E A;  2BUP A;  3CF5 L;  3OY9 A;  3WNE A;  2ZJP L;  4CK1 A;  2B4J A;  2X6N A;  3HM9 A;  3MK6 A;  4PL8 A;  3EL2 A;  3KLF A;  3RR8 A;  2HHW A;  4CW7 B;  3UKR B;  1QVG M;  3HM8 A;  3P39 A;  3SAG A;  3A5L C;  4LSL A;  1U47 A;  5GAH P;  3M8S A;  1TKT A;  4IOX A;  2E4L A;  4ELV A;  1WSH A;  3AO2 A;  2HOE A;  1M90 O;  3ZSX A;  4BG8 A;  4BRF A;  1YTU A;  3H3O B;  3KKS A;  4PHT X;  4IOA L;  1A5X A;  1NK9 A;  1NGA A;  2KFN A;  3R9P A;  4YOV A;  1XMO K;  4BWJ A;  4Z4H A;  3SUN A;  4FJI A;  1DGK N;  1QTM A;  4WQ4 A;  1OH8 A;  3HP9 A;  2ASM A;  4CEZ A;  1HMV A;  2O8C A;  4KBO A;  1LW0 A;  3EO3 A;  1QE1 A;  3TAQ A;  3K5O A;  1XI1 A;  4EHT A;  4DV5 K;  5AQM A;  4CZM A;  4OJR A;  3R8E A;  1EWR A;  4BRD A;  2DPN A;  4KRF A;  4FW2 A;  5C24 A;  2UXB K;  3VGL A;  3AVK A;  3GOI A;  1VSF A;  3VQA A;  4DR3 K;  1S3X A;  5IT9 O;  4FJM A;  3UIQ A;  1WN7 A;  1J5E K;  4FWK A;  3VQ4 A;  3V9X A;  2FF3 B;  2QK9 A;  5JVG L;  3KK2 A;  3QER A;  3DYA A;  3NF6 A;  3WNH A;  2Y1J A;  1K6Y A;  2HVI A;  1U2V B;  4H8K A;  3BDP A;  4ELU A;  3ZSR A;  1S22 A;  3VQD A;  4BRQ A;  2E2O A;  3C6U A;  3CQY A;  1NK6 A;  3BF1 A;  4KFB A;  4CGD A;  1N5Y A;  3MWT A;  4M3R A;  3SQ1 A;  3FE1 A;  5AQS A;  3NGI A;  2Z1I A;  2E5L K;  4F9O A;  3TAG A;  3LDQ A;  4O8K A;  4DU4 A;  1BDG A;  1GLJ O;  3R3L A;  3O8M A;  4CZJ A;  2VWJ A;  5JS2 A;  1NK0 A;  1GLF O;  1VRU A;  2DFH A;  4Y0W A;  4XEI A;  1BIZ A;  3MEC A;  4N47 A;  4CFA A;  4CCH A;  2NNW A;  4FM1 A;  4EZ9 A;  5HL7 L;  3KWI A;  3IUC A;  1A5V A;  3AVC A;  2BH1 A;  2LSN A;  3UKR A;  4Z4E A;  4KAZ A;  4O55 A;  1GLD G;  1X9W A;  3PO5 A;  3HT3 A;  4Q0B A;  4MFB A;  4XH4 A;  2ZJQ L;  3ZT3 A;  3OBW A;  3CJC A;  4JKC A;  3KHY A;  1ZC6 A;  1NOY A;  4B9T A;  3QET A;  2D0P A;  3OYI A;  3AAP A;  2G8U A;  5C15 A;  4KHW A;  3K59 A;  4F2S A;  4FWQ A;  4BVP A;  3ZET A;  4I6M B;  4EIA A;  3S3N A;  4N41 A;  4IFY A;  1E4F T;  4OPA A;  4OX9 K;  4E1J A;  4JS4 A;  3TAN A;  4CZH A;  3U9Z A;  3MN9 A;  1QVF M;  2VYP A;  4H5W A;  1IG9 A;  1NK7 A;  4FWL A;  4RTF D;  5LJW A;  4LFA K;  1I3A A;  3QIN A;  1J5O A;  4JKF A;  1NJY A;  1HJR A;  2NRH A;  5AQQ A;  3ZET B;  3QEP A;  4IO9 L;  2E2Q A;  3C7N A;  3U3G A;  4MLH A;  2KQ2 A;  4DU3 A;  3FZH A;  1KAX A;  3VA0 A;  1NOZ A;  3NH2 A;  3ZEU A;  3LP1 A;  1NLV A;  1TKD A;  1K73 O;  3SQ4 A;  5F2R A;  5JMV A;  2VGM A;  5HRS A;  4ISE A;  4YOY A;  1K9M O;  3BUZ B;  3IMX A;  3K2P A;  3ZSO A;  3DMJ A;  1VQK N;  2D1K A;  2EHG A;  1QSY A;  4C8N A;  2V51 B;  3WQT A;  4GNI A;  3J8A A;  4B9Q A;  1CXU A;  3EE9 A;  5M1O A;  1MA9 B;  4O4G A;  4OLB A;  3ULE B;  2HBJ A;  3OYG A;  2GUI A;  3C6H A;  1ZBH A;  4FJG A;  2UXD K;  1KVB A;  3AGK A;  3V9Z A;  3V1O A;  3QES A;  1HRH A;  4BAC A;  2Q2R A;  1VRT A;  4OKE A;  3TAR A;  4MO4 A;  4CES A;  5BRE A;  4M7X A;  4HCC A;  1WAF A;  3THX A;  2HST A;  5BPM A;  4WQ5 C;  3NGZ A;  4FWO A;  5C42 A;  3ZSW A;  1XC9 A;  3CJB A;  4IKF A;  4B1Y B;  4BGA A;  4Z4G A;  5BRH A;  3FZF A;  2YHX A;  4CGF A;  2R7Y A;  1EQY A;  1OH7 A;  3CC2 N;  1JLA A;  1N32 K;  4CJP A;  3TR8 A;  3L3U A;  1YVU A;  1SZ2 A;  3GDQ A;  4JI2 K;  1RT1 A;  3O08 A;  4B1X B;  1HNW K;  2HF4 A;  2YCH A;  4O5B A;  1Y97 A;  3NH0 A;  3JSM A;  5GIN A;  1JLB A;  2W40 A;  4CJK A;  3AVA A;  3D2E B;  4RCH A;  3VQP A;  2IAJ A;  3UB5 A;  3ZEU B;  2Q3S A;  1ZBU A;  5LY3 A;  3O3F A;  2F8S A;  4Z4I A;  1JLE A;  3OBY A;  2D5R A;  4IJA A;  1F21 A;  3NH1 A;  1Y64 A;  3BY5 A;  4DTP A;  5J2N A;  2E1Z A;  2XRI A;  4B3O A;  3U9D A;  4CJW A;  3NHG A;  5AQI A;  2UUB K;  5M1F A;  3A8Y A;  4PL7 A;  1QQC A;  4JK7 A;  1J54 A;  3VEY A;  5AQZ A;  4LF8 K;  3HSC A;  3NF8 A;  4FK2 A;  1S1X A;  1VK0 A;  4CZG A;  1XHX A;  1RBU A;  5HRR A;  4FJN A;  2HHS A;  3K5L A;  5ELZ A;  4C8L A;  5HRN A;  2KKZ A;  4CHQ A;  2ITG A;  2DTU A;  2NRV A;  3IKM A;  4BRG A;  5CR4 A;  1N6Q A;  1VQM N;  2KFZ A;  3ZX2 A;  4YDU A;  1VSJ A;  2QWM A;  5I3U A;  1FW6 A;  5CYQ A;  3LDL A;  2W41 A;  4PKH A;  4C23 A;  4CJ3 A;  4RW6 A;  3MCA B;  1IBL K;  3TAP A;  2DY4 A;  3LL3 A;  2GTD A;  3VQQ A;  4MLE A;  3SUP A;  2P5G A;  1KSP A;  5AZJ B;  1IH7 A;  2YHB A;  1A5W A;  4HCB A;  1MWM A;  3LAM A;  5LJV A;  1NGE A;  1NGI A;  1GLL O;  3RR7 A;  2D0O A;  3G4S N;  2A5X A;  2UUA K;  1QZ5 A;  3R1X A;  3E66 A;  1TL3 A;  1RCH A;  4CJR A;  1C6V A;  1TV6 A;  5FPD A;  3AVJ A;  3SPZ A;  2IS3 A;  4UQG A;  4AHT A;  2HF3 A;  1KVA A;  5AQN A;  4U7B A;  2UYT A;  4YOX A;  4N5S A;  4OO1 J;  3MEG A;  1RFQ A;  5AQF A;  3CCR N;  4DQI A;  1JCG A;  1T8E A;  4NYN A;  3OHR A;  3BEX A;  1N34 K;  3HP6 A;  1RGI A;  1QHT A;  1LW2 A;  3K9J A;  3T1H K;  2AJQ A;  2W6K A;  1B92 A;  4H0T B;  3ZSV A;  3OS0 A;  4K43 A;  5E26 A;  2QTD A;  4AF1 A;  3THY A;  4LF9 K;  3AA2 A;  4BRN A;  1NK5 A;  1ZYQ A;  3VES A;  4KRE A;  3I56 N;  3OW2 M;  4BRH A;  1BA1 A;  1ILY A;  2BAN A;  3JXU A;  3FFK B;  4CER A;  1RTJ A;  4RW8 A;  4LSN A;  4DR6 K;  3QIO A;  4FWS A;  2IDO A;  4JKD A;  3SV3 A;  3MN6 A;  4G1Q A;  4KV8 A;  4H0P A;  4A57 A;  3LDN A;  1KLM A;  4FZZ A;  4CF1 A;  4JLH A;  3ENB A;  4MDA A;  5GAE P;  2P9N B;  2CGK A;  5AZI B;  4BQL A;  4IFE A;  3PX0 A;  2G8K A;  3U8X A;  3CJ9 A;  3ISN C;  3TI0 A;  3VPZ A;  3ZT4 A;  2JLE A;  2VGN A;  3SNN A;  4H0Y B;  3OYL A;  4YOW A;  5AZJ A;  4PUO A;  3SPY A;  1WOQ A;  3D2E A;  3ZX0 A;  4N56 A;  4OPK A;  3ULD A;  1ATS A;  3HZ6 A;  2PZS A;  4AHC A;  4X62 K;  3SYZ A;  4WFN L;  1WLJ A;  4JKE A;  1QQM A;  3A2F A;  3CYM A;  3CMA N; 
#chains in the Genus database with same CATH homology
 4DV3 K;  4DV1 K;  4K0K K;  4DUY K;  1N32 K;  1FJG K;  4JYA K;  5LL6 Z;  5IWA K;  4GKJ K;  1XMO K;  4JI2 K;  2UUA K;  4OX9 K;  4CVN E;  4KHP K;  2VQE K;  1HNW K;  2UU9 K;  4X66 K;  1HR0 K;  3J7A P;  4JI3 K;  4LFC K;  4V19 S;  4X64 K;  4B3T K;  4DV2 K;  4NXM K;  4LF7 K;  4LFA K;  1N36 K;  4DR4 K;  4DV5 K;  4DUZ K;  1HNX K;  3T1Y K;  1N34 K;  2UUC K;  2UXB K;  3T1H K;  2UXC K;  3J7Y P;  2HHH K;  4DR3 K;  4JI1 K;  2F4V K;  4X65 K;  5IT9 O;  4LF9 K;  1J5E K;  4JI5 K;  4DR7 K;  4LFB K;  2UUB K;  5LMU K;  1I94 K;  4JI4 K;  4DR6 K;  3J81 O;  1XMQ K;  4LF8 K;  4AQY K;  4B3R K;  4JI8 K;  4DV6 K;  4NXN K;  4B3M K;  5FLX O;  5AJ3 K;  5LMN K;  4DV0 K;  4DR1 K;  1N33 K;  2E5L K;  1IBK K;  3JAM O;  1HNZ K;  2UXD K;  4JI0 K;  4DV4 K;  4JI6 K;  4LF5 K;  4LF4 K;  1XNR K;  5A2Q O;  3OTO K;  4DR2 K;  4B3S K;  1IBM K;  2ZM6 K;  1IBL K;  1XNQ K;  4X62 K;  4DR5 K;  4JV5 K;  4YY3 K;  5BR8 K;  4CW7 B;  3J80 O;  4GKK K;  4LF6 K;  4JI7 K;  4YHH K;  2VQF K;  4DV7 K; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...