1IBKK

Structure of the thermus thermophilus 30s ribosomal subunit in complex with the antibiotic paromomycin
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
119
structure length
119
Chain Sequence
KRQVASGRAYIHASYNNTIVTITDPDGNPITWSSGGVIGYKGSRKGTPYAAQLAALDAAKKAMAYGMQSVDVIVRGTGAGREQAIRALQASGLQVKSIVDDTPVPHNGCRPKKKFRKAS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S RIBOSOMAL RNA
publication title Recognition of cognate transfer RNA by the 30S ribosomal subunit.
pubmed doi rcsb
molecule tags Ribosome
total genus 29
structure length 119
sequence length 119
ec nomenclature
pdb deposition date 2001-03-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
K PF00411 Ribosomal_S11 Ribosomal protein S11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.80 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribosomal protein S11 1ibkK00
4LFCK 2E5LK 2VQEK 4KHPK 1J5EK 4LF4K 1N36K 1HR0K 4DV6K 1FJGK 4OX9K 4DV2K 4JI1K 4JV5K 4DV7K 4LF7K 4CW7B 3JAMO 4GKKK 4JI2K 1N34K 4NXNK 2ZM6K 1IBKK 3J81O 4DR5K 2VQFK 5LL6Z 1N33K 2F4VK 4DUZK 4LFBK 2UXBK 4DR1K 1I94K 4JI0K 4JYAK 4AQYK 5BR8K 3T1HK 4B3RK 4DR2K 3T1YK 1XMOK 4DR7K 1HNWK 5LMNK 2UXDK 2UUCK 1XNRK 4K0KK 4LF5K 1HNXK 3J7AP 4JI7K 4B3SK 4DR3K 2UUBK 4DV0K 4DV3K 4DUYK 3OTOK 4DR6K 4YHHK 4JI3K 4LF8K 5AJ3K 4JI6K 1IBLK 4NXMK 4B3MK 1XNQK 5FLXO 4DV1K 5IWAK 4B3TK 4JI5K 4JI8K 4DR4K 2HHHK 4CVNE 4JI4K 4GKJK 4X66K 4LF6K 4X62K 4X64K 3J80O 2UU9K 5IT9O 4LF9K 2UUAK 1N32K 1IBMK 4X65K 5A2QO 4YY3K 1HNZK 4V19S 4LFAK 2UXCK 4DV4K 5LMUK 4DV5K 1XMQK 3J7YP
chains in the Genus database with same CATH superfamily
3SI6A 3SK3A 3VQCA 3KLEA 4FJ7A 3UKUB 2HHSA 1T03A 4XEIA 2I7NA 2Q2RA 5C2FA 3OYIA 3L4IA 3AO3A 1FJGK 3QIPA 1RBRA 3HYFA 3KK2A 1GLBG 3V6DA 2OZMA 3TAEA 4KREA 1TAQA 1LAWA 4B9VA 1I39A 3CPEA 1XHZA 4FZYA 3OS2A 4JK7A 1NGGA 2G8WA 1BQNA 1TKXA 4DS5A 4I6MA 1CXUA 4K25A 5JVGL 2VG7A 2AJQA 3TAQA 5I3UA 3C6TA 4WQ5C 1JXBA 3B6PA 3HOTA 3SCXA 4DF4A 1EXQA 4H5NA 2XY5A 4DQPA 4JKGA 3DLHA 4JN4A 1VSKA 3BGRA 5BR9A 1J53A 3K9JA 3ZSWA 2OPSA 4KO0A 5C2DA 3SAGA 3DXMB 5FPEA 3VQEA 1S72N 1S1VA 4DHYA 2KLAA 3U9DA 2O8DB 4KB0A 1RT5A 2YNGA 1CXQA 4CJUA 1FW6A 2HF4A 2Z1GA 3WEEB 4BY9C 1J6ZA 4FVUA 1NK6A 3NE6A 4J2EA 3VGKA 2BDPA 4H0PA 4CEDA 3PSIA 4H4MA 4CF1A 3IUCA 3O9QA 3CQXA 5AR0A 3VGLA 5JS1A 3O4QA 2QK9A 3RTVA 5M1QA 4DSKA 2P9LA 4CIFA 5AQGA 1LWFA 1MWMA 2YHWA 1BQMA 4BVPA 3Q7BA 3P83D 1P8ZA 5HP1A 3SPYA 1EWRA 1TK8A 3JXUA 3AGKA 1BGXT 3MEGA 5AQLA 1HMVA 2YNIA 1ILYA 2YJFA 3QDKA 2G8UA 4KHPK 5DK5A 3CMAN 3CMEN 1IH7A 4I2PA 1X3MA 1YVUA 4C8OA 4B1XB 4B9MA 2A41A 2VGNA 1BWFO 1N34K 3RMCA 5LJWA 4OPHA 4CCHA 4DR5K 4KH5A 2DFHA 1X9MA 4EP5A 4BRNA 1VSJA 2A42A 4BG9A 3LDOA 4DQSA 3A5NC 1KAXA 4ILHA 5DM6L 1I94K 3KLHA 2HBKA 4CJRA 3NAEA 4YDUA 1YI2N 3T1HK 5AZIB 3OYMA 1BHLA 1KSPA 4OKKA 3HJFA 3S3MA 4QOZB 1A5XA 2V7YA 4K0KK 3WUHA 5AQRA 3AA3A 5FROA 5KPTA 1M1KO 4L8RB 1RT2A 5GADP 1C1AA 4F2SA 4M3WA 4BVOA 3V1RA 4PL8A 3UKRA 5AZJA 3S3NA 5SZTA 2F9TA 3PUFA 4M3ZA 3R1XA 1NKCA 4QAGA 2H3GX 3CJAA 4H0VB 3ZEUB 2GTDA 3MAQA 5ELZA 5EOYA 1LW2A 2P9PA 1RFQA 5C24A 4AHTA 4KH4A 3TSUA 4FJNA 4U7BA 4KKOA 5JMVA 4PWDA 3EO3A 4KI6A 4HUGA 1RTHA 4X66K 3K0SA 3ZYYX 3MN7A 2LSNA 5BRFA 2PAVA 1NBWA 4KFBA 4C8LA 2Q97A 4E1JA 3QEVA 2FBYA 1ESVA 3LM9A 2O4GA 3ZT2A 3U3YA 1YF5L 3TANA 1N32K 1NGFA 4OGCA 5AQYA 4CHNA 5AFUA 2KZZA 4FM0A 4DQIA 1TYQA 4LFAK 3HPOA 3ULEB 1NK8A 3VEVA 2P9UB 3LP3A 4XH4A 1REVA 4CF8A 3CXCM 4DV6K 3TAGA 1DEJA 3PX6A 4FLUA 4I2QA 2D0AA 3FR0A 5HOOA 2GBZA 4G9ZA 1RT7A 1JCGA 3BEXA 4ISEA 4CEAA 2HMPA 4A57A 2BANA 4CHYA 2ASMA 4IOCL 3VQ7A 3OYKA 3AAPA 1OH6A 4WQ4C 3A5LC 4CIGA 4PA1A 4LFBK 1UA1A 3AVGA 2YHXA 3TAMA 4JYAK 4CK1A 1EETA 3UE5A 2YV0X 3GG4A 3I8DA 3SJJA 3N4QA 1J9AA 3ZETB 1IV0A 5T7BA 1DT9A 2XY8A 3E01A 3NBPA 1QQOA 4FLWA 3KIOA 3UB5A 1VSEA 3VF2A 3G10A 3ZSYA 1RBVA 3DLBA 2AA4A 5F0XA 2FBVA 3NGZA 1VQ9N 1HNXK 4BACA 3J7AP 1JLEA 4F2RA 1Q9YA 5AQNA 3LPUA 4O44A 3N4PA 3CFPA 1K73O 4BR5A 2HHTA 2HBLA 3OBWA 2E8AA 1KTQA 3AGRA 4R79A 2ETJA 3VQAA 3TABA 3U6FA 5FLXO 1YUWA 3OJUA 4DTJA 1EO1A 3NH1A 3KK1A 3VQPA 4BC4A 3IDHA 1TUYA 3V9ZA 1P90A 5TKWA 3L2WA 3ZSQA 4EP4A 1BOTO 3AVIA 2HVHA 4CF9A 4GKJK 3ZX0A 3C7NA 4J2DA 3F73A 5C42A 5GIOA 4CEZA 1Z26A 4CFCA 5BN9A 5GIPA 5B8HA 1J5OA 3LAMA 3P38A 4FPAA 4YFUA 3TWHA 2KKZA 3Q7CA 2E4LA 2KFZA 4X65K 3JS6A 3KLFA 3LDNA 1GLDG 4FSVA 3H46O 2HOEA 3K5OA 4LFCK 3LP1A 2E5LK 4DFMA 3I55N 4CJWA 3S41A 4CJKA 4FYDA 3FFIA 3C6AA 1BIZA 3VMFB 3RSEA 4E7JA 2KHOA 3OYNA 3ZSRA 3MCPA 4FJGA 1NJWA 1N5YA 3CCSN 3AARA 3H3NO 2FF6A 3E9LA 1LW0A 4BRHA 3CHWA 3M1FA 4MLHA 1NK4A 2DFFA 4BDYA 1ASUA 2BH1A 4KPYA 4O5BA 1NGCA 4CEEA 1CZ9A 1RGIA 3VEZA 3LDPA 4EHTA 3FLCO 4JKDA 4BGBA 1DTQA 4WQ5A 3M6GA 3BZKA 2D0OA 4DQRA 2E1YA 3DLKA 1J54A 3T1YK 4FK2A 3K9KA 2YKMA 2GUIA 2Q1NA 3GL1A 2O8EA 5KGXA 3LP0A 5LMNK 2E2OA 4CJSA 2ITGA 1Y64A 4CGFA 4O55A 3ATVA 3IRXA 1KFDA 4B9QA 1K8KB 4DCHA 5C15A 2VWKA 3RWUA 1SS6A 1WBDA 5SWMA 4TSXA 3D2EB 3IKMA 2ZWHA 4O8KA 3OYGA 3P5JA 4DUYK 3CM5A 1WLJA 4DQQA 4RW9A 2F96A 1BU6O 2P1JA 3CJ1A 1GLLO 2QI2A 1JLCA 4FJKA 3FGUA 3P1GA 2D1KA 4M63C 1ZBFA 4NLBA 4A5AA 2E2PA 3KJVA 2KW4A 1VQ4N 4AHRA 4ISGA 3I0SA 3NVMA 2RPIA 1B9FA 4EHUA 3ATUA 3QMLA 3BDPA 3VQ6A 3LANA 5AQQA 3EE8A 2UUAK 4HWIA 1QVFM 3F9KA 4KHNA 1D9DA 4EIAA 1ATRA 2X78A 3I56N 3T19A 4A61A 4CJVA 4QS8A 4DV4K 4B1YB 3V9XA 5TKYA 1HPMA 4IKFA 3K58A 3TTCA 5BPNA 5KPRA 3R9PA 3OYEA 1J5EK 3SAHA 3DLLL 4CZIA 3KK7A 3VQDA 3VESA 1O13A 3SBTA 1ATNA 3HVTA 3E66A 5EVZA 3VQ8A 4CHQA 3CG7A 4O0IA 2PYJA 3RMDA 4LF7K 4U67L 1XHXA 4CFBA 3PSFA 3T1AA 1JLGA 1L3TA 3L6QA 4FWSA 3O3HA 3ENOA 2G8FA 2PZSA 4Z4GA 2FXUA 3M8PA 4LC9B 5J2MA 1OKJA 1S1XA 4JLHA 3KK3A 4BG8A 1XMOK 3FZFA 2UYTA 3O9SA 2QWMA 3THYB 5AFUH 3QBXA 1JLBA 3EKUA 4CFDA 4CBWA 1GOBA 3MN6A 1RT4A 3RMBA 5KGWA 1EWQA 4O4GA 4KHWA 2HSTA 1TUUA 4KRFA 1ASVA 3H6EA 4ICLA 4N47A 3ISNC 3PO4A 4DSJA 5FDLA 1NK7A 1YHQN 4NXMK 4KAZA 4IFVA 5C10A 4M7XA 1NJXA 1OH7A 3SLCA 2W6KA 5HLFA 2NRXA 2P9NB 5JLHA 4E7LA 3LZJA 1WBBA 4JD2B 3VGMA 2OTLN 1VSIA 4FWPA 3PIOL 4JS5A 1KD1O 3ZX3A 5E41A 2QW9A 3KD1E 4CHOA 3DLEA 4M3RA 3OYHA 2F9WA 4YOUA 4DSEA 4CF0A 2QM1A 3O1WA 4C8NA 4OKEA 2ITMA 1QZ5A 2B4JA 4C8MA 4DTNA 2I7PA 3ZX2A 2YKNA 4BR7A 3LP2A 3JSMA 3PLAA 1WAJA 3O3GA 3QEIA 1VQON 4RCHA 4JKFA 3T7ZA 1KLMA 4O0JA 4IZ9A 2E20A 1BA0A 2HW3A 3LL3A 3RVCA 3NH2A 3HBTA 2GEMA 3WXLA 4CW7B 4HCCA 1KLNA 2D5RA 3C6HA 1MWKA 3R8EA 1XQSC 2O8BA 3C65A 1JCEA 5AQTA 3L0QA 1HKBA 4C8KA 4FM1A 4WQ4A 3K59A 1O1WA 3RRHA 3SQ4A 1KAYA 1TK5A 2O8CA 4OVLA 1FKPA 2YJEA 5J2QA 2HBJA 3ID8A 5AQHA 1RT3A 4B9LA 5BR8K 4B9TA 4JAXA 5HRSA 3DOLA 1BIUA 3D7EO 4B9NA 4NCBA 4BRPA 4JHDB 3SAFA 1VQNN 4BWJA 2O8FB 2P9IB 4ILGB 2A5XA 4BE0A 3MMVA 2GWJA 4B9UA 4RW6A 1HRHA 4BRQA 2A40A 3C0BA 1WOQA 3SUPA 4CBUA 3HSTB 1QSLA 3L3UA 4E1MA 3SPZA 3WNGA 3VA3A 3ALYA 4HTUA 4ZTJA 3CCUN 2HB5A 2P9SB 5CYQA 4Z94A 1BCMA 2P9LB 3L8BA 2HHQA 1ZYQA 3D45A 4E7IA 1TKTA 4O8UA 3B8AX 5GAGP 4F3OA 5KQDA 2Z1HA 3DXKB 3HZ6A 1FXXA 3P4IA 4X62K 4Y1CA 5K14A 4XH1A 3V1QA 3THWB 3FZHA 5AQMA 4AHUA 4IFYA 3OW2M 1JKHA 3QFUA 4BC3A 2BE2A 3UKUA 3PIPL 4Z4EA 1MA9B 3BP8A 1U2VB 2DPNA 4JKAA 1SKWA 2NRRA 2VQEK 4FO0A 1WUAA 4IO8A 4FJJA 4LH5A 1HR0K 5AQPA 5KTQA 3RR7A 3DJCA 1RDBA 4DFKA 2YNHA 1NOZA 3O80A 2V51B 3AVHA 1NGDA 3V81A 4FLXA 3JAMO 4CF2A 2XHBA 2WFBA 1Q18A 1IBKK 1T6DA 3VERA 5BRHA 1YTAA 2QKBA 2IDOA 1EX4A 4CBXA 1BDGA 4HTLA 1WSIA 2NRTA 2XRIA 3O5BA 4A2AA 5CE3A 3QEXA 4DSFA 4DR2K 3AVJA 5JLFA 5AQUA 1RDWX 2UXDK 4CGGA 1GOAA 3ENHA 4BROA 4W5TA 2HHVA 2O8DA 2WOMA 4WFNL 1ZBUA 4JI7K 4FXDA 4PL7A 4FL9A 3KWIA 3CCVN 4ELVA 4A62A 1FK9A 4DR6K 2OZSA 2Q36A 4FJ9A 4XH5A 4DFPA 2FSKA 1XC9A 3B6OA 3FFKB 3I33A 3ZT0A 3THVA 3EY1A 5EXWA 2E2NA 4FWOA 3VEXA 4AHSA 2BUPA 3CCLN 5HBMA 1L5UA 5BREA 3UIQA 3HK2A 2D0CA 5HRNA 2P9KB 1RBSA 4RW4A 3VETA 1JL1A 3HP6A 4GVEA 4BRKA 3SV3A 4FJ8A 4B1ZA 3TR8A 4BGAA 4JI4K 1D5AA 3L2RA 1TYQB 4HCBA 4Y0WA 1TL1A 4QCLA 1TAUA 3NGIA 4H5WA 2R7YA 4CEBA 3O9RA 3NF7A 4OO1J 4IG0A 3DLGA 1RT6A 1VK0A 1GLAG 3EE9A 3CJ9A 5A2QO 4YY3K 2W42A 4FCYA 2KFNA 4RW7A 3BZCA 1E3MA 4FJMA 1IO2A 3HRGA 1N6QA 4A5BA 4KHYA 2OANA 3QNOA 1T44A 2VGMA 3SV4A 5KI6A 3AO1A 4CZKA 4NLCA 2Q0UA 4DG1A 3CQYA 4IDKA 1WSGA 1BG3A 2NRVA 4DFJA 1S9GA 4DTSA 2ZM6K 2W41A 5AQXA 5C25A 1NGBA 4PHTX 3RMAA 4KB1A 5AZIA 1SKRA 2E88A 4EZ9A 1XI1A 2OPQA 1X3NA 1TGOA 3MXJA 2HNYA 4J8FA 4AQYK 3LALA 1VQ5N 4N56A 2O4IA 4JKHA 2HBMA 3QNNA 4M42A 2VWBA 2GUPA 3BF3A 1U45A 4BC5A 1GLFO 3PX4A 3AY9A 1CZBA 3VQ5A 3AVLA 4UQGA 1T7PA 1V4TA 3MEDA 4FJIA 3ZEUA 3ZT1A 5J2NA 1SKSA 1L3UA 4DV3K 1NWKA 4CJEA 4YHHK 4KV8A 4B3OA 1HYSA 4B3MK 5I42A 1NK5A 4CEFA 2FF3B 3DRPA 2VWJA 3QLHA 3A5MC 5F1XA 4CK3A 1G99A 2OA8A 1OVYA 4M7YA 4FZZA 3LWLA 4JK9A 2NRZA 4IOAL 3H08A 1NGAA 3TAFA 2X6NA 3G6EN 3CJCA 3K2PA 3WXIA 5IT9O 2ZF5O 3E1YA 2G8KA 3EKSA 3KLIA 1H1VA 4B8CA 3RR8A 2P9UA 1RTIA 2DTUA 4H8KA 2FC0A 4PKHA 1R0AA 4V19S 3DLRA 3NF8A 4K41A 3GDQA 3RSEB 4KHUA 3KKSA 3U9ZA 3OYJA 4ISFA 1Q7YO 1MDUB 3CC7N 1ATSA 3U3GA 5BPLA 3NCIA 3LWMA 1K9MO 1SAZA 2FSNA 2B6AA 5M1OA 4AF1A 4KHSA 3E9PA 5HRPA 4GV6A 5GAHP 1U4BA 4DQ8A 3AVBA 5C0YA 3G71N 4O5FA 4BR2A 4CK2A 4EZ6A 3ZETA 1HKGA 1WAFA 3M3ZA 1Z6RA 4DUZK 1VQ6N 1U47A 1NKEA 1E4GT 2GELA 1HPZA 4CGJA 1R59O 2FBXA 3O8MA 4ILJA 3AVAA 4JKEA 5LJVA 1JCFA 4UY8O 4EAHD 2D0PA 3SUNA 1OVQA 1YVNA 3WQUA 2ASPA 4IJAA 3BY5A 1NOYA 2G8HA 1XNRK 3SMPA 4E7KA 3AO5A 3DRRA 4OLBA 1SV5A 4B3SK 3LDSA 3O3FA 3V9WA 3OS1A 1QSYA 4IEEA 5CZ2A 4E19A 3EZWA 4CFAA 4LSNA 3LM2A 5AJ3K 1QVGM 5J1EA 2VYPA 2E6LA 1F21A 3VPZA 2NRHA 3OYBA 1N8RO 4GNIA 1GLCG 1YAGA 1QQNA 4YOVA 2WUSA 4DLGA 4IOXA 4PKIA 4FWRA 2G8VA 2Q3SA 3GE1A 2JWLA 4Z4IA 3VQBA 4DSLA 1VRUA 4H0YB 4CESA 1VQ7N 1VSLA 1QHTA 1WSFA 4E7HA 1V4SA 2E1ZA 3TSPA 2QA4N 3MN5A 4F3TA 1A5VA 2IVPA 4CIEA 3MN9A 1HNZK 3CJBA 1HQUA 1JL2A 2FSJA 3F9MA 2PFUA 1D8YA 3PV8A 3F5TA 1DKGD 3AA2A 3FZMA 4BC2A 1KFSA 5KRSA 3O4NA 3NVKA 3NHGA 2B5JA 3U4LA 4YDUC 2HHWA 4RTFD 3O6WA 1D9FA 3H45C 1T8EA 4N5SA 2CH6A 4H4OA 4OX9K 2QWNA 5BN8A 4JI1K 5AQOA 3QESA 1JLFA 3DAWA 5EU7A 1TVRA 3MDQA 3E9OA 2Y1JA 3D6RA 2VQFK 3MECA 4FWNA 4H03B 4Q0BA 2F4VK 1HYVA 2V7ZA 3LDLA 4B08A 4OGEA 2WBNA 4WF9L 1Q8IA 4DTUA 1NK0A 4YORA 3HXMA 4I9QA 1Q9XA 4WYBA 1K8KA 3OYAA 3CD6N 1NM1A 2QXFA 3D2EA 4GV3A 4CD3A 3HPHA 3VTIA 3A2FA 3OY9A 1KVAA 1BL3A 4ELUA 2YCHA 1K6YA 3L2UA 3CFRA 1JLQA 4IWVA 1Z05A 2QWOA 5KQ8A 2HVIA 4CZEA 5AQZA 4CERA 5CR4A 1EQYA 4YOTA 3HP9A 3CPWM 3VQ9A 3OYFA 4Z4HA 2J4RA 4ZTFA 3DM2A 4IBNA 1JJ2M 4M3XA 4DSIA 4OJRA 3EZ5A 4CGHA 4BR4A 3CQ8A 4JI5K 1HYZA 1GOCA 4BRFA 4NYNA 2IVNA 4H5TA 3TARA 4LF6K 3SQ2A 4CZHA 1XWLA 4FOEA 2UU9K 1C0GA 3SQ0A 2RE2A 3QETA 3NF9A 1BISA 4M3YA 4IFEA 3DOKA 3QICA 4OLAA 3T3FA 2NRWA 3QO9A 4H5VA 3VENA 5AQKA 5LMUK 3QERA 3CM6A 4C1NI 4MFBA 2P51A 3J7YP 1DLOA 3M8QA 4CJTA 3VQ4A 3TTFA 1W0HA 3MWTA 4LF4K 1VSHA 4H5RA 4FJXA 1BI4A 2QTDA 3KZBA 2NUBA 3VTHA 4BQZA 1X9SA 3W0LA 4DV7K 1XUPO 5AQVA 3IS9A 1QE1A 3HO1A 4RG8A 3O08A 3A8YA 5LL6Z 1A5WA 2I5JA 1IG8A 3IFRA 2QEXN 3H3OB 3L2QA 4IJNA 4QS7A 4I6MB 3MX5A 3SMSA 1KVBA 4BRCA 4LD0A 1HNWK 2ZGYA 3CF5L 3CC2N 1W97L 1UWBA 3AVFA 3WNHA 3S3OA 1WSEA 2AP1A 4GW6A 4CZGA 4B8AB 4Z4CA 4JKGB 1T3VA 3L2VA 4RWTA 4ID5A 5I9EB 1QS4A 3OTOK 4GVMA 1ZBIA 3KLGA 4CD1A 4E0DA 4WFBL 1BO5O 4FPBA 2PY5A 4DMNA 1LV5A 1LWCA 2QWPA 1XNQK 4AM7A 1LWEA 4N41A 4C23A 2GV9A 1BCOA 5IWAK 2IC3A 3LAKA 2EWSA 1ZBSA 3THXA 3PY8A 2XY7A 1I3AA 1VRTA 1C1CA 5CHIA 2HHUA 3V4IA 3R6MA 4CECA 4K43A 4LSLA 1YITN 3ITHA 1VQMN 1U48A 3HVRA 3L3VA 3AVKA 3HTVA 3O9TA 1QQCA 5JICA 4J2BA 3H1VX 3OYCA 4Z4FA 2OYQA 3OHRA 3CC4N 1NLVA 3FE1A 3IG1A 2GX9A 4BRIA 2Q0RA 4PKGA 2OPPA 1SZ2A 2IGIA 2XY6A 4FK4A 3CIPA 4XIUA 2HF3A 4MO5A 1D4XA 4BR9A 3AAQA 1X1PA 3D2FA 4QS9A 4CJ7A 4AILC 1YIJN 1L3SA 1S1WA 1W9HA 4IDHA 2EHGA 2IAJA 2KTQA 5FPMA 3NF6A 1QHAA 4CJ4A 3WXKA 1U6ZA 4JEPA 1RDUA 4PQUA 4JS4A 3OVNA 1S3XA 4JHDA 4DR1K 3SYZA 1GLJO 1WSHA 2A3ZA 3A0IX 1L3VA 2O8FA 4NCGA 2P9IA 3OA9A 4Q5VA 1EKEA 5GAEP 2ZQBA 5AQIA 1C6VA 4DTRA 4BDZA 2GWKA 2Z1IA 3HOSA 4DU4A 4JRPA 4BRMA 3G25A 3HL8A 3M8SA 2OTJN 4HVJA 1M90O 3QB0A 3P31A 3CCMN 3BF1A 2P9SA 2CH5A 4JI3K 1NGIA 3AVMA 3P39A 5AZJB 3UKRB 2W40A 3KVGA 2W6LA 1VHXA 3WXMB 3DXMA 3H1QA 1IKXA 3DXKA 3ID6A 4BRAA 3TSQA 4W5QA 1NJIO 3THWA 3CFOA 3A5OC 3HM9A 2IIRA 4CJFA 2DY4A 2P9PB 4CGDA 4CJ5A 4X64K 1VAZA 1TL3A 3WEEA 3DRSA 2PBDA 1DGKN 1G15A 4DKWA 4I9LA 1NG9A 3VA0A 5EY4A 5M1KA 3QEPA 1U2VA 3VF4A 2QWRA 1S1UA 3C94A 5H1SQ 2ZJRL 1B9DA 5ADXA 1HX1A 2ASOA 4KI4A 3M5RA 3M8RA 5KRTA 2X6SA 4CJLA 2HNDA 2QWQA 3WQTA 2HMIA 3KWGA 1HNIA 5AQJA 4DTMA 1SL2A 5HRRA 3ASMA 1ASWA 4KTQA 4OPKA 3AVNA 3TU5A 3K5LA 1N36K 2WONA 4RW8A 3DMJA 1IKWA 4A2BA 1FKOA 3MXIA 4DWIA 2E2QA 2CGKA 4JNEA 2IOCA 4M45A 3RRGA 1SL1A 1YTUA 1S22A 4AHCA 4FJ5A 1JXEA 3F2KA 4H0OA 1C0TA 4FWLA 5AQFA 1NGJA 4GY2B 2FLOA 4YNQA 4MDAA 2HNZA 2OPRA 1T6CA 4DB3A 4FJLA 4BRDA 3C95A 1WSJA 5M1NA 3MK6A 3WT0A 3QEWA 3CCEN 4CE9A 4BDPA 3SNNA 4PY5A 1K8AO 1Z25A 4FM2A 3VEOA 4KBOA 3R3LA 3DYAA 3OBYA 4ID1A 1IKVA 4CHZA 1C0FA 4MDBA 3LZIA 4HHTA 1RDAA 1HNVA 5D3GA 1NMDA 1TKZA 3JYTA 1HKCA 2P9KA 5BRDA 3V1OA 3QIOA 2JGUA 4LY7A 4K8ZA 1S5JA 1UA0A 3VEYA 4OKJA 2Q31A 3QINA 1WNSA 1YT3A 1WN7A 4BRGA 1TK0A 2HHXA 3CI5A 4CI6A 4CGIA 3J80O 2QXLA 2Y1IA 1E4FT 1RDCA 4PUOA 5HROA 1QTMA 3O1BA 2ZJQL 4I7FA 3V9SA 4GV9A 1NNEA 2P5OA 1UAXA 2ZE2A 3T69A 4YOYA 3C7NB 1RTDA 1LOTB 1BA1A 5J2PA 1RBTA 3LDQA 5GINA 2EX3A 4JRQA 1VQLN 2ATQA 1X9JA 4DV5K 2E6MA 4CEOA 3O4WA 2YI1A 4EFHA 3C6UA 4CHPA 1IKYA 1SUQA 3K5MA 3FZKA 4NYFA 3W3DA 1LCUA 4CZLA 3KTQA 4DV2K 2F8TA 5DM7L 1HUXA 3ULEA 4WCEL 1YXQA 1U04A 2V52B 2P5GA 4F4KA 3VQQA 3O9UA 3SUQA 1RT1A 3NFAA 3MXMA 3SQ1A 3J81O 4GMJB 3WXJA 3PX0A 1UOCA 4H0TB 1N33K 3VEWA 5C12A 3WNFA 4M41A 1BUPA 4BQLA 4CZFA 1S6QA 4DU3A 3SUOA 3EL2A 4W5RA 4ZHRA 4M3TA 2RHKA 3ZSXA 2VG5A 4DU1A 3KHYA 4OPJA 4DR7K 2OCEA 2BGGA 3HPGA 1HLUA 4L3QA 2UUCK 4DTPA 1OH8A 1RDDA 3GOIA 4AM6A 2UUBK 2G8IA 3I0RA 2O8EB 2X74A 3CYMA 1S1TA 4CJQA 1ZXOA 1KQSM 3ZLJA 4JI6K 4F8RA 3V9UA 5DMRA 1WB9A 2VG6A 1W2BM 4FLYA 3J8AA 4HUEA 1Q81O 3NH0A 2VCPA 1ITGA 1IG9A 3AVCA 3ZCMA 4MQ3A 4DTXA 4FJHA 2QWLA 4DR4K 5AQSA 2HHHK 1NKBA 1XC3A 4IEIA 3EN9A 4BE1A 2F7TA 1OH5A 2ZGZA 4CEQA 3ZSZA 1Q86O 1RTJA 4F9OA 2NNWA 2KZMA 1B92A 3K5NA 1ZC6A 4LF9K 3SBGA 5FPNA 1VQ8N 3CCJN 4FOIA 4WE1A 4Y1DA 1IBMK 1RNHA 3ZT4A 5E84A 2A6AA 3KKRA 3L4QA 5CYMA 1RILA 4BREA 2UXCK 3CJ7A 3TI0A 1XMQK 3OJSA 4ELTA 4N76A 5M1PA 2Z1JA 3AO4A 3SZ2A 1VSMA 2IVOA 3LPTA 1HJRA 4FLVA 3ULDA 1C0MA 4JV5K 4FLTA 4IG3A 3HI0A 3MEEA 4JI2K 4M3UA 3AA5X 1KCFA 4DLEA 3PO5A 1NGHA 3CCRN 2UXBK 4C1NK 2QKKA 1KC8O 1VSFA 3VF6A 1SQKA 5KPZA 1VQKN 1NJZA 4MO4A 4W5NA 1ZBLA 4OPAA 1C0UA 2YHBA 4BR0A 2ZD1A 3AV9A 4IXCA 1NMNA 5ADXH 1X9WA 4CZJA 4LF5K 4NCAA 3GBTA 3ZT3A 2YHYA 5E26A 4DV0K 3HT3A 3CCQN 2YX6A 3CETA 3G4SN 1HJOA 4FW1A 2YHAA 3TAPA 1CLQA 4LF8K 2CGLA 1NJYA 1IBLK 3FZLA 3AA4A 4LH4A 3S9HA 4BE2A 5AQWA 3KD5E 4CZMA 2NZTA 4MLEA 2RKIA 4CJPA 4B9SA 1LAVA 4FVMA 4B3TK 4FLZA 4JI8K 1KXPA 2D4WA 3IMXA 1HQEA 4FWMA 4BRLA 5BPMA 2NLXA 1DTTA 1KAZA 1NGEA 4A59A 4YOXA 4E3SA 2A1SA 2XO7A 4AH9A 4KTZA 1JLAA 2IS3A 1RBUA 1T05A 1Q82O 2D0BA 4B1WB 4DTOA 1BI4B 3OYDA 4FK0A 4YOWA 3BUZB 2BTFA 3VOVA 3OYLA 4R5PA 4W5OA 5M1FA 4K8XA 4J2AA 1RCHA 1S9EA 3HSCA 2FBTA 3MCAB 1U49A 1QSSA 3QBWA 2ZJPL 4FZXC 4GKKK 5F2RA 4KTWA 4E89A 4NXNK 5FPDA 1TV6A 3ENBA 3MWPA 5JS2A 4JKBA 3ZSVA 4E1NA 4BWMA 4B1VA 4H0XB 3OS0A 1KVCA 1W7AA 1TKDA 2PYLA 4JI0K 3I8BA 1EP4A 2O8BB 4NB4A 3AO2A 4B3RK 2O8CB 3MX2A 1QQMA 3D0PA 3U8XA 3NDKA 4HUFA 5MLCQ 3TPQA 4Z0UA 3QFPA 4DR3K 2WC9A 1Y97A 1MU2A 4B1UB 3DI6A 4DF8A 5LY3A 5JVHL 1YJWN 4AHVA 3TTDA 3NGYA 3THXB 3THYA 3WNEA 5FRMA 4FW2A 4DS4A 3SJHA 1NK9A 2YNFA 4JK8A 2A1RA 4G1QA 3CERA 1KRPA 4DV1K 2F8SA 3VN5A 4NO7A 3ZSOA 2RF2A 1YJNN 3J7ZO 5CZ1A 3NMUA 5FRNA 1VSDA 2KQ2A 1ZBHA 3IAYA 4CVNE 1C1BA 3DWLA 1VQPN 4IO9L 2P9NA 2CGJA 1NU0A 4KHQA 4K42A 4JD2A 4FWQA 2DFEA 2WTUA 4FWKA 1S6PA 3K57A 1QZ6A 3G0ZA 4CJ3A 1IJJA 4KH6A 5CY4A 4WFAL 1GLEG 4JKCA 3D2FB 3EEQA 3HM8A 1CZAN 2RN2A 2JLEA 1YJ9N 3EYZA 5HL7L 1SL0A 5EX5A 2JWKA
chains in the Genus database with same CATH topology
4LFCK 2E5LK 2VQEK 4KHPK 1J5EK 4LF4K 1N36K 1HR0K 4DV6K 1FJGK 4OX9K 4DV2K 4JI1K 4JV5K 4DV7K 4LF7K 4CW7B 3JAMO 4GKKK 4JI2K 1N34K 4NXNK 2ZM6K 1IBKK 3J81O 4DR5K 2VQFK 5LL6Z 1N33K 2F4VK 4DUZK 4LFBK 2UXBK 4DR1K 1I94K 4JI0K 4JYAK 4AQYK 5BR8K 3T1HK 4B3RK 4DR2K 3T1YK 1XMOK 4DR7K 1HNWK 5LMNK 2UXDK 2UUCK 1XNRK 4K0KK 4LF5K 1HNXK 3J7AP 4JI7K 4B3SK 4DR3K 2UUBK 4DV0K 4DV3K 4DUYK 3OTOK 4DR6K 4YHHK 4JI3K 4LF8K 5AJ3K 4JI6K 1IBLK 4NXMK 4B3MK 1XNQK 5FLXO 4DV1K 5IWAK 4B3TK 4JI5K 4JI8K 4DR4K 2HHHK 4CVNE 4JI4K 4GKJK 4X66K 4LF6K 4X62K 4X64K 3J80O 2UU9K 5IT9O 4LF9K 2UUAK 1N32K 1IBMK 4X65K 5A2QO 4YY3K 1HNZK 4V19S 4LFAK 2UXCK 4DV4K 5LMUK 4DV5K 1XMQK 3J7YP
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4LFC K;  2E5L K;  2VQE K;  4KHP K;  1J5E K;  4LF4 K;  1N36 K;  1HR0 K;  4DV6 K;  1FJG K;  4OX9 K;  4DV2 K;  4JI1 K;  4JV5 K;  4DV7 K;  4LF7 K;  4CW7 B;  3JAM O;  4GKK K;  4JI2 K;  1N34 K;  4NXN K;  2ZM6 K;  1IBK K;  3J81 O;  4DR5 K;  2VQF K;  5LL6 Z;  1N33 K;  2F4V K;  4DUZ K;  4LFB K;  2UXB K;  4DR1 K;  1I94 K;  4JI0 K;  4JYA K;  4AQY K;  5BR8 K;  3T1H K;  4B3R K;  4DR2 K;  3T1Y K;  1XMO K;  4DR7 K;  1HNW K;  5LMN K;  2UXD K;  2UUC K;  1XNR K;  4K0K K;  4LF5 K;  1HNX K;  3J7A P;  4JI7 K;  4B3S K;  4DR3 K;  2UUB K;  4DV0 K;  4DV3 K;  4DUY K;  3OTO K;  4DR6 K;  4YHH K;  4JI3 K;  4LF8 K;  5AJ3 K;  4JI6 K;  1IBL K;  4NXM K;  4B3M K;  1XNQ K;  5FLX O;  4DV1 K;  5IWA K;  4B3T K;  4JI5 K;  4JI8 K;  4DR4 K;  2HHH K;  4CVN E;  4JI4 K;  4GKJ K;  4X66 K;  4LF6 K;  4X62 K;  4X64 K;  3J80 O;  2UU9 K;  5IT9 O;  4LF9 K;  2UUA K;  1N32 K;  1IBM K;  4X65 K;  5A2Q O;  4YY3 K;  1HNZ K;  4V19 S;  4LFA K;  2UXC K;  4DV4 K;  5LMU K;  4DV5 K;  1XMQ K;  3J7Y P; 
#chains in the Genus database with same CATH topology
 3SI6 A;  3SK3 A;  3VQC A;  3KLE A;  4FJ7 A;  3UKU B;  2HHS A;  1T03 A;  4XEI A;  2I7N A;  2Q2R A;  5C2F A;  3OYI A;  3L4I A;  3AO3 A;  1FJG K;  3QIP A;  1RBR A;  3HYF A;  3KK2 A;  1GLB G;  3V6D A;  2OZM A;  3TAE A;  4KRE A;  1TAQ A;  1LAW A;  4B9V A;  1I39 A;  3CPE A;  1XHZ A;  4FZY A;  3OS2 A;  4JK7 A;  1NGG A;  2G8W A;  1BQN A;  1TKX A;  4DS5 A;  4I6M A;  1CXU A;  4K25 A;  5JVG L;  2VG7 A;  2AJQ A;  3TAQ A;  5I3U A;  3C6T A;  4WQ5 C;  1JXB A;  3B6P A;  3HOT A;  3SCX A;  4DF4 A;  1EXQ A;  4H5N A;  2XY5 A;  4DQP A;  4JKG A;  3DLH A;  4JN4 A;  1VSK A;  3BGR A;  5BR9 A;  1J53 A;  3K9J A;  3ZSW A;  2OPS A;  4KO0 A;  5C2D A;  3SAG A;  3DXM B;  5FPE A;  3VQE A;  1S72 N;  1S1V A;  4DHY A;  2KLA A;  3U9D A;  2O8D B;  4KB0 A;  1RT5 A;  2YNG A;  1CXQ A;  4CJU A;  1FW6 A;  2HF4 A;  2Z1G A;  3WEE B;  4BY9 C;  1J6Z A;  4FVU A;  1NK6 A;  3NE6 A;  4J2E A;  3VGK A;  2BDP A;  4H0P A;  4CED A;  3PSI A;  4H4M A;  4CF1 A;  3IUC A;  3O9Q A;  3CQX A;  5AR0 A;  3VGL A;  5JS1 A;  3O4Q A;  2QK9 A;  3RTV A;  5M1Q A;  4DSK A;  2P9L A;  4CIF A;  5AQG A;  1LWF A;  1MWM A;  2YHW A;  1BQM A;  4BVP A;  3Q7B A;  3P83 D;  1P8Z A;  5HP1 A;  3SPY A;  1EWR A;  1TK8 A;  3JXU A;  3AGK A;  1BGX T;  3MEG A;  5AQL A;  1HMV A;  2YNI A;  1ILY A;  2YJF A;  3QDK A;  2G8U A;  4KHP K;  5DK5 A;  3CMA N;  3CME N;  1IH7 A;  4I2P A;  1X3M A;  1YVU A;  4C8O A;  4B1X B;  4B9M A;  2A41 A;  2VGN A;  1BWF O;  1N34 K;  3RMC A;  5LJW A;  4OPH A;  4CCH A;  4DR5 K;  4KH5 A;  2DFH A;  1X9M A;  4EP5 A;  4BRN A;  1VSJ A;  2A42 A;  4BG9 A;  3LDO A;  4DQS A;  3A5N C;  1KAX A;  4ILH A;  5DM6 L;  1I94 K;  3KLH A;  2HBK A;  4CJR A;  3NAE A;  4YDU A;  1YI2 N;  3T1H K;  5AZI B;  3OYM A;  1BHL A;  1KSP A;  4OKK A;  3HJF A;  3S3M A;  4QOZ B;  1A5X A;  2V7Y A;  4K0K K;  3WUH A;  5AQR A;  3AA3 A;  5FRO A;  5KPT A;  1M1K O;  4L8R B;  1RT2 A;  5GAD P;  1C1A A;  4F2S A;  4M3W A;  4BVO A;  3V1R A;  4PL8 A;  3UKR A;  5AZJ A;  3S3N A;  5SZT A;  2F9T A;  3PUF A;  4M3Z A;  3R1X A;  1NKC A;  4QAG A;  2H3G X;  3CJA A;  4H0V B;  3ZEU B;  2GTD A;  3MAQ A;  5ELZ A;  5EOY A;  1LW2 A;  2P9P A;  1RFQ A;  5C24 A;  4AHT A;  4KH4 A;  3TSU A;  4FJN A;  4U7B A;  4KKO A;  5JMV A;  4PWD A;  3EO3 A;  4KI6 A;  4HUG A;  1RTH A;  4X66 K;  3K0S A;  3ZYY X;  3MN7 A;  2LSN A;  5BRF A;  2PAV A;  1NBW A;  4KFB A;  4C8L A;  2Q97 A;  4E1J A;  3QEV A;  2FBY A;  1ESV A;  3LM9 A;  2O4G A;  3ZT2 A;  3U3Y A;  1YF5 L;  3TAN A;  1N32 K;  1NGF A;  4OGC A;  5AQY A;  4CHN A;  5AFU A;  2KZZ A;  4FM0 A;  4DQI A;  1TYQ A;  4LFA K;  3HPO A;  3ULE B;  1NK8 A;  3VEV A;  2P9U B;  3LP3 A;  4XH4 A;  1REV A;  4CF8 A;  3CXC M;  4DV6 K;  3TAG A;  1DEJ A;  3PX6 A;  4FLU A;  4I2Q A;  2D0A A;  3FR0 A;  5HOO A;  2GBZ A;  4G9Z A;  1RT7 A;  1JCG A;  3BEX A;  4ISE A;  4CEA A;  2HMP A;  4A57 A;  2BAN A;  4CHY A;  2ASM A;  4IOC L;  3VQ7 A;  3OYK A;  3AAP A;  1OH6 A;  4WQ4 C;  3A5L C;  4CIG A;  4PA1 A;  4LFB K;  1UA1 A;  3AVG A;  2YHX A;  3TAM A;  4JYA K;  4CK1 A;  1EET A;  3UE5 A;  2YV0 X;  3GG4 A;  3I8D A;  3SJJ A;  3N4Q A;  1J9A A;  3ZET B;  1IV0 A;  5T7B A;  1DT9 A;  2XY8 A;  3E01 A;  3NBP A;  1QQO A;  4FLW A;  3KIO A;  3UB5 A;  1VSE A;  3VF2 A;  3G10 A;  3ZSY A;  1RBV A;  3DLB A;  2AA4 A;  5F0X A;  2FBV A;  3NGZ A;  1VQ9 N;  1HNX K;  4BAC A;  3J7A P;  1JLE A;  4F2R A;  1Q9Y A;  5AQN A;  3LPU A;  4O44 A;  3N4P A;  3CFP A;  1K73 O;  4BR5 A;  2HHT A;  2HBL A;  3OBW A;  2E8A A;  1KTQ A;  3AGR A;  4R79 A;  2ETJ A;  3VQA A;  3TAB A;  3U6F A;  5FLX O;  1YUW A;  3OJU A;  4DTJ A;  1EO1 A;  3NH1 A;  3KK1 A;  3VQP A;  4BC4 A;  3IDH A;  1TUY A;  3V9Z A;  1P90 A;  5TKW A;  3L2W A;  3ZSQ A;  4EP4 A;  1BOT O;  3AVI A;  2HVH A;  4CF9 A;  4GKJ K;  3ZX0 A;  3C7N A;  4J2D A;  3F73 A;  5C42 A;  5GIO A;  4CEZ A;  1Z26 A;  4CFC A;  5BN9 A;  5GIP A;  5B8H A;  1J5O A;  3LAM A;  3P38 A;  4FPA A;  4YFU A;  3TWH A;  2KKZ A;  3Q7C A;  2E4L A;  2KFZ A;  4X65 K;  3JS6 A;  3KLF A;  3LDN A;  1GLD G;  4FSV A;  3H46 O;  2HOE A;  3K5O A;  4LFC K;  3LP1 A;  2E5L K;  4DFM A;  3I55 N;  4CJW A;  3S41 A;  4CJK A;  4FYD A;  3FFI A;  3C6A A;  1BIZ A;  3VMF B;  3RSE A;  4E7J A;  2KHO A;  3OYN A;  3ZSR A;  3MCP A;  4FJG A;  1NJW A;  1N5Y A;  3CCS N;  3AAR A;  3H3N O;  2FF6 A;  3E9L A;  1LW0 A;  4BRH A;  3CHW A;  3M1F A;  4MLH A;  1NK4 A;  2DFF A;  4BDY A;  1ASU A;  2BH1 A;  4KPY A;  4O5B A;  1NGC A;  4CEE A;  1CZ9 A;  1RGI A;  3VEZ A;  3LDP A;  4EHT A;  3FLC O;  4JKD A;  4BGB A;  1DTQ A;  4WQ5 A;  3M6G A;  3BZK A;  2D0O A;  4DQR A;  2E1Y A;  3DLK A;  1J54 A;  3T1Y K;  4FK2 A;  3K9K A;  2YKM A;  2GUI A;  2Q1N A;  3GL1 A;  2O8E A;  5KGX A;  3LP0 A;  5LMN K;  2E2O A;  4CJS A;  2ITG A;  1Y64 A;  4CGF A;  4O55 A;  3ATV A;  3IRX A;  1KFD A;  4B9Q A;  1K8K B;  4DCH A;  5C15 A;  2VWK A;  3RWU A;  1SS6 A;  1WBD A;  5SWM A;  4TSX A;  3D2E B;  3IKM A;  2ZWH A;  4O8K A;  3OYG A;  3P5J A;  4DUY K;  3CM5 A;  1WLJ A;  4DQQ A;  4RW9 A;  2F96 A;  1BU6 O;  2P1J A;  3CJ1 A;  1GLL O;  2QI2 A;  1JLC A;  4FJK A;  3FGU A;  3P1G A;  2D1K A;  4M63 C;  1ZBF A;  4NLB A;  4A5A A;  2E2P A;  3KJV A;  2KW4 A;  1VQ4 N;  4AHR A;  4ISG A;  3I0S A;  3NVM A;  2RPI A;  1B9F A;  4EHU A;  3ATU A;  3QML A;  3BDP A;  3VQ6 A;  3LAN A;  5AQQ A;  3EE8 A;  2UUA K;  4HWI A;  1QVF M;  3F9K A;  4KHN A;  1D9D A;  4EIA A;  1ATR A;  2X78 A;  3I56 N;  3T19 A;  4A61 A;  4CJV A;  4QS8 A;  4DV4 K;  4B1Y B;  3V9X A;  5TKY A;  1HPM A;  4IKF A;  3K58 A;  3TTC A;  5BPN A;  5KPR A;  3R9P A;  3OYE A;  1J5E K;  3SAH A;  3DLL L;  4CZI A;  3KK7 A;  3VQD A;  3VES A;  1O13 A;  3SBT A;  1ATN A;  3HVT A;  3E66 A;  5EVZ A;  3VQ8 A;  4CHQ A;  3CG7 A;  4O0I A;  2PYJ A;  3RMD A;  4LF7 K;  4U67 L;  1XHX A;  4CFB A;  3PSF A;  3T1A A;  1JLG A;  1L3T A;  3L6Q A;  4FWS A;  3O3H A;  3ENO A;  2G8F A;  2PZS A;  4Z4G A;  2FXU A;  3M8P A;  4LC9 B;  5J2M A;  1OKJ A;  1S1X A;  4JLH A;  3KK3 A;  4BG8 A;  1XMO K;  3FZF A;  2UYT A;  3O9S A;  2QWM A;  3THY B;  5AFU H;  3QBX A;  1JLB A;  3EKU A;  4CFD A;  4CBW A;  1GOB A;  3MN6 A;  1RT4 A;  3RMB A;  5KGW A;  1EWQ A;  4O4G A;  4KHW A;  2HST A;  1TUU A;  4KRF A;  1ASV A;  3H6E A;  4ICL A;  4N47 A;  3ISN C;  3PO4 A;  4DSJ A;  5FDL A;  1NK7 A;  1YHQ N;  4NXM K;  4KAZ A;  4IFV A;  5C10 A;  4M7X A;  1NJX A;  1OH7 A;  3SLC A;  2W6K A;  5HLF A;  2NRX A;  2P9N B;  5JLH A;  4E7L A;  3LZJ A;  1WBB A;  4JD2 B;  3VGM A;  2OTL N;  1VSI A;  4FWP A;  3PIO L;  4JS5 A;  1KD1 O;  3ZX3 A;  5E41 A;  2QW9 A;  3KD1 E;  4CHO A;  3DLE A;  4M3R A;  3OYH A;  2F9W A;  4YOU A;  4DSE A;  4CF0 A;  2QM1 A;  3O1W A;  4C8N A;  4OKE A;  2ITM A;  1QZ5 A;  2B4J A;  4C8M A;  4DTN A;  2I7P A;  3ZX2 A;  2YKN A;  4BR7 A;  3LP2 A;  3JSM A;  3PLA A;  1WAJ A;  3O3G A;  3QEI A;  1VQO N;  4RCH A;  4JKF A;  3T7Z A;  1KLM A;  4O0J A;  4IZ9 A;  2E20 A;  1BA0 A;  2HW3 A;  3LL3 A;  3RVC A;  3NH2 A;  3HBT A;  2GEM A;  3WXL A;  4CW7 B;  4HCC A;  1KLN A;  2D5R A;  3C6H A;  1MWK A;  3R8E A;  1XQS C;  2O8B A;  3C65 A;  1JCE A;  5AQT A;  3L0Q A;  1HKB A;  4C8K A;  4FM1 A;  4WQ4 A;  3K59 A;  1O1W A;  3RRH A;  3SQ4 A;  1KAY A;  1TK5 A;  2O8C A;  4OVL A;  1FKP A;  2YJE A;  5J2Q A;  2HBJ A;  3ID8 A;  5AQH A;  1RT3 A;  4B9L A;  5BR8 K;  4B9T A;  4JAX A;  5HRS A;  3DOL A;  1BIU A;  3D7E O;  4B9N A;  4NCB A;  4BRP A;  4JHD B;  3SAF A;  1VQN N;  4BWJ A;  2O8F B;  2P9I B;  4ILG B;  2A5X A;  4BE0 A;  3MMV A;  2GWJ A;  4B9U A;  4RW6 A;  1HRH A;  4BRQ A;  2A40 A;  3C0B A;  1WOQ A;  3SUP A;  4CBU A;  3HST B;  1QSL A;  3L3U A;  4E1M A;  3SPZ A;  3WNG A;  3VA3 A;  3ALY A;  4HTU A;  4ZTJ A;  3CCU N;  2HB5 A;  2P9S B;  5CYQ A;  4Z94 A;  1BCM A;  2P9L B;  3L8B A;  2HHQ A;  1ZYQ A;  3D45 A;  4E7I A;  1TKT A;  4O8U A;  3B8A X;  5GAG P;  4F3O A;  5KQD A;  2Z1H A;  3DXK B;  3HZ6 A;  1FXX A;  3P4I A;  4X62 K;  4Y1C A;  5K14 A;  4XH1 A;  3V1Q A;  3THW B;  3FZH A;  5AQM A;  4AHU A;  4IFY A;  3OW2 M;  1JKH A;  3QFU A;  4BC3 A;  2BE2 A;  3UKU A;  3PIP L;  4Z4E A;  1MA9 B;  3BP8 A;  1U2V B;  2DPN A;  4JKA A;  1SKW A;  2NRR A;  2VQE K;  4FO0 A;  1WUA A;  4IO8 A;  4FJJ A;  4LH5 A;  1HR0 K;  5AQP A;  5KTQ A;  3RR7 A;  3DJC A;  1RDB A;  4DFK A;  2YNH A;  1NOZ A;  3O80 A;  2V51 B;  3AVH A;  1NGD A;  3V81 A;  4FLX A;  3JAM O;  4CF2 A;  2XHB A;  2WFB A;  1Q18 A;  1IBK K;  1T6D A;  3VER A;  5BRH A;  1YTA A;  2QKB A;  2IDO A;  1EX4 A;  4CBX A;  1BDG A;  4HTL A;  1WSI A;  2NRT A;  2XRI A;  3O5B A;  4A2A A;  5CE3 A;  3QEX A;  4DSF A;  4DR2 K;  3AVJ A;  5JLF A;  5AQU A;  1RDW X;  2UXD K;  4CGG A;  1GOA A;  3ENH A;  4BRO A;  4W5T A;  2HHV A;  2O8D A;  2WOM A;  4WFN L;  1ZBU A;  4JI7 K;  4FXD A;  4PL7 A;  4FL9 A;  3KWI A;  3CCV N;  4ELV A;  4A62 A;  1FK9 A;  4DR6 K;  2OZS A;  2Q36 A;  4FJ9 A;  4XH5 A;  4DFP A;  2FSK A;  1XC9 A;  3B6O A;  3FFK B;  3I33 A;  3ZT0 A;  3THV A;  3EY1 A;  5EXW A;  2E2N A;  4FWO A;  3VEX A;  4AHS A;  2BUP A;  3CCL N;  5HBM A;  1L5U A;  5BRE A;  3UIQ A;  3HK2 A;  2D0C A;  5HRN A;  2P9K B;  1RBS A;  4RW4 A;  3VET A;  1JL1 A;  3HP6 A;  4GVE A;  4BRK A;  3SV3 A;  4FJ8 A;  4B1Z A;  3TR8 A;  4BGA A;  4JI4 K;  1D5A A;  3L2R A;  1TYQ B;  4HCB A;  4Y0W A;  1TL1 A;  4QCL A;  1TAU A;  3NGI A;  4H5W A;  2R7Y A;  4CEB A;  3O9R A;  3NF7 A;  4OO1 J;  4IG0 A;  3DLG A;  1RT6 A;  1VK0 A;  1GLA G;  3EE9 A;  3CJ9 A;  5A2Q O;  4YY3 K;  2W42 A;  4FCY A;  2KFN A;  4RW7 A;  3BZC A;  1E3M A;  4FJM A;  1IO2 A;  3HRG A;  1N6Q A;  4A5B A;  4KHY A;  2OAN A;  3QNO A;  1T44 A;  2VGM A;  3SV4 A;  5KI6 A;  3AO1 A;  4CZK A;  4NLC A;  2Q0U A;  4DG1 A;  3CQY A;  4IDK A;  1WSG A;  1BG3 A;  2NRV A;  4DFJ A;  1S9G A;  4DTS A;  2ZM6 K;  2W41 A;  5AQX A;  5C25 A;  1NGB A;  4PHT X;  3RMA A;  4KB1 A;  5AZI A;  1SKR A;  2E88 A;  4EZ9 A;  1XI1 A;  2OPQ A;  1X3N A;  1TGO A;  3MXJ A;  2HNY A;  4J8F A;  4AQY K;  3LAL A;  1VQ5 N;  4N56 A;  2O4I A;  4JKH A;  2HBM A;  3QNN A;  4M42 A;  2VWB A;  2GUP A;  3BF3 A;  1U45 A;  4BC5 A;  1GLF O;  3PX4 A;  3AY9 A;  1CZB A;  3VQ5 A;  3AVL A;  4UQG A;  1T7P A;  1V4T A;  3MED A;  4FJI A;  3ZEU A;  3ZT1 A;  5J2N A;  1SKS A;  1L3U A;  4DV3 K;  1NWK A;  4CJE A;  4YHH K;  4KV8 A;  4B3O A;  1HYS A;  4B3M K;  5I42 A;  1NK5 A;  4CEF A;  2FF3 B;  3DRP A;  2VWJ A;  3QLH A;  3A5M C;  5F1X A;  4CK3 A;  1G99 A;  2OA8 A;  1OVY A;  4M7Y A;  4FZZ A;  3LWL A;  4JK9 A;  2NRZ A;  4IOA L;  3H08 A;  1NGA A;  3TAF A;  2X6N A;  3G6E N;  3CJC A;  3K2P A;  3WXI A;  5IT9 O;  2ZF5 O;  3E1Y A;  2G8K A;  3EKS A;  3KLI A;  1H1V A;  4B8C A;  3RR8 A;  2P9U A;  1RTI A;  2DTU A;  4H8K A;  2FC0 A;  4PKH A;  1R0A A;  4V19 S;  3DLR A;  3NF8 A;  4K41 A;  3GDQ A;  3RSE B;  4KHU A;  3KKS A;  3U9Z A;  3OYJ A;  4ISF A;  1Q7Y O;  1MDU B;  3CC7 N;  1ATS A;  3U3G A;  5BPL A;  3NCI A;  3LWM A;  1K9M O;  1SAZ A;  2FSN A;  2B6A A;  5M1O A;  4AF1 A;  4KHS A;  3E9P A;  5HRP A;  4GV6 A;  5GAH P;  1U4B A;  4DQ8 A;  3AVB A;  5C0Y A;  3G71 N;  4O5F A;  4BR2 A;  4CK2 A;  4EZ6 A;  3ZET A;  1HKG A;  1WAF A;  3M3Z A;  1Z6R A;  4DUZ K;  1VQ6 N;  1U47 A;  1NKE A;  1E4G T;  2GEL A;  1HPZ A;  4CGJ A;  1R59 O;  2FBX A;  3O8M A;  4ILJ A;  3AVA A;  4JKE A;  5LJV A;  1JCF A;  4UY8 O;  4EAH D;  2D0P A;  3SUN A;  1OVQ A;  1YVN A;  3WQU A;  2ASP A;  4IJA A;  3BY5 A;  1NOY A;  2G8H A;  1XNR K;  3SMP A;  4E7K A;  3AO5 A;  3DRR A;  4OLB A;  1SV5 A;  4B3S K;  3LDS A;  3O3F A;  3V9W A;  3OS1 A;  1QSY A;  4IEE A;  5CZ2 A;  4E19 A;  3EZW A;  4CFA A;  4LSN A;  3LM2 A;  5AJ3 K;  1QVG M;  5J1E A;  2VYP A;  2E6L A;  1F21 A;  3VPZ A;  2NRH A;  3OYB A;  1N8R O;  4GNI A;  1GLC G;  1YAG A;  1QQN A;  4YOV A;  2WUS A;  4DLG A;  4IOX A;  4PKI A;  4FWR A;  2G8V A;  2Q3S A;  3GE1 A;  2JWL A;  4Z4I A;  3VQB A;  4DSL A;  1VRU A;  4H0Y B;  4CES A;  1VQ7 N;  1VSL A;  1QHT A;  1WSF A;  4E7H A;  1V4S A;  2E1Z A;  3TSP A;  2QA4 N;  3MN5 A;  4F3T A;  1A5V A;  2IVP A;  4CIE A;  3MN9 A;  1HNZ K;  3CJB A;  1HQU A;  1JL2 A;  2FSJ A;  3F9M A;  2PFU A;  1D8Y A;  3PV8 A;  3F5T A;  1DKG D;  3AA2 A;  3FZM A;  4BC2 A;  1KFS A;  5KRS A;  3O4N A;  3NVK A;  3NHG A;  2B5J A;  3U4L A;  4YDU C;  2HHW A;  4RTF D;  3O6W A;  1D9F A;  3H45 C;  1T8E A;  4N5S A;  2CH6 A;  4H4O A;  4OX9 K;  2QWN A;  5BN8 A;  4JI1 K;  5AQO A;  3QES A;  1JLF A;  3DAW A;  5EU7 A;  1TVR A;  3MDQ A;  3E9O A;  2Y1J A;  3D6R A;  2VQF K;  3MEC A;  4FWN A;  4H03 B;  4Q0B A;  2F4V K;  1HYV A;  2V7Z A;  3LDL A;  4B08 A;  4OGE A;  2WBN A;  4WF9 L;  1Q8I A;  4DTU A;  1NK0 A;  4YOR A;  3HXM A;  4I9Q A;  1Q9X A;  4WYB A;  1K8K A;  3OYA A;  3CD6 N;  1NM1 A;  2QXF A;  3D2E A;  4GV3 A;  4CD3 A;  3HPH A;  3VTI A;  3A2F A;  3OY9 A;  1KVA A;  1BL3 A;  4ELU A;  2YCH A;  1K6Y A;  3L2U A;  3CFR A;  1JLQ A;  4IWV A;  1Z05 A;  2QWO A;  5KQ8 A;  2HVI A;  4CZE A;  5AQZ A;  4CER A;  5CR4 A;  1EQY A;  4YOT A;  3HP9 A;  3CPW M;  3VQ9 A;  3OYF A;  4Z4H A;  2J4R A;  4ZTF A;  3DM2 A;  4IBN A;  1JJ2 M;  4M3X A;  4DSI A;  4OJR A;  3EZ5 A;  4CGH A;  4BR4 A;  3CQ8 A;  4JI5 K;  1HYZ A;  1GOC A;  4BRF A;  4NYN A;  2IVN A;  4H5T A;  3TAR A;  4LF6 K;  3SQ2 A;  4CZH A;  1XWL A;  4FOE A;  2UU9 K;  1C0G A;  3SQ0 A;  2RE2 A;  3QET A;  3NF9 A;  1BIS A;  4M3Y A;  4IFE A;  3DOK A;  3QIC A;  4OLA A;  3T3F A;  2NRW A;  3QO9 A;  4H5V A;  3VEN A;  5AQK A;  5LMU K;  3QER A;  3CM6 A;  4C1N I;  4MFB A;  2P51 A;  3J7Y P;  1DLO A;  3M8Q A;  4CJT A;  3VQ4 A;  3TTF A;  1W0H A;  3MWT A;  4LF4 K;  1VSH A;  4H5R A;  4FJX A;  1BI4 A;  2QTD A;  3KZB A;  2NUB A;  3VTH A;  4BQZ A;  1X9S A;  3W0L A;  4DV7 K;  1XUP O;  5AQV A;  3IS9 A;  1QE1 A;  3HO1 A;  4RG8 A;  3O08 A;  3A8Y A;  5LL6 Z;  1A5W A;  2I5J A;  1IG8 A;  3IFR A;  2QEX N;  3H3O B;  3L2Q A;  4IJN A;  4QS7 A;  4I6M B;  3MX5 A;  3SMS A;  1KVB A;  4BRC A;  4LD0 A;  1HNW K;  2ZGY A;  3CF5 L;  3CC2 N;  1W97 L;  1UWB A;  3AVF A;  3WNH A;  3S3O A;  1WSE A;  2AP1 A;  4GW6 A;  4CZG A;  4B8A B;  4Z4C A;  4JKG B;  1T3V A;  3L2V A;  4RWT A;  4ID5 A;  5I9E B;  1QS4 A;  3OTO K;  4GVM A;  1ZBI A;  3KLG A;  4CD1 A;  4E0D A;  4WFB L;  1BO5 O;  4FPB A;  2PY5 A;  4DMN A;  1LV5 A;  1LWC A;  2QWP A;  1XNQ K;  4AM7 A;  1LWE A;  4N41 A;  4C23 A;  2GV9 A;  1BCO A;  5IWA K;  2IC3 A;  3LAK A;  2EWS A;  1ZBS A;  3THX A;  3PY8 A;  2XY7 A;  1I3A A;  1VRT A;  1C1C A;  5CHI A;  2HHU A;  3V4I A;  3R6M A;  4CEC A;  4K43 A;  4LSL A;  1YIT N;  3ITH A;  1VQM N;  1U48 A;  3HVR A;  3L3V A;  3AVK A;  3HTV A;  3O9T A;  1QQC A;  5JIC A;  4J2B A;  3H1V X;  3OYC A;  4Z4F A;  2OYQ A;  3OHR A;  3CC4 N;  1NLV A;  3FE1 A;  3IG1 A;  2GX9 A;  4BRI A;  2Q0R A;  4PKG A;  2OPP A;  1SZ2 A;  2IGI A;  2XY6 A;  4FK4 A;  3CIP A;  4XIU A;  2HF3 A;  4MO5 A;  1D4X A;  4BR9 A;  3AAQ A;  1X1P A;  3D2F A;  4QS9 A;  4CJ7 A;  4AIL C;  1YIJ N;  1L3S A;  1S1W A;  1W9H A;  4IDH A;  2EHG A;  2IAJ A;  2KTQ A;  5FPM A;  3NF6 A;  1QHA A;  4CJ4 A;  3WXK A;  1U6Z A;  4JEP A;  1RDU A;  4PQU A;  4JS4 A;  3OVN A;  1S3X A;  4JHD A;  4DR1 K;  3SYZ A;  1GLJ O;  1WSH A;  2A3Z A;  3A0I X;  1L3V A;  2O8F A;  4NCG A;  2P9I A;  3OA9 A;  4Q5V A;  1EKE A;  5GAE P;  2ZQB A;  5AQI A;  1C6V A;  4DTR A;  4BDZ A;  2GWK A;  2Z1I A;  3HOS A;  4DU4 A;  4JRP A;  4BRM A;  3G25 A;  3HL8 A;  3M8S A;  2OTJ N;  4HVJ A;  1M90 O;  3QB0 A;  3P31 A;  3CCM N;  3BF1 A;  2P9S A;  2CH5 A;  4JI3 K;  1NGI A;  3AVM A;  3P39 A;  5AZJ B;  3UKR B;  2W40 A;  3KVG A;  2W6L A;  1VHX A;  3WXM B;  3DXM A;  3H1Q A;  1IKX A;  3DXK A;  3ID6 A;  4BRA A;  3TSQ A;  4W5Q A;  1NJI O;  3THW A;  3CFO A;  3A5O C;  3HM9 A;  2IIR A;  4CJF A;  2DY4 A;  2P9P B;  4CGD A;  4CJ5 A;  4X64 K;  1VAZ A;  1TL3 A;  3WEE A;  3DRS A;  2PBD A;  1DGK N;  1G15 A;  4DKW A;  4I9L A;  1NG9 A;  3VA0 A;  5EY4 A;  5M1K A;  3QEP A;  1U2V A;  3VF4 A;  2QWR A;  1S1U A;  3C94 A;  5H1S Q;  2ZJR L;  1B9D A;  5ADX A;  1HX1 A;  2ASO A;  4KI4 A;  3M5R A;  3M8R A;  5KRT A;  2X6S A;  4CJL A;  2HND A;  2QWQ A;  3WQT A;  2HMI A;  3KWG A;  1HNI A;  5AQJ A;  4DTM A;  1SL2 A;  5HRR A;  3ASM A;  1ASW A;  4KTQ A;  4OPK A;  3AVN A;  3TU5 A;  3K5L A;  1N36 K;  2WON A;  4RW8 A;  3DMJ A;  1IKW A;  4A2B A;  1FKO A;  3MXI A;  4DWI A;  2E2Q A;  2CGK A;  4JNE A;  2IOC A;  4M45 A;  3RRG A;  1SL1 A;  1YTU A;  1S22 A;  4AHC A;  4FJ5 A;  1JXE A;  3F2K A;  4H0O A;  1C0T A;  4FWL A;  5AQF A;  1NGJ A;  4GY2 B;  2FLO A;  4YNQ A;  4MDA A;  2HNZ A;  2OPR A;  1T6C A;  4DB3 A;  4FJL A;  4BRD A;  3C95 A;  1WSJ A;  5M1N A;  3MK6 A;  3WT0 A;  3QEW A;  3CCE N;  4CE9 A;  4BDP A;  3SNN A;  4PY5 A;  1K8A O;  1Z25 A;  4FM2 A;  3VEO A;  4KBO A;  3R3L A;  3DYA A;  3OBY A;  4ID1 A;  1IKV A;  4CHZ A;  1C0F A;  4MDB A;  3LZI A;  4HHT A;  1RDA A;  1HNV A;  5D3G A;  1NMD A;  1TKZ A;  3JYT A;  1HKC A;  2P9K A;  5BRD A;  3V1O A;  3QIO A;  2JGU A;  4LY7 A;  4K8Z A;  1S5J A;  1UA0 A;  3VEY A;  4OKJ A;  2Q31 A;  3QIN A;  1WNS A;  1YT3 A;  1WN7 A;  4BRG A;  1TK0 A;  2HHX A;  3CI5 A;  4CI6 A;  4CGI A;  3J80 O;  2QXL A;  2Y1I A;  1E4F T;  1RDC A;  4PUO A;  5HRO A;  1QTM A;  3O1B A;  2ZJQ L;  4I7F A;  3V9S A;  4GV9 A;  1NNE A;  2P5O A;  1UAX A;  2ZE2 A;  3T69 A;  4YOY A;  3C7N B;  1RTD A;  1LOT B;  1BA1 A;  5J2P A;  1RBT A;  3LDQ A;  5GIN A;  2EX3 A;  4JRQ A;  1VQL N;  2ATQ A;  1X9J A;  4DV5 K;  2E6M A;  4CEO A;  3O4W A;  2YI1 A;  4EFH A;  3C6U A;  4CHP A;  1IKY A;  1SUQ A;  3K5M A;  3FZK A;  4NYF A;  3W3D A;  1LCU A;  4CZL A;  3KTQ A;  4DV2 K;  2F8T A;  5DM7 L;  1HUX A;  3ULE A;  4WCE L;  1YXQ A;  1U04 A;  2V52 B;  2P5G A;  4F4K A;  3VQQ A;  3O9U A;  3SUQ A;  1RT1 A;  3NFA A;  3MXM A;  3SQ1 A;  3J81 O;  4GMJ B;  3WXJ A;  3PX0 A;  1UOC A;  4H0T B;  1N33 K;  3VEW A;  5C12 A;  3WNF A;  4M41 A;  1BUP A;  4BQL A;  4CZF A;  1S6Q A;  4DU3 A;  3SUO A;  3EL2 A;  4W5R A;  4ZHR A;  4M3T A;  2RHK A;  3ZSX A;  2VG5 A;  4DU1 A;  3KHY A;  4OPJ A;  4DR7 K;  2OCE A;  2BGG A;  3HPG A;  1HLU A;  4L3Q A;  2UUC K;  4DTP A;  1OH8 A;  1RDD A;  3GOI A;  4AM6 A;  2UUB K;  2G8I A;  3I0R A;  2O8E B;  2X74 A;  3CYM A;  1S1T A;  4CJQ A;  1ZXO A;  1KQS M;  3ZLJ A;  4JI6 K;  4F8R A;  3V9U A;  5DMR A;  1WB9 A;  2VG6 A;  1W2B M;  4FLY A;  3J8A A;  4HUE A;  1Q81 O;  3NH0 A;  2VCP A;  1ITG A;  1IG9 A;  3AVC A;  3ZCM A;  4MQ3 A;  4DTX A;  4FJH A;  2QWL A;  4DR4 K;  5AQS A;  2HHH K;  1NKB A;  1XC3 A;  4IEI A;  3EN9 A;  4BE1 A;  2F7T A;  1OH5 A;  2ZGZ A;  4CEQ A;  3ZSZ A;  1Q86 O;  1RTJ A;  4F9O A;  2NNW A;  2KZM A;  1B92 A;  3K5N A;  1ZC6 A;  4LF9 K;  3SBG A;  5FPN A;  1VQ8 N;  3CCJ N;  4FOI A;  4WE1 A;  4Y1D A;  1IBM K;  1RNH A;  3ZT4 A;  5E84 A;  2A6A A;  3KKR A;  3L4Q A;  5CYM A;  1RIL A;  4BRE A;  2UXC K;  3CJ7 A;  3TI0 A;  1XMQ K;  3OJS A;  4ELT A;  4N76 A;  5M1P A;  2Z1J A;  3AO4 A;  3SZ2 A;  1VSM A;  2IVO A;  3LPT A;  1HJR A;  4FLV A;  3ULD A;  1C0M A;  4JV5 K;  4FLT A;  4IG3 A;  3HI0 A;  3MEE A;  4JI2 K;  4M3U A;  3AA5 X;  1KCF A;  4DLE A;  3PO5 A;  1NGH A;  3CCR N;  2UXB K;  4C1N K;  2QKK A;  1KC8 O;  1VSF A;  3VF6 A;  1SQK A;  5KPZ A;  1VQK N;  1NJZ A;  4MO4 A;  4W5N A;  1ZBL A;  4OPA A;  1C0U A;  2YHB A;  4BR0 A;  2ZD1 A;  3AV9 A;  4IXC A;  1NMN A;  5ADX H;  1X9W A;  4CZJ A;  4LF5 K;  4NCA A;  3GBT A;  3ZT3 A;  2YHY A;  5E26 A;  4DV0 K;  3HT3 A;  3CCQ N;  2YX6 A;  3CET A;  3G4S N;  1HJO A;  4FW1 A;  2YHA A;  3TAP A;  1CLQ A;  4LF8 K;  2CGL A;  1NJY A;  1IBL K;  3FZL A;  3AA4 A;  4LH4 A;  3S9H A;  4BE2 A;  5AQW A;  3KD5 E;  4CZM A;  2NZT A;  4MLE A;  2RKI A;  4CJP A;  4B9S A;  1LAV A;  4FVM A;  4B3T K;  4FLZ A;  4JI8 K;  1KXP A;  2D4W A;  3IMX A;  1HQE A;  4FWM A;  4BRL A;  5BPM A;  2NLX A;  1DTT A;  1KAZ A;  1NGE A;  4A59 A;  4YOX A;  4E3S A;  2A1S A;  2XO7 A;  4AH9 A;  4KTZ A;  1JLA A;  2IS3 A;  1RBU A;  1T05 A;  1Q82 O;  2D0B A;  4B1W B;  4DTO A;  1BI4 B;  3OYD A;  4FK0 A;  4YOW A;  3BUZ B;  2BTF A;  3VOV A;  3OYL A;  4R5P A;  4W5O A;  5M1F A;  4K8X A;  4J2A A;  1RCH A;  1S9E A;  3HSC A;  2FBT A;  3MCA B;  1U49 A;  1QSS A;  3QBW A;  2ZJP L;  4FZX C;  4GKK K;  5F2R A;  4KTW A;  4E89 A;  4NXN K;  5FPD A;  1TV6 A;  3ENB A;  3MWP A;  5JS2 A;  4JKB A;  3ZSV A;  4E1N A;  4BWM A;  4B1V A;  4H0X B;  3OS0 A;  1KVC A;  1W7A A;  1TKD A;  2PYL A;  4JI0 K;  3I8B A;  1EP4 A;  2O8B B;  4NB4 A;  3AO2 A;  4B3R K;  2O8C B;  3MX2 A;  1QQM A;  3D0P A;  3U8X A;  3NDK A;  4HUF A;  5MLC Q;  3TPQ A;  4Z0U A;  3QFP A;  4DR3 K;  2WC9 A;  1Y97 A;  1MU2 A;  4B1U B;  3DI6 A;  4DF8 A;  5LY3 A;  5JVH L;  1YJW N;  4AHV A;  3TTD A;  3NGY A;  3THX B;  3THY A;  3WNE A;  5FRM A;  4FW2 A;  4DS4 A;  3SJH A;  1NK9 A;  2YNF A;  4JK8 A;  2A1R A;  4G1Q A;  3CER A;  1KRP A;  4DV1 K;  2F8S A;  3VN5 A;  4NO7 A;  3ZSO A;  2RF2 A;  1YJN N;  3J7Z O;  5CZ1 A;  3NMU A;  5FRN A;  1VSD A;  2KQ2 A;  1ZBH A;  3IAY A;  4CVN E;  1C1B A;  3DWL A;  1VQP N;  4IO9 L;  2P9N A;  2CGJ A;  1NU0 A;  4KHQ A;  4K42 A;  4JD2 A;  4FWQ A;  2DFE A;  2WTU A;  4FWK A;  1S6P A;  3K57 A;  1QZ6 A;  3G0Z A;  4CJ3 A;  1IJJ A;  4KH6 A;  5CY4 A;  4WFA L;  1GLE G;  4JKC A;  3D2F B;  3EEQ A;  3HM8 A;  1CZA N;  2RN2 A;  2JLE A;  1YJ9 N;  3EYZ A;  5HL7 L;  1SL0 A;  5EX5 A;  2JWK A; 
#chains in the Genus database with same CATH homology
 4LFC K;  2E5L K;  2VQE K;  4KHP K;  1J5E K;  4LF4 K;  1N36 K;  1HR0 K;  4DV6 K;  1FJG K;  4OX9 K;  4DV2 K;  4JI1 K;  4JV5 K;  4DV7 K;  4LF7 K;  4CW7 B;  3JAM O;  4GKK K;  4JI2 K;  1N34 K;  4NXN K;  2ZM6 K;  1IBK K;  3J81 O;  4DR5 K;  2VQF K;  5LL6 Z;  1N33 K;  2F4V K;  4DUZ K;  4LFB K;  2UXB K;  4DR1 K;  1I94 K;  4JI0 K;  4JYA K;  4AQY K;  5BR8 K;  3T1H K;  4B3R K;  4DR2 K;  3T1Y K;  1XMO K;  4DR7 K;  1HNW K;  5LMN K;  2UXD K;  2UUC K;  1XNR K;  4K0K K;  4LF5 K;  1HNX K;  3J7A P;  4JI7 K;  4B3S K;  4DR3 K;  2UUB K;  4DV0 K;  4DV3 K;  4DUY K;  3OTO K;  4DR6 K;  4YHH K;  4JI3 K;  4LF8 K;  5AJ3 K;  4JI6 K;  1IBL K;  4NXM K;  4B3M K;  1XNQ K;  5FLX O;  4DV1 K;  5IWA K;  4B3T K;  4JI5 K;  4JI8 K;  4DR4 K;  2HHH K;  4CVN E;  4JI4 K;  4GKJ K;  4X66 K;  4LF6 K;  4X62 K;  4X64 K;  3J80 O;  2UU9 K;  5IT9 O;  4LF9 K;  2UUA K;  1N32 K;  1IBM K;  4X65 K;  5A2Q O;  4YY3 K;  1HNZ K;  4V19 S;  4LFA K;  2UXC K;  4DV4 K;  5LMU K;  4DV5 K;  1XMQ K;  3J7Y P; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...