1IBKK

Structure of the thermus thermophilus 30s ribosomal subunit in complex with the antibiotic paromomycin
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
119
structure length
119
Chain Sequence
KRQVASGRAYIHASYNNTIVTITDPDGNPITWSSGGVIGYKGSRKGTPYAAQLAALDAAKKAMAYGMQSVDVIVRGTGAGREQAIRALQASGLQVKSIVDDTPVPHNGCRPKKKFRKAS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S RIBOSOMAL RNA
publication title Recognition of cognate transfer RNA by the 30S ribosomal subunit.
pubmed doi rcsb
molecule tags Ribosome
total genus 29
structure length 119
sequence length 119
ec nomenclature
pdb deposition date 2001-03-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
K PF00411 Ribosomal_S11 Ribosomal protein S11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.80 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribosomal protein S11 1ibkK00
4B3TK 4V19S 1HNXK 4B3RK 4YHHK 3J7YP 4JI8K 1I94K 2HHHK 4K0KK 4LF6K 4KHPK 4GKKK 4JI2K 2UXBK 5AJ3K 4NXNK 1HNWK 3T1YK 4JI6K 3J80O 4DR7K 5A2QO 5LMUK 4NXMK 2F4VK 4X66K 4DV4K 4DR6K 4JYAK 1N36K 5LMNK 4JI0K 1IBLK 2UXCK 3J81O 4JI5K 2UU9K 4B3SK 1N34K 5LL6Z 5FLXO 1IBMK 4JI7K 4LF9K 4DV2K 4DV6K 3OTOK 1FJGK 4OX9K 2UXDK 3T1HK 4DR4K 4DR5K 4X64K 4DV1K 2VQFK 5IT9O 4DV0K 1N32K 4DR1K 4GKJK 1XNQK 2UUCK 4LFAK 1N33K 4DR3K 1XNRK 3J7AP 4AQYK 4X65K 4YY3K 4LF8K 4DV3K 4DR2K 5IWAK 1HR0K 2E5LK 2VQEK 2UUBK 1J5EK 4DUYK 4LF4K 1HNZK 4JI3K 1XMQK 4JV5K 4LF7K 3JAMO 4B3MK 4CVNE 2UUAK 4LFCK 1IBKK 4JI1K 4DV7K 4X62K 4LFBK 2ZM6K 4CW7B 4DUZK 1XMOK 4JI4K 5BR8K 4LF5K 4DV5K
chains in the Genus database with same CATH superfamily
4XEIA 2IAJA 1T7PA 3TANA 4B3RK 3ZSZA 3TAQA 4KV8A 3AVAA 5C2DA 3THYA 2NRTA 3QETA 3IAYA 4CHQA 3BUZB 2GBZA 2X6NA 2HNDA 3PO5A 4M7XA 5HRPA 3C65A 4ILGB 1BA1A 3BZKA 1X1PA 2HVIA 4CEZA 3A0IX 3MN7A 5A2QO 3NGZA 3LP2A 1BWFO 4MFBA 1JJ2M 1X9WA 3OYCA 1QHAA 4IBNA 3MAQA 4DQPA 2KLAA 3DOLA 4WF9L 3AVBA 4FM2A 2OTLN 4JI0K 4CHNA 1X9MA 1KXPA 2ZJRL 4XH5A 4CGIA 1KTQA 1N34K 3M6GA 4CZMA 4C8OA 4LF9K 3HPGA 3BDPA 1KLNA 2V51B 1U2VB 1VSMA 5AQPA 4YFUA 4B3OA 3S3OA 3FR0A 4GV6A 4DG1A 3KTQA 1ITGA 1UAXA 1TKZA 4DFPA 1DT9A 3TR8A 1CZBA 5M1NA 4QCLA 2YNFA 2W42A 1IG8A 1XNRK 1Y97A 4FZZA 2IC3A 4H0XB 4CD1A 4PWDA 2EHGA 1JXBA 3LAMA 3RMDA 4M3ZA 4YY3K 2FF3B 3WXMB 3NAEA 4E1MA 3AA2A 4DF8A 1YITN 1BI4B 4NO7A 5AQZA 1CLQA 3AO4A 1GLCG 1W0HA 2O4GA 4C23A 4M3WA 2VWKA 2QTDA 4FLTA 4YORA 3LL3A 2AA4A 3OYIA 3JXUA 3TAEA 1VQKN 1B92A 3QO9A 3O8MA 3SQ2A 5FROA 3THWA 2QI2A 3CPEA 1NOZA 5EY4A 3S3NA 4JRQA 3QB0A 4IG0A 1VQ6N 2HBKA 4JHDB 4DQIA 3PIPL 4DV5K 4FLVA 1HJOA 3AVLA 1JCFA 2ASMA 3V81A 4OJRA 2XY5A 1JKHA 4BDZA 4CIGA 3CG7A 1QQNA 4B1YB 4B1VA 4DWIA 2QWRA 4GNIA 4DQ8A 1NK4A 1VQMN 2V7ZA 1KC8O 3CIPA 4Y1DA 4M7YA 1WSHA 3HVTA 3P39A 3CERA 1IKXA 1EKEA 5LMUK 3MWPA 1T3VA 3H1VX 1NNEA 3G71N 2F7TA 4E7LA 1Q86O 4DR6K 3SLCA 3AVHA 1VSFA 4TSXA 4BRFA 1KSPA 2ZD1A 1GOCA 4F2RA 1CZ9A 2OPRA 4PKGA 2YI1A 1SL2A 2WONA 3SI6A 1NK0A 3AAPA 3TSPA 3OTOK 1L3TA 3VPZA 5CY4A 4BR2A 3D2FA 1GLBG 3WXJA 4FWPA 5GADP 3EE8A 2VGNA 3I0SA 2QWPA 2WOMA 3NH1A 1U4BA 5KTQA 1U6ZA 3MN5A 4CZEA 4PUOA 3OYFA 3EZ5A 5CZ1A 4KFBA 4FJHA 3OYGA 3SNNA 3TAGA 1LW0A 3H46O 1HKCA 1ATRA 1TVRA 4CZJA 1WOQA 3A5LC 1EWQA 1CXUA 1VSJA 5CYQA 1RDCA 3HO1A 4RW9A 3OA9A 4DS5A 2P9PB 2NRRA 2I5JA 1RT2A 2ITGA 4CJ4A 1TAQA 1RTIA 3PUFA 4DUYK 3U9DA 3SV4A 4BRLA 4IWVA 5AQLA 4RW8A 4CGFA 4KHNA 1VSHA 1KVAA 3KD1E 4F3TA 1NGBA 5LJVA 4NB4A 4FLXA 1GLJO 2PAVA 3MWTA 5J2MA 4B3TK 3EEQA 4JAXA 3C7NB 4V19S 1RCHA 1GOBA 4Z4FA 3G6EN 4K0KK 1BHLA 3CCUN 3RMCA 4K25A 4KHPK 3UIQA 5HL7L 4WE1A 3OS1A 2XHBA 4FJKA 3PX4A 2X78A 4NXNK 2E8AA 1RGIA 4GV3A 3VQBA 1P8ZA 2ZJPL 2W6LA 3CMEN 2ZWHA 4DQQA 3P38A 3AO3A 5C2FA 2WTUA 3A8YA 2H3GX 3AVCA 1V4SA 1M90O 3KK7A 1NK5A 2F8TA 4KB1A 3W3DA 5LL6Z 2W41A 3AVIA 1RDAA 3CCLN 4E1NA 3QNNA 2EWSA 1S3XA 3DMJA 3K9JA 3OVNA 3NH2A 2VQFK 3AVFA 3SZ2A 1QZ6A 3DLRA 1BG3A 5FDLA 3OYHA 3ZSOA 5AZIA 4DR3K 4B9TA 4BR5A 1HJRA 4E7IA 2P9KA 4H8KA 3THYB 4F2SA 3VEZA 3QEXA 1EO1A 1BGXT 1IKWA 1WSEA 3JS6A 3CFRA 1KRPA 4JLHA 4AHCA 4BE0A 4KPYA 1XC9A 4EHTA 4HUEA 3KWIA 1BL3A 2ZF5O 4BRHA 5CE3A 1M1KO 5HROA 1HKBA 2RPIA 2QKBA 5C25A 3R6MA 3ZEUA 2O4IA 3V9UA 4O5BA 2DFEA 2OA8A 3S41A 4XH1A 4IXCA 2G8VA 4EFHA 3NH0A 4JI4K 3L0QA 4CESA 3DLKA 1VSKA 3E66A 5GAGP 3LZJA 4KI6A 2VG6A 4C1NK 1DKGD 4A59A 2QKKA 2BTFA 5SWMA 3BP8A 4BE2A 1ZBFA 2FBXA 3QICA 1T8EA 3HVRA 3V9XA 4WCEL 5C10A 5MLCQ 3V9WA 3VQDA 4I9LA 1C1CA 3OS0A 4G1QA 4H0TB 1C1BA 2HMPA 3NMUA 4KAZA 2YKNA 1IV0A 3H6EA 3O4QA 3SPZA 3GOIA 3W0LA 3C94A 4GVMA 3UKUA 4AHTA 4B3SK 3TSUA 5M1KA 2R7YA 1QSYA 5FLXO 4G9ZA 4FLWA 4BACA 4BGAA 3K2PA 1OKJA 1SKRA 1RTJA 3THWB 1YUWA 3DLBA 3IS9A 4H5TA 2IVOA 3IRXA 4AHSA 1D9FA 3JSMA 4DV0K 5HRNA 1N32K 1TL1A 4H5WA 3AA4A 5JVGL 1YXQA 4DQSA 3WQTA 3TABA 1JLEA 5AQVA 2B4JA 3SPYA 2WUSA 5LY3A 5JLFA 4HCCA 2E1YA 3ENBA 2Q0UA 4W5RA 2RKIA 1WSFA 1NJYA 2ETJA 3WT0A 4YOWA 2HHTA 4FJNA 3C6UA 2HF3A 2Z1HA 1KAXA 5M1OA 2KTQA 2A1RA 2Z1IA 4QOZB 3KK3A 4HUFA 3G25A 3Q7BA 3SYZA 1ASWA 3ALYA 2HVHA 4CJFA 3KLGA 1XQSC 3O1BA 1KAYA 3EL2A 3VQEA 2DFFA 5BRFA 5C0YA 3KWGA 3RTVA 5B8HA 2QK9A 3HI0A 3D2FB 3CMAN 2E6LA 2GELA 1Z05A 3HYFA 4CJWA 1I94K 1RTHA 3CPWM 1BISA 4YOXA 2HHSA 4CBWA 1GLAG 2WFBA 4CJTA 4B9VA 1NKCA 4RCHA 4CBUA 1WAFA 4RW7A 3QNOA 5I42A 4JS5A 4ZTFA 1SKSA 5AQGA 1VSEA 4DF4A 3I33A 3D6RA 2HOEA 4KTZA 1QQCA 2NRXA 1HPZA 3IFRA 2KHOA 1ATSA 3BF3A 2KZMA 5FPNA 1BQNA 1NGCA 1FW6A 1S22A 1VQ4N 3A5MC 4BE1A 3OYAA 3AVNA 4KO0A 3MXIA 1NKBA 3U3YA 4JI7K 1FJGK 1WBDA 4HTUA 1Q82O 5T7BA 1B9FA 1G15A 1SQKA 3ZT1A 1XHZA 5BPLA 1XI1A 1BQMA 1SV5A 2GWJA 3ZCMA 1WLJA 1K8AO 1L5UA 3QESA 2BH1A 1KAZA 4Z4IA 3CXCM 2ITMA 3KKSA 1HMVA 2OANA 5IWAK 3HZ6A 1NOYA 3AY9A 5ADXA 1JCGA 1XUPO 4DS4A 2F96A 1J5OA 4DHYA 4CF8A 1WBBA 1S1XA 5HRSA 4DFKA 1JLAA 3FFIA 4A2AA 4CEEA 1Z25A 4W5OA 3VQAA 2P9NA 2CGJA 2YKMA 3HPOA 4BREA 4PKIA 4CEOA 3N4QA 1YF5L 4JKHA 4JI1K 2HB5A 2F9TA 4X62K 3SMPA 4CW7B 3OY9A 2FXUA 4IG3A 4LF5K 4FK0A 4FJ5A 1JLFA 1IJJA 3AGKA 3TAMA 3BZCA 3ZT4A 4KHSA 2A40A 4DU1A 2D0OA 3SBGA 1Q9YA 1ZXOA 3D7EO 2UYTA 1NLVA 3O4WA 3TPQA 3TTDA 5C12A 4FK4A 2O8DA 4JKFA 3WNGA 5AZIB 1HNWK 1C0GA 2HBMA 4BGBA 1NU0A 5J1EA 5CYMA 4WFBL 2DFHA 2P9KB 3CETA 3WXIA 3ZSXA 4E7KA 4LH5A 3MXJA 2IS3A 1EWRA 4C8MA 2DPNA 3K0SA 3EYZA 4RWTA 4C8LA 4CEQA 1NJXA 1TUYA 1TUUA 2BUPA 4BRAA 4I7FA 5CR4A 1RT5A 5AQHA 3M8QA 4IO8A 4N56A 1VRTA 4FPAA 4CHZA 3KLHA 3WNEA 3ZEUB 2D0CA 2E1ZA 2FBVA 3VEYA 2A3ZA 4DV2K 2D0BA 3N4PA 1LOTB 4BR0A 4EAHD 4ELVA 4DR4K 2V7YA 2OZMA 4FVUA 2DTUA 2HBLA 4C8NA 5E84A 4A5AA 4FK2A 4N5SA 1HUXA 4LD0A 2OPQA 3P83D 1QE1A 1GLEG 3DRPA 3DJCA 3HT3A 1QTMA 4N76A 1LWFA 1RNHA 1NJIO 4ZHRA 5AFUA 2VCPA 1MWMA 4B1UB 4I9QA 3KLEA 4RTFD 2ZJQL 1TAUA 4CJ3A 4DTRA 1ILYA 4CZLA 4CJEA 3NF6A 1E4GT 4YOTA 3ATUA 3K5LA 2GEMA 2NRVA 4FO0A 2HHXA 4KH4A 1VQ9N 1C0FA 1YTUA 4FJ8A 4IZ9A 3LM9A 4FWRA 1RBRA 3UKUB 4HTLA 3DRRA 4ILHA 3H45C 3B8AX 2KFZA 4GW6A 4KH6A 3DLGA 2BANA 3L2UA 2HHWA 3MEEA 5BN8A 1NMDA 3EZWA 3VENA 5BR8K 3QIPA 1VSDA 2HNYA 1K9MO 4CF9A 4B9QA 4KHWA 4FWNA 4CIFA 4YHHK 5DM7L 2O8FA 1NJWA 5EVZA 1KLMA 1A5XA 3I0RA 4BRIA 5AQNA 1SKWA 2CGKA 4B8CA 1BIUA 1RDDA 4MO5A 3OJSA 3NF8A 4H5VA 1VSLA 3AA5X 3VQ8A 4BDPA 2X6SA 4O44A 2F4VK 4FOEA 4DFJA 3DWLA 1HQEA 3SQ1A 3CJ1A 1SL0A 3PSFA 1HLUA 3QMLA 4IEIA 4LH4A 3MK6A 3TARA 5C15A 3J81O 2DY4A 2OCEA 4HCBA 2PZSA 4FLYA 2FSNA 1RT1A 4B8AB 2YHAA 4R5PA 4KTWA 5HOOA 4FYDA 1RFQA 3HM9A 4OX9K 4QS7A 3E9LA 4DR5K 2FSKA 3VOVA 3HPHA 4B9NA 1TKXA 2FF6A 2YJEA 1UWBA 4JRPA 1UA1A 4DTUA 3F9KA 5J2PA 2VG7A 1NGJA 1JXEA 4DLGA 1ZBIA 4E0DA 5JICA 3M8SA 3E9OA 3FZFA 4CK3A 1W2BM 1JLGA 3HL8A 4BC5A 5E26A 1NGDA 3K5NA 2VQEK 4OLBA 2NRHA 1W9HA 4FJMA 2P9SA 1HNVA 3QIOA 1HYVA 3LDOA 2HHUA 2A42A 3O9SA 4H4OA 4OPKA 1HNZK 1GLLO 4E7HA 3TU5A 1S6QA 4KH5A 3CJBA 5BPMA 1EETA 3CQXA 4ELTA 3P4IA 1S1UA 1KVCA 4BDYA 5KRTA 4KBOA 2YHYA 2P9UA 3SQ4A 3P31A 5AQTA 1NGAA 1IKVA 1WSJA 1LWEA 3WEEA 4IOXA 1QHTA 5KPTA 3LDQA 3CFPA 5J2QA 3BGRA 3VGKA 4KTQA 3FFKB 3V9SA 4H0PA 2VG5A 3T69A 1J6ZA 3LPTA 3V1RA 4FJXA 4QS8A 5AQKA 5AQSA 2KFNA 4O0IA 3LP1A 4FWQA 3J80O 2ZE2A 2W40A 1NMNA 4U67L 1OVYA 4DQRA 3WXKA 2BE2A 3T19A 4CF0A 1SUQA 3PO4A 3VN5A 2F8SA 3ZX3A 5M1FA 3FLCO 3RSEA 2CGLA 4CZFA 1TK5A 2Y1IA 4B1ZA 1VHXA 2P9NB 3F5TA 2IGIA 3IUCA 5DMRA 1NKEA 4I2PA 3SUNA 1SAZA 4ISFA 4WYBA 2IIRA 1ASUA 1J53A 3S3MA 1T05A 5F2RA 2PFUA 1JL2A 3LDPA 4CJLA 5AQIA 4EP5A 3HJFA 3ZSWA 3L4QA 1C0MA 5HLFA 1OH6A 4DCHA 1NGGA 1N33K 4OKJA 3RWUA 3ZX0A 3QEIA 3J7AP 5AQMA 1TK0A 2KKZA 4H0VB 3VA3A 1YVUA 2O8DB 3ULDA 4DR2K 1DLOA 1HQUA 3L2RA 4E7JA 3DI6A 3CYMA 3AVMA 4CZIA 4FL9A 5EOYA 1KD1O 4Z4GA 3H1QA 3KKRA 3CHWA 4BG9A 3U8XA 2P1JA 4LF4K 4CFCA 4B1XB 3JAMO 3F2KA 4CFAA 2LSNA 3ZSVA 1IBKK 2E4LA 4BRCA 3FZMA 4EZ9A 3SAFA 4JKBA 4AHRA 4JNEA 1XMOK 1BUPA 1YT3A 4GV9A 1F21A 4WQ4A 3MN6A 3QEPA 3CCVN 3J7ZO 2I7PA 1A5WA 1DEJA 2P9IA 1WNSA 3GG4A 4IFVA 3B6OA 4DLEA 4AM6A 1J9AA 3QEVA 3MN9A 1NGFA 1VQ5N 4J8FA 2IVNA 4O8KA 1QZ5A 5AR0A 4YOYA 2B5JA 2IVPA 3L3VA 4CJ7A 3T1YK 4FZYA 4O55A 1C0TA 3AO1A 3VERA 3CM6A 4FJIA 3PY8A 3VQ5A 1QS4A 4JKCA 4L3QA 3ULEA 2GTDA 1ZC6A 1NM1A 3VEOA 3P1GA 3IG1A 4ISGA 5LMNK 3PIOL 1RTDA 4CHYA 3MCAB 3CF5L 1IKYA 3NF7A 5AQFA 4PHTX 3RMAA 3PLAA 1QQMA 1YTAA 4CZHA 2QWNA 3OYMA 2OYQA 1N6QA 3KZBA 3A5NC 3CJCA 4ISEA 1VQON 1JLQA 3CQ8A 2XRIA 5C24A 5FRNA 2D5RA 4R79A 4PKHA 1BIZA 2A1SA 1S72N 4BVOA 5TKYA 5JVHL 4CJSA 2O8FB 4BQLA 4CZKA 4CHPA 1UOCA 3KJVA 1YJWN 5AZJA 3RVCA 1VQNN 1I3AA 2Z1JA 1V4TA 4BRPA 3BEXA 5JS1A 2HMIA 3AO5A 3VQ4A 4M3UA 3TWHA 2A5XA 3K5OA 4OPAA 3DYAA 1J5EK 1T6CA 2KW4A 4DTOA 3VEVA 4FWOA 4IJAA 1HX1A 3OYLA 3LWMA 3G4SN 3SUQA 2UUAK 2F9WA 1BOTO 2HF4A 4H4MA 4RW6A 4WQ5A 4M42A 3VMFB 4DV7K 3V1QA 3HM8A 3L8BA 1WSGA 3PSIA 4BRNA 4JD2B 4A57A 1BDGA 4FM1A 3QERA 2HNZA 4MO4A 4CJKA 4FWKA 5GIOA 3ID6A 1HNXK 4DTXA 4JI8K 2QW9A 2PYLA 2HHHK 3MEDA 3HOTA 2UXBK 2BGGA 1ESVA 2QXFA 1RT4A 3PV8A 2E2NA 5AQYA 4CJVA 4CJUA 1K8KA 1ZBSA 3C95A 3NF9A 4F9OA 4J2DA 5EX5A 2O8EA 4DSEA 4M3RA 1Z26A 1U49A 5KI6A 4BC3A 3Q7CA 4KHQA 2PBDA 4XH4A 3VF4A 3V4IA 3MMVA 2P9SB 4B08A 1Z6RA 2YHXA 4FJGA 1KQSM 4L8RB 4IDHA 3SUPA 1UA0A 5BREA 4M41A 4M45A 2UXDK 3ENHA 3SCXA 3NVKA 4H5RA 3K9KA 1KFDA 3L2VA 1NGHA 1K73O 1YI2N 2P9UB 1D4XA 3OW2M 4JEPA 3ZETA 4DSIA 3GBTA 1U47A 1EP4A 4KB0A 1OVQA 3WEEB 4JS4A 2YNIA 4BVPA 4U7BA 1LW2A 2G8HA 5I3UA 4DV3K 4K41A 3CC2N 3I56N 3QBWA 4IKFA 3OYKA 4W5QA 1EQYA 3AVGA 2FBTA 4J2BA 1NK9A 1C6VA 3VEWA 4M63C 4KREA 1JL1A 3THXA 2J4RA 4KRFA 4MDBA 3FGUA 1DGKN 1YJ9N 5KRSA 4B3MK 4CVNE 1X9SA 4J2EA 4FW2A 3RSEB 4J2AA 3AAQA 3V1OA 4BQZA 4CE9A 3O9TA 3AV9A 2YJFA 1O13A 2QEXN 3OBWA 3K59A 1R0AA 4AM7A 3O80A 4CHOA 3LWLA 4E89A 4GKKK 3M8PA 1I39A 3G10A 1WAJA 1IO2A 1HPMA 3QBXA 2ZGYA 3JYTA 3H3NO 4CK1A 3SJJA 2YHBA 4JYAK 4WQ4C 1S1TA 2JLEA 2VWBA 3P5JA 3WQUA 1ZBUA 2A6AA 2EX3A 4BRDA 5J2NA 3T7ZA 4BC2A 4FWMA 1QVGM 3CI5A 1JCEA 4PL7A 3HSCA 4CD3A 3CCEN 3TTFA 1TGOA 4N41A 1LAVA 1TK8A 2V52B 1NJZA 4O0JA 4PL8A 3T1HK 5HRRA 3QFPA 2G8WA 3L6QA 1TYQA 4OKKA 4Y0WA 3QEWA 3DLLL 3V9ZA 4DR1K 1QSSA 3OYJA 2P9IB 1N8RO 2UUCK 4LFAK 3T1AA 3O3HA 3D0PA 4OPJA 2XY6A 3FE1A 4I6MA 3AA3A 4JKGA 4FCYA 3MCPA 1HRHA 2QM1A 3O3FA 1E3MA 3D45A 1NK8A 3CM5A 3LANA 1HYZA 3U4LA 4OO1J 2QA4N 1EX4A 1H1VA 1NK7A 1R59O 4FSVA 3EKUA 3ULEB 2Y1JA 3H3OB 4FPBA 4CJ5A 3R3LA 1U45A 4JKAA 1J54A 3OYDA 1MDUB 2JWKA 3NGIA 1GLFO 4IO9L 3MX5A 2Q0RA 3R1XA 4YNQA 1QSLA 1T03A 3ISNC 1VQ7N 2NRZA 5KPZA 1L3SA 2G8IA 2YHWA 5GAEP 3LDNA 3B6PA 4AHVA 2FBYA 4ZTJA 4A5BA 4DKWA 3SQ0A 2OPSA 4JI2K 2Q36A 1RBTA 4HHTA 1D5AA 3E9PA 4Z4EA 1TKTA 5FPMA 4B9SA 1T44A 3J8AA 3MDQA 3KK2A 4WQ5C 3PX6A 3R9PA 5BPNA 3ATVA 5AZJB 3RRHA 3ZYYX 2NUBA 1WSIA 2HHQA 3DOKA 4DV4K 3U9ZA 4CF2A 2E20A 5H1SQ 3LDLA 1YVNA 1B9DA 1JLCA 3DXKA 3HXMA 2FLOA 3KD5E 2YNGA 4DU4A 1KFSA 1U48A 3UE5A 1TKDA 5AQUA 2PY5A 1N5YA 5BR9A 4WFAL 2FSJA 1MA9B 4CGGA 2Z1GA 4X64K 3NHGA 2XY7A 3OHRA 4FM0A 2XO7A 3QFUA 1NG9A 5ELZA 3HSTB 1BO5O 4DSJA 5CHIA 3ZX2A 2W6KA 3DLEA 4CZGA 4DTNA 4H0YB 4CJPA 3OJUA 4JD2A 1C0UA 3O9RA 3H08A 4ID1A 1K8KB 4PY5A 4Q0BA 3EE9A 4QS9A 4K42A 4LC9B 1K6YA 2YNHA 4Z4CA 4CFBA 4A2BA 3NVMA 2O8EB 4JN4A 3VETA 3OS2A 2GX9A 2E2QA 1MWKA 3L2WA 3VQPA 1BU6O 5KQ8A 5E41A 4FVMA 5BRDA 3CCSN 4LF7K 3O5BA 2Q97A 1S9GA 5EU7A 4K43A 4UQGA 1NBWA 3SUOA 4O5FA 3CCQN 5AQWA 4Z94A 1RDUA 3E1YA 4EZ6A 3BF1A 3AVJA 3LP3A 5LJWA 2E2OA 1FXXA 3IDHA 1D8YA 3ZSRA 3K58A 1NWKA 4LF6K 4GMJB 3AARA 3VF6A 3ZT3A 3OYBA 3ZETB 4IEEA 1BA0A 3SJHA 2HW3A 1REVA 3NCIA 2QWMA 3QDKA 3FZLA 3VGMA 4B9UA 4CEFA 1LCUA 4CF1A 3ID8A 3ASMA 2OTJN 3VTHA 3DXMA 4JKDA 3LP0A 2KQ2A 5DM6L 2AP1A 1BCMA 4GVEA 3THXB 4F4KA 2O8BA 1ASVA 4F3OA 4BRKA 1ZYQA 3KK1A 1S9EA 2JGUA 2GUPA 4CJRA 1RBSA 4M3YA 3TAPA 1HYSA 2CH6A 3ENOA 4HVJA 1RDWX 5ADXH 3HP9A 4KI4A 3O9UA 1FKPA 3D2EA 5AQOA 4W5TA 1YJNN 3KHYA 3ZT0A 5TKWA 2RHKA 4MLEA 4BG8A 2VYPA 3LDSA 2BDPA 4ICLA 4BWJA 1YHQN 4B9LA 1RT7A 4BWMA 3C0BA 3MECA 4HUGA 3LALA 4JK7A 1ZBHA 3O9QA 4FJLA 4JKEA 5D3GA 4KHYA 1RBUA 4A61A 3L3UA 3U3GA 2P51A 1HR0K 2RN2A 3NE6A 2CH5A 3I55N 2NNWA 4O4GA 3VQQA 4FLZA 1GOAA 3MEGA 1VSIA 3A2FA 4YOUA 4FJ7A 5DK5A 2O8CA 1XC3A 4PA1A 1SL1A 4PQUA 3WUHA 4JI3K 4JV5K 4AF1A 4E1JA 4WFNL 3SV3A 4DTJA 4EHUA 1C1AA 1CZAN 5HBMA 1KCFA 3HP6A 1E4FT 4CERA 3HOSA 3VQ6A 3C6HA 1CXQA 4DUZK 4CEBA 2Q3SA 4Z4HA 4AHUA 1P90A 3HRGA 4EIAA 2WBNA 4FWSA 3J7YP 1RT6A 3IMXA 4DU3A 4CEAA 1TYQB 2X74A 3UKRA 4RW4A 2D1KA 4MDAA 2P9LB 5CZ2A 3NDKA 4FWLA 4IOCL 2Q31A 2I7NA 5SZTA 1IH7A 3S9HA 4CGJA 1BCOA 1RDBA 5FPEA 4I6MB 5JMVA 1T6DA 4JKGB 3PX0A 3HBTA 5M1PA 3SAHA 4X66K 1SZ2A 4E3SA 4Q5VA 3DM2A 2ATQA 4DMNA 4N47A 3ZLJA 1VK0A 3M5RA 2UXCK 5EXWA 4GY2B 1L3VA 4BRQA 5F0XA 4F8RA 4M3XA 5HP1A 2UU9K 3LAKA 4FLUA 2IOCA 4FXDA 1NGEA 4CI6A 4DV6K 3TSQA 4CECA 1W97L 2D4WA 4H03B 1VAZA 4ILJA 4M3TA 2QWLA 5AFUH 2RE2A 4OGEA 2QWQA 2QXLA 3C6TA 4IFEA 2YCHA 4DSFA 1G99A 4NCBA 3HTVA 4IOAL 5I9EB 4DSKA 4OVLA 2Q2RA 3KVGA 1XNQK 4GKJK 4NLCA 1XHXA 3SBTA 4YDUA 1LWCA 2KZZA 2ASOA 3FZHA 2FC0A 4BR4A 4LF8K 1O1WA 1VQ8N 3CJ7A 3GL1A 4NYFA 2G8UA 4IFYA 5KGXA 1S6PA 5JLHA 3V6DA 5GINA 4RG8A 4BROA 3VF2A 3CC7N 3M1FA 4FJJA 1MU2A 4BY9C 3TAFA 3CCMN 1XMQK 3AO2A 3DXKB 4DTMA 5GAHP 2OPPA 1U2VA 1GLDG 2ZQBA 3VQ7A 4BR9A 5BN9A 4O8UA 4JK8A 4CK2A 2G8KA 1SS6A 4C8KA 1FKOA 4Y1CA 2A41A 2NLXA 3F73A 3OBYA 1D9DA 3T3FA 2HHVA 3AGRA 1X3NA 4BR7A 1S1WA 4DSLA 4H0OA 5AJ3K 5AQJA 3VGLA 3CJ9A 1Q8IA 3WNFA 1WUAA 1BI4A 3KIOA 3GDQA 1YIJN 1VRUA 1RILA 3BY5A 4FJ9A 1OH8A 4DR7K 4MLHA 4NXMK 2PYJA 3G0ZA 2GWKA 2JWLA 2P5OA 1XWLA 4YOVA 1N36K 3VTIA 3RR8A 3TTCA 1DTQA 3FZKA 3R8EA 2OZSA 1IBLK 1YAGA 1NGIA 3RR7A 5JS2A 3MX2A 3GE1A 4OGCA 4FOIA 2VGMA 4JHDA 4CIEA 1VQLN 3VESA 5KPRA 4IJNA 3VQCA 1WB9A 1IG9A 4I2QA 3ZSQA 4CFDA 2VWJA 2ASPA 3DAWA 4QAGA 5KQDA 4DV1K 1L3UA 4OPHA 3MXMA 5IT9O 3QLHA 4H5NA 2NZTA 3O6WA 3SK3A 1WN7A 1ATNA 3UB5A 3NFAA 2RF2A 4LY7A 3IKMA 2E2PA 4AQYK 4X65K 3O1WA 1EXQA 3VQ9A 3THVA 3CFOA 3HK2A 2ZGZA 1A5VA 1OH5A 2P5GA 1S5JA 2E5LK 3O4NA 4LSLA 3RMBA 1QVFM 4K8ZA 3EY1A 3O08A 1RT3A 1TV6A 4JK9A 4C1NI 2QWOA 3DXMB 4BRMA 4CCHA 2HBJA 4DTPA 4OLAA 4NYNA 3I8DA 4LFCK 1S1VA 1Q9XA 3WNHA 3ZT2A 2O8BB 2HSTA 5AQRA 5FRMA 3QINA 4NCGA 1RBVA 4E19A 3K57A 4DTSA 3RRGA 5F1XA 1X9JA 4EP4A 1TL3A 3L2QA 3F9MA 3TI0A 3DRSA 3CCRN 3M8RA 3D2EB 4FW1A 4B1WB 4CJQA 3A5OC 4OKEA 3KLIA 4K8XA 2G8FA 3EN9A 4JI6K 2P9PA 4ID5A 3LM2A 2NRWA 2D0AA 5AQXA 1LAWA 5BRHA 3NBPA 4B9MA 4DFMA 3VA0A 2Q1NA 3EO3A 3M3ZA 3CC4N 3E01A 3O3GA 1NK6A 4JI5K 2GUIA 4AILC 1JLBA 5GIPA 2O8CB 2B6AA 4HWIA 1IBMK 5FPDA 4UY8O 4LSNA 3AVKA 4NCAA 3C7NA 2WC9A 3KLFA 5C42A 1HKGA 2E6MA 4Z0UA 4CGHA 1FK9A 5AQQA 3K5MA 4CBXA 1VQPN 1DTTA 2GV9A 3OYEA 4KHUA 1QQOA 4DB3A 2AJQA 3LZIA 4W5NA 3EKSA 3SMSA 4ELUA 2D0PA 1Q18A 2IDOA 3UKRB 2YV0X 2YX6A 4AH9A 1U04A 3L4IA 4CGDA 3DLHA 3U6FA 2E88A 1Q7YO 2UUBK 4NLBA 3ITHA 3I8BA 3SAGA 1Q81O 3C6AA 3CD6N 1Y64A 1X3MA 2P9LA 1ZBLA 3WXLA 3NGYA 4A62A 3OYNA 4BRGA 3CCJN 3LPUA 4MQ3A 1KVBA 3CJAA 3CQYA 5M1QA 3VEXA 1W7AA 4BC4A 4YDUC 1HNIA 4IDKA 5KGWA 4XIUA 1LV5A 4CEDA 4LFBK 2ZM6K 5K14A 4FZXC 3ZSYA 2XY8A 4KKOA 1OH7A
chains in the Genus database with same CATH topology
4B3TK 4V19S 1HNXK 4B3RK 4YHHK 3J7YP 4JI8K 1I94K 2HHHK 4K0KK 4LF6K 4KHPK 4GKKK 4JI2K 2UXBK 5AJ3K 4NXNK 1HNWK 3T1YK 4JI6K 3J80O 4DR7K 5A2QO 5LMUK 4NXMK 2F4VK 4X66K 4DV4K 4DR6K 4JYAK 1N36K 5LMNK 4JI0K 1IBLK 2UXCK 3J81O 4JI5K 2UU9K 4B3SK 1N34K 5LL6Z 5FLXO 1IBMK 4JI7K 4LF9K 4DV2K 4DV6K 3OTOK 1FJGK 4OX9K 2UXDK 3T1HK 4DR4K 4DR5K 4X64K 4DV1K 2VQFK 5IT9O 4DV0K 1N32K 4DR1K 4GKJK 1XNQK 2UUCK 4LFAK 1N33K 4DR3K 1XNRK 3J7AP 4AQYK 4X65K 4YY3K 4LF8K 4DV3K 4DR2K 5IWAK 1HR0K 2E5LK 2VQEK 2UUBK 1J5EK 4DUYK 4LF4K 1HNZK 4JI3K 1XMQK 4JV5K 4LF7K 3JAMO 4B3MK 4CVNE 2UUAK 4LFCK 1IBKK 4JI1K 4DV7K 4X62K 4LFBK 2ZM6K 4CW7B 4DUZK 1XMOK 4JI4K 5BR8K 4LF5K 4DV5K
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4B3T K;  4V19 S;  1HNX K;  4B3R K;  4YHH K;  3J7Y P;  4JI8 K;  1I94 K;  2HHH K;  4K0K K;  4LF6 K;  4KHP K;  4GKK K;  4JI2 K;  2UXB K;  5AJ3 K;  4NXN K;  1HNW K;  3T1Y K;  4JI6 K;  3J80 O;  4DR7 K;  5A2Q O;  5LMU K;  4NXM K;  2F4V K;  4X66 K;  4DV4 K;  4DR6 K;  4JYA K;  1N36 K;  5LMN K;  4JI0 K;  1IBL K;  2UXC K;  3J81 O;  4JI5 K;  2UU9 K;  4B3S K;  1N34 K;  5LL6 Z;  5FLX O;  1IBM K;  4JI7 K;  4LF9 K;  4DV2 K;  4DV6 K;  3OTO K;  1FJG K;  4OX9 K;  2UXD K;  3T1H K;  4DR4 K;  4DR5 K;  4X64 K;  4DV1 K;  2VQF K;  5IT9 O;  4DV0 K;  1N32 K;  4DR1 K;  4GKJ K;  1XNQ K;  2UUC K;  4LFA K;  1N33 K;  4DR3 K;  1XNR K;  3J7A P;  4AQY K;  4X65 K;  4YY3 K;  4LF8 K;  4DV3 K;  4DR2 K;  5IWA K;  1HR0 K;  2E5L K;  2VQE K;  2UUB K;  1J5E K;  4DUY K;  4LF4 K;  1HNZ K;  4JI3 K;  1XMQ K;  4JV5 K;  4LF7 K;  3JAM O;  4B3M K;  4CVN E;  2UUA K;  4LFC K;  1IBK K;  4JI1 K;  4DV7 K;  4X62 K;  4LFB K;  2ZM6 K;  4CW7 B;  4DUZ K;  1XMO K;  4JI4 K;  5BR8 K;  4LF5 K;  4DV5 K; 
#chains in the Genus database with same CATH topology
 4XEI A;  2IAJ A;  1T7P A;  3TAN A;  4B3R K;  3ZSZ A;  3TAQ A;  4KV8 A;  3AVA A;  5C2D A;  3THY A;  2NRT A;  3QET A;  3IAY A;  4CHQ A;  3BUZ B;  2GBZ A;  2X6N A;  2HND A;  3PO5 A;  4M7X A;  5HRP A;  3C65 A;  4ILG B;  1BA1 A;  3BZK A;  1X1P A;  2HVI A;  4CEZ A;  3A0I X;  3MN7 A;  5A2Q O;  3NGZ A;  3LP2 A;  1BWF O;  4MFB A;  1JJ2 M;  1X9W A;  3OYC A;  1QHA A;  4IBN A;  3MAQ A;  4DQP A;  2KLA A;  3DOL A;  4WF9 L;  3AVB A;  4FM2 A;  2OTL N;  4JI0 K;  4CHN A;  1X9M A;  1KXP A;  2ZJR L;  4XH5 A;  4CGI A;  1KTQ A;  1N34 K;  3M6G A;  4CZM A;  4C8O A;  4LF9 K;  3HPG A;  3BDP A;  1KLN A;  2V51 B;  1U2V B;  1VSM A;  5AQP A;  4YFU A;  4B3O A;  3S3O A;  3FR0 A;  4GV6 A;  4DG1 A;  3KTQ A;  1ITG A;  1UAX A;  1TKZ A;  4DFP A;  1DT9 A;  3TR8 A;  1CZB A;  5M1N A;  4QCL A;  2YNF A;  2W42 A;  1IG8 A;  1XNR K;  1Y97 A;  4FZZ A;  2IC3 A;  4H0X B;  4CD1 A;  4PWD A;  2EHG A;  1JXB A;  3LAM A;  3RMD A;  4M3Z A;  4YY3 K;  2FF3 B;  3WXM B;  3NAE A;  4E1M A;  3AA2 A;  4DF8 A;  1YIT N;  1BI4 B;  4NO7 A;  5AQZ A;  1CLQ A;  3AO4 A;  1GLC G;  1W0H A;  2O4G A;  4C23 A;  4M3W A;  2VWK A;  2QTD A;  4FLT A;  4YOR A;  3LL3 A;  2AA4 A;  3OYI A;  3JXU A;  3TAE A;  1VQK N;  1B92 A;  3QO9 A;  3O8M A;  3SQ2 A;  5FRO A;  3THW A;  2QI2 A;  3CPE A;  1NOZ A;  5EY4 A;  3S3N A;  4JRQ A;  3QB0 A;  4IG0 A;  1VQ6 N;  2HBK A;  4JHD B;  4DQI A;  3PIP L;  4DV5 K;  4FLV A;  1HJO A;  3AVL A;  1JCF A;  2ASM A;  3V81 A;  4OJR A;  2XY5 A;  1JKH A;  4BDZ A;  4CIG A;  3CG7 A;  1QQN A;  4B1Y B;  4B1V A;  4DWI A;  2QWR A;  4GNI A;  4DQ8 A;  1NK4 A;  1VQM N;  2V7Z A;  1KC8 O;  3CIP A;  4Y1D A;  4M7Y A;  1WSH A;  3HVT A;  3P39 A;  3CER A;  1IKX A;  1EKE A;  5LMU K;  3MWP A;  1T3V A;  3H1V X;  1NNE A;  3G71 N;  2F7T A;  4E7L A;  1Q86 O;  4DR6 K;  3SLC A;  3AVH A;  1VSF A;  4TSX A;  4BRF A;  1KSP A;  2ZD1 A;  1GOC A;  4F2R A;  1CZ9 A;  2OPR A;  4PKG A;  2YI1 A;  1SL2 A;  2WON A;  3SI6 A;  1NK0 A;  3AAP A;  3TSP A;  3OTO K;  1L3T A;  3VPZ A;  5CY4 A;  4BR2 A;  3D2F A;  1GLB G;  3WXJ A;  4FWP A;  5GAD P;  3EE8 A;  2VGN A;  3I0S A;  2QWP A;  2WOM A;  3NH1 A;  1U4B A;  5KTQ A;  1U6Z A;  3MN5 A;  4CZE A;  4PUO A;  3OYF A;  3EZ5 A;  5CZ1 A;  4KFB A;  4FJH A;  3OYG A;  3SNN A;  3TAG A;  1LW0 A;  3H46 O;  1HKC A;  1ATR A;  1TVR A;  4CZJ A;  1WOQ A;  3A5L C;  1EWQ A;  1CXU A;  1VSJ A;  5CYQ A;  1RDC A;  3HO1 A;  4RW9 A;  3OA9 A;  4DS5 A;  2P9P B;  2NRR A;  2I5J A;  1RT2 A;  2ITG A;  4CJ4 A;  1TAQ A;  1RTI A;  3PUF A;  4DUY K;  3U9D A;  3SV4 A;  4BRL A;  4IWV A;  5AQL A;  4RW8 A;  4CGF A;  4KHN A;  1VSH A;  1KVA A;  3KD1 E;  4F3T A;  1NGB A;  5LJV A;  4NB4 A;  4FLX A;  1GLJ O;  2PAV A;  3MWT A;  5J2M A;  4B3T K;  3EEQ A;  4JAX A;  3C7N B;  4V19 S;  1RCH A;  1GOB A;  4Z4F A;  3G6E N;  4K0K K;  1BHL A;  3CCU N;  3RMC A;  4K25 A;  4KHP K;  3UIQ A;  5HL7 L;  4WE1 A;  3OS1 A;  2XHB A;  4FJK A;  3PX4 A;  2X78 A;  4NXN K;  2E8A A;  1RGI A;  4GV3 A;  3VQB A;  1P8Z A;  2ZJP L;  2W6L A;  3CME N;  2ZWH A;  4DQQ A;  3P38 A;  3AO3 A;  5C2F A;  2WTU A;  3A8Y A;  2H3G X;  3AVC A;  1V4S A;  1M90 O;  3KK7 A;  1NK5 A;  2F8T A;  4KB1 A;  3W3D A;  5LL6 Z;  2W41 A;  3AVI A;  1RDA A;  3CCL N;  4E1N A;  3QNN A;  2EWS A;  1S3X A;  3DMJ A;  3K9J A;  3OVN A;  3NH2 A;  2VQF K;  3AVF A;  3SZ2 A;  1QZ6 A;  3DLR A;  1BG3 A;  5FDL A;  3OYH A;  3ZSO A;  5AZI A;  4DR3 K;  4B9T A;  4BR5 A;  1HJR A;  4E7I A;  2P9K A;  4H8K A;  3THY B;  4F2S A;  3VEZ A;  3QEX A;  1EO1 A;  1BGX T;  1IKW A;  1WSE A;  3JS6 A;  3CFR A;  1KRP A;  4JLH A;  4AHC A;  4BE0 A;  4KPY A;  1XC9 A;  4EHT A;  4HUE A;  3KWI A;  1BL3 A;  2ZF5 O;  4BRH A;  5CE3 A;  1M1K O;  5HRO A;  1HKB A;  2RPI A;  2QKB A;  5C25 A;  3R6M A;  3ZEU A;  2O4I A;  3V9U A;  4O5B A;  2DFE A;  2OA8 A;  3S41 A;  4XH1 A;  4IXC A;  2G8V A;  4EFH A;  3NH0 A;  4JI4 K;  3L0Q A;  4CES A;  3DLK A;  1VSK A;  3E66 A;  5GAG P;  3LZJ A;  4KI6 A;  2VG6 A;  4C1N K;  1DKG D;  4A59 A;  2QKK A;  2BTF A;  5SWM A;  3BP8 A;  4BE2 A;  1ZBF A;  2FBX A;  3QIC A;  1T8E A;  3HVR A;  3V9X A;  4WCE L;  5C10 A;  5MLC Q;  3V9W A;  3VQD A;  4I9L A;  1C1C A;  3OS0 A;  4G1Q A;  4H0T B;  1C1B A;  2HMP A;  3NMU A;  4KAZ A;  2YKN A;  1IV0 A;  3H6E A;  3O4Q A;  3SPZ A;  3GOI A;  3W0L A;  3C94 A;  4GVM A;  3UKU A;  4AHT A;  4B3S K;  3TSU A;  5M1K A;  2R7Y A;  1QSY A;  5FLX O;  4G9Z A;  4FLW A;  4BAC A;  4BGA A;  3K2P A;  1OKJ A;  1SKR A;  1RTJ A;  3THW B;  1YUW A;  3DLB A;  3IS9 A;  4H5T A;  2IVO A;  3IRX A;  4AHS A;  1D9F A;  3JSM A;  4DV0 K;  5HRN A;  1N32 K;  1TL1 A;  4H5W A;  3AA4 A;  5JVG L;  1YXQ A;  4DQS A;  3WQT A;  3TAB A;  1JLE A;  5AQV A;  2B4J A;  3SPY A;  2WUS A;  5LY3 A;  5JLF A;  4HCC A;  2E1Y A;  3ENB A;  2Q0U A;  4W5R A;  2RKI A;  1WSF A;  1NJY A;  2ETJ A;  3WT0 A;  4YOW A;  2HHT A;  4FJN A;  3C6U A;  2HF3 A;  2Z1H A;  1KAX A;  5M1O A;  2KTQ A;  2A1R A;  2Z1I A;  4QOZ B;  3KK3 A;  4HUF A;  3G25 A;  3Q7B A;  3SYZ A;  1ASW A;  3ALY A;  2HVH A;  4CJF A;  3KLG A;  1XQS C;  3O1B A;  1KAY A;  3EL2 A;  3VQE A;  2DFF A;  5BRF A;  5C0Y A;  3KWG A;  3RTV A;  5B8H A;  2QK9 A;  3HI0 A;  3D2F B;  3CMA N;  2E6L A;  2GEL A;  1Z05 A;  3HYF A;  4CJW A;  1I94 K;  1RTH A;  3CPW M;  1BIS A;  4YOX A;  2HHS A;  4CBW A;  1GLA G;  2WFB A;  4CJT A;  4B9V A;  1NKC A;  4RCH A;  4CBU A;  1WAF A;  4RW7 A;  3QNO A;  5I42 A;  4JS5 A;  4ZTF A;  1SKS A;  5AQG A;  1VSE A;  4DF4 A;  3I33 A;  3D6R A;  2HOE A;  4KTZ A;  1QQC A;  2NRX A;  1HPZ A;  3IFR A;  2KHO A;  1ATS A;  3BF3 A;  2KZM A;  5FPN A;  1BQN A;  1NGC A;  1FW6 A;  1S22 A;  1VQ4 N;  3A5M C;  4BE1 A;  3OYA A;  3AVN A;  4KO0 A;  3MXI A;  1NKB A;  3U3Y A;  4JI7 K;  1FJG K;  1WBD A;  4HTU A;  1Q82 O;  5T7B A;  1B9F A;  1G15 A;  1SQK A;  3ZT1 A;  1XHZ A;  5BPL A;  1XI1 A;  1BQM A;  1SV5 A;  2GWJ A;  3ZCM A;  1WLJ A;  1K8A O;  1L5U A;  3QES A;  2BH1 A;  1KAZ A;  4Z4I A;  3CXC M;  2ITM A;  3KKS A;  1HMV A;  2OAN A;  5IWA K;  3HZ6 A;  1NOY A;  3AY9 A;  5ADX A;  1JCG A;  1XUP O;  4DS4 A;  2F96 A;  1J5O A;  4DHY A;  4CF8 A;  1WBB A;  1S1X A;  5HRS A;  4DFK A;  1JLA A;  3FFI A;  4A2A A;  4CEE A;  1Z25 A;  4W5O A;  3VQA A;  2P9N A;  2CGJ A;  2YKM A;  3HPO A;  4BRE A;  4PKI A;  4CEO A;  3N4Q A;  1YF5 L;  4JKH A;  4JI1 K;  2HB5 A;  2F9T A;  4X62 K;  3SMP A;  4CW7 B;  3OY9 A;  2FXU A;  4IG3 A;  4LF5 K;  4FK0 A;  4FJ5 A;  1JLF A;  1IJJ A;  3AGK A;  3TAM A;  3BZC A;  3ZT4 A;  4KHS A;  2A40 A;  4DU1 A;  2D0O A;  3SBG A;  1Q9Y A;  1ZXO A;  3D7E O;  2UYT A;  1NLV A;  3O4W A;  3TPQ A;  3TTD A;  5C12 A;  4FK4 A;  2O8D A;  4JKF A;  3WNG A;  5AZI B;  1HNW K;  1C0G A;  2HBM A;  4BGB A;  1NU0 A;  5J1E A;  5CYM A;  4WFB L;  2DFH A;  2P9K B;  3CET A;  3WXI A;  3ZSX A;  4E7K A;  4LH5 A;  3MXJ A;  2IS3 A;  1EWR A;  4C8M A;  2DPN A;  3K0S A;  3EYZ A;  4RWT A;  4C8L A;  4CEQ A;  1NJX A;  1TUY A;  1TUU A;  2BUP A;  4BRA A;  4I7F A;  5CR4 A;  1RT5 A;  5AQH A;  3M8Q A;  4IO8 A;  4N56 A;  1VRT A;  4FPA A;  4CHZ A;  3KLH A;  3WNE A;  3ZEU B;  2D0C A;  2E1Z A;  2FBV A;  3VEY A;  2A3Z A;  4DV2 K;  2D0B A;  3N4P A;  1LOT B;  4BR0 A;  4EAH D;  4ELV A;  4DR4 K;  2V7Y A;  2OZM A;  4FVU A;  2DTU A;  2HBL A;  4C8N A;  5E84 A;  4A5A A;  4FK2 A;  4N5S A;  1HUX A;  4LD0 A;  2OPQ A;  3P83 D;  1QE1 A;  1GLE G;  3DRP A;  3DJC A;  3HT3 A;  1QTM A;  4N76 A;  1LWF A;  1RNH A;  1NJI O;  4ZHR A;  5AFU A;  2VCP A;  1MWM A;  4B1U B;  4I9Q A;  3KLE A;  4RTF D;  2ZJQ L;  1TAU A;  4CJ3 A;  4DTR A;  1ILY A;  4CZL A;  4CJE A;  3NF6 A;  1E4G T;  4YOT A;  3ATU A;  3K5L A;  2GEM A;  2NRV A;  4FO0 A;  2HHX A;  4KH4 A;  1VQ9 N;  1C0F A;  1YTU A;  4FJ8 A;  4IZ9 A;  3LM9 A;  4FWR A;  1RBR A;  3UKU B;  4HTL A;  3DRR A;  4ILH A;  3H45 C;  3B8A X;  2KFZ A;  4GW6 A;  4KH6 A;  3DLG A;  2BAN A;  3L2U A;  2HHW A;  3MEE A;  5BN8 A;  1NMD A;  3EZW A;  3VEN A;  5BR8 K;  3QIP A;  1VSD A;  2HNY A;  1K9M O;  4CF9 A;  4B9Q A;  4KHW A;  4FWN A;  4CIF A;  4YHH K;  5DM7 L;  2O8F A;  1NJW A;  5EVZ A;  1KLM A;  1A5X A;  3I0R A;  4BRI A;  5AQN A;  1SKW A;  2CGK A;  4B8C A;  1BIU A;  1RDD A;  4MO5 A;  3OJS A;  3NF8 A;  4H5V A;  1VSL A;  3AA5 X;  3VQ8 A;  4BDP A;  2X6S A;  4O44 A;  2F4V K;  4FOE A;  4DFJ A;  3DWL A;  1HQE A;  3SQ1 A;  3CJ1 A;  1SL0 A;  3PSF A;  1HLU A;  3QML A;  4IEI A;  4LH4 A;  3MK6 A;  3TAR A;  5C15 A;  3J81 O;  2DY4 A;  2OCE A;  4HCB A;  2PZS A;  4FLY A;  2FSN A;  1RT1 A;  4B8A B;  2YHA A;  4R5P A;  4KTW A;  5HOO A;  4FYD A;  1RFQ A;  3HM9 A;  4OX9 K;  4QS7 A;  3E9L A;  4DR5 K;  2FSK A;  3VOV A;  3HPH A;  4B9N A;  1TKX A;  2FF6 A;  2YJE A;  1UWB A;  4JRP A;  1UA1 A;  4DTU A;  3F9K A;  5J2P A;  2VG7 A;  1NGJ A;  1JXE A;  4DLG A;  1ZBI A;  4E0D A;  5JIC A;  3M8S A;  3E9O A;  3FZF A;  4CK3 A;  1W2B M;  1JLG A;  3HL8 A;  4BC5 A;  5E26 A;  1NGD A;  3K5N A;  2VQE K;  4OLB A;  2NRH A;  1W9H A;  4FJM A;  2P9S A;  1HNV A;  3QIO A;  1HYV A;  3LDO A;  2HHU A;  2A42 A;  3O9S A;  4H4O A;  4OPK A;  1HNZ K;  1GLL O;  4E7H A;  3TU5 A;  1S6Q A;  4KH5 A;  3CJB A;  5BPM A;  1EET A;  3CQX A;  4ELT A;  3P4I A;  1S1U A;  1KVC A;  4BDY A;  5KRT A;  4KBO A;  2YHY A;  2P9U A;  3SQ4 A;  3P31 A;  5AQT A;  1NGA A;  1IKV A;  1WSJ A;  1LWE A;  3WEE A;  4IOX A;  1QHT A;  5KPT A;  3LDQ A;  3CFP A;  5J2Q A;  3BGR A;  3VGK A;  4KTQ A;  3FFK B;  3V9S A;  4H0P A;  2VG5 A;  3T69 A;  1J6Z A;  3LPT A;  3V1R A;  4FJX A;  4QS8 A;  5AQK A;  5AQS A;  2KFN A;  4O0I A;  3LP1 A;  4FWQ A;  3J80 O;  2ZE2 A;  2W40 A;  1NMN A;  4U67 L;  1OVY A;  4DQR A;  3WXK A;  2BE2 A;  3T19 A;  4CF0 A;  1SUQ A;  3PO4 A;  3VN5 A;  2F8S A;  3ZX3 A;  5M1F A;  3FLC O;  3RSE A;  2CGL A;  4CZF A;  1TK5 A;  2Y1I A;  4B1Z A;  1VHX A;  2P9N B;  3F5T A;  2IGI A;  3IUC A;  5DMR A;  1NKE A;  4I2P A;  3SUN A;  1SAZ A;  4ISF A;  4WYB A;  2IIR A;  1ASU A;  1J53 A;  3S3M A;  1T05 A;  5F2R A;  2PFU A;  1JL2 A;  3LDP A;  4CJL A;  5AQI A;  4EP5 A;  3HJF A;  3ZSW A;  3L4Q A;  1C0M A;  5HLF A;  1OH6 A;  4DCH A;  1NGG A;  1N33 K;  4OKJ A;  3RWU A;  3ZX0 A;  3QEI A;  3J7A P;  5AQM A;  1TK0 A;  2KKZ A;  4H0V B;  3VA3 A;  1YVU A;  2O8D B;  3ULD A;  4DR2 K;  1DLO A;  1HQU A;  3L2R A;  4E7J A;  3DI6 A;  3CYM A;  3AVM A;  4CZI A;  4FL9 A;  5EOY A;  1KD1 O;  4Z4G A;  3H1Q A;  3KKR A;  3CHW A;  4BG9 A;  3U8X A;  2P1J A;  4LF4 K;  4CFC A;  4B1X B;  3JAM O;  3F2K A;  4CFA A;  2LSN A;  3ZSV A;  1IBK K;  2E4L A;  4BRC A;  3FZM A;  4EZ9 A;  3SAF A;  4JKB A;  4AHR A;  4JNE A;  1XMO K;  1BUP A;  1YT3 A;  4GV9 A;  1F21 A;  4WQ4 A;  3MN6 A;  3QEP A;  3CCV N;  3J7Z O;  2I7P A;  1A5W A;  1DEJ A;  2P9I A;  1WNS A;  3GG4 A;  4IFV A;  3B6O A;  4DLE A;  4AM6 A;  1J9A A;  3QEV A;  3MN9 A;  1NGF A;  1VQ5 N;  4J8F A;  2IVN A;  4O8K A;  1QZ5 A;  5AR0 A;  4YOY A;  2B5J A;  2IVP A;  3L3V A;  4CJ7 A;  3T1Y K;  4FZY A;  4O55 A;  1C0T A;  3AO1 A;  3VER A;  3CM6 A;  4FJI A;  3PY8 A;  3VQ5 A;  1QS4 A;  4JKC A;  4L3Q A;  3ULE A;  2GTD A;  1ZC6 A;  1NM1 A;  3VEO A;  3P1G A;  3IG1 A;  4ISG A;  5LMN K;  3PIO L;  1RTD A;  4CHY A;  3MCA B;  3CF5 L;  1IKY A;  3NF7 A;  5AQF A;  4PHT X;  3RMA A;  3PLA A;  1QQM A;  1YTA A;  4CZH A;  2QWN A;  3OYM A;  2OYQ A;  1N6Q A;  3KZB A;  3A5N C;  3CJC A;  4ISE A;  1VQO N;  1JLQ A;  3CQ8 A;  2XRI A;  5C24 A;  5FRN A;  2D5R A;  4R79 A;  4PKH A;  1BIZ A;  2A1S A;  1S72 N;  4BVO A;  5TKY A;  5JVH L;  4CJS A;  2O8F B;  4BQL A;  4CZK A;  4CHP A;  1UOC A;  3KJV A;  1YJW N;  5AZJ A;  3RVC A;  1VQN N;  1I3A A;  2Z1J A;  1V4T A;  4BRP A;  3BEX A;  5JS1 A;  2HMI A;  3AO5 A;  3VQ4 A;  4M3U A;  3TWH A;  2A5X A;  3K5O A;  4OPA A;  3DYA A;  1J5E K;  1T6C A;  2KW4 A;  4DTO A;  3VEV A;  4FWO A;  4IJA A;  1HX1 A;  3OYL A;  3LWM A;  3G4S N;  3SUQ A;  2UUA K;  2F9W A;  1BOT O;  2HF4 A;  4H4M A;  4RW6 A;  4WQ5 A;  4M42 A;  3VMF B;  4DV7 K;  3V1Q A;  3HM8 A;  3L8B A;  1WSG A;  3PSI A;  4BRN A;  4JD2 B;  4A57 A;  1BDG A;  4FM1 A;  3QER A;  2HNZ A;  4MO4 A;  4CJK A;  4FWK A;  5GIO A;  3ID6 A;  1HNX K;  4DTX A;  4JI8 K;  2QW9 A;  2PYL A;  2HHH K;  3MED A;  3HOT A;  2UXB K;  2BGG A;  1ESV A;  2QXF A;  1RT4 A;  3PV8 A;  2E2N A;  5AQY A;  4CJV A;  4CJU A;  1K8K A;  1ZBS A;  3C95 A;  3NF9 A;  4F9O A;  4J2D A;  5EX5 A;  2O8E A;  4DSE A;  4M3R A;  1Z26 A;  1U49 A;  5KI6 A;  4BC3 A;  3Q7C A;  4KHQ A;  2PBD A;  4XH4 A;  3VF4 A;  3V4I A;  3MMV A;  2P9S B;  4B08 A;  1Z6R A;  2YHX A;  4FJG A;  1KQS M;  4L8R B;  4IDH A;  3SUP A;  1UA0 A;  5BRE A;  4M41 A;  4M45 A;  2UXD K;  3ENH A;  3SCX A;  3NVK A;  4H5R A;  3K9K A;  1KFD A;  3L2V A;  1NGH A;  1K73 O;  1YI2 N;  2P9U B;  1D4X A;  3OW2 M;  4JEP A;  3ZET A;  4DSI A;  3GBT A;  1U47 A;  1EP4 A;  4KB0 A;  1OVQ A;  3WEE B;  4JS4 A;  2YNI A;  4BVP A;  4U7B A;  1LW2 A;  2G8H A;  5I3U A;  4DV3 K;  4K41 A;  3CC2 N;  3I56 N;  3QBW A;  4IKF A;  3OYK A;  4W5Q A;  1EQY A;  3AVG A;  2FBT A;  4J2B A;  1NK9 A;  1C6V A;  3VEW A;  4M63 C;  4KRE A;  1JL1 A;  3THX A;  2J4R A;  4KRF A;  4MDB A;  3FGU A;  1DGK N;  1YJ9 N;  5KRS A;  4B3M K;  4CVN E;  1X9S A;  4J2E A;  4FW2 A;  3RSE B;  4J2A A;  3AAQ A;  3V1O A;  4BQZ A;  4CE9 A;  3O9T A;  3AV9 A;  2YJF A;  1O13 A;  2QEX N;  3OBW A;  3K59 A;  1R0A A;  4AM7 A;  3O80 A;  4CHO A;  3LWL A;  4E89 A;  4GKK K;  3M8P A;  1I39 A;  3G10 A;  1WAJ A;  1IO2 A;  1HPM A;  3QBX A;  2ZGY A;  3JYT A;  3H3N O;  4CK1 A;  3SJJ A;  2YHB A;  4JYA K;  4WQ4 C;  1S1T A;  2JLE A;  2VWB A;  3P5J A;  3WQU A;  1ZBU A;  2A6A A;  2EX3 A;  4BRD A;  5J2N A;  3T7Z A;  4BC2 A;  4FWM A;  1QVG M;  3CI5 A;  1JCE A;  4PL7 A;  3HSC A;  4CD3 A;  3CCE N;  3TTF A;  1TGO A;  4N41 A;  1LAV A;  1TK8 A;  2V52 B;  1NJZ A;  4O0J A;  4PL8 A;  3T1H K;  5HRR A;  3QFP A;  2G8W A;  3L6Q A;  1TYQ A;  4OKK A;  4Y0W A;  3QEW A;  3DLL L;  3V9Z A;  4DR1 K;  1QSS A;  3OYJ A;  2P9I B;  1N8R O;  2UUC K;  4LFA K;  3T1A A;  3O3H A;  3D0P A;  4OPJ A;  2XY6 A;  3FE1 A;  4I6M A;  3AA3 A;  4JKG A;  4FCY A;  3MCP A;  1HRH A;  2QM1 A;  3O3F A;  1E3M A;  3D45 A;  1NK8 A;  3CM5 A;  3LAN A;  1HYZ A;  3U4L A;  4OO1 J;  2QA4 N;  1EX4 A;  1H1V A;  1NK7 A;  1R59 O;  4FSV A;  3EKU A;  3ULE B;  2Y1J A;  3H3O B;  4FPB A;  4CJ5 A;  3R3L A;  1U45 A;  4JKA A;  1J54 A;  3OYD A;  1MDU B;  2JWK A;  3NGI A;  1GLF O;  4IO9 L;  3MX5 A;  2Q0R A;  3R1X A;  4YNQ A;  1QSL A;  1T03 A;  3ISN C;  1VQ7 N;  2NRZ A;  5KPZ A;  1L3S A;  2G8I A;  2YHW A;  5GAE P;  3LDN A;  3B6P A;  4AHV A;  2FBY A;  4ZTJ A;  4A5B A;  4DKW A;  3SQ0 A;  2OPS A;  4JI2 K;  2Q36 A;  1RBT A;  4HHT A;  1D5A A;  3E9P A;  4Z4E A;  1TKT A;  5FPM A;  4B9S A;  1T44 A;  3J8A A;  3MDQ A;  3KK2 A;  4WQ5 C;  3PX6 A;  3R9P A;  5BPN A;  3ATV A;  5AZJ B;  3RRH A;  3ZYY X;  2NUB A;  1WSI A;  2HHQ A;  3DOK A;  4DV4 K;  3U9Z A;  4CF2 A;  2E20 A;  5H1S Q;  3LDL A;  1YVN A;  1B9D A;  1JLC A;  3DXK A;  3HXM A;  2FLO A;  3KD5 E;  2YNG A;  4DU4 A;  1KFS A;  1U48 A;  3UE5 A;  1TKD A;  5AQU A;  2PY5 A;  1N5Y A;  5BR9 A;  4WFA L;  2FSJ A;  1MA9 B;  4CGG A;  2Z1G A;  4X64 K;  3NHG A;  2XY7 A;  3OHR A;  4FM0 A;  2XO7 A;  3QFU A;  1NG9 A;  5ELZ A;  3HST B;  1BO5 O;  4DSJ A;  5CHI A;  3ZX2 A;  2W6K A;  3DLE A;  4CZG A;  4DTN A;  4H0Y B;  4CJP A;  3OJU A;  4JD2 A;  1C0U A;  3O9R A;  3H08 A;  4ID1 A;  1K8K B;  4PY5 A;  4Q0B A;  3EE9 A;  4QS9 A;  4K42 A;  4LC9 B;  1K6Y A;  2YNH A;  4Z4C A;  4CFB A;  4A2B A;  3NVM A;  2O8E B;  4JN4 A;  3VET A;  3OS2 A;  2GX9 A;  2E2Q A;  1MWK A;  3L2W A;  3VQP A;  1BU6 O;  5KQ8 A;  5E41 A;  4FVM A;  5BRD A;  3CCS N;  4LF7 K;  3O5B A;  2Q97 A;  1S9G A;  5EU7 A;  4K43 A;  4UQG A;  1NBW A;  3SUO A;  4O5F A;  3CCQ N;  5AQW A;  4Z94 A;  1RDU A;  3E1Y A;  4EZ6 A;  3BF1 A;  3AVJ A;  3LP3 A;  5LJW A;  2E2O A;  1FXX A;  3IDH A;  1D8Y A;  3ZSR A;  3K58 A;  1NWK A;  4LF6 K;  4GMJ B;  3AAR A;  3VF6 A;  3ZT3 A;  3OYB A;  3ZET B;  4IEE A;  1BA0 A;  3SJH A;  2HW3 A;  1REV A;  3NCI A;  2QWM A;  3QDK A;  3FZL A;  3VGM A;  4B9U A;  4CEF A;  1LCU A;  4CF1 A;  3ID8 A;  3ASM A;  2OTJ N;  3VTH A;  3DXM A;  4JKD A;  3LP0 A;  2KQ2 A;  5DM6 L;  2AP1 A;  1BCM A;  4GVE A;  3THX B;  4F4K A;  2O8B A;  1ASV A;  4F3O A;  4BRK A;  1ZYQ A;  3KK1 A;  1S9E A;  2JGU A;  2GUP A;  4CJR A;  1RBS A;  4M3Y A;  3TAP A;  1HYS A;  2CH6 A;  3ENO A;  4HVJ A;  1RDW X;  5ADX H;  3HP9 A;  4KI4 A;  3O9U A;  1FKP A;  3D2E A;  5AQO A;  4W5T A;  1YJN N;  3KHY A;  3ZT0 A;  5TKW A;  2RHK A;  4MLE A;  4BG8 A;  2VYP A;  3LDS A;  2BDP A;  4ICL A;  4BWJ A;  1YHQ N;  4B9L A;  1RT7 A;  4BWM A;  3C0B A;  3MEC A;  4HUG A;  3LAL A;  4JK7 A;  1ZBH A;  3O9Q A;  4FJL A;  4JKE A;  5D3G A;  4KHY A;  1RBU A;  4A61 A;  3L3U A;  3U3G A;  2P51 A;  1HR0 K;  2RN2 A;  3NE6 A;  2CH5 A;  3I55 N;  2NNW A;  4O4G A;  3VQQ A;  4FLZ A;  1GOA A;  3MEG A;  1VSI A;  3A2F A;  4YOU A;  4FJ7 A;  5DK5 A;  2O8C A;  1XC3 A;  4PA1 A;  1SL1 A;  4PQU A;  3WUH A;  4JI3 K;  4JV5 K;  4AF1 A;  4E1J A;  4WFN L;  3SV3 A;  4DTJ A;  4EHU A;  1C1A A;  1CZA N;  5HBM A;  1KCF A;  3HP6 A;  1E4F T;  4CER A;  3HOS A;  3VQ6 A;  3C6H A;  1CXQ A;  4DUZ K;  4CEB A;  2Q3S A;  4Z4H A;  4AHU A;  1P90 A;  3HRG A;  4EIA A;  2WBN A;  4FWS A;  3J7Y P;  1RT6 A;  3IMX A;  4DU3 A;  4CEA A;  1TYQ B;  2X74 A;  3UKR A;  4RW4 A;  2D1K A;  4MDA A;  2P9L B;  5CZ2 A;  3NDK A;  4FWL A;  4IOC L;  2Q31 A;  2I7N A;  5SZT A;  1IH7 A;  3S9H A;  4CGJ A;  1BCO A;  1RDB A;  5FPE A;  4I6M B;  5JMV A;  1T6D A;  4JKG B;  3PX0 A;  3HBT A;  5M1P A;  3SAH A;  4X66 K;  1SZ2 A;  4E3S A;  4Q5V A;  3DM2 A;  2ATQ A;  4DMN A;  4N47 A;  3ZLJ A;  1VK0 A;  3M5R A;  2UXC K;  5EXW A;  4GY2 B;  1L3V A;  4BRQ A;  5F0X A;  4F8R A;  4M3X A;  5HP1 A;  2UU9 K;  3LAK A;  4FLU A;  2IOC A;  4FXD A;  1NGE A;  4CI6 A;  4DV6 K;  3TSQ A;  4CEC A;  1W97 L;  2D4W A;  4H03 B;  1VAZ A;  4ILJ A;  4M3T A;  2QWL A;  5AFU H;  2RE2 A;  4OGE A;  2QWQ A;  2QXL A;  3C6T A;  4IFE A;  2YCH A;  4DSF A;  1G99 A;  4NCB A;  3HTV A;  4IOA L;  5I9E B;  4DSK A;  4OVL A;  2Q2R A;  3KVG A;  1XNQ K;  4GKJ K;  4NLC A;  1XHX A;  3SBT A;  4YDU A;  1LWC A;  2KZZ A;  2ASO A;  3FZH A;  2FC0 A;  4BR4 A;  4LF8 K;  1O1W A;  1VQ8 N;  3CJ7 A;  3GL1 A;  4NYF A;  2G8U A;  4IFY A;  5KGX A;  1S6P A;  5JLH A;  3V6D A;  5GIN A;  4RG8 A;  4BRO A;  3VF2 A;  3CC7 N;  3M1F A;  4FJJ A;  1MU2 A;  4BY9 C;  3TAF A;  3CCM N;  1XMQ K;  3AO2 A;  3DXK B;  4DTM A;  5GAH P;  2OPP A;  1U2V A;  1GLD G;  2ZQB A;  3VQ7 A;  4BR9 A;  5BN9 A;  4O8U A;  4JK8 A;  4CK2 A;  2G8K A;  1SS6 A;  4C8K A;  1FKO A;  4Y1C A;  2A41 A;  2NLX A;  3F73 A;  3OBY A;  1D9D A;  3T3F A;  2HHV A;  3AGR A;  1X3N A;  4BR7 A;  1S1W A;  4DSL A;  4H0O A;  5AJ3 K;  5AQJ A;  3VGL A;  3CJ9 A;  1Q8I A;  3WNF A;  1WUA A;  1BI4 A;  3KIO A;  3GDQ A;  1YIJ N;  1VRU A;  1RIL A;  3BY5 A;  4FJ9 A;  1OH8 A;  4DR7 K;  4MLH A;  4NXM K;  2PYJ A;  3G0Z A;  2GWK A;  2JWL A;  2P5O A;  1XWL A;  4YOV A;  1N36 K;  3VTI A;  3RR8 A;  3TTC A;  1DTQ A;  3FZK A;  3R8E A;  2OZS A;  1IBL K;  1YAG A;  1NGI A;  3RR7 A;  5JS2 A;  3MX2 A;  3GE1 A;  4OGC A;  4FOI A;  2VGM A;  4JHD A;  4CIE A;  1VQL N;  3VES A;  5KPR A;  4IJN A;  3VQC A;  1WB9 A;  1IG9 A;  4I2Q A;  3ZSQ A;  4CFD A;  2VWJ A;  2ASP A;  3DAW A;  4QAG A;  5KQD A;  4DV1 K;  1L3U A;  4OPH A;  3MXM A;  5IT9 O;  3QLH A;  4H5N A;  2NZT A;  3O6W A;  3SK3 A;  1WN7 A;  1ATN A;  3UB5 A;  3NFA A;  2RF2 A;  4LY7 A;  3IKM A;  2E2P A;  4AQY K;  4X65 K;  3O1W A;  1EXQ A;  3VQ9 A;  3THV A;  3CFO A;  3HK2 A;  2ZGZ A;  1A5V A;  1OH5 A;  2P5G A;  1S5J A;  2E5L K;  3O4N A;  4LSL A;  3RMB A;  1QVF M;  4K8Z A;  3EY1 A;  3O08 A;  1RT3 A;  1TV6 A;  4JK9 A;  4C1N I;  2QWO A;  3DXM B;  4BRM A;  4CCH A;  2HBJ A;  4DTP A;  4OLA A;  4NYN A;  3I8D A;  4LFC K;  1S1V A;  1Q9X A;  3WNH A;  3ZT2 A;  2O8B B;  2HST A;  5AQR A;  5FRM A;  3QIN A;  4NCG A;  1RBV A;  4E19 A;  3K57 A;  4DTS A;  3RRG A;  5F1X A;  1X9J A;  4EP4 A;  1TL3 A;  3L2Q A;  3F9M A;  3TI0 A;  3DRS A;  3CCR N;  3M8R A;  3D2E B;  4FW1 A;  4B1W B;  4CJQ A;  3A5O C;  4OKE A;  3KLI A;  4K8X A;  2G8F A;  3EN9 A;  4JI6 K;  2P9P A;  4ID5 A;  3LM2 A;  2NRW A;  2D0A A;  5AQX A;  1LAW A;  5BRH A;  3NBP A;  4B9M A;  4DFM A;  3VA0 A;  2Q1N A;  3EO3 A;  3M3Z A;  3CC4 N;  3E01 A;  3O3G A;  1NK6 A;  4JI5 K;  2GUI A;  4AIL C;  1JLB A;  5GIP A;  2O8C B;  2B6A A;  4HWI A;  1IBM K;  5FPD A;  4UY8 O;  4LSN A;  3AVK A;  4NCA A;  3C7N A;  2WC9 A;  3KLF A;  5C42 A;  1HKG A;  2E6M A;  4Z0U A;  4CGH A;  1FK9 A;  5AQQ A;  3K5M A;  4CBX A;  1VQP N;  1DTT A;  2GV9 A;  3OYE A;  4KHU A;  1QQO A;  4DB3 A;  2AJQ A;  3LZI A;  4W5N A;  3EKS A;  3SMS A;  4ELU A;  2D0P A;  1Q18 A;  2IDO A;  3UKR B;  2YV0 X;  2YX6 A;  4AH9 A;  1U04 A;  3L4I A;  4CGD A;  3DLH A;  3U6F A;  2E88 A;  1Q7Y O;  2UUB K;  4NLB A;  3ITH A;  3I8B A;  3SAG A;  1Q81 O;  3C6A A;  3CD6 N;  1Y64 A;  1X3M A;  2P9L A;  1ZBL A;  3WXL A;  3NGY A;  4A62 A;  3OYN A;  4BRG A;  3CCJ N;  3LPU A;  4MQ3 A;  1KVB A;  3CJA A;  3CQY A;  5M1Q A;  3VEX A;  1W7A A;  4BC4 A;  4YDU C;  1HNI A;  4IDK A;  5KGW A;  4XIU A;  1LV5 A;  4CED A;  4LFB K;  2ZM6 K;  5K14 A;  4FZX C;  3ZSY A;  2XY8 A;  4KKO A;  1OH7 A; 
#chains in the Genus database with same CATH homology
 4B3T K;  4V19 S;  1HNX K;  4B3R K;  4YHH K;  3J7Y P;  4JI8 K;  1I94 K;  2HHH K;  4K0K K;  4LF6 K;  4KHP K;  4GKK K;  4JI2 K;  2UXB K;  5AJ3 K;  4NXN K;  1HNW K;  3T1Y K;  4JI6 K;  3J80 O;  4DR7 K;  5A2Q O;  5LMU K;  4NXM K;  2F4V K;  4X66 K;  4DV4 K;  4DR6 K;  4JYA K;  1N36 K;  5LMN K;  4JI0 K;  1IBL K;  2UXC K;  3J81 O;  4JI5 K;  2UU9 K;  4B3S K;  1N34 K;  5LL6 Z;  5FLX O;  1IBM K;  4JI7 K;  4LF9 K;  4DV2 K;  4DV6 K;  3OTO K;  1FJG K;  4OX9 K;  2UXD K;  3T1H K;  4DR4 K;  4DR5 K;  4X64 K;  4DV1 K;  2VQF K;  5IT9 O;  4DV0 K;  1N32 K;  4DR1 K;  4GKJ K;  1XNQ K;  2UUC K;  4LFA K;  1N33 K;  4DR3 K;  1XNR K;  3J7A P;  4AQY K;  4X65 K;  4YY3 K;  4LF8 K;  4DV3 K;  4DR2 K;  5IWA K;  1HR0 K;  2E5L K;  2VQE K;  2UUB K;  1J5E K;  4DUY K;  4LF4 K;  1HNZ K;  4JI3 K;  1XMQ K;  4JV5 K;  4LF7 K;  3JAM O;  4B3M K;  4CVN E;  2UUA K;  4LFC K;  1IBK K;  4JI1 K;  4DV7 K;  4X62 K;  4LFB K;  2ZM6 K;  4CW7 B;  4DUZ K;  1XMO K;  4JI4 K;  5BR8 K;  4LF5 K;  4DV5 K; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...