1IBKL

Structure of the thermus thermophilus 30s ribosomal subunit in complex with the antibiotic paromomycin
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
124
structure length
124
Chain Sequence
PTINQLVRKGREKVRKKSKVPALKGAPFRRGVCTVVRTVTPKKPNSALRKVAKVRLTSGYEVTAYIPGEGHNLQEHSVVLIRGGRVKDLPGVRYHIVRGVYDAAGVKDRKKSRSKYGTKKPKEA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Recognition of cognate transfer RNA by the 30S ribosomal subunit.
pubmed doi rcsb
molecule tags Ribosome
molecule keywords 16S RIBOSOMAL RNA
total genus 14
structure length 124
sequence length 124
ec nomenclature
pdb deposition date 2001-03-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
L PF00164 Ribosom_S12_S23 Ribosomal protein S12/S23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 1ibkL00
1YHBA 1PH3A 2D62A 3S1RH 1KL9A 1FVIA 4KHPL 4KHZA 3F2DA 3MXNB 2KHJA 5LMUL 1SE8A 4ALPA 4JI7Q 4KLKA 4DR4L 2HHHL 3S24A 3UE0A 3CCJA 2RF4A 3CXCA 1YNXA 4JOIC 2FXQA 2ZJRA 4A3CH 1WI5A 1SMXA 1B70B 1TXYA 1VQOA 4GN4B 4O0AA 2QEXA 2GVBA 5M3FG 4LF6Q 1VQIA 3EBEA 1L2FA 3KDFA 1WCMH 5JEAJ 4IOAA 3J80c 1QVCA 2XTIA 1M1KC 1RIPA 2NN6I 1Y1VG 4DV6Q 4HJ7A 1X3FA 3CD6A 5IYCH 1JT8A 2VQFL 3BU2A 4DV1L 1EQRA 1PYSB 2JE6I 4DR1L 3I4NH 5JJKA 2VQFQ 3SGIA 2QA4A 2CKZB 4IJLA 1L0WA 3I4MG 2Q2IA 2ZTDA 4DV5Q 2UXCL 4YY3L 2EQSA 4JI7L 2JA7G 2UXBL 2IY5B 3JC66 1YHAA 1G291 2PI2E 4A3FG 3ERSX 3CCUA 3PO3G 1VS0A 4X66Q 2R93H 4JYAL 2CQOA 1GD7A 1EWIA 3DM3A 3GTLH 1CUKA 1Y1VH 3KOJA 4QQBX 4DV3L 1TWHH 1WOCA 4GKKQ 1VQJA 2KCMA 3DLLA 3HOUG 1VQ7A 4EQ5A 4GKJL 4XTCS 3CCSA 2KHIA 2ZM6Q 1Q46A 3S14H 2R7DA 1EIFA 2R7FA 3NELA 1A0IA 1YJWA 3WWVA 5DLQE 5JEAG 4PZ7A 1JE5A 2LXKA 2AHOB 2F4VQ 1X55A 4JI2L 2JQOA 4JC0A 1EQQA 1N36Q 1VQLA 4WJ4A 1FL0A 1G6PA 2VZAA 5M5WH 4GLXA 1V1QA 2UUCL 3EN2A 4HJ5A 4LF4Q 2ID0A 3H3VH 2WFWA 5IP7H 1V9PA 1QVGA 4POGA 5C44H 4JI3L 5IYBG 5HGQA 3T1HQ 3M3YH 4A3JG 1CSQA 1XPRA 3TS2A 1AH9A 1VQFA 3L2PA 1P16A 4B3TL 2ATWA 4A4IA 4X62L 2JA6H 4ME3A 2IX0A 2OTLA 4FDBA 3ULJA 1X3EA 2VS1A 2WB1G 4JI5L 4NXML 1KC8C 4X62Q 3CPFA 4BY1G 1FJGL 3PV0A 5IYDG 5GAHC 1QUQA 2Q2UA 1VQDA 4P71A 4A93G 2AKWB 4A3KH 4B3RL 3S1NH 1QVFA 2YYZA 3G71A 1MIUA 4PMWA 2E2JH 4LUZA 1QUQB 1Q81C 1B7YB 3KDFB 3UDFA 5BR8L 5JJLA 1NMGA 3HOXG 2WAQG 1VQ9A 3GTGH 4GS3A 1FGUA 3CMAA 2Q2TA 4LF5L 3I55A 1IBKQ 4JBMA 3ICEA 5M3MG 1J5EL 3ULPA 4LUVA 2Y0SE 1D7QA 4C3JH 4IO9A 1IBKL 4AQYL 3J81j 2WB1E 2HQLA 3RZOH 1GKHA 5FLMH 5FJ8G 3AYHB 1X65A 4NXNL 1KQSA 3J81c 4Y52H 4YCVA 1KRTA 3G4SA 1YITA 3J81i 4L5RC 1NY4A 1YBYA 4H02A 4KI0A 4JI1Q 4B3ML 1HH2P 4R4CA 3PGZA 2VQEQ 2UUBQ 3M4PA 3F8TA 2CFMA 3TEHB 4LF7Q 1UE7A 2KCTA 2IX1A 3I4NG 1E24A 4DUZQ 3CCLA 2B63H 1L1OA 4TVAB 3GTKH 3A74A 1YZ6A 1IBMQ 3UE1A 2R92G 1OXTA 1LTLA 4UP8A 4NB3A 3A0JA 2JA7H 3CF5A 1X3GA 1IBML 4BBRH 4A76A 4A3FH 1QZGA 5FJ8H 4YCWA 5JJIA 1QZHA 3M4QA 3K7AH 4P73A 1W3SA 1Q82C 2DGYA 2RHSB 4C3HH 2NVYH 1WYDA 2UU9L 4YWLA 1JJCB 1VQBA 2B3GA 2PNHA 4IPGA 2D0PA 3OYYA 1U5KA 4NXNQ 1LYLA 1X6OA 3D31A 1JMCA 2DUDA 1UWVA 4IFDJ 3S2DH 4DAYB 1K8AC 1VQHA 2HHHQ 1BVSA 1UEBA 4L5SA 2ZTCA 2F3IA 4DR6L 3GDEA 2ZM6L 2BA1A 1KXLA 3CC2A 2OQKA 4A3MH 1Y1WG 4DUZL 5C3EH 4MNOA 4BXXH 4A3CG 4DV7L 4JBKA 3E0EA 4EX5A 2NN6G 1HZAA 2QGQA 3H0GG 4AYBG 5GAGC 4LFBL 4DV5L 2UXCQ 1HNWQ 3HOVH 2K75A 4A3JH 4DR3L 4OXPA 4LFBQ 4P72A 4A93H 5BR8Q 3STBD 3RN5A 1YIJA 4BBSH 4BY7G 4X66L 1VQAA 2JA6G 4IJHA 2ZJPA 2NZOA 1XMQL 4AH6A 4R1JA 1PH6A 2YU9H 2YTXA 1Z47A 1N34Q 5C4XH 2JA8G 1YHQA 2LXJA 3NENA 3S15H 4GOPA 1WJJA 3RZDH 4L5TA 4A3MG 1Y1WH 2KBNA 3Q8DA 2A1AA 3I2ZA 3ULLA 1L1OB 2MO0A 1SN8A 5FLMG 5FLXc 1HR0Q 4JI6L 4LF6L 2VUMG 3NBHB 4IFDI 1Q1BA 5IT9c 3H15A 2AWOA 2IHFA 3E9HA 1PYBA 5J3BA 1OXSC 1XNRQ 3D0FA 3PF4A 4DR2Q 4LF4L 2XGTA 4PZ8A 4A75A 4TQUS 3OTOL 1N8RC 1GVPA 1Q12A 1V43A 2OQ0A 1PFSA 4DR5L 1XNQL 3KYHC 3U50C 4HJAA 1OXUA 3KF6B 1PV4A 4OWWB 3IRBA 1I6HH 1IYJB 1HJPA 3U4VA 3W5OA 4LFCQ 4LFAQ 2E5LL 3I7FA 1BBWA 3KF6A 4GNXB 4IPHA 3CAMA 4DAMA 3UDIA 2UUAQ 1M90C 2NVTH 3GD7A 1N34L 2EXDA 1VQ5A 5LMNW 3U58A 4DV2L 4L5QA 2YTVA 3ZJYC 1XJVA 1KIXA 3GTQH 3U4ZA 3E9IA 1WFQA 3PF5A 1IL2A 2LSSA 1I5FA 4XIGS 1H95A 2ASBA 4JI8L 4DUYL 1U0LA 5IP9G 1EYGA 2K52A 4X65L 1B8AA 5IE8A 4RG1A 1MJEA 3KFUA 4A3LG 4DR6Q 3AFPA 1E1OA 2MNAA 1KRSA 3HKZG 5GAEC 1K83H 1RL2A 5C0XG 3T1YL 1J5EQ 3JAMi 1JJ2A 3FKIG 1XNQQ 4YWMA 4JBJA 5EAYA 2BH8A 3PUVA 1VQNA 1SLJA 3PUYA 5M3MH 4BY1H 5AJ3L 4K0KQ 1A63A 1MKHA 1Y14B 1VQKA 1CKMA 1CSPA 2D0OA 2L15A 4DR1Q 1UE6A 1N33L 4JYAQ 1X54A 2AMCB 4IPCA 1X56A 3RR5A 5C3EG 3I56A 4A3KG 5ELOA 3HOXH 5IY0A 1MJCA 3HKSA 1SROA 1PHJA 3HOVG 2HIVA 2R7ZG 4LF8L 2ZJQA 4DV4L 2V1CC 2Z6KA 2JA9A 2KENA 4DK6C 1XNRL 4DNIA 1N36L 2OWOA 2NVQH 4LNQA 3HOUH 1K73C 3KF8B 3PIPA 4OO1I 4Y7NH 3S16H 4PZ6A 3K7UC 4DPGA 3PIOA 1A8VA 1Q7YC 1I50H 1CKNA 4OX9L 2HT1A 4HJ8A 2Z6KC 4X64Q 1SFOH 3M7NA 3PO2H 2JEBI 1ASZA 2AWNA 4UP9A 1YEZA 3PCOB 3KJOA 1HZBA 4DR7L 5HY6A 2ALYB 1TWGH 4QJFA 3K0XA 1W2BA 3NEMA 1HNZL 3TRZA 1HR0W 1OXVA 1S40A 4LF9Q 5M3FH 2UUBL 1EFWA 1VQMA 1PH8A 1NE3A 4UPAA 2R7ZH 1VQPA 1UE1A 4A3EH 1HNWL 5IP7G 2A19A 1PH7A 2VY3A 4DV0Q 2OTJA 1YI2A 2R92H 5LMNL 5IYCG 5C44G 2JA8H 2R6GA 5C4XG 1NTGA 1S3OA 2K14A 2PI2A 2WP8J 3W1GA 2YTYA 4C3IH 3CCMA 1GO3E 2CWAA 3LGJA 5LMNQ 1PH1A 3KLWA 4HIMA 1KAWA 1E1TA 5LMUQ 1E7ZA 1SRUA 2CWPA 4OWXB 2MFIA 4BBRG 1TWAH 1CKOA 1C0AA 3RNUA 4B3RQ 4DV3Q 3K80C 2EIFA 4GKJQ 3PUWA 3B6YA 3PUZA 4JG2A 5H1SE 1OTCA 1PVOA 4PG3A 1GM5A 4JI0Q 2YV5A 4A3GH 1K9MC 4DR2L 3G6EA 4UP7A 1EUJA 4R4QA 1CKNB 1N9WA 4YHHL 2OCEA 3F2CA 3CCQA 4OX9Q 1JJGA 5IWAL 1E22A 3M9BA 4DK3C 1EIYB 3STBC 3VDYA 5GROA 2UXBQ 2B29A 1VQGA 4HJ9A 4IOCA 3K81C 1EOVA 5M5XH 3ER0A 1OXXK 5IWAQ 4HIDA 4A3IG 1XTDA 3T1HL 3FKIH 3BZCA 4POFA 3JAMc 1XMOQ 4C2MH 3TS0A 3RLOA 4A3DH 1N32L 4K0KL 2RHQB 1IZ6A 4QY7A 4R4IA 4A3GG 1SR3A 4DV4Q 4JOIA 1I94L 1BBUA 4BY7H 3S1MH 4B3SQ 1K0RA 4KHPQ 1A62A 1AE2A 3BZKA 4YWKA 2B63G 4X65Q 1IXRA 1NJIC 3I4MH 3S2HH 4IFDG 4DR4Q 4MZ9A 3CC4A 3HOYG 3L7ZC 3CCRA 2VUMH 2K5HA 3TREA 3HOWG 2HIXA 4DV7Q 4A3BG 1KHIA 2PQAB 3CP0A 1I3QH 4OONA 4B3SL 4HIKA 1NMFA 4WJ3M 3HOZH 3GTPH 5IYDH 3BJUA 3F2BA 4AYBE 1LUZA 4LF5Q 2N8NA 4LF9L 5M5YH 3CCEA 1UE5A 2E8GA 4YY3Q 3J7A5 3PO3H 4DV0L 4JI5Q 4NXMQ 1XMOL 2R93G 3AQQA 1X9NA 1YJNA 2ZTEA 4P75A 1IBLQ 3HOWH 2N78A 4JI4Q 1PH2A 2UU9Q 3H3VI 2I5MX 1K3RA 2CCZA 3M4OH 5GADC 4GNXA 1XPOA 2UXDQ 2GN5A 2VL6A 3K8AA 4X64L 4DKAC 4YHHQ 5E7NA 2N49A 1K8GA 1HNXQ 4JV5Q 2C35B 4DV1Q 2IT1A 1VCIA 4JI1L 1VQ6A 2I5LX 1YJ9A 3UDGA 1HNXL 4O2DA 4GOPC 1Q86C 4LF7L 2GVAA 3H0GH 1N33Q 4J15A 1VQCA 2A8VA 3G48A 4R4TA 3OTOQ 4JCVE 4APVA 1TWFH 1Q1EA 2F4VL 2IHEA 3GTOH 4DR5Q 4DV6L 3J80i 5C0XI 3TQYA 3S1QH 2UUCQ 4LF8Q 1AE3A 4BBSG 1HR0L 3M85A 2JA5H 5IYBH 1S72A 4JI6Q 1HZ9A 2K5VA 4YCUA 1D8LA 1NBWA 3FHWA 2VW9A 4GLVB 4A3LH 2MQHA 3CCVA 1PH5A 4P74A 3A5ZB 4GKKL 3OW2A 3GTMH 2Q2HA 3PUXA 4GOPB 1IBLL 1XMQQ 3L0OA 1KD1C 3PO2G 1LM0A 2I5HA 3W1BA 4A3IH 4LW1A 1O7IA 1G51A 2JEAI 1N32Q 3CQZH 2Z0SA 1HNZQ 4OO1G 3PSIA 2JK8A 1WCMG 4QL5A 3RN2A 4UY8C 1DGSA 1FJGQ 1PH9A 1VQ4A 2VNUD 4LFCL 2I0QA 3RLFA 3CC7A 1I94Q 4QGUA 2Y0SG 2JA5G 3GO5A 3GTJH 4MTNA 1L1OC 3UDXA 1HZCA 2E2HH 4A3EG 4B3TQ 4BXXG 4DV2Q 2K50A 3CMEA 1PA6A 2UUAL 2BH2A 3HOYH 5ELNA 3S17H 4GLAC 4A3DG 4QIWE 1T9HA 5C0XJ 4A3BH 3MEFA 2PMZE 2K5NA 2ES2A 1VQEA 1R9TH 1Q8KA 3HKZE 1E3PA 4BA2I 4LUOA 1XPUA 1VQ8A 4JI0L 3HOZG 4HIOA 1JB7A 1C9OA 2JJQA 4GN3B 3J7ZC 3I4OA 5C4JH 3FP9A 4JI3Q 2NZHA 3CPWA 1TWCH 3EIVA 5IP9H 3CW2C 3KJPA 4RMFA 4GN5A 3AEVA 3HFZB 4GNXC 4R4OA 4JI4L 3RLNA 2BA0A 4AIMA 5K36G 1J6QA 4IPDA 3F1ZA 2NVXH 1C7YA 4X6AH 5AJ3Q 4JI8Q 4DUYQ 2MO1A 5GQOA 4JI2Q 4JV5L 1PH4A 4BA1I 2UXDL 1BKBA 1YVCA 4JBWA 4OWTB 2N3SA 3T1YQ 4LWCA 2E2IH 2K4KA 2H5XA 4NPSA 3AFQA 4AQYQ 2WAQE 1ASYA 2PQAA 2RCNA 1Z9FA 2VQEL 4B3MQ 2E5LQ 3A5UA 2F52A 4LFAL 4DR7Q 4DR3Q 1P8LA
chains in the Genus database with same CATH superfamily
2O2LD 2KEDA 1KL9A 1MGSA 5LMUL 2KHJA 4ALPA 4JI7Q 2L0CA 3BVZA 2HHHL 1I4RA 2RF4A 1YNXA 2KUMA 1B70B 3RUZA 4CDFC 1TXYA 4GN4B 4O0AA 5KNBA 1L2FA 1SYBA 2K32A 3QO2A 1LV9A 5C44B 2E2JB 4ZK9B 1RIPA 2NN6I 1X3FA 5LHY1 1SFOB 1JT8A 4C2MB 4L63B 3Q23A 1GHKA 3WOFA 1V1PA 1PYSB 3DXJC 2F3WA 3NQIA 4KN4C 4FP5D 2NVXB 3PIP3 1TQOA 2EYMA 3C2PA 2QA4A 2CKZB 1JOOA 1B2TA 1CZWA 2EQSA 2RCFA 2PI2E 3CCUA 3PO3G 2R93H 4X66Q 3DM3A 1EWIA 1CUKA 3KOJA 2F3VA 1VQ7A 3BZDB 3NP8A 2KHIA 3S14H 1QJOA 1SJHD 2L5TA 5JEAG 4PZ7A 1JE5A 1BQQT 1X55A 4JC0A 1N36Q 5EBCA 1I50B 2QCPX 4GLXA 1TWHB 2EJFC 2RQXA 5IP7H 1MHWC 2OXPA 5JOBA 4POGA 4JI3L 5M3FB 5IYBG 3VA7A 5IGBA 3H3VC 3L2PA 2Z4HA 3OIPA 4A4IA 2JA6H 1GUSA 2OTLA 4FDBA 5EPLA 1X3EA 3ULJA 3VYUA 2EVBA 3M4YA 2G5DA 3PV0A 4DNTB 1K8MA 2R93B 2AKWB 3GV3A 1JE4A 1TS5A 4H0LC 1ICFB 4H44C 4LUZA 3BDOA 1A3VA 3KDFB 4DK1A 5BR8L 3HOXG 2WAQG 3TSSA 2PZTA 2F0SA 2RDHA 4OEMB 3OWEB 2Q2TA 3DUZA 5I4DA 4LF5L 3S9WA 3LWEA 4C1NI 4JBMA 2XSCA 4CGYB 1SE3A 2Y0SE 1B9NA 4K8JA 4IO9A 5KNDA 5FLMH 1J8IA 2CQAA 3J81c 4Y52H 1E2WA 3F2UA 4IQZA 3AU7A 3QIAA 1YBYA 4R4CA 3PGZA 3M4PA 3S1NB 2EE1A 4G7ZC 3T53B 1E24A 4A3DB 1L1OA 4TVAB 3J81L 1WD0A 3A0JA 2JA7H 5CV9A 5IGEA 4ZYSA 1I6HB 4A3FH 3J7YW 1QZHA 1Q82C 4P73A 1WYDA 5CMDA 3T56B 4YWLA 1JJCB 2B3GA 2PNHA 4BY1B 2D0PA 1LTBD 4U673 4KKSA 1ICWA 3NQTA 4NXNQ 1X6OA 2DUDA 4IFDJ 1UEBA 1EYCA 1HPCA 1LT4D 2F3IA 4DR6L 4HAEA 2ZM6L 4L8JA 2OQKA 4A3MH 1Y1WG 4MNOA 3VR3A 2PW7A 4DV7L 3E0EA 1VMCA 2QGQA 2H4OA 4AYBG 1R4PB 4XYQA 5GAGC 2L55A 2QILA 4A3JH 4FF1A 2L4NA 2HQEA 3RN5A 1X3QA 2FFKB 1EY8A 3W3AA 3MZ5A 3OWFA 2JA6G 2NTTA 4AH6A 4RWSC 3X3NA 1PH6A 1IL8A 2YU9H 1LTAD 1YHQA 1AW7A 1D5XC 2MP1A 1BUVT 1PZKD 3P20A 1L1OB 1SN8A 5IT9c 2AWOA 2IHFA 2XWBB 3NPPA 1OXSC 4JVZA 2XGTA 3T51B 4FXKC 4DAVA 4HCEA 2IWHA 3S15B 3U50C 2HD3A 1BOSA 3OPOA 2M00A 1PV4A 1I6HH 3IRBA 4WORA 3U4VA 4FXGC 3W5OA 1PFNA 3ONAB 3I4NB 1SDFA 3DEPA 4LFCQ 4FF4A 1BBWA 1B9MA 3SK5A 2VB3X 3DWAA 1RD9D 3GD7A 2IX3A 1H9RA 3U58A 3LNNA 1U4PA 4L5QA 1S5BD 3ZJYC 4DFAA 1WFQA 2OF1A 5CYUA 2N55A 1H95A 1JWMD 2QDBA 5IP9G 1I4GA 4CDCC 1RTOA 5IE8A 3AB9A 4C3IB 4A3LG 4F7XA 1NAPA 3OSOA 4MHEA 4RCOA 1KRSA 5C0XG 1JJ2A 1K83H 4MN3A 5EAYA 1WTPA 1A63A 2F0IA 3G7LA 5AJ3L 2A6HD 3E3XA 1N33L 4DR1Q 3GV6A 3RR5A 5IY0A 5AFWA 2R7ZG 2A74C 4LF8L 4ILWA 2KENA 2L9HA 2CH4A 5NUCA 1N36L 3KF8B 3PIPA 4OO1I 3S16H 4PZ6A 2HT1A 1Q7YC 2WB1B 1I50H 4YIJA 3VYRA 3PO2H 1SFOH 3M7NA 2JEBI 4HSPA 2AWNA 1MBYA 3PCOB 2JA6B 1PDQA 3KLSA 3VR6A 3TP7A 5JAVA 1SYFA 1FNWA 4ZUIA 3NEMA 3TRZA 1OXVA 1RKNA 1S40A 1NR4A 1D5MC 1VQMA 1VQPA 1F9SA 2R92B 5IP7G 1PH7A 5IYCG 2R6GA 1NTGA 1S3OA 4A3BB 3FRPB 3LGJA 1PH1A 2QEJC 4F8MA 2B2TC 3KLWA 3MFYA 1UUPA 4PNYA 4HIMA 5LMUQ 3OMGA 1E7ZA 2AQ2B 5C5MA 1KDBA 3KUPA 5ELEA 2PNRC 1HQMC 1V1OA 3PUZA 1B1ZA 1K9MC 1TS2A 3G6EA 3A54A 5M5WB 2O5IC 1N9WA 5T1IA 1H9JA 1STNA 2KCCA 3K0YA 3M9BA 1B50A 2F0NA 2HCIA 2FMMA 3STBC 1B53A 2OEOA 2KHSA 3HP3A 4HJ9A 4IOCA 4G4KA 1EOVA 2I07B 5BN4A 1KNEA 1EOTA 2AUKA 4RGTA 4A3IG 1XTDA 4I7ZC 3T1HL 1XMOQ 1MD2D 4C2MH 2F0KA 3A8KE 4K0KL 4QY7A 1NSNS 3TDQA 1CFMA 4DV4Q 4JOIA 1BBUA 3S1MH 1IW7D 1JB3A 1K0RA 4A3FB 1A62A 2E75C 3I4MH 4YWKA 3SK8A 4X65Q 3S2HH 3LWUA 4DR4Q 3M7GA 2B2WA 1VF7A 3TREA 1Y8OB 2PQAB 3CP0A 2A69D 1DJRD 2NVQB 3JAME 3HOZH 3GTPH 3TP6A 3TZDA 4XYOA 4LF5Q 4LF9L 5M5YH 1UE5A 5EBDA 4DV0L 4KD3A 4NXMQ 1TS3A 1IBLQ 2N78A 2UU9Q 3HEJA 3K5OA 3H3VI 1CA5A 3M4OH 4GNXA 2UXDQ 2GN5A 2VL6A 4YHHQ 4DKAC 5E7NA 1LTRD 4UHVA 1VCIA 4O2DA 2PYKA 2GVAA 4K6LA 2ICEC 3G48A 4R4TA 4APVA 3GTOH 2D2CC 1EL0A 1EQVA 4OHJA 3TQYA 5C0XI 4A93B 2JN4A 3RZOB 2PCFB 2JA5H 1S72A 3FVQA 1CK1A 2K04A 1NBWA 4GLVB 2MQHA 1PRTC 3RZDB 4GOPB 1LM0A 2I5HA 4A3IH 1O7IA 5EKIA 2JEAI 1N32Q 1HNZQ 3WDNA 3PSIA 1AN8A 1WCMG 4QL5A 2VNUD 4UY8C 2O5JC 1PH9A 1QWYA 4K14A 3RLFA 5G3LD 1I94Q 1E2VA 4QGUA 2Y0SG 2RA4A 3GTJH 4B08A 1HZCA 4KMUC 4B3TQ 4C3HB 1I4QA 2L11A 2UUAL 3FEWX 5ELNA 2PZUA 1KDAA 4XXEA 4QIWE 1SBBB 2K5NA 1E3PA 5IODA 1D6EC 4OO1H 4C56C 3MA2B 1XPUA 1PRTD 1STAA 1VQ8A 4GN3B 2D9UA 1VDZA 1WCMB 3EIVA 5IP9H 3CW2C 4RMFA 3EROA 4BWGB 2Z9HA 1ESRA 5COYA 4AIMA 2NVXH 1C7YA 4X6AH 4JI8Q 1CZGA 4JI2Q 4BA1I 1EY7A 1XXGA 4OWTB 3SK4A 4CHTB 3SE0A 1M4VA 3SEBA 4FVMA 1Z9FA 2NUCA 3CHBD 4CDDC 2D62A 1ILQA 2XIWA 3RMHA 1FVIA 1PXUA 3MXNB 3CKIB 1ZKOA 4P2CB 2JA5B 3S24A 2FXQA 3NBIA 3N52A 1IYUA 4H13C 5M3FG 3EBEA 3KDFA 1WCMH 5JEAJ 4IOAA 3J80c 5BN3A 2LKVA 4DV6Q 4HJ7A 3HOZB 1G6ZA 3CD6A 4KY5A 3NTKA 4JW0A 1H9MA 3I4LA 1Q3LA 1EQRA 4DR1L 5EJWA 4K2KA 1EYAA 4EGVA 3NUCA 5JVH3 2PMZB 2Q2IA 4DV5Q 4X3TA 2UXCL 2IY5B 5IIFA 1G291 3ERSX 1AP0A 2SNSA 1VS0A 4XT3B 4JYAL 2CQOA 1GD7A 2TSSA 2X6GA 1CQFA 3DLLA 2KCMA 3HOUG 3KBGA 1CHQD 1K0SA 2ZM6Q 1O7ZA 2R7FA 1VF5C 3WWVA 3HZXA 5DLQE 3SHLA 5M9OA 1STYA 1B44D 4WJ4A 3W2DA 3CU7A 4EQPA 1FL0A 1SNCA 1V1QA 3ITPA 4HJ5A 2ID0A 2XRSD 1HRJA 2WFWA 4XQJA 3OOCA 1V1PB 3T1HQ 1Y1WB 1KLGD 1DXMA 2ATWA 5CV4A 4X62L 4ME3A 5I2XA 5CV7A 5FO8B 5C0XH 4X62Q 3VYSA 5IYDG 3R2TA 1QUQA 1PMRA 3NWSA 2EY5A 1VQDA 4P71A 3S1NH 2C5CA 2YYZA 3G71A 1BDOA 1EIHA 3C1FA 1TWAB 2K05A 5C3EB 4GS3A 1FGUA 4KV6A 3I55A 5TSSA 1BNZA 2RDGA 4LK1C 1J5EL 4KK7A 5IGGA 3ULPA 1D7QA 1WTVA 3BDCA 2KOLA 4AQYL 2WB1E 1EQTA 1KQSA 1JCKB 5EPKA 3J7AV 2KECA 1KRTA 3G4SA 1YITA 1TR5A 4KI0A 1NY4A 4H02A 4HR7B 2ZXOA 2OT2A 5D65A 1HH2P 2VQEQ 2RVLA 2EYJA 3MEHA 1UE7A 2KCTA 1QE6A 3X3MA 1Y69U 1YZ6A 5CC4A 1WVLA 2R92G 2SDFA 3HG9A 3GTGB 2F0WA 3K7AH 2DGYA 4F88A 2UU9L 2NVYH 4X3KA 1VQBA 1U5KA 4NDXA 1F2LA 1LYLA 4KY7A 4ZRZA 3DEOA 3S2DH 4DAYB 2E2DC 2JP1A 4KD4A 4ABNA 4ZAIA 1KXLA 4M1UB 1O80A 4DUZL 5C3EH 3E5SA 1ZYRC 3GP7A 4V0BA 3GTJB 2NWGA 4KJNA 2AQ3B 2CVRA 2E2IB 1SYCA 1F2ZA 3HOVH 4IZ8A 4OXPA 1GUOA 3D4DA 3MXPA 5BR8Q 3STBD 1YIJA 4BBSH 4X66L 4WRDA 1VQAA 3BG3A 2ZJPA 4QB4A 2VB2X 4NKLA 3UI2A 2FINB 2E76C 2B2VA 2LXJA 2ENBA 5I2YA 4GOPA 3RZDH 1SMYC 4L5TA 4A3MG 1Y1WH 3Q8DA 4C3JG 3I4MG 3I2ZA 5I6YA 5IGCA 1ET9A 4IFDI 3NE5B 4NP5A 1XNRQ 3IFTA 1GXDC 1D1IA 4PZ8A 3HS0C 1SNMA 2K28A 3IFDA 4TQUS 4ZCKA 2OQ0A 1PFSA 3VA5A 3PIO3 2QDLA 3GQBA 5FOBB 1OXUA 1PTOH 1PLFA 4KKUA 5JEAH 1QNUA 1JC7A 5BN5A 3Q24A 3CAMA 2KQ3A 3QG1A 1N34L 2DJGC 1QG7A 2YTVA 3NTHA 1A3TA 4G57A 5I9PA 4N8FA 4RKBA 4XIGS 4JI8L 1U0LA 1B8AA 1ET6A 1E2ZA 4F87A 3KFUA 1RTNA 2BDOA 2MNAA 1MSHA 1RL2A 1J5EQ 2A5HA 1XNQQ 3FKIG 4YWMA 3MC0B 2N88A 4JBJA 2BH8A 3PMFA 3RD4A 3PUVA 1VQNA 5JVG3 3I73A 1SLJA 4IUUA 1OO9B 1SYEA 1Y14B 2CHBD 3H94A 2XRQD 1F9QA 4XQQA 3HOXH 3NTIA 2Q8TA 4IUPA 3I3CA 4G7HC 3IAYA 4RA8A 2WKCA 2OWOA 2NVQH 3HOUH 4LNQA 3HOWB 1K73C 4Y7NH 4BXXH 3PIOA 4PMCA 1CKNA 3R2IA 4HJ8A 2Z6KC 1K8OA 1NR2A 1SNOA 3KF8A 1HZBA 4DR7L 4IUTA 5IGFA 2PQEA 1WTXA 1E0BA 4EVOA 3K0XA 1HR0W 2UUBL 1B3AA 3A8JE 1PH8A 2R7ZH 4A3EH 5KEEA 2F0UA 2KJXA 5LL6S 1DYQA 3W1GA 3K5NA 3CCMA 1PRTB 2YTYA 1RJTA 2XWJB 4N9TA 4QUCA 1SRUA 2EYPA 2MFIA 1DOMA 1TWCB 3K80C 1ENAA 4GKJQ 4JG2A 2KVMA 3L9AX 4JI0Q 4A3GH 4DR2L 4R4QA 3CCQA 4OX9Q 3F2CA 5CBEE 3VDYA 4KTAA 5GROA 3A8IE 2EXZA 1AEXA 3SK6A 1HXYD 4HIDA 1O7LA 3BZCA 1ZYRD 4A3DH 4QCLA 1JWUD 4K5XA 1T5EA 1IHZA 1STHA 1HFGA 3VR5A 1AE2A 3BZKA 2B63G 1IXRA 1NJIC 4IFDG 5F2DA 3CC4A 3PO2B 1A2TA 4Z9CB 4ZKCB 2K5HA 2VUMH 5EKKA 1I3QH 4OONA 2A6HC 3GTLB 4IUQA 1ENCA 2FMCA 3BJUA 1PTOF 4A3IB 1LUZA 2N8NA 2F0PA 1RCVD 3PO3H 2R93G 4JI5Q 2F0MA 1YJNA 4P75A 5E4XA 1DCZA 1G8ZD 4C3JB 2M2LA 1PRTF 3CCLA 3HOWH 4X64L 2N49A 4DV1Q 4DU9A 3U9SA 2I46A 4UDUC 3UDGA 3K5LA 1BBXC 3T4AC 3C1EA 1N33Q 4J15A 4V190 1DOKA 1VQCA 4FNFA 2IHEA 2KCNA 4DR5Q 4DV6L 4LF8Q 4BBSG 4HN7A 3E6ZX 1LT5D 1D8LA 3QWNA 4U68A 5E4WC 3CCVA 1PH5A 4P74A 3BVMA 3OW2A 3IL8A 5M5XB 3GTMH 1AZPA 4CJ0B 2Q2HA 3PUXA 2NB0A 1IBLL 1XMQQ 1EZ8A 3NK9A 3EA6A 3OIQA 1G51A 2Z0SA 1G2TA 2B2YC 3V96A 3RN2A 4ME5A 1BR9A 1DGSA 2DJFC 1VQ4A 4LFCL 3FMCA 5I9OA 2I0QA 3CC7A 2F0TA 2JA5G 2E2HH 4BXXG 4IFDH 1EY0A 1PA6A 2BH2A 3S1MB 1EY9A 1CQVA 4A3DG 1KNAA 2E2HB 2PMZE 5ISRA 2ES2A 3ND8A 4H7BA 4RGOS 1Y1VB 1H9KA 4LUOA 3J7ZC 2JJQA 5C4JH 3J81E 3BS1A 1ILPA 3FP9A 4JI3Q 1TWFB 3CPWA 1NNXA 3EFXD 1SYDA 2Z8LA 3KJPA 3S17B 3HFZB 4GNXC 4R4OA 4JI4L 1W6JA 1HA5A 3R8BA 3F1ZA 2JA7B 4DUYQ 2MO1A 5GQOA 4JV5L 5ELFA 2JA8B 2G9DA 2PPBC 4O42A 1YVCA 2N3SA 3T1YQ 2K4KA 2H5XA 3AFQA 1FGBD 4AQYQ 2H1EA 4K5WA 3A5UA 4LFAL 4DR7Q 3QJYA 3S1RH 1JOQA 4KHZA 5E3FA 3CRKC 1PZID 4CKCA 1SE8A 4O1NA 1TY0A 4DR4L 3OMCA 3UE0A 2ZJRA 1EU3A 2EY6A 3I4MB 1GUNA 3Q0AA 1VQOA 3PO3B 2GVBA 2LFNA 4LF6Q 1VQIA 2HDMA 2BCOA 4DNRB 1QVCA 2XTIA 1M1KC 5M3MB 1Y1VG 2HCCA 3R3OA 1ESFA 1ML0D 4WJWA 2MGSA 2CW0C 2J0TD 3BU2A 4DV1L 5KIXA 3QB3A 5JJKA 2FJ2A 1L0WA 1B4OA 2HDLA 2ZTDA 4C1NK 4JI7L 2JA7G 1BXTA 1S5CD 4IUNA 2LS01 1AFPA 4A3FG 3GTLH 5L37A 4QQBX 3HOVB 1TWHH 4EQ5A 3I91A 4GKJL 4G7OC 4J6HA 2R7DA 3NELA 4MTKA 1TT2A 1S5DD 2JQOA 1EQQA 3QOLA 2VZAA 4BBSB 2UUCL 1PFBA 3EN2A 3H3VH 1SSOA 3D6WA 1C48A 3I70A 5HGQA 3D4RA 3M3YH 4A3JG 1CSQA 3HOYB 3TS2A 4B3TL 2D5DA 2NN6H 2WB1G 4NXML 5KGUA 3CPFA 3I8ZA 5GAHC 1CT1D 2RSOA 2F0GA 1D5ZC 4A3KH 4TKOB 4B3RL 5K5PA 1MIUA 4PMWA 2E2JH 2NVYB 1QUQB 1Q81C 1NMGA 1VQ9A 3GTGH 1II3A 1A2UA 5IT9E 2YU9B 1MI2A 2NBFA 1IBKQ 5T1GA 5CGKA 4LUVA 2EYOA 3MAQA 2L1BA 1IBKL 2HQLA 3RZOH 1FD7D 2EZVA 1EY4A 1X65A 4NXNL 2A73B 2Y0SB 2HUGA 4YCVA 4BY7B 1KABA 1Y8PB 4L5RC 4JI1Q 5FO7B 4CKEA 2UUBQ 5E1FA 4LF7Q 3TEHB 3F8TA 2CFMA 1FNVA 1IBMQ 5A2QL 4UP8A 3K59A 1X3GA 1IBML 1R4QB 4FYDA 5C4HA 1BCPB 3S1RB 1F2YA 1QILA 4QMGA 5FJ8H 4YCWA 1QZGA 2F0OA 5JJIA 2AQ1B 2IJ0A 1ZEQX 3M4QA 3WOEA 1IKMA 1D2BA 2RSNA 4C3HH 1PYWD 5CV6A 5DM73 4IPGA 3OYYA 3GTPB 2F0VA 4A3GB 4FO2A 1D1KA 3I90A 2B2YA 2ZTCA 2BA1A 1PTOB 3CC2A 1ZXTA 2A6ED 1RDPD 1UEAB 1HZAA 3H0GG 2EJGC 3SDZA 2K75A 4FF3A 1TY2A 4A93H 3TZUA 1B3QA 2NZOA 4R1JA 1ENFA 2YTXA 2IPKD 2M9VA 4ZLTF 5C4XH 3NBHA 2JA8G 3NENA 4PV1C 2O4XA 1WJJA 3M3YB 3ULLA 1QCBD 3OHXC 5FLMG 1LTID 1HR0Q 4JI6L 4LF6L 2VUMG 3NBHB 1EFID 1Q1BA 3H15A 5EGTA 3PF4A 5DEHA 1WTQA 4HTHA 4DR2Q 1S5FD 4A75A 3O13A 3OTOL 4ZKBB 1Q12A 5JPNC 4DR5L 2F0QA 5M5YB 1SAPA 3A55A 4HJAA 3KF6B 3K57A 4OWWB 5D3DA 1IYJB 4FXDA 3NHHA 1C8CA 1HJPA 1HFNA 3K6OA 5CORA 4LFAQ 3I7FA 4GNXB 4IPHA 1JOKA 4DAMA 1LLRD 3UDIA 2NVTH 2EXDA 4DV2L 3GTQH 1EEID 1KIXA 2EJMA 2NZ1D 3PF5A 1C4QA 1Z7TA 2LSSA 3K7AB 4CDEC 1A6XA 2ASBA 4DUYL 4X65L 4BBRB 4NMZA 1CHPD 3AFPA 1E1OA 4DR6Q 5GAEC 2F0FA 4RH6A 3S2DB 2MHVA 2JSOA 1DM0B 4C3HG 5CBAE 5J22A 3PUYA 5M3MH 1SXTA 4ZQ3A 4K0KQ 1MKHA 1VQKA 1CSPA 2L15A 1YNNC 4R8NA 4WJ3M 1X54A 2AMCB 5C3EG 1X56A 3I56A 4A3KG 4DAPA 5ELOA 1SROA 2HIVA 2ZJQA 1MSGA 3MXUA 2DY8A 5FO9B 4DK6C 1XNRL 4DNIA 2B2VC 4KN7C 4DPGA 4K5VA 1A8VA 2LMCB 1ASZA 1YEZA 3KJOA 4FF2A 5D3IB 5HY6A 4QJFA 1W2BA 2K1BA 2F0EA 5KYLA 4LF9Q 1F9RA 2DN8A 5M3FH 3VR2A 1NE3A 1X3PA 4UPAA 1SE4A 1HNWL 3MHBA 1HHVA 1YI2A 2R92H 5LMNL 2JA8H 5C4XG 1Q90A 1YNND 2K14A 2WP8J 1GO3E 5LMNQ 2K33A 1KAWA 1E1TA 4B9XA 2CWPA 4OL7A 3K5MA 2BOSA 1TWAH 1CKOA 1A15A 1SJED 3RNUA 1F2MA 1TS4A 5EKLA 1W6KA 2EIFA 1PVOA 4PG3A 1GM5A 1NCVA 2JXMB 3T13A 4UP7A 5HGTA 5K36H 1EUJA 1RF2D 1JJGA 2EDGA 1EIYB 3P1HA 2UXBQ 5C4XB 1DZ1A 1VQGA 2QW7A 3K81C 3D3RA 3ER0A 3L3OC 1OXXK 1U9RA 1LACA 1O7YA 3SVMA 3QR8A 5C6AA 2DNEA 3FKIH 4CJ2C 5HURA 3JAMc 3S15H 3ND9A 1N32L 1H9SA 1PTOC 2RHQB 3S1QB 1HA6A 4ID6A 4A3GG 1SR3A 2F1MA 3EJIA 2PO4A 1I94L 4A3MB 4B3SQ 3D6CA 4KHPQ 4CBVA 3FPPA 2PZWA 3HOYG 2GA4B 1M8AA 3L7ZC 2NVTB 1YNJC 3HOWG 2HIXA 4A3BG 4B3SL 1STGA 5IYDH 1LABA 1BCPC 4JK1C 4MIUA 3F2BA 1SE2A 4AYBE 1L0XB 5DM63 1FYCA 1TU2B 1XMOL 3AQQA 1X9NA 1GOZA 3MXGA 2QKIC 4RGNA 2I5MX 2CCZA 5GADC 5EPJA 1XPOA 4LMQD 4OX9L 3OW7A 3K8AA 1K8GA 1HNXQ 2C35B 2J4XA 5A35A 1JR0D 4JI1L 1VQ6A 2I5LX 1YJ9A 2WV6D 1HNXL 1Q86C 4GOPC 2A69C 1G2SA 3H0GH 3OTOQ 1NUCA 1TWFH 5C3WA 5C4JB 4I65A 2ZXRA 1RODA 4ODGA 3J80i 3S1QH 3FKIB 4CKBA 3M85A 1HR0L 4JI6Q 1EIGA 4YCUA 4A3LH 2VW9A 1CM9A 4EQNA 3MTSA 4KY6A 2WAQB 3EVQA 4QF4A 3G6JB 1GUGA 1EWCA 1KD1C 3L0OA 4LW1A 3HGBA 5KRUA 2RBMA 2B39A 3BVGA 4S3SA 2WACA 4OELB 3UDXA 4A3EG 3HOYH 5EQ0A 4GLAC 1K28A 2B8FA 4A3BH 1T9HA 1DD2A 2ICIA 3MEFA 3R93A 1XYIA 3BYTB 1VQEA 4BA2I 2R3ZA 4JI0L 2RKSA 1JB7A 3I4OA 3VYTA 1TIID 1TWCH 4C3IG 4RHRA 3N6RA 2SNMA 3RLNA 3Q6SA 3NSWA 1J6QA 4IPDA 3URYA 5AJ3Q 4IALA 5FLXE 1PH4A 1K83B 4IUVA 2UXDL 2Q8IB 1Q8IA 4LWCA 5KNCA 5FK9C 4NPSA 1AZQA 2PQAA 2RCNA 2VQEL 4N9PA 4B3MQ 3H0GB 2E5LQ 2F52A 5CV5A 3VR4A 4DR3Q 1YHBA 1PH3A 4N8X1 4DN4M 4KHPL 2QF7A 3Q22A 2X69A 3KBXA 3F2DA 2P5ZX 4KLKA 4Y7NB 4ZUJA 5D14A 3CCJA 1BCPD 3CXCA 4A3EB 4JOIC 4A3CH 1WI5A 1SMXA 4XT1B 1T5XD 2QEXA 1YNJD 5FKAC 1HTPA 4AYBB 5IYCH 4X3UA 5CV8A 2VQFL 3H91A 4DXGA 2JE6I 3I4NH 3J80L 4IURA 1VMPA 1RHPA 2VQFQ 3SGIA 4IJLA 4KHVA 1A3UA 4YY3L 2UXBL 3JC66 1YHAA 1V8QA 4A3JB 1Y1VH 4DV3L 1WOCA 4L6TB 1VQJA 1R9TB 4GKKQ 2R7ZB 1HUNA 1I4HA 4IN3A 5G3LF 4XTCS 3CCSA 3A7LA 1Q46A 1EIFA 2R61A 1A0IA 1YJWA 3H6MA 5A2QE 2LXKA 2AHOB 2F4VQ 4JI2L 1VQLA 3AMUA 1G6PA 1QNKA 5M5WH 3J80E 4E6IA 4LF4Q 2PW5A 4QUFA 1V9PA 1QVGA 3CRLC 5C44H 5KYIA 5CR3A 1EU4A 1XPRA 1LO5D 1QB5D 1WTWA 1AH9A 1VQFA 2Z4IA 1P16A 3ZYYX 2IX0A 2VS1A 4JI5L 2Z6BA 1KC8C 2AUJD 4BY1G 1FJGL 2G9HD 5IT9L 1JWSD 4XDXA 2Q2UA 4A93G 2XVSA 1QVFA 4DXFA 1KTKA 1B7YB 5C3XA 3UDFA 5JJLA 2F0HA 5IOCA 3CMAA 3S14B 1U4LA 4HEDA 1LTTD 3ICEA 5M3MG 1GUTA 4C3JH 3NWTA 1JQYD 3J81j 1GKHA 5FJ8G 3AYHB 3MXNA 2EPBA 1SNQA 5FLXL 2J7ZA 3J81i 1XX8A 4PMBA 1U4RA 4B3ML 2F0DA 2IX1A 2K01A 5ELBA 3I4NG 1HUMA 4DF7A 4GZYC 4DUZQ 4PQXA 2B63H 3GTKH 3A74A 3UE1A 1OXTA 1LTLA 3S16B 1FNUA 4NB3A 2EYLA 5ELCA 3CF5A 3MFGA 4BBRH 2SEBD 4A76A 3GTOB 2XN9C 1X32A 3LX0A 1DOLA 1W3SA 1HQRD 3V2TA 1WTHA 2RHSB 1U4MA 3IKJA 3V05A 2A6EC 1GUWA 3D31A 1JMCA 4XQNA 1UWVA 3TMEA 2BE5D 1K8AC 1VQHA 2HHHQ 1BVSA 4L5SA 4Q0FA 4HSVA 2BE5C 2K5DA 3GDEA 1STBA 2TMPA 5JPMC 3TP5A 1PTOD 4A3CG 4JBKA 3A7AB 4EX5A 2NN6G 3I72A 3GTQB 1SMYD 4LFBL 4DV5L 2UXCQ 1SNPA 1HNWQ 4DR3L 4LFBQ 4P72A 1K3BC 4B9WA 4DGZA 4BY7G 1PZJD 2DNCA 4IJHA 3HKZB 1S4ZA 1XMQL 2MUYA 2WKDA 1HTLD 3D4WA 1Z47A 5J1ZA 1N34Q 2F0LA 2KBNA 2A1AA 4R9WA 2MO0A 2F03A 2KEEA 5FLXc 2B2WC 1UAPA 3E9HA 1PYBA 5J3BA 3T16A 3D0FA 2BDNA 4LF4L 3A56A 1N8RC 1GVPA 2EYFA 1V43A 1LTGD 4HMIA 4R8IA 1XNQL 3KYHC 1TWGB 3BDLA 1L0YB 4X3SA 2K5WA 1IW7C 2E5LL 3KF6A 3C46A 4LJZC 2UUAQ 1M90C 1VQ5A 3KLSX 2K6AA 5LMNW 2X6LA 1XJVA 3U4ZA 3E9IA 1J9OA 3KLRA 1TVXA 1IL2A 1I5FA 2B8GA 1PFMA 2ZT9C 1EYGA 2K52A 4RG1A 2A68C 1MJEA 2C9OA 1G91A 3FPUB 3T1YL 3HKZG 2LY7A 1LT3D 3M4OB 1EY5A 3JAMi 2CH4W 1F9PA 1KLUD 4BY1H 4BS9A 1CKMA 2D0OA 1O78A 5JJZA 1UE6A 4JYAQ 3HOXB 4IPCA 1MJCA 3HKSA 1PHJA 3E0JA 3HOVG 4DV4L 2V1CC 2Z6KA 2JA9A 5IGDA 2MPMA 3QOJA 3KK7A 4RCNA 1BCPF 1IKLA 2XNAC 3K7UC 2Q8RE 2K03A 5ELDA 4X64Q 4UP9A 4HMJA 3HRZC 4RKLA 2ALYB 1TWGH 2WINB 4J8QA 2EYHA 3ERQA 1HNZL 1EFWA 1S5ED 2ZXPA 4I7AA 3TBIB 1UE1A 1FR3A 2A19A 2VY3A 4DK0A 4DV0Q 2OTJA 2B2UA 3TN2A 4RFBA 1IYVA 5C44G 2F0JA 1SEBD 1STEA 4OGQC 3CQZB 4QIWB 1SNDA 2PI2A 2IL8A 4C3IH 1XTCD 2CWAA 4RHSA 3TP8A 1BO0A 4OWXB 1SYGA 5C5LA 4BBRG 1C0AA 4B3RQ 4OIKA 1EEFD 4DV3Q 4OIJA 1KDCA 3B6YA 3PUWA 5H1SE 1OTCA 2FHTA 2MJ8A 2YV5A 5DAUA 1CKNB 4YHHL 2OCEA 2IW3A 5IWAL 1E22A 4DK3C 1XWEA 2F4IA 2B29A 2A68D 5M5XH 3GTMB 1F77A 5IWAQ 4POFA 5I6WA 3DHQA 4RGMA 3RLOA 3TS0A 4KJOA 4DAYA 1IZ6A 4R4IA 1I4PA 1CTMA 1JORA 3P7JA 4BY7H 1CI3M 3DWQA 1I4XA 4MZ9A 1CA6A 2VXWA 3CCRA 4DV7Q 1KHIA 4K8IA 3D8GA 4TRDA 5LL6X 1NMFA 4HIKA 2K7VA 5C4ZA 4M8AA 2E74C 3CCEA 2E8GA 4YY3Q 3J7A5 1GJXA 2ZTEA 5DNFA 4JI4Q 1I3QB 1PH2A 1K3RA 1EY6A 2VUMB 3DMUA 2B63B 3GTKB 4JV5Q 2NTSA 2IT1A 3MWYW 4LF7L 1HCZA 1I6VC 2A8VA 2V4DA 5J39A 4JCVE 1Y8NB 1Z6HA 1Q1EA 2F4VL 1WD1A 2KA7A 3SR1A 4TSSA 3BYYB 2UUCQ 1AE3A 2EY2A 5IYBH 1LT6D 1HZ9A 2K5VA 3FHWA 2L12A 3A5ZB 4GKKL 3S2HB 1DONA 2EOTA 2B2UC 3PO2G 3W1BA 2B2TA 4Q5VA 4NW2A 3CQZH 4OO1G 2JK8A 2JYOA 1FJGQ 2SOBA 2K5QA 3J7AF 3GO5A 1KAAA 1QOHA 3DWPA 1L1OC 4MTNA 4ULLA 4EQOA 3PQIA 4DV2Q 4JPBW 4K6DA 3EQLC 2EY1A 2K50A 3CMEA 4RAUC 3S17H 3H09A 5C0XJ 4KKTA 4WFN3 4DA2A 4A3KB 1R9TH 1Q8KA 3HKZE 1JICA 3U9OA 3JAML 3HOUB 1EYDA 3HOZG 3DM1A 4HIOA 2DY7A 3MVVA 1C9OA 3FDTA 2NZHA 3NXWA 4HCSA 2Z1CA 1GHJA 4GN5A 1ONLA 3AEVA 1BF4A 2BA0A 5K36G 1EWHA 4CJ1B 2WIIB 1UNSA 2RDFA 4LAAA 3K58A 1BKBA 4JBWA 1LTSD 2E2IH 1TKWB 1WTOA 2NYZD 4UAIA 3C3LA 2WAQE 1ASYA 4J1MA 4K2LA 3SXHA 1H9SB 1EZ6A 3P75A 1WTRA 2CW0D 1P8LA
chains in the Genus database with same CATH topology
1YHBA 1PH3A 2D62A 3S1RH 1KL9A 1FVIA 4KHPL 4KHZA 3F2DA 3MXNB 2KHJA 5LMUL 1SE8A 4ALPA 4JI7Q 4KLKA 4DR4L 2HHHL 3S24A 3UE0A 3CCJA 2RF4A 3CXCA 1YNXA 4JOIC 2FXQA 2ZJRA 4A3CH 1WI5A 1SMXA 1B70B 1TXYA 1VQOA 4GN4B 4O0AA 2QEXA 2GVBA 5M3FG 4LF6Q 1VQIA 3EBEA 1L2FA 3KDFA 1WCMH 5JEAJ 4IOAA 3J80c 1QVCA 2XTIA 1M1KC 1RIPA 2NN6I 1Y1VG 4DV6Q 4HJ7A 1X3FA 3CD6A 5IYCH 1JT8A 2VQFL 3BU2A 4DV1L 1EQRA 1PYSB 2JE6I 4DR1L 3I4NH 5JJKA 2VQFQ 3SGIA 2QA4A 2CKZB 4IJLA 1L0WA 3I4MG 2Q2IA 2ZTDA 4DV5Q 2UXCL 4YY3L 2EQSA 4JI7L 2JA7G 2UXBL 2IY5B 3JC66 1YHAA 1G291 2PI2E 4A3FG 3ERSX 3CCUA 3PO3G 1VS0A 4X66Q 2R93H 4JYAL 2CQOA 1GD7A 1EWIA 3DM3A 3GTLH 1CUKA 1Y1VH 3KOJA 4QQBX 4DV3L 1TWHH 1WOCA 4GKKQ 1VQJA 2KCMA 3DLLA 3HOUG 1VQ7A 4EQ5A 4GKJL 4XTCS 3CCSA 2KHIA 2ZM6Q 1Q46A 3S14H 2R7DA 1EIFA 2R7FA 3NELA 1A0IA 1YJWA 3WWVA 5DLQE 5JEAG 4PZ7A 1JE5A 2LXKA 2AHOB 2F4VQ 1X55A 4JI2L 2JQOA 4JC0A 1EQQA 1N36Q 1VQLA 4WJ4A 1FL0A 1G6PA 2VZAA 5M5WH 4GLXA 1V1QA 2UUCL 3EN2A 4HJ5A 4LF4Q 2ID0A 3H3VH 2WFWA 5IP7H 1V9PA 1QVGA 4POGA 5C44H 4JI3L 5IYBG 5HGQA 3T1HQ 3M3YH 4A3JG 1CSQA 1XPRA 3TS2A 1AH9A 1VQFA 3L2PA 1P16A 4B3TL 2ATWA 4A4IA 4X62L 2JA6H 4ME3A 2IX0A 2OTLA 4FDBA 3ULJA 1X3EA 2VS1A 2WB1G 4JI5L 4NXML 1KC8C 4X62Q 3CPFA 4BY1G 1FJGL 3PV0A 5IYDG 5GAHC 1QUQA 2Q2UA 1VQDA 4P71A 4A93G 2AKWB 4A3KH 4B3RL 3S1NH 1QVFA 2YYZA 3G71A 1MIUA 4PMWA 2E2JH 4LUZA 1QUQB 1Q81C 1B7YB 3KDFB 3UDFA 5BR8L 5JJLA 1NMGA 3HOXG 2WAQG 1VQ9A 3GTGH 4GS3A 1FGUA 3CMAA 2Q2TA 4LF5L 3I55A 1IBKQ 4JBMA 3ICEA 5M3MG 1J5EL 3ULPA 4LUVA 2Y0SE 1D7QA 4C3JH 4IO9A 1IBKL 4AQYL 3J81j 2WB1E 2HQLA 3RZOH 1GKHA 5FLMH 5FJ8G 3AYHB 1X65A 4NXNL 1KQSA 3J81c 4Y52H 4YCVA 1KRTA 3G4SA 1YITA 3J81i 4L5RC 1NY4A 1YBYA 4H02A 4KI0A 4JI1Q 4B3ML 1HH2P 4R4CA 3PGZA 2VQEQ 2UUBQ 3M4PA 3F8TA 2CFMA 3TEHB 4LF7Q 1UE7A 2KCTA 2IX1A 3I4NG 1E24A 4DUZQ 3CCLA 2B63H 1L1OA 4TVAB 3GTKH 3A74A 1YZ6A 1IBMQ 3UE1A 2R92G 1OXTA 1LTLA 4UP8A 4NB3A 3A0JA 2JA7H 3CF5A 1X3GA 1IBML 4BBRH 4A76A 4A3FH 1QZGA 5FJ8H 4YCWA 5JJIA 1QZHA 3M4QA 3K7AH 4P73A 1W3SA 1Q82C 2DGYA 2RHSB 4C3HH 2NVYH 1WYDA 2UU9L 4YWLA 1JJCB 1VQBA 2B3GA 2PNHA 4IPGA 2D0PA 3OYYA 1U5KA 4NXNQ 1LYLA 1X6OA 3D31A 1JMCA 2DUDA 1UWVA 4IFDJ 3S2DH 4DAYB 1K8AC 1VQHA 2HHHQ 1BVSA 1UEBA 4L5SA 2ZTCA 2F3IA 4DR6L 3GDEA 2ZM6L 2BA1A 1KXLA 3CC2A 2OQKA 4A3MH 1Y1WG 4DUZL 5C3EH 4MNOA 4BXXH 4A3CG 4DV7L 4JBKA 3E0EA 4EX5A 2NN6G 1HZAA 2QGQA 3H0GG 4AYBG 5GAGC 4LFBL 4DV5L 2UXCQ 1HNWQ 3HOVH 2K75A 4A3JH 4DR3L 4OXPA 4LFBQ 4P72A 4A93H 5BR8Q 3STBD 3RN5A 1YIJA 4BBSH 4BY7G 4X66L 1VQAA 2JA6G 4IJHA 2ZJPA 2NZOA 1XMQL 4AH6A 4R1JA 1PH6A 2YU9H 2YTXA 1Z47A 1N34Q 5C4XH 2JA8G 1YHQA 2LXJA 3NENA 3S15H 4GOPA 1WJJA 3RZDH 4L5TA 4A3MG 1Y1WH 2KBNA 3Q8DA 2A1AA 3I2ZA 3ULLA 1L1OB 2MO0A 1SN8A 5FLMG 5FLXc 1HR0Q 4JI6L 4LF6L 2VUMG 3NBHB 4IFDI 1Q1BA 5IT9c 3H15A 2AWOA 2IHFA 3E9HA 1PYBA 5J3BA 1OXSC 1XNRQ 3D0FA 3PF4A 4DR2Q 4LF4L 2XGTA 4PZ8A 4A75A 4TQUS 3OTOL 1N8RC 1GVPA 1Q12A 1V43A 2OQ0A 1PFSA 4DR5L 1XNQL 3KYHC 3U50C 4HJAA 1OXUA 3KF6B 1PV4A 4OWWB 3IRBA 1I6HH 1IYJB 1HJPA 3U4VA 3W5OA 4LFCQ 4LFAQ 2E5LL 3I7FA 1BBWA 3KF6A 4GNXB 4IPHA 3CAMA 4DAMA 3UDIA 2UUAQ 1M90C 2NVTH 3GD7A 1N34L 2EXDA 1VQ5A 5LMNW 3U58A 4DV2L 4L5QA 2YTVA 3ZJYC 1XJVA 1KIXA 3GTQH 3U4ZA 3E9IA 1WFQA 3PF5A 1IL2A 2LSSA 1I5FA 4XIGS 1H95A 2ASBA 4JI8L 4DUYL 1U0LA 5IP9G 1EYGA 2K52A 4X65L 1B8AA 5IE8A 4RG1A 1MJEA 3KFUA 4A3LG 4DR6Q 3AFPA 1E1OA 2MNAA 1KRSA 3HKZG 5GAEC 1K83H 1RL2A 5C0XG 3T1YL 1J5EQ 3JAMi 1JJ2A 3FKIG 1XNQQ 4YWMA 4JBJA 5EAYA 2BH8A 3PUVA 1VQNA 1SLJA 3PUYA 5M3MH 4BY1H 5AJ3L 4K0KQ 1A63A 1MKHA 1Y14B 1VQKA 1CKMA 1CSPA 2D0OA 2L15A 4DR1Q 1UE6A 1N33L 4JYAQ 1X54A 2AMCB 4IPCA 1X56A 3RR5A 5C3EG 3I56A 4A3KG 5ELOA 3HOXH 5IY0A 1MJCA 3HKSA 1SROA 1PHJA 3HOVG 2HIVA 2R7ZG 4LF8L 2ZJQA 4DV4L 2V1CC 2Z6KA 2JA9A 2KENA 4DK6C 1XNRL 4DNIA 1N36L 2OWOA 2NVQH 4LNQA 3HOUH 1K73C 3KF8B 3PIPA 4OO1I 4Y7NH 3S16H 4PZ6A 3K7UC 4DPGA 3PIOA 1A8VA 1Q7YC 1I50H 1CKNA 4OX9L 2HT1A 4HJ8A 2Z6KC 4X64Q 1SFOH 3M7NA 3PO2H 2JEBI 1ASZA 2AWNA 4UP9A 1YEZA 3PCOB 3KJOA 1HZBA 4DR7L 5HY6A 2ALYB 1TWGH 4QJFA 3K0XA 1W2BA 3NEMA 1HNZL 3TRZA 1HR0W 1OXVA 1S40A 4LF9Q 5M3FH 2UUBL 1EFWA 1VQMA 1PH8A 1NE3A 4UPAA 2R7ZH 1VQPA 1UE1A 4A3EH 1HNWL 5IP7G 2A19A 1PH7A 2VY3A 4DV0Q 2OTJA 1YI2A 2R92H 5LMNL 5IYCG 5C44G 2JA8H 2R6GA 5C4XG 1NTGA 1S3OA 2K14A 2PI2A 2WP8J 3W1GA 2YTYA 4C3IH 3CCMA 1GO3E 2CWAA 3LGJA 5LMNQ 1PH1A 3KLWA 4HIMA 1KAWA 1E1TA 5LMUQ 1E7ZA 1SRUA 2CWPA 4OWXB 2MFIA 4BBRG 1TWAH 1CKOA 1C0AA 3RNUA 4B3RQ 4DV3Q 3K80C 2EIFA 4GKJQ 3PUWA 3B6YA 3PUZA 4JG2A 5H1SE 1OTCA 1PVOA 4PG3A 1GM5A 4JI0Q 2YV5A 4A3GH 1K9MC 4DR2L 3G6EA 4UP7A 1EUJA 4R4QA 1CKNB 1N9WA 4YHHL 2OCEA 3F2CA 3CCQA 4OX9Q 1JJGA 5IWAL 1E22A 3M9BA 4DK3C 1EIYB 3STBC 3VDYA 5GROA 2UXBQ 2B29A 1VQGA 4HJ9A 4IOCA 3K81C 1EOVA 5M5XH 3ER0A 1OXXK 5IWAQ 4HIDA 4A3IG 1XTDA 3T1HL 3FKIH 3BZCA 4POFA 3JAMc 1XMOQ 4C2MH 3TS0A 3RLOA 4A3DH 1N32L 4K0KL 2RHQB 1IZ6A 4QY7A 4R4IA 4A3GG 1SR3A 4DV4Q 4JOIA 1I94L 1BBUA 4BY7H 3S1MH 4B3SQ 1K0RA 4KHPQ 1A62A 1AE2A 3BZKA 4YWKA 2B63G 4X65Q 1IXRA 1NJIC 3I4MH 3S2HH 4IFDG 4DR4Q 4MZ9A 3CC4A 3HOYG 3L7ZC 3CCRA 2VUMH 2K5HA 3TREA 3HOWG 2HIXA 4DV7Q 4A3BG 1KHIA 2PQAB 3CP0A 1I3QH 4OONA 4B3SL 4HIKA 1NMFA 4WJ3M 3HOZH 3GTPH 5IYDH 3BJUA 3F2BA 4AYBE 1LUZA 4LF5Q 2N8NA 4LF9L 5M5YH 3CCEA 1UE5A 2E8GA 4YY3Q 3J7A5 3PO3H 4DV0L 4JI5Q 4NXMQ 1XMOL 2R93G 3AQQA 1X9NA 1YJNA 2ZTEA 4P75A 1IBLQ 3HOWH 2N78A 4JI4Q 1PH2A 2UU9Q 3H3VI 2I5MX 1K3RA 2CCZA 3M4OH 5GADC 4GNXA 1XPOA 2UXDQ 2GN5A 2VL6A 3K8AA 4X64L 4DKAC 4YHHQ 5E7NA 2N49A 1K8GA 1HNXQ 4JV5Q 2C35B 4DV1Q 2IT1A 1VCIA 4JI1L 1VQ6A 2I5LX 1YJ9A 3UDGA 1HNXL 4O2DA 4GOPC 1Q86C 4LF7L 2GVAA 3H0GH 1N33Q 4J15A 1VQCA 2A8VA 3G48A 4R4TA 3OTOQ 4JCVE 4APVA 1TWFH 1Q1EA 2F4VL 2IHEA 3GTOH 4DR5Q 4DV6L 3J80i 5C0XI 3TQYA 3S1QH 2UUCQ 4LF8Q 1AE3A 4BBSG 1HR0L 3M85A 2JA5H 5IYBH 1S72A 4JI6Q 1HZ9A 2K5VA 4YCUA 1D8LA 1NBWA 3FHWA 2VW9A 4GLVB 4A3LH 2MQHA 3CCVA 1PH5A 4P74A 3A5ZB 4GKKL 3OW2A 3GTMH 2Q2HA 3PUXA 4GOPB 1IBLL 1XMQQ 3L0OA 1KD1C 3PO2G 1LM0A 2I5HA 3W1BA 4A3IH 4LW1A 1O7IA 1G51A 2JEAI 1N32Q 3CQZH 2Z0SA 1HNZQ 4OO1G 3PSIA 2JK8A 1WCMG 4QL5A 3RN2A 4UY8C 1DGSA 1FJGQ 1PH9A 1VQ4A 2VNUD 4LFCL 2I0QA 3RLFA 3CC7A 1I94Q 4QGUA 2Y0SG 2JA5G 3GO5A 3GTJH 4MTNA 1L1OC 3UDXA 1HZCA 2E2HH 4A3EG 4B3TQ 4BXXG 4DV2Q 2K50A 3CMEA 1PA6A 2UUAL 2BH2A 3HOYH 5ELNA 3S17H 4GLAC 4A3DG 4QIWE 1T9HA 5C0XJ 4A3BH 3MEFA 2PMZE 2K5NA 2ES2A 1VQEA 1R9TH 1Q8KA 3HKZE 1E3PA 4BA2I 4LUOA 1XPUA 1VQ8A 4JI0L 3HOZG 4HIOA 1JB7A 1C9OA 2JJQA 4GN3B 3J7ZC 3I4OA 5C4JH 3FP9A 4JI3Q 2NZHA 3CPWA 1TWCH 3EIVA 5IP9H 3CW2C 3KJPA 4RMFA 4GN5A 3AEVA 3HFZB 4GNXC 4R4OA 4JI4L 3RLNA 2BA0A 4AIMA 5K36G 1J6QA 4IPDA 3F1ZA 2NVXH 1C7YA 4X6AH 5AJ3Q 4JI8Q 4DUYQ 2MO1A 5GQOA 4JI2Q 4JV5L 1PH4A 4BA1I 2UXDL 1BKBA 1YVCA 4JBWA 4OWTB 2N3SA 3T1YQ 4LWCA 2E2IH 2K4KA 2H5XA 4NPSA 3AFQA 4AQYQ 2WAQE 1ASYA 2PQAA 2RCNA 1Z9FA 2VQEL 4B3MQ 2E5LQ 3A5UA 2F52A 4LFAL 4DR7Q 4DR3Q 1P8LA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1YHB A;  1PH3 A;  2D62 A;  3S1R H;  1KL9 A;  1FVI A;  4KHP L;  4KHZ A;  3F2D A;  3MXN B;  2KHJ A;  5LMU L;  1SE8 A;  4ALP A;  4JI7 Q;  4KLK A;  4DR4 L;  2HHH L;  3S24 A;  3UE0 A;  3CCJ A;  2RF4 A;  3CXC A;  1YNX A;  4JOI C;  2FXQ A;  2ZJR A;  4A3C H;  1WI5 A;  1SMX A;  1B70 B;  1TXY A;  1VQO A;  4GN4 B;  4O0A A;  2QEX A;  2GVB A;  5M3F G;  4LF6 Q;  1VQI A;  3EBE A;  1L2F A;  3KDF A;  1WCM H;  5JEA J;  4IOA A;  3J80 c;  1QVC A;  2XTI A;  1M1K C;  1RIP A;  2NN6 I;  1Y1V G;  4DV6 Q;  4HJ7 A;  1X3F A;  3CD6 A;  5IYC H;  1JT8 A;  2VQF L;  3BU2 A;  4DV1 L;  1EQR A;  1PYS B;  2JE6 I;  4DR1 L;  3I4N H;  5JJK A;  2VQF Q;  3SGI A;  2QA4 A;  2CKZ B;  4IJL A;  1L0W A;  3I4M G;  2Q2I A;  2ZTD A;  4DV5 Q;  2UXC L;  4YY3 L;  2EQS A;  4JI7 L;  2JA7 G;  2UXB L;  2IY5 B;  3JC6 6;  1YHA A;  1G29 1;  2PI2 E;  4A3F G;  3ERS X;  3CCU A;  3PO3 G;  1VS0 A;  4X66 Q;  2R93 H;  4JYA L;  2CQO A;  1GD7 A;  1EWI A;  3DM3 A;  3GTL H;  1CUK A;  1Y1V H;  3KOJ A;  4QQB X;  4DV3 L;  1TWH H;  1WOC A;  4GKK Q;  1VQJ A;  2KCM A;  3DLL A;  3HOU G;  1VQ7 A;  4EQ5 A;  4GKJ L;  4XTC S;  3CCS A;  2KHI A;  2ZM6 Q;  1Q46 A;  3S14 H;  2R7D A;  1EIF A;  2R7F A;  3NEL A;  1A0I A;  1YJW A;  3WWV A;  5DLQ E;  5JEA G;  4PZ7 A;  1JE5 A;  2LXK A;  2AHO B;  2F4V Q;  1X55 A;  4JI2 L;  2JQO A;  4JC0 A;  1EQQ A;  1N36 Q;  1VQL A;  4WJ4 A;  1FL0 A;  1G6P A;  2VZA A;  5M5W H;  4GLX A;  1V1Q A;  2UUC L;  3EN2 A;  4HJ5 A;  4LF4 Q;  2ID0 A;  3H3V H;  2WFW A;  5IP7 H;  1V9P A;  1QVG A;  4POG A;  5C44 H;  4JI3 L;  5IYB G;  5HGQ A;  3T1H Q;  3M3Y H;  4A3J G;  1CSQ A;  1XPR A;  3TS2 A;  1AH9 A;  1VQF A;  3L2P A;  1P16 A;  4B3T L;  2ATW A;  4A4I A;  4X62 L;  2JA6 H;  4ME3 A;  2IX0 A;  2OTL A;  4FDB A;  3ULJ A;  1X3E A;  2VS1 A;  2WB1 G;  4JI5 L;  4NXM L;  1KC8 C;  4X62 Q;  3CPF A;  4BY1 G;  1FJG L;  3PV0 A;  5IYD G;  5GAH C;  1QUQ A;  2Q2U A;  1VQD A;  4P71 A;  4A93 G;  2AKW B;  4A3K H;  4B3R L;  3S1N H;  1QVF A;  2YYZ A;  3G71 A;  1MIU A;  4PMW A;  2E2J H;  4LUZ A;  1QUQ B;  1Q81 C;  1B7Y B;  3KDF B;  3UDF A;  5BR8 L;  5JJL A;  1NMG A;  3HOX G;  2WAQ G;  1VQ9 A;  3GTG H;  4GS3 A;  1FGU A;  3CMA A;  2Q2T A;  4LF5 L;  3I55 A;  1IBK Q;  4JBM A;  3ICE A;  5M3M G;  1J5E L;  3ULP A;  4LUV A;  2Y0S E;  1D7Q A;  4C3J H;  4IO9 A;  1IBK L;  4AQY L;  3J81 j;  2WB1 E;  2HQL A;  3RZO H;  1GKH A;  5FLM H;  5FJ8 G;  3AYH B;  1X65 A;  4NXN L;  1KQS A;  3J81 c;  4Y52 H;  4YCV A;  1KRT A;  3G4S A;  1YIT A;  3J81 i;  4L5R C;  1NY4 A;  1YBY A;  4H02 A;  4KI0 A;  4JI1 Q;  4B3M L;  1HH2 P;  4R4C A;  3PGZ A;  2VQE Q;  2UUB Q;  3M4P A;  3F8T A;  2CFM A;  3TEH B;  4LF7 Q;  1UE7 A;  2KCT A;  2IX1 A;  3I4N G;  1E24 A;  4DUZ Q;  3CCL A;  2B63 H;  1L1O A;  4TVA B;  3GTK H;  3A74 A;  1YZ6 A;  1IBM Q;  3UE1 A;  2R92 G;  1OXT A;  1LTL A;  4UP8 A;  4NB3 A;  3A0J A;  2JA7 H;  3CF5 A;  1X3G A;  1IBM L;  4BBR H;  4A76 A;  4A3F H;  1QZG A;  5FJ8 H;  4YCW A;  5JJI A;  1QZH A;  3M4Q A;  3K7A H;  4P73 A;  1W3S A;  1Q82 C;  2DGY A;  2RHS B;  4C3H H;  2NVY H;  1WYD A;  2UU9 L;  4YWL A;  1JJC B;  1VQB A;  2B3G A;  2PNH A;  4IPG A;  2D0P A;  3OYY A;  1U5K A;  4NXN Q;  1LYL A;  1X6O A;  3D31 A;  1JMC A;  2DUD A;  1UWV A;  4IFD J;  3S2D H;  4DAY B;  1K8A C;  1VQH A;  2HHH Q;  1BVS A;  1UEB A;  4L5S A;  2ZTC A;  2F3I A;  4DR6 L;  3GDE A;  2ZM6 L;  2BA1 A;  1KXL A;  3CC2 A;  2OQK A;  4A3M H;  1Y1W G;  4DUZ L;  5C3E H;  4MNO A;  4BXX H;  4A3C G;  4DV7 L;  4JBK A;  3E0E A;  4EX5 A;  2NN6 G;  1HZA A;  2QGQ A;  3H0G G;  4AYB G;  5GAG C;  4LFB L;  4DV5 L;  2UXC Q;  1HNW Q;  3HOV H;  2K75 A;  4A3J H;  4DR3 L;  4OXP A;  4LFB Q;  4P72 A;  4A93 H;  5BR8 Q;  3STB D;  3RN5 A;  1YIJ A;  4BBS H;  4BY7 G;  4X66 L;  1VQA A;  2JA6 G;  4IJH A;  2ZJP A;  2NZO A;  1XMQ L;  4AH6 A;  4R1J A;  1PH6 A;  2YU9 H;  2YTX A;  1Z47 A;  1N34 Q;  5C4X H;  2JA8 G;  1YHQ A;  2LXJ A;  3NEN A;  3S15 H;  4GOP A;  1WJJ A;  3RZD H;  4L5T A;  4A3M G;  1Y1W H;  2KBN A;  3Q8D A;  2A1A A;  3I2Z A;  3ULL A;  1L1O B;  2MO0 A;  1SN8 A;  5FLM G;  5FLX c;  1HR0 Q;  4JI6 L;  4LF6 L;  2VUM G;  3NBH B;  4IFD I;  1Q1B A;  5IT9 c;  3H15 A;  2AWO A;  2IHF A;  3E9H A;  1PYB A;  5J3B A;  1OXS C;  1XNR Q;  3D0F A;  3PF4 A;  4DR2 Q;  4LF4 L;  2XGT A;  4PZ8 A;  4A75 A;  4TQU S;  3OTO L;  1N8R C;  1GVP A;  1Q12 A;  1V43 A;  2OQ0 A;  1PFS A;  4DR5 L;  1XNQ L;  3KYH C;  3U50 C;  4HJA A;  1OXU A;  3KF6 B;  1PV4 A;  4OWW B;  3IRB A;  1I6H H;  1IYJ B;  1HJP A;  3U4V A;  3W5O A;  4LFC Q;  4LFA Q;  2E5L L;  3I7F A;  1BBW A;  3KF6 A;  4GNX B;  4IPH A;  3CAM A;  4DAM A;  3UDI A;  2UUA Q;  1M90 C;  2NVT H;  3GD7 A;  1N34 L;  2EXD A;  1VQ5 A;  5LMN W;  3U58 A;  4DV2 L;  4L5Q A;  2YTV A;  3ZJY C;  1XJV A;  1KIX A;  3GTQ H;  3U4Z A;  3E9I A;  1WFQ A;  3PF5 A;  1IL2 A;  2LSS A;  1I5F A;  4XIG S;  1H95 A;  2ASB A;  4JI8 L;  4DUY L;  1U0L A;  5IP9 G;  1EYG A;  2K52 A;  4X65 L;  1B8A A;  5IE8 A;  4RG1 A;  1MJE A;  3KFU A;  4A3L G;  4DR6 Q;  3AFP A;  1E1O A;  2MNA A;  1KRS A;  3HKZ G;  5GAE C;  1K83 H;  1RL2 A;  5C0X G;  3T1Y L;  1J5E Q;  3JAM i;  1JJ2 A;  3FKI G;  1XNQ Q;  4YWM A;  4JBJ A;  5EAY A;  2BH8 A;  3PUV A;  1VQN A;  1SLJ A;  3PUY A;  5M3M H;  4BY1 H;  5AJ3 L;  4K0K Q;  1A63 A;  1MKH A;  1Y14 B;  1VQK A;  1CKM A;  1CSP A;  2D0O A;  2L15 A;  4DR1 Q;  1UE6 A;  1N33 L;  4JYA Q;  1X54 A;  2AMC B;  4IPC A;  1X56 A;  3RR5 A;  5C3E G;  3I56 A;  4A3K G;  5ELO A;  3HOX H;  5IY0 A;  1MJC A;  3HKS A;  1SRO A;  1PHJ A;  3HOV G;  2HIV A;  2R7Z G;  4LF8 L;  2ZJQ A;  4DV4 L;  2V1C C;  2Z6K A;  2JA9 A;  2KEN A;  4DK6 C;  1XNR L;  4DNI A;  1N36 L;  2OWO A;  2NVQ H;  4LNQ A;  3HOU H;  1K73 C;  3KF8 B;  3PIP A;  4OO1 I;  4Y7N H;  3S16 H;  4PZ6 A;  3K7U C;  4DPG A;  3PIO A;  1A8V A;  1Q7Y C;  1I50 H;  1CKN A;  4OX9 L;  2HT1 A;  4HJ8 A;  2Z6K C;  4X64 Q;  1SFO H;  3M7N A;  3PO2 H;  2JEB I;  1ASZ A;  2AWN A;  4UP9 A;  1YEZ A;  3PCO B;  3KJO A;  1HZB A;  4DR7 L;  5HY6 A;  2ALY B;  1TWG H;  4QJF A;  3K0X A;  1W2B A;  3NEM A;  1HNZ L;  3TRZ A;  1HR0 W;  1OXV A;  1S40 A;  4LF9 Q;  5M3F H;  2UUB L;  1EFW A;  1VQM A;  1PH8 A;  1NE3 A;  4UPA A;  2R7Z H;  1VQP A;  1UE1 A;  4A3E H;  1HNW L;  5IP7 G;  2A19 A;  1PH7 A;  2VY3 A;  4DV0 Q;  2OTJ A;  1YI2 A;  2R92 H;  5LMN L;  5IYC G;  5C44 G;  2JA8 H;  2R6G A;  5C4X G;  1NTG A;  1S3O A;  2K14 A;  2PI2 A;  2WP8 J;  3W1G A;  2YTY A;  4C3I H;  3CCM A;  1GO3 E;  2CWA A;  3LGJ A;  5LMN Q;  1PH1 A;  3KLW A;  4HIM A;  1KAW A;  1E1T A;  5LMU Q;  1E7Z A;  1SRU A;  2CWP A;  4OWX B;  2MFI A;  4BBR G;  1TWA H;  1CKO A;  1C0A A;  3RNU A;  4B3R Q;  4DV3 Q;  3K80 C;  2EIF A;  4GKJ Q;  3PUW A;  3B6Y A;  3PUZ A;  4JG2 A;  5H1S E;  1OTC A;  1PVO A;  4PG3 A;  1GM5 A;  4JI0 Q;  2YV5 A;  4A3G H;  1K9M C;  4DR2 L;  3G6E A;  4UP7 A;  1EUJ A;  4R4Q A;  1CKN B;  1N9W A;  4YHH L;  2OCE A;  3F2C A;  3CCQ A;  4OX9 Q;  1JJG A;  5IWA L;  1E22 A;  3M9B A;  4DK3 C;  1EIY B;  3STB C;  3VDY A;  5GRO A;  2UXB Q;  2B29 A;  1VQG A;  4HJ9 A;  4IOC A;  3K81 C;  1EOV A;  5M5X H;  3ER0 A;  1OXX K;  5IWA Q;  4HID A;  4A3I G;  1XTD A;  3T1H L;  3FKI H;  3BZC A;  4POF A;  3JAM c;  1XMO Q;  4C2M H;  3TS0 A;  3RLO A;  4A3D H;  1N32 L;  4K0K L;  2RHQ B;  1IZ6 A;  4QY7 A;  4R4I A;  4A3G G;  1SR3 A;  4DV4 Q;  4JOI A;  1I94 L;  1BBU A;  4BY7 H;  3S1M H;  4B3S Q;  1K0R A;  4KHP Q;  1A62 A;  1AE2 A;  3BZK A;  4YWK A;  2B63 G;  4X65 Q;  1IXR A;  1NJI C;  3I4M H;  3S2H H;  4IFD G;  4DR4 Q;  4MZ9 A;  3CC4 A;  3HOY G;  3L7Z C;  3CCR A;  2VUM H;  2K5H A;  3TRE A;  3HOW G;  2HIX A;  4DV7 Q;  4A3B G;  1KHI A;  2PQA B;  3CP0 A;  1I3Q H;  4OON A;  4B3S L;  4HIK A;  1NMF A;  4WJ3 M;  3HOZ H;  3GTP H;  5IYD H;  3BJU A;  3F2B A;  4AYB E;  1LUZ A;  4LF5 Q;  2N8N A;  4LF9 L;  5M5Y H;  3CCE A;  1UE5 A;  2E8G A;  4YY3 Q;  3J7A 5;  3PO3 H;  4DV0 L;  4JI5 Q;  4NXM Q;  1XMO L;  2R93 G;  3AQQ A;  1X9N A;  1YJN A;  2ZTE A;  4P75 A;  1IBL Q;  3HOW H;  2N78 A;  4JI4 Q;  1PH2 A;  2UU9 Q;  3H3V I;  2I5M X;  1K3R A;  2CCZ A;  3M4O H;  5GAD C;  4GNX A;  1XPO A;  2UXD Q;  2GN5 A;  2VL6 A;  3K8A A;  4X64 L;  4DKA C;  4YHH Q;  5E7N A;  2N49 A;  1K8G A;  1HNX Q;  4JV5 Q;  2C35 B;  4DV1 Q;  2IT1 A;  1VCI A;  4JI1 L;  1VQ6 A;  2I5L X;  1YJ9 A;  3UDG A;  1HNX L;  4O2D A;  4GOP C;  1Q86 C;  4LF7 L;  2GVA A;  3H0G H;  1N33 Q;  4J15 A;  1VQC A;  2A8V A;  3G48 A;  4R4T A;  3OTO Q;  4JCV E;  4APV A;  1TWF H;  1Q1E A;  2F4V L;  2IHE A;  3GTO H;  4DR5 Q;  4DV6 L;  3J80 i;  5C0X I;  3TQY A;  3S1Q H;  2UUC Q;  4LF8 Q;  1AE3 A;  4BBS G;  1HR0 L;  3M85 A;  2JA5 H;  5IYB H;  1S72 A;  4JI6 Q;  1HZ9 A;  2K5V A;  4YCU A;  1D8L A;  1NBW A;  3FHW A;  2VW9 A;  4GLV B;  4A3L H;  2MQH A;  3CCV A;  1PH5 A;  4P74 A;  3A5Z B;  4GKK L;  3OW2 A;  3GTM H;  2Q2H A;  3PUX A;  4GOP B;  1IBL L;  1XMQ Q;  3L0O A;  1KD1 C;  3PO2 G;  1LM0 A;  2I5H A;  3W1B A;  4A3I H;  4LW1 A;  1O7I A;  1G51 A;  2JEA I;  1N32 Q;  3CQZ H;  2Z0S A;  1HNZ Q;  4OO1 G;  3PSI A;  2JK8 A;  1WCM G;  4QL5 A;  3RN2 A;  4UY8 C;  1DGS A;  1FJG Q;  1PH9 A;  1VQ4 A;  2VNU D;  4LFC L;  2I0Q A;  3RLF A;  3CC7 A;  1I94 Q;  4QGU A;  2Y0S G;  2JA5 G;  3GO5 A;  3GTJ H;  4MTN A;  1L1O C;  3UDX A;  1HZC A;  2E2H H;  4A3E G;  4B3T Q;  4BXX G;  4DV2 Q;  2K50 A;  3CME A;  1PA6 A;  2UUA L;  2BH2 A;  3HOY H;  5ELN A;  3S17 H;  4GLA C;  4A3D G;  4QIW E;  1T9H A;  5C0X J;  4A3B H;  3MEF A;  2PMZ E;  2K5N A;  2ES2 A;  1VQE A;  1R9T H;  1Q8K A;  3HKZ E;  1E3P A;  4BA2 I;  4LUO A;  1XPU A;  1VQ8 A;  4JI0 L;  3HOZ G;  4HIO A;  1JB7 A;  1C9O A;  2JJQ A;  4GN3 B;  3J7Z C;  3I4O A;  5C4J H;  3FP9 A;  4JI3 Q;  2NZH A;  3CPW A;  1TWC H;  3EIV A;  5IP9 H;  3CW2 C;  3KJP A;  4RMF A;  4GN5 A;  3AEV A;  3HFZ B;  4GNX C;  4R4O A;  4JI4 L;  3RLN A;  2BA0 A;  4AIM A;  5K36 G;  1J6Q A;  4IPD A;  3F1Z A;  2NVX H;  1C7Y A;  4X6A H;  5AJ3 Q;  4JI8 Q;  4DUY Q;  2MO1 A;  5GQO A;  4JI2 Q;  4JV5 L;  1PH4 A;  4BA1 I;  2UXD L;  1BKB A;  1YVC A;  4JBW A;  4OWT B;  2N3S A;  3T1Y Q;  4LWC A;  2E2I H;  2K4K A;  2H5X A;  4NPS A;  3AFQ A;  4AQY Q;  2WAQ E;  1ASY A;  2PQA A;  2RCN A;  1Z9F A;  2VQE L;  4B3M Q;  2E5L Q;  3A5U A;  2F52 A;  4LFA L;  4DR7 Q;  4DR3 Q;  1P8L A; 
#chains in the Genus database with same CATH topology
 2O2L D;  2KED A;  1KL9 A;  1MGS A;  5LMU L;  2KHJ A;  4ALP A;  4JI7 Q;  2L0C A;  3BVZ A;  2HHH L;  1I4R A;  2RF4 A;  1YNX A;  2KUM A;  1B70 B;  3RUZ A;  4CDF C;  1TXY A;  4GN4 B;  4O0A A;  5KNB A;  1L2F A;  1SYB A;  2K32 A;  3QO2 A;  1LV9 A;  5C44 B;  2E2J B;  4ZK9 B;  1RIP A;  2NN6 I;  1X3F A;  5LHY 1;  1SFO B;  1JT8 A;  4C2M B;  4L63 B;  3Q23 A;  1GHK A;  3WOF A;  1V1P A;  1PYS B;  3DXJ C;  2F3W A;  3NQI A;  4KN4 C;  4FP5 D;  2NVX B;  3PIP 3;  1TQO A;  2EYM A;  3C2P A;  2QA4 A;  2CKZ B;  1JOO A;  1B2T A;  1CZW A;  2EQS A;  2RCF A;  2PI2 E;  3CCU A;  3PO3 G;  2R93 H;  4X66 Q;  3DM3 A;  1EWI A;  1CUK A;  3KOJ A;  2F3V A;  1VQ7 A;  3BZD B;  3NP8 A;  2KHI A;  3S14 H;  1QJO A;  1SJH D;  2L5T A;  5JEA G;  4PZ7 A;  1JE5 A;  1BQQ T;  1X55 A;  4JC0 A;  1N36 Q;  5EBC A;  1I50 B;  2QCP X;  4GLX A;  1TWH B;  2EJF C;  2RQX A;  5IP7 H;  1MHW C;  2OXP A;  5JOB A;  4POG A;  4JI3 L;  5M3F B;  5IYB G;  3VA7 A;  5IGB A;  3H3V C;  3L2P A;  2Z4H A;  3OIP A;  4A4I A;  2JA6 H;  1GUS A;  2OTL A;  4FDB A;  5EPL A;  1X3E A;  3ULJ A;  3VYU A;  2EVB A;  3M4Y A;  2G5D A;  3PV0 A;  4DNT B;  1K8M A;  2R93 B;  2AKW B;  3GV3 A;  1JE4 A;  1TS5 A;  4H0L C;  1ICF B;  4H44 C;  4LUZ A;  3BDO A;  1A3V A;  3KDF B;  4DK1 A;  5BR8 L;  3HOX G;  2WAQ G;  3TSS A;  2PZT A;  2F0S A;  2RDH A;  4OEM B;  3OWE B;  2Q2T A;  3DUZ A;  5I4D A;  4LF5 L;  3S9W A;  3LWE A;  4C1N I;  4JBM A;  2XSC A;  4CGY B;  1SE3 A;  2Y0S E;  1B9N A;  4K8J A;  4IO9 A;  5KND A;  5FLM H;  1J8I A;  2CQA A;  3J81 c;  4Y52 H;  1E2W A;  3F2U A;  4IQZ A;  3AU7 A;  3QIA A;  1YBY A;  4R4C A;  3PGZ A;  3M4P A;  3S1N B;  2EE1 A;  4G7Z C;  3T53 B;  1E24 A;  4A3D B;  1L1O A;  4TVA B;  3J81 L;  1WD0 A;  3A0J A;  2JA7 H;  5CV9 A;  5IGE A;  4ZYS A;  1I6H B;  4A3F H;  3J7Y W;  1QZH A;  1Q82 C;  4P73 A;  1WYD A;  5CMD A;  3T56 B;  4YWL A;  1JJC B;  2B3G A;  2PNH A;  4BY1 B;  2D0P A;  1LTB D;  4U67 3;  4KKS A;  1ICW A;  3NQT A;  4NXN Q;  1X6O A;  2DUD A;  4IFD J;  1UEB A;  1EYC A;  1HPC A;  1LT4 D;  2F3I A;  4DR6 L;  4HAE A;  2ZM6 L;  4L8J A;  2OQK A;  4A3M H;  1Y1W G;  4MNO A;  3VR3 A;  2PW7 A;  4DV7 L;  3E0E A;  1VMC A;  2QGQ A;  2H4O A;  4AYB G;  1R4P B;  4XYQ A;  5GAG C;  2L55 A;  2QIL A;  4A3J H;  4FF1 A;  2L4N A;  2HQE A;  3RN5 A;  1X3Q A;  2FFK B;  1EY8 A;  3W3A A;  3MZ5 A;  3OWF A;  2JA6 G;  2NTT A;  4AH6 A;  4RWS C;  3X3N A;  1PH6 A;  1IL8 A;  2YU9 H;  1LTA D;  1YHQ A;  1AW7 A;  1D5X C;  2MP1 A;  1BUV T;  1PZK D;  3P20 A;  1L1O B;  1SN8 A;  5IT9 c;  2AWO A;  2IHF A;  2XWB B;  3NPP A;  1OXS C;  4JVZ A;  2XGT A;  3T51 B;  4FXK C;  4DAV A;  4HCE A;  2IWH A;  3S15 B;  3U50 C;  2HD3 A;  1BOS A;  3OPO A;  2M00 A;  1PV4 A;  1I6H H;  3IRB A;  4WOR A;  3U4V A;  4FXG C;  3W5O A;  1PFN A;  3ONA B;  3I4N B;  1SDF A;  3DEP A;  4LFC Q;  4FF4 A;  1BBW A;  1B9M A;  3SK5 A;  2VB3 X;  3DWA A;  1RD9 D;  3GD7 A;  2IX3 A;  1H9R A;  3U58 A;  3LNN A;  1U4P A;  4L5Q A;  1S5B D;  3ZJY C;  4DFA A;  1WFQ A;  2OF1 A;  5CYU A;  2N55 A;  1H95 A;  1JWM D;  2QDB A;  5IP9 G;  1I4G A;  4CDC C;  1RTO A;  5IE8 A;  3AB9 A;  4C3I B;  4A3L G;  4F7X A;  1NAP A;  3OSO A;  4MHE A;  4RCO A;  1KRS A;  5C0X G;  1JJ2 A;  1K83 H;  4MN3 A;  5EAY A;  1WTP A;  1A63 A;  2F0I A;  3G7L A;  5AJ3 L;  2A6H D;  3E3X A;  1N33 L;  4DR1 Q;  3GV6 A;  3RR5 A;  5IY0 A;  5AFW A;  2R7Z G;  2A74 C;  4LF8 L;  4ILW A;  2KEN A;  2L9H A;  2CH4 A;  5NUC A;  1N36 L;  3KF8 B;  3PIP A;  4OO1 I;  3S16 H;  4PZ6 A;  2HT1 A;  1Q7Y C;  2WB1 B;  1I50 H;  4YIJ A;  3VYR A;  3PO2 H;  1SFO H;  3M7N A;  2JEB I;  4HSP A;  2AWN A;  1MBY A;  3PCO B;  2JA6 B;  1PDQ A;  3KLS A;  3VR6 A;  3TP7 A;  5JAV A;  1SYF A;  1FNW A;  4ZUI A;  3NEM A;  3TRZ A;  1OXV A;  1RKN A;  1S40 A;  1NR4 A;  1D5M C;  1VQM A;  1VQP A;  1F9S A;  2R92 B;  5IP7 G;  1PH7 A;  5IYC G;  2R6G A;  1NTG A;  1S3O A;  4A3B B;  3FRP B;  3LGJ A;  1PH1 A;  2QEJ C;  4F8M A;  2B2T C;  3KLW A;  3MFY A;  1UUP A;  4PNY A;  4HIM A;  5LMU Q;  3OMG A;  1E7Z A;  2AQ2 B;  5C5M A;  1KDB A;  3KUP A;  5ELE A;  2PNR C;  1HQM C;  1V1O A;  3PUZ A;  1B1Z A;  1K9M C;  1TS2 A;  3G6E A;  3A54 A;  5M5W B;  2O5I C;  1N9W A;  5T1I A;  1H9J A;  1STN A;  2KCC A;  3K0Y A;  3M9B A;  1B50 A;  2F0N A;  2HCI A;  2FMM A;  3STB C;  1B53 A;  2OEO A;  2KHS A;  3HP3 A;  4HJ9 A;  4IOC A;  4G4K A;  1EOV A;  2I07 B;  5BN4 A;  1KNE A;  1EOT A;  2AUK A;  4RGT A;  4A3I G;  1XTD A;  4I7Z C;  3T1H L;  1XMO Q;  1MD2 D;  4C2M H;  2F0K A;  3A8K E;  4K0K L;  4QY7 A;  1NSN S;  3TDQ A;  1CFM A;  4DV4 Q;  4JOI A;  1BBU A;  3S1M H;  1IW7 D;  1JB3 A;  1K0R A;  4A3F B;  1A62 A;  2E75 C;  3I4M H;  4YWK A;  3SK8 A;  4X65 Q;  3S2H H;  3LWU A;  4DR4 Q;  3M7G A;  2B2W A;  1VF7 A;  3TRE A;  1Y8O B;  2PQA B;  3CP0 A;  2A69 D;  1DJR D;  2NVQ B;  3JAM E;  3HOZ H;  3GTP H;  3TP6 A;  3TZD A;  4XYO A;  4LF5 Q;  4LF9 L;  5M5Y H;  1UE5 A;  5EBD A;  4DV0 L;  4KD3 A;  4NXM Q;  1TS3 A;  1IBL Q;  2N78 A;  2UU9 Q;  3HEJ A;  3K5O A;  3H3V I;  1CA5 A;  3M4O H;  4GNX A;  2UXD Q;  2GN5 A;  2VL6 A;  4YHH Q;  4DKA C;  5E7N A;  1LTR D;  4UHV A;  1VCI A;  4O2D A;  2PYK A;  2GVA A;  4K6L A;  2ICE C;  3G48 A;  4R4T A;  4APV A;  3GTO H;  2D2C C;  1EL0 A;  1EQV A;  4OHJ A;  3TQY A;  5C0X I;  4A93 B;  2JN4 A;  3RZO B;  2PCF B;  2JA5 H;  1S72 A;  3FVQ A;  1CK1 A;  2K04 A;  1NBW A;  4GLV B;  2MQH A;  1PRT C;  3RZD B;  4GOP B;  1LM0 A;  2I5H A;  4A3I H;  1O7I A;  5EKI A;  2JEA I;  1N32 Q;  1HNZ Q;  3WDN A;  3PSI A;  1AN8 A;  1WCM G;  4QL5 A;  2VNU D;  4UY8 C;  2O5J C;  1PH9 A;  1QWY A;  4K14 A;  3RLF A;  5G3L D;  1I94 Q;  1E2V A;  4QGU A;  2Y0S G;  2RA4 A;  3GTJ H;  4B08 A;  1HZC A;  4KMU C;  4B3T Q;  4C3H B;  1I4Q A;  2L11 A;  2UUA L;  3FEW X;  5ELN A;  2PZU A;  1KDA A;  4XXE A;  4QIW E;  1SBB B;  2K5N A;  1E3P A;  5IOD A;  1D6E C;  4OO1 H;  4C56 C;  3MA2 B;  1XPU A;  1PRT D;  1STA A;  1VQ8 A;  4GN3 B;  2D9U A;  1VDZ A;  1WCM B;  3EIV A;  5IP9 H;  3CW2 C;  4RMF A;  3ERO A;  4BWG B;  2Z9H A;  1ESR A;  5COY A;  4AIM A;  2NVX H;  1C7Y A;  4X6A H;  4JI8 Q;  1CZG A;  4JI2 Q;  4BA1 I;  1EY7 A;  1XXG A;  4OWT B;  3SK4 A;  4CHT B;  3SE0 A;  1M4V A;  3SEB A;  4FVM A;  1Z9F A;  2NUC A;  3CHB D;  4CDD C;  2D62 A;  1ILQ A;  2XIW A;  3RMH A;  1FVI A;  1PXU A;  3MXN B;  3CKI B;  1ZKO A;  4P2C B;  2JA5 B;  3S24 A;  2FXQ A;  3NBI A;  3N52 A;  1IYU A;  4H13 C;  5M3F G;  3EBE A;  3KDF A;  1WCM H;  5JEA J;  4IOA A;  3J80 c;  5BN3 A;  2LKV A;  4DV6 Q;  4HJ7 A;  3HOZ B;  1G6Z A;  3CD6 A;  4KY5 A;  3NTK A;  4JW0 A;  1H9M A;  3I4L A;  1Q3L A;  1EQR A;  4DR1 L;  5EJW A;  4K2K A;  1EYA A;  4EGV A;  3NUC A;  5JVH 3;  2PMZ B;  2Q2I A;  4DV5 Q;  4X3T A;  2UXC L;  2IY5 B;  5IIF A;  1G29 1;  3ERS X;  1AP0 A;  2SNS A;  1VS0 A;  4XT3 B;  4JYA L;  2CQO A;  1GD7 A;  2TSS A;  2X6G A;  1CQF A;  3DLL A;  2KCM A;  3HOU G;  3KBG A;  1CHQ D;  1K0S A;  2ZM6 Q;  1O7Z A;  2R7F A;  1VF5 C;  3WWV A;  3HZX A;  5DLQ E;  3SHL A;  5M9O A;  1STY A;  1B44 D;  4WJ4 A;  3W2D A;  3CU7 A;  4EQP A;  1FL0 A;  1SNC A;  1V1Q A;  3ITP A;  4HJ5 A;  2ID0 A;  2XRS D;  1HRJ A;  2WFW A;  4XQJ A;  3OOC A;  1V1P B;  3T1H Q;  1Y1W B;  1KLG D;  1DXM A;  2ATW A;  5CV4 A;  4X62 L;  4ME3 A;  5I2X A;  5CV7 A;  5FO8 B;  5C0X H;  4X62 Q;  3VYS A;  5IYD G;  3R2T A;  1QUQ A;  1PMR A;  3NWS A;  2EY5 A;  1VQD A;  4P71 A;  3S1N H;  2C5C A;  2YYZ A;  3G71 A;  1BDO A;  1EIH A;  3C1F A;  1TWA B;  2K05 A;  5C3E B;  4GS3 A;  1FGU A;  4KV6 A;  3I55 A;  5TSS A;  1BNZ A;  2RDG A;  4LK1 C;  1J5E L;  4KK7 A;  5IGG A;  3ULP A;  1D7Q A;  1WTV A;  3BDC A;  2KOL A;  4AQY L;  2WB1 E;  1EQT A;  1KQS A;  1JCK B;  5EPK A;  3J7A V;  2KEC A;  1KRT A;  3G4S A;  1YIT A;  1TR5 A;  4KI0 A;  1NY4 A;  4H02 A;  4HR7 B;  2ZXO A;  2OT2 A;  5D65 A;  1HH2 P;  2VQE Q;  2RVL A;  2EYJ A;  3MEH A;  1UE7 A;  2KCT A;  1QE6 A;  3X3M A;  1Y69 U;  1YZ6 A;  5CC4 A;  1WVL A;  2R92 G;  2SDF A;  3HG9 A;  3GTG B;  2F0W A;  3K7A H;  2DGY A;  4F88 A;  2UU9 L;  2NVY H;  4X3K A;  1VQB A;  1U5K A;  4NDX A;  1F2L A;  1LYL A;  4KY7 A;  4ZRZ A;  3DEO A;  3S2D H;  4DAY B;  2E2D C;  2JP1 A;  4KD4 A;  4ABN A;  4ZAI A;  1KXL A;  4M1U B;  1O80 A;  4DUZ L;  5C3E H;  3E5S A;  1ZYR C;  3GP7 A;  4V0B A;  3GTJ B;  2NWG A;  4KJN A;  2AQ3 B;  2CVR A;  2E2I B;  1SYC A;  1F2Z A;  3HOV H;  4IZ8 A;  4OXP A;  1GUO A;  3D4D A;  3MXP A;  5BR8 Q;  3STB D;  1YIJ A;  4BBS H;  4X66 L;  4WRD A;  1VQA A;  3BG3 A;  2ZJP A;  4QB4 A;  2VB2 X;  4NKL A;  3UI2 A;  2FIN B;  2E76 C;  2B2V A;  2LXJ A;  2ENB A;  5I2Y A;  4GOP A;  3RZD H;  1SMY C;  4L5T A;  4A3M G;  1Y1W H;  3Q8D A;  4C3J G;  3I4M G;  3I2Z A;  5I6Y A;  5IGC A;  1ET9 A;  4IFD I;  3NE5 B;  4NP5 A;  1XNR Q;  3IFT A;  1GXD C;  1D1I A;  4PZ8 A;  3HS0 C;  1SNM A;  2K28 A;  3IFD A;  4TQU S;  4ZCK A;  2OQ0 A;  1PFS A;  3VA5 A;  3PIO 3;  2QDL A;  3GQB A;  5FOB B;  1OXU A;  1PTO H;  1PLF A;  4KKU A;  5JEA H;  1QNU A;  1JC7 A;  5BN5 A;  3Q24 A;  3CAM A;  2KQ3 A;  3QG1 A;  1N34 L;  2DJG C;  1QG7 A;  2YTV A;  3NTH A;  1A3T A;  4G57 A;  5I9P A;  4N8F A;  4RKB A;  4XIG S;  4JI8 L;  1U0L A;  1B8A A;  1ET6 A;  1E2Z A;  4F87 A;  3KFU A;  1RTN A;  2BDO A;  2MNA A;  1MSH A;  1RL2 A;  1J5E Q;  2A5H A;  1XNQ Q;  3FKI G;  4YWM A;  3MC0 B;  2N88 A;  4JBJ A;  2BH8 A;  3PMF A;  3RD4 A;  3PUV A;  1VQN A;  5JVG 3;  3I73 A;  1SLJ A;  4IUU A;  1OO9 B;  1SYE A;  1Y14 B;  2CHB D;  3H94 A;  2XRQ D;  1F9Q A;  4XQQ A;  3HOX H;  3NTI A;  2Q8T A;  4IUP A;  3I3C A;  4G7H C;  3IAY A;  4RA8 A;  2WKC A;  2OWO A;  2NVQ H;  3HOU H;  4LNQ A;  3HOW B;  1K73 C;  4Y7N H;  4BXX H;  3PIO A;  4PMC A;  1CKN A;  3R2I A;  4HJ8 A;  2Z6K C;  1K8O A;  1NR2 A;  1SNO A;  3KF8 A;  1HZB A;  4DR7 L;  4IUT A;  5IGF A;  2PQE A;  1WTX A;  1E0B A;  4EVO A;  3K0X A;  1HR0 W;  2UUB L;  1B3A A;  3A8J E;  1PH8 A;  2R7Z H;  4A3E H;  5KEE A;  2F0U A;  2KJX A;  5LL6 S;  1DYQ A;  3W1G A;  3K5N A;  3CCM A;  1PRT B;  2YTY A;  1RJT A;  2XWJ B;  4N9T A;  4QUC A;  1SRU A;  2EYP A;  2MFI A;  1DOM A;  1TWC B;  3K80 C;  1ENA A;  4GKJ Q;  4JG2 A;  2KVM A;  3L9A X;  4JI0 Q;  4A3G H;  4DR2 L;  4R4Q A;  3CCQ A;  4OX9 Q;  3F2C A;  5CBE E;  3VDY A;  4KTA A;  5GRO A;  3A8I E;  2EXZ A;  1AEX A;  3SK6 A;  1HXY D;  4HID A;  1O7L A;  3BZC A;  1ZYR D;  4A3D H;  4QCL A;  1JWU D;  4K5X A;  1T5E A;  1IHZ A;  1STH A;  1HFG A;  3VR5 A;  1AE2 A;  3BZK A;  2B63 G;  1IXR A;  1NJI C;  4IFD G;  5F2D A;  3CC4 A;  3PO2 B;  1A2T A;  4Z9C B;  4ZKC B;  2K5H A;  2VUM H;  5EKK A;  1I3Q H;  4OON A;  2A6H C;  3GTL B;  4IUQ A;  1ENC A;  2FMC A;  3BJU A;  1PTO F;  4A3I B;  1LUZ A;  2N8N A;  2F0P A;  1RCV D;  3PO3 H;  2R93 G;  4JI5 Q;  2F0M A;  1YJN A;  4P75 A;  5E4X A;  1DCZ A;  1G8Z D;  4C3J B;  2M2L A;  1PRT F;  3CCL A;  3HOW H;  4X64 L;  2N49 A;  4DV1 Q;  4DU9 A;  3U9S A;  2I46 A;  4UDU C;  3UDG A;  3K5L A;  1BBX C;  3T4A C;  3C1E A;  1N33 Q;  4J15 A;  4V19 0;  1DOK A;  1VQC A;  4FNF A;  2IHE A;  2KCN A;  4DR5 Q;  4DV6 L;  4LF8 Q;  4BBS G;  4HN7 A;  3E6Z X;  1LT5 D;  1D8L A;  3QWN A;  4U68 A;  5E4W C;  3CCV A;  1PH5 A;  4P74 A;  3BVM A;  3OW2 A;  3IL8 A;  5M5X B;  3GTM H;  1AZP A;  4CJ0 B;  2Q2H A;  3PUX A;  2NB0 A;  1IBL L;  1XMQ Q;  1EZ8 A;  3NK9 A;  3EA6 A;  3OIQ A;  1G51 A;  2Z0S A;  1G2T A;  2B2Y C;  3V96 A;  3RN2 A;  4ME5 A;  1BR9 A;  1DGS A;  2DJF C;  1VQ4 A;  4LFC L;  3FMC A;  5I9O A;  2I0Q A;  3CC7 A;  2F0T A;  2JA5 G;  2E2H H;  4BXX G;  4IFD H;  1EY0 A;  1PA6 A;  2BH2 A;  3S1M B;  1EY9 A;  1CQV A;  4A3D G;  1KNA A;  2E2H B;  2PMZ E;  5ISR A;  2ES2 A;  3ND8 A;  4H7B A;  4RGO S;  1Y1V B;  1H9K A;  4LUO A;  3J7Z C;  2JJQ A;  5C4J H;  3J81 E;  3BS1 A;  1ILP A;  3FP9 A;  4JI3 Q;  1TWF B;  3CPW A;  1NNX A;  3EFX D;  1SYD A;  2Z8L A;  3KJP A;  3S17 B;  3HFZ B;  4GNX C;  4R4O A;  4JI4 L;  1W6J A;  1HA5 A;  3R8B A;  3F1Z A;  2JA7 B;  4DUY Q;  2MO1 A;  5GQO A;  4JV5 L;  5ELF A;  2JA8 B;  2G9D A;  2PPB C;  4O42 A;  1YVC A;  2N3S A;  3T1Y Q;  2K4K A;  2H5X A;  3AFQ A;  1FGB D;  4AQY Q;  2H1E A;  4K5W A;  3A5U A;  4LFA L;  4DR7 Q;  3QJY A;  3S1R H;  1JOQ A;  4KHZ A;  5E3F A;  3CRK C;  1PZI D;  4CKC A;  1SE8 A;  4O1N A;  1TY0 A;  4DR4 L;  3OMC A;  3UE0 A;  2ZJR A;  1EU3 A;  2EY6 A;  3I4M B;  1GUN A;  3Q0A A;  1VQO A;  3PO3 B;  2GVB A;  2LFN A;  4LF6 Q;  1VQI A;  2HDM A;  2BCO A;  4DNR B;  1QVC A;  2XTI A;  1M1K C;  5M3M B;  1Y1V G;  2HCC A;  3R3O A;  1ESF A;  1ML0 D;  4WJW A;  2MGS A;  2CW0 C;  2J0T D;  3BU2 A;  4DV1 L;  5KIX A;  3QB3 A;  5JJK A;  2FJ2 A;  1L0W A;  1B4O A;  2HDL A;  2ZTD A;  4C1N K;  4JI7 L;  2JA7 G;  1BXT A;  1S5C D;  4IUN A;  2LS0 1;  1AFP A;  4A3F G;  3GTL H;  5L37 A;  4QQB X;  3HOV B;  1TWH H;  4EQ5 A;  3I91 A;  4GKJ L;  4G7O C;  4J6H A;  2R7D A;  3NEL A;  4MTK A;  1TT2 A;  1S5D D;  2JQO A;  1EQQ A;  3QOL A;  2VZA A;  4BBS B;  2UUC L;  1PFB A;  3EN2 A;  3H3V H;  1SSO A;  3D6W A;  1C48 A;  3I70 A;  5HGQ A;  3D4R A;  3M3Y H;  4A3J G;  1CSQ A;  3HOY B;  3TS2 A;  4B3T L;  2D5D A;  2NN6 H;  2WB1 G;  4NXM L;  5KGU A;  3CPF A;  3I8Z A;  5GAH C;  1CT1 D;  2RSO A;  2F0G A;  1D5Z C;  4A3K H;  4TKO B;  4B3R L;  5K5P A;  1MIU A;  4PMW A;  2E2J H;  2NVY B;  1QUQ B;  1Q81 C;  1NMG A;  1VQ9 A;  3GTG H;  1II3 A;  1A2U A;  5IT9 E;  2YU9 B;  1MI2 A;  2NBF A;  1IBK Q;  5T1G A;  5CGK A;  4LUV A;  2EYO A;  3MAQ A;  2L1B A;  1IBK L;  2HQL A;  3RZO H;  1FD7 D;  2EZV A;  1EY4 A;  1X65 A;  4NXN L;  2A73 B;  2Y0S B;  2HUG A;  4YCV A;  4BY7 B;  1KAB A;  1Y8P B;  4L5R C;  4JI1 Q;  5FO7 B;  4CKE A;  2UUB Q;  5E1F A;  4LF7 Q;  3TEH B;  3F8T A;  2CFM A;  1FNV A;  1IBM Q;  5A2Q L;  4UP8 A;  3K59 A;  1X3G A;  1IBM L;  1R4Q B;  4FYD A;  5C4H A;  1BCP B;  3S1R B;  1F2Y A;  1QIL A;  4QMG A;  5FJ8 H;  4YCW A;  1QZG A;  2F0O A;  5JJI A;  2AQ1 B;  2IJ0 A;  1ZEQ X;  3M4Q A;  3WOE A;  1IKM A;  1D2B A;  2RSN A;  4C3H H;  1PYW D;  5CV6 A;  5DM7 3;  4IPG A;  3OYY A;  3GTP B;  2F0V A;  4A3G B;  4FO2 A;  1D1K A;  3I90 A;  2B2Y A;  2ZTC A;  2BA1 A;  1PTO B;  3CC2 A;  1ZXT A;  2A6E D;  1RDP D;  1UEA B;  1HZA A;  3H0G G;  2EJG C;  3SDZ A;  2K75 A;  4FF3 A;  1TY2 A;  4A93 H;  3TZU A;  1B3Q A;  2NZO A;  4R1J A;  1ENF A;  2YTX A;  2IPK D;  2M9V A;  4ZLT F;  5C4X H;  3NBH A;  2JA8 G;  3NEN A;  4PV1 C;  2O4X A;  1WJJ A;  3M3Y B;  3ULL A;  1QCB D;  3OHX C;  5FLM G;  1LTI D;  1HR0 Q;  4JI6 L;  4LF6 L;  2VUM G;  3NBH B;  1EFI D;  1Q1B A;  3H15 A;  5EGT A;  3PF4 A;  5DEH A;  1WTQ A;  4HTH A;  4DR2 Q;  1S5F D;  4A75 A;  3O13 A;  3OTO L;  4ZKB B;  1Q12 A;  5JPN C;  4DR5 L;  2F0Q A;  5M5Y B;  1SAP A;  3A55 A;  4HJA A;  3KF6 B;  3K57 A;  4OWW B;  5D3D A;  1IYJ B;  4FXD A;  3NHH A;  1C8C A;  1HJP A;  1HFN A;  3K6O A;  5COR A;  4LFA Q;  3I7F A;  4GNX B;  4IPH A;  1JOK A;  4DAM A;  1LLR D;  3UDI A;  2NVT H;  2EXD A;  4DV2 L;  3GTQ H;  1EEI D;  1KIX A;  2EJM A;  2NZ1 D;  3PF5 A;  1C4Q A;  1Z7T A;  2LSS A;  3K7A B;  4CDE C;  1A6X A;  2ASB A;  4DUY L;  4X65 L;  4BBR B;  4NMZ A;  1CHP D;  3AFP A;  1E1O A;  4DR6 Q;  5GAE C;  2F0F A;  4RH6 A;  3S2D B;  2MHV A;  2JSO A;  1DM0 B;  4C3H G;  5CBA E;  5J22 A;  3PUY A;  5M3M H;  1SXT A;  4ZQ3 A;  4K0K Q;  1MKH A;  1VQK A;  1CSP A;  2L15 A;  1YNN C;  4R8N A;  4WJ3 M;  1X54 A;  2AMC B;  5C3E G;  1X56 A;  3I56 A;  4A3K G;  4DAP A;  5ELO A;  1SRO A;  2HIV A;  2ZJQ A;  1MSG A;  3MXU A;  2DY8 A;  5FO9 B;  4DK6 C;  1XNR L;  4DNI A;  2B2V C;  4KN7 C;  4DPG A;  4K5V A;  1A8V A;  2LMC B;  1ASZ A;  1YEZ A;  3KJO A;  4FF2 A;  5D3I B;  5HY6 A;  4QJF A;  1W2B A;  2K1B A;  2F0E A;  5KYL A;  4LF9 Q;  1F9R A;  2DN8 A;  5M3F H;  3VR2 A;  1NE3 A;  1X3P A;  4UPA A;  1SE4 A;  1HNW L;  3MHB A;  1HHV A;  1YI2 A;  2R92 H;  5LMN L;  2JA8 H;  5C4X G;  1Q90 A;  1YNN D;  2K14 A;  2WP8 J;  1GO3 E;  5LMN Q;  2K33 A;  1KAW A;  1E1T A;  4B9X A;  2CWP A;  4OL7 A;  3K5M A;  2BOS A;  1TWA H;  1CKO A;  1A15 A;  1SJE D;  3RNU A;  1F2M A;  1TS4 A;  5EKL A;  1W6K A;  2EIF A;  1PVO A;  4PG3 A;  1GM5 A;  1NCV A;  2JXM B;  3T13 A;  4UP7 A;  5HGT A;  5K36 H;  1EUJ A;  1RF2 D;  1JJG A;  2EDG A;  1EIY B;  3P1H A;  2UXB Q;  5C4X B;  1DZ1 A;  1VQG A;  2QW7 A;  3K81 C;  3D3R A;  3ER0 A;  3L3O C;  1OXX K;  1U9R A;  1LAC A;  1O7Y A;  3SVM A;  3QR8 A;  5C6A A;  2DNE A;  3FKI H;  4CJ2 C;  5HUR A;  3JAM c;  3S15 H;  3ND9 A;  1N32 L;  1H9S A;  1PTO C;  2RHQ B;  3S1Q B;  1HA6 A;  4ID6 A;  4A3G G;  1SR3 A;  2F1M A;  3EJI A;  2PO4 A;  1I94 L;  4A3M B;  4B3S Q;  3D6C A;  4KHP Q;  4CBV A;  3FPP A;  2PZW A;  3HOY G;  2GA4 B;  1M8A A;  3L7Z C;  2NVT B;  1YNJ C;  3HOW G;  2HIX A;  4A3B G;  4B3S L;  1STG A;  5IYD H;  1LAB A;  1BCP C;  4JK1 C;  4MIU A;  3F2B A;  1SE2 A;  4AYB E;  1L0X B;  5DM6 3;  1FYC A;  1TU2 B;  1XMO L;  3AQQ A;  1X9N A;  1GOZ A;  3MXG A;  2QKI C;  4RGN A;  2I5M X;  2CCZ A;  5GAD C;  5EPJ A;  1XPO A;  4LMQ D;  4OX9 L;  3OW7 A;  3K8A A;  1K8G A;  1HNX Q;  2C35 B;  2J4X A;  5A35 A;  1JR0 D;  4JI1 L;  1VQ6 A;  2I5L X;  1YJ9 A;  2WV6 D;  1HNX L;  1Q86 C;  4GOP C;  2A69 C;  1G2S A;  3H0G H;  3OTO Q;  1NUC A;  1TWF H;  5C3W A;  5C4J B;  4I65 A;  2ZXR A;  1ROD A;  4ODG A;  3J80 i;  3S1Q H;  3FKI B;  4CKB A;  3M85 A;  1HR0 L;  4JI6 Q;  1EIG A;  4YCU A;  4A3L H;  2VW9 A;  1CM9 A;  4EQN A;  3MTS A;  4KY6 A;  2WAQ B;  3EVQ A;  4QF4 A;  3G6J B;  1GUG A;  1EWC A;  1KD1 C;  3L0O A;  4LW1 A;  3HGB A;  5KRU A;  2RBM A;  2B39 A;  3BVG A;  4S3S A;  2WAC A;  4OEL B;  3UDX A;  4A3E G;  3HOY H;  5EQ0 A;  4GLA C;  1K28 A;  2B8F A;  4A3B H;  1T9H A;  1DD2 A;  2ICI A;  3MEF A;  3R93 A;  1XYI A;  3BYT B;  1VQE A;  4BA2 I;  2R3Z A;  4JI0 L;  2RKS A;  1JB7 A;  3I4O A;  3VYT A;  1TII D;  1TWC H;  4C3I G;  4RHR A;  3N6R A;  2SNM A;  3RLN A;  3Q6S A;  3NSW A;  1J6Q A;  4IPD A;  3URY A;  5AJ3 Q;  4IAL A;  5FLX E;  1PH4 A;  1K83 B;  4IUV A;  2UXD L;  2Q8I B;  1Q8I A;  4LWC A;  5KNC A;  5FK9 C;  4NPS A;  1AZQ A;  2PQA A;  2RCN A;  2VQE L;  4N9P A;  4B3M Q;  3H0G B;  2E5L Q;  2F52 A;  5CV5 A;  3VR4 A;  4DR3 Q;  1YHB A;  1PH3 A;  4N8X 1;  4DN4 M;  4KHP L;  2QF7 A;  3Q22 A;  2X69 A;  3KBX A;  3F2D A;  2P5Z X;  4KLK A;  4Y7N B;  4ZUJ A;  5D14 A;  3CCJ A;  1BCP D;  3CXC A;  4A3E B;  4JOI C;  4A3C H;  1WI5 A;  1SMX A;  4XT1 B;  1T5X D;  2QEX A;  1YNJ D;  5FKA C;  1HTP A;  4AYB B;  5IYC H;  4X3U A;  5CV8 A;  2VQF L;  3H91 A;  4DXG A;  2JE6 I;  3I4N H;  3J80 L;  4IUR A;  1VMP A;  1RHP A;  2VQF Q;  3SGI A;  4IJL A;  4KHV A;  1A3U A;  4YY3 L;  2UXB L;  3JC6 6;  1YHA A;  1V8Q A;  4A3J B;  1Y1V H;  4DV3 L;  1WOC A;  4L6T B;  1VQJ A;  1R9T B;  4GKK Q;  2R7Z B;  1HUN A;  1I4H A;  4IN3 A;  5G3L F;  4XTC S;  3CCS A;  3A7L A;  1Q46 A;  1EIF A;  2R61 A;  1A0I A;  1YJW A;  3H6M A;  5A2Q E;  2LXK A;  2AHO B;  2F4V Q;  4JI2 L;  1VQL A;  3AMU A;  1G6P A;  1QNK A;  5M5W H;  3J80 E;  4E6I A;  4LF4 Q;  2PW5 A;  4QUF A;  1V9P A;  1QVG A;  3CRL C;  5C44 H;  5KYI A;  5CR3 A;  1EU4 A;  1XPR A;  1LO5 D;  1QB5 D;  1WTW A;  1AH9 A;  1VQF A;  2Z4I A;  1P16 A;  3ZYY X;  2IX0 A;  2VS1 A;  4JI5 L;  2Z6B A;  1KC8 C;  2AUJ D;  4BY1 G;  1FJG L;  2G9H D;  5IT9 L;  1JWS D;  4XDX A;  2Q2U A;  4A93 G;  2XVS A;  1QVF A;  4DXF A;  1KTK A;  1B7Y B;  5C3X A;  3UDF A;  5JJL A;  2F0H A;  5IOC A;  3CMA A;  3S14 B;  1U4L A;  4HED A;  1LTT D;  3ICE A;  5M3M G;  1GUT A;  4C3J H;  3NWT A;  1JQY D;  3J81 j;  1GKH A;  5FJ8 G;  3AYH B;  3MXN A;  2EPB A;  1SNQ A;  5FLX L;  2J7Z A;  3J81 i;  1XX8 A;  4PMB A;  1U4R A;  4B3M L;  2F0D A;  2IX1 A;  2K01 A;  5ELB A;  3I4N G;  1HUM A;  4DF7 A;  4GZY C;  4DUZ Q;  4PQX A;  2B63 H;  3GTK H;  3A74 A;  3UE1 A;  1OXT A;  1LTL A;  3S16 B;  1FNU A;  4NB3 A;  2EYL A;  5ELC A;  3CF5 A;  3MFG A;  4BBR H;  2SEB D;  4A76 A;  3GTO B;  2XN9 C;  1X32 A;  3LX0 A;  1DOL A;  1W3S A;  1HQR D;  3V2T A;  1WTH A;  2RHS B;  1U4M A;  3IKJ A;  3V05 A;  2A6E C;  1GUW A;  3D31 A;  1JMC A;  4XQN A;  1UWV A;  3TME A;  2BE5 D;  1K8A C;  1VQH A;  2HHH Q;  1BVS A;  4L5S A;  4Q0F A;  4HSV A;  2BE5 C;  2K5D A;  3GDE A;  1STB A;  2TMP A;  5JPM C;  3TP5 A;  1PTO D;  4A3C G;  4JBK A;  3A7A B;  4EX5 A;  2NN6 G;  3I72 A;  3GTQ B;  1SMY D;  4LFB L;  4DV5 L;  2UXC Q;  1SNP A;  1HNW Q;  4DR3 L;  4LFB Q;  4P72 A;  1K3B C;  4B9W A;  4DGZ A;  4BY7 G;  1PZJ D;  2DNC A;  4IJH A;  3HKZ B;  1S4Z A;  1XMQ L;  2MUY A;  2WKD A;  1HTL D;  3D4W A;  1Z47 A;  5J1Z A;  1N34 Q;  2F0L A;  2KBN A;  2A1A A;  4R9W A;  2MO0 A;  2F03 A;  2KEE A;  5FLX c;  2B2W C;  1UAP A;  3E9H A;  1PYB A;  5J3B A;  3T16 A;  3D0F A;  2BDN A;  4LF4 L;  3A56 A;  1N8R C;  1GVP A;  2EYF A;  1V43 A;  1LTG D;  4HMI A;  4R8I A;  1XNQ L;  3KYH C;  1TWG B;  3BDL A;  1L0Y B;  4X3S A;  2K5W A;  1IW7 C;  2E5L L;  3KF6 A;  3C46 A;  4LJZ C;  2UUA Q;  1M90 C;  1VQ5 A;  3KLS X;  2K6A A;  5LMN W;  2X6L A;  1XJV A;  3U4Z A;  3E9I A;  1J9O A;  3KLR A;  1TVX A;  1IL2 A;  1I5F A;  2B8G A;  1PFM A;  2ZT9 C;  1EYG A;  2K52 A;  4RG1 A;  2A68 C;  1MJE A;  2C9O A;  1G91 A;  3FPU B;  3T1Y L;  3HKZ G;  2LY7 A;  1LT3 D;  3M4O B;  1EY5 A;  3JAM i;  2CH4 W;  1F9P A;  1KLU D;  4BY1 H;  4BS9 A;  1CKM A;  2D0O A;  1O78 A;  5JJZ A;  1UE6 A;  4JYA Q;  3HOX B;  4IPC A;  1MJC A;  3HKS A;  1PHJ A;  3E0J A;  3HOV G;  4DV4 L;  2V1C C;  2Z6K A;  2JA9 A;  5IGD A;  2MPM A;  3QOJ A;  3KK7 A;  4RCN A;  1BCP F;  1IKL A;  2XNA C;  3K7U C;  2Q8R E;  2K03 A;  5ELD A;  4X64 Q;  4UP9 A;  4HMJ A;  3HRZ C;  4RKL A;  2ALY B;  1TWG H;  2WIN B;  4J8Q A;  2EYH A;  3ERQ A;  1HNZ L;  1EFW A;  1S5E D;  2ZXP A;  4I7A A;  3TBI B;  1UE1 A;  1FR3 A;  2A19 A;  2VY3 A;  4DK0 A;  4DV0 Q;  2OTJ A;  2B2U A;  3TN2 A;  4RFB A;  1IYV A;  5C44 G;  2F0J A;  1SEB D;  1STE A;  4OGQ C;  3CQZ B;  4QIW B;  1SND A;  2PI2 A;  2IL8 A;  4C3I H;  1XTC D;  2CWA A;  4RHS A;  3TP8 A;  1BO0 A;  4OWX B;  1SYG A;  5C5L A;  4BBR G;  1C0A A;  4B3R Q;  4OIK A;  1EEF D;  4DV3 Q;  4OIJ A;  1KDC A;  3B6Y A;  3PUW A;  5H1S E;  1OTC A;  2FHT A;  2MJ8 A;  2YV5 A;  5DAU A;  1CKN B;  4YHH L;  2OCE A;  2IW3 A;  5IWA L;  1E22 A;  4DK3 C;  1XWE A;  2F4I A;  2B29 A;  2A68 D;  5M5X H;  3GTM B;  1F77 A;  5IWA Q;  4POF A;  5I6W A;  3DHQ A;  4RGM A;  3RLO A;  3TS0 A;  4KJO A;  4DAY A;  1IZ6 A;  4R4I A;  1I4P A;  1CTM A;  1JOR A;  3P7J A;  4BY7 H;  1CI3 M;  3DWQ A;  1I4X A;  4MZ9 A;  1CA6 A;  2VXW A;  3CCR A;  4DV7 Q;  1KHI A;  4K8I A;  3D8G A;  4TRD A;  5LL6 X;  1NMF A;  4HIK A;  2K7V A;  5C4Z A;  4M8A A;  2E74 C;  3CCE A;  2E8G A;  4YY3 Q;  3J7A 5;  1GJX A;  2ZTE A;  5DNF A;  4JI4 Q;  1I3Q B;  1PH2 A;  1K3R A;  1EY6 A;  2VUM B;  3DMU A;  2B63 B;  3GTK B;  4JV5 Q;  2NTS A;  2IT1 A;  3MWY W;  4LF7 L;  1HCZ A;  1I6V C;  2A8V A;  2V4D A;  5J39 A;  4JCV E;  1Y8N B;  1Z6H A;  1Q1E A;  2F4V L;  1WD1 A;  2KA7 A;  3SR1 A;  4TSS A;  3BYY B;  2UUC Q;  1AE3 A;  2EY2 A;  5IYB H;  1LT6 D;  1HZ9 A;  2K5V A;  3FHW A;  2L12 A;  3A5Z B;  4GKK L;  3S2H B;  1DON A;  2EOT A;  2B2U C;  3PO2 G;  3W1B A;  2B2T A;  4Q5V A;  4NW2 A;  3CQZ H;  4OO1 G;  2JK8 A;  2JYO A;  1FJG Q;  2SOB A;  2K5Q A;  3J7A F;  3GO5 A;  1KAA A;  1QOH A;  3DWP A;  1L1O C;  4MTN A;  4ULL A;  4EQO A;  3PQI A;  4DV2 Q;  4JPB W;  4K6D A;  3EQL C;  2EY1 A;  2K50 A;  3CME A;  4RAU C;  3S17 H;  3H09 A;  5C0X J;  4KKT A;  4WFN 3;  4DA2 A;  4A3K B;  1R9T H;  1Q8K A;  3HKZ E;  1JIC A;  3U9O A;  3JAM L;  3HOU B;  1EYD A;  3HOZ G;  3DM1 A;  4HIO A;  2DY7 A;  3MVV A;  1C9O A;  3FDT A;  2NZH A;  3NXW A;  4HCS A;  2Z1C A;  1GHJ A;  4GN5 A;  1ONL A;  3AEV A;  1BF4 A;  2BA0 A;  5K36 G;  1EWH A;  4CJ1 B;  2WII B;  1UNS A;  2RDF A;  4LAA A;  3K58 A;  1BKB A;  4JBW A;  1LTS D;  2E2I H;  1TKW B;  1WTO A;  2NYZ D;  4UAI A;  3C3L A;  2WAQ E;  1ASY A;  4J1M A;  4K2L A;  3SXH A;  1H9S B;  1EZ6 A;  3P75 A;  1WTR A;  2CW0 D;  1P8L A; 
#chains in the Genus database with same CATH homology
 1YHB A;  1PH3 A;  2D62 A;  3S1R H;  1KL9 A;  1FVI A;  4KHP L;  4KHZ A;  3F2D A;  3MXN B;  2KHJ A;  5LMU L;  1SE8 A;  4ALP A;  4JI7 Q;  4KLK A;  4DR4 L;  2HHH L;  3S24 A;  3UE0 A;  3CCJ A;  2RF4 A;  3CXC A;  1YNX A;  4JOI C;  2FXQ A;  2ZJR A;  4A3C H;  1WI5 A;  1SMX A;  1B70 B;  1TXY A;  1VQO A;  4GN4 B;  4O0A A;  2QEX A;  2GVB A;  5M3F G;  4LF6 Q;  1VQI A;  3EBE A;  1L2F A;  3KDF A;  1WCM H;  5JEA J;  4IOA A;  3J80 c;  1QVC A;  2XTI A;  1M1K C;  1RIP A;  2NN6 I;  1Y1V G;  4DV6 Q;  4HJ7 A;  1X3F A;  3CD6 A;  5IYC H;  1JT8 A;  2VQF L;  3BU2 A;  4DV1 L;  1EQR A;  1PYS B;  2JE6 I;  4DR1 L;  3I4N H;  5JJK A;  2VQF Q;  3SGI A;  2QA4 A;  2CKZ B;  4IJL A;  1L0W A;  3I4M G;  2Q2I A;  2ZTD A;  4DV5 Q;  2UXC L;  4YY3 L;  2EQS A;  4JI7 L;  2JA7 G;  2UXB L;  2IY5 B;  3JC6 6;  1YHA A;  1G29 1;  2PI2 E;  4A3F G;  3ERS X;  3CCU A;  3PO3 G;  1VS0 A;  4X66 Q;  2R93 H;  4JYA L;  2CQO A;  1GD7 A;  1EWI A;  3DM3 A;  3GTL H;  1CUK A;  1Y1V H;  3KOJ A;  4QQB X;  4DV3 L;  1TWH H;  1WOC A;  4GKK Q;  1VQJ A;  2KCM A;  3DLL A;  3HOU G;  1VQ7 A;  4EQ5 A;  4GKJ L;  4XTC S;  3CCS A;  2KHI A;  2ZM6 Q;  1Q46 A;  3S14 H;  2R7D A;  1EIF A;  2R7F A;  3NEL A;  1A0I A;  1YJW A;  3WWV A;  5DLQ E;  5JEA G;  4PZ7 A;  1JE5 A;  2LXK A;  2AHO B;  2F4V Q;  1X55 A;  4JI2 L;  2JQO A;  4JC0 A;  1EQQ A;  1N36 Q;  1VQL A;  4WJ4 A;  1FL0 A;  1G6P A;  2VZA A;  5M5W H;  4GLX A;  1V1Q A;  2UUC L;  3EN2 A;  4HJ5 A;  4LF4 Q;  2ID0 A;  3H3V H;  2WFW A;  5IP7 H;  1V9P A;  1QVG A;  4POG A;  5C44 H;  4JI3 L;  5IYB G;  5HGQ A;  3T1H Q;  3M3Y H;  4A3J G;  1CSQ A;  1XPR A;  3TS2 A;  1AH9 A;  1VQF A;  3L2P A;  1P16 A;  4B3T L;  2ATW A;  4A4I A;  4X62 L;  2JA6 H;  4ME3 A;  2IX0 A;  2OTL A;  4FDB A;  3ULJ A;  1X3E A;  2VS1 A;  2WB1 G;  4JI5 L;  4NXM L;  1KC8 C;  4X62 Q;  3CPF A;  4BY1 G;  1FJG L;  3PV0 A;  5IYD G;  5GAH C;  1QUQ A;  2Q2U A;  1VQD A;  4P71 A;  4A93 G;  2AKW B;  4A3K H;  4B3R L;  3S1N H;  1QVF A;  2YYZ A;  3G71 A;  1MIU A;  4PMW A;  2E2J H;  4LUZ A;  1QUQ B;  1Q81 C;  1B7Y B;  3KDF B;  3UDF A;  5BR8 L;  5JJL A;  1NMG A;  3HOX G;  2WAQ G;  1VQ9 A;  3GTG H;  4GS3 A;  1FGU A;  3CMA A;  2Q2T A;  4LF5 L;  3I55 A;  1IBK Q;  4JBM A;  3ICE A;  5M3M G;  1J5E L;  3ULP A;  4LUV A;  2Y0S E;  1D7Q A;  4C3J H;  4IO9 A;  1IBK L;  4AQY L;  3J81 j;  2WB1 E;  2HQL A;  3RZO H;  1GKH A;  5FLM H;  5FJ8 G;  3AYH B;  1X65 A;  4NXN L;  1KQS A;  3J81 c;  4Y52 H;  4YCV A;  1KRT A;  3G4S A;  1YIT A;  3J81 i;  4L5R C;  1NY4 A;  1YBY A;  4H02 A;  4KI0 A;  4JI1 Q;  4B3M L;  1HH2 P;  4R4C A;  3PGZ A;  2VQE Q;  2UUB Q;  3M4P A;  3F8T A;  2CFM A;  3TEH B;  4LF7 Q;  1UE7 A;  2KCT A;  2IX1 A;  3I4N G;  1E24 A;  4DUZ Q;  3CCL A;  2B63 H;  1L1O A;  4TVA B;  3GTK H;  3A74 A;  1YZ6 A;  1IBM Q;  3UE1 A;  2R92 G;  1OXT A;  1LTL A;  4UP8 A;  4NB3 A;  3A0J A;  2JA7 H;  3CF5 A;  1X3G A;  1IBM L;  4BBR H;  4A76 A;  4A3F H;  1QZG A;  5FJ8 H;  4YCW A;  5JJI A;  1QZH A;  3M4Q A;  3K7A H;  4P73 A;  1W3S A;  1Q82 C;  2DGY A;  2RHS B;  4C3H H;  2NVY H;  1WYD A;  2UU9 L;  4YWL A;  1JJC B;  1VQB A;  2B3G A;  2PNH A;  4IPG A;  2D0P A;  3OYY A;  1U5K A;  4NXN Q;  1LYL A;  1X6O A;  3D31 A;  1JMC A;  2DUD A;  1UWV A;  4IFD J;  3S2D H;  4DAY B;  1K8A C;  1VQH A;  2HHH Q;  1BVS A;  1UEB A;  4L5S A;  2ZTC A;  2F3I A;  4DR6 L;  3GDE A;  2ZM6 L;  2BA1 A;  1KXL A;  3CC2 A;  2OQK A;  4A3M H;  1Y1W G;  4DUZ L;  5C3E H;  4MNO A;  4BXX H;  4A3C G;  4DV7 L;  4JBK A;  3E0E A;  4EX5 A;  2NN6 G;  1HZA A;  2QGQ A;  3H0G G;  4AYB G;  5GAG C;  4LFB L;  4DV5 L;  2UXC Q;  1HNW Q;  3HOV H;  2K75 A;  4A3J H;  4DR3 L;  4OXP A;  4LFB Q;  4P72 A;  4A93 H;  5BR8 Q;  3STB D;  3RN5 A;  1YIJ A;  4BBS H;  4BY7 G;  4X66 L;  1VQA A;  2JA6 G;  4IJH A;  2ZJP A;  2NZO A;  1XMQ L;  4AH6 A;  4R1J A;  1PH6 A;  2YU9 H;  2YTX A;  1Z47 A;  1N34 Q;  5C4X H;  2JA8 G;  1YHQ A;  2LXJ A;  3NEN A;  3S15 H;  4GOP A;  1WJJ A;  3RZD H;  4L5T A;  4A3M G;  1Y1W H;  2KBN A;  3Q8D A;  2A1A A;  3I2Z A;  3ULL A;  1L1O B;  2MO0 A;  1SN8 A;  5FLM G;  5FLX c;  1HR0 Q;  4JI6 L;  4LF6 L;  2VUM G;  3NBH B;  4IFD I;  1Q1B A;  5IT9 c;  3H15 A;  2AWO A;  2IHF A;  3E9H A;  1PYB A;  5J3B A;  1OXS C;  1XNR Q;  3D0F A;  3PF4 A;  4DR2 Q;  4LF4 L;  2XGT A;  4PZ8 A;  4A75 A;  4TQU S;  3OTO L;  1N8R C;  1GVP A;  1Q12 A;  1V43 A;  2OQ0 A;  1PFS A;  4DR5 L;  1XNQ L;  3KYH C;  3U50 C;  4HJA A;  1OXU A;  3KF6 B;  1PV4 A;  4OWW B;  3IRB A;  1I6H H;  1IYJ B;  1HJP A;  3U4V A;  3W5O A;  4LFC Q;  4LFA Q;  2E5L L;  3I7F A;  1BBW A;  3KF6 A;  4GNX B;  4IPH A;  3CAM A;  4DAM A;  3UDI A;  2UUA Q;  1M90 C;  2NVT H;  3GD7 A;  1N34 L;  2EXD A;  1VQ5 A;  5LMN W;  3U58 A;  4DV2 L;  4L5Q A;  2YTV A;  3ZJY C;  1XJV A;  1KIX A;  3GTQ H;  3U4Z A;  3E9I A;  1WFQ A;  3PF5 A;  1IL2 A;  2LSS A;  1I5F A;  4XIG S;  1H95 A;  2ASB A;  4JI8 L;  4DUY L;  1U0L A;  5IP9 G;  1EYG A;  2K52 A;  4X65 L;  1B8A A;  5IE8 A;  4RG1 A;  1MJE A;  3KFU A;  4A3L G;  4DR6 Q;  3AFP A;  1E1O A;  2MNA A;  1KRS A;  3HKZ G;  5GAE C;  1K83 H;  1RL2 A;  5C0X G;  3T1Y L;  1J5E Q;  3JAM i;  1JJ2 A;  3FKI G;  1XNQ Q;  4YWM A;  4JBJ A;  5EAY A;  2BH8 A;  3PUV A;  1VQN A;  1SLJ A;  3PUY A;  5M3M H;  4BY1 H;  5AJ3 L;  4K0K Q;  1A63 A;  1MKH A;  1Y14 B;  1VQK A;  1CKM A;  1CSP A;  2D0O A;  2L15 A;  4DR1 Q;  1UE6 A;  1N33 L;  4JYA Q;  1X54 A;  2AMC B;  4IPC A;  1X56 A;  3RR5 A;  5C3E G;  3I56 A;  4A3K G;  5ELO A;  3HOX H;  5IY0 A;  1MJC A;  3HKS A;  1SRO A;  1PHJ A;  3HOV G;  2HIV A;  2R7Z G;  4LF8 L;  2ZJQ A;  4DV4 L;  2V1C C;  2Z6K A;  2JA9 A;  2KEN A;  4DK6 C;  1XNR L;  4DNI A;  1N36 L;  2OWO A;  2NVQ H;  4LNQ A;  3HOU H;  1K73 C;  3KF8 B;  3PIP A;  4OO1 I;  4Y7N H;  3S16 H;  4PZ6 A;  3K7U C;  4DPG A;  3PIO A;  1A8V A;  1Q7Y C;  1I50 H;  1CKN A;  4OX9 L;  2HT1 A;  4HJ8 A;  2Z6K C;  4X64 Q;  1SFO H;  3M7N A;  3PO2 H;  2JEB I;  1ASZ A;  2AWN A;  4UP9 A;  1YEZ A;  3PCO B;  3KJO A;  1HZB A;  4DR7 L;  5HY6 A;  2ALY B;  1TWG H;  4QJF A;  3K0X A;  1W2B A;  3NEM A;  1HNZ L;  3TRZ A;  1HR0 W;  1OXV A;  1S40 A;  4LF9 Q;  5M3F H;  2UUB L;  1EFW A;  1VQM A;  1PH8 A;  1NE3 A;  4UPA A;  2R7Z H;  1VQP A;  1UE1 A;  4A3E H;  1HNW L;  5IP7 G;  2A19 A;  1PH7 A;  2VY3 A;  4DV0 Q;  2OTJ A;  1YI2 A;  2R92 H;  5LMN L;  5IYC G;  5C44 G;  2JA8 H;  2R6G A;  5C4X G;  1NTG A;  1S3O A;  2K14 A;  2PI2 A;  2WP8 J;  3W1G A;  2YTY A;  4C3I H;  3CCM A;  1GO3 E;  2CWA A;  3LGJ A;  5LMN Q;  1PH1 A;  3KLW A;  4HIM A;  1KAW A;  1E1T A;  5LMU Q;  1E7Z A;  1SRU A;  2CWP A;  4OWX B;  2MFI A;  4BBR G;  1TWA H;  1CKO A;  1C0A A;  3RNU A;  4B3R Q;  4DV3 Q;  3K80 C;  2EIF A;  4GKJ Q;  3PUW A;  3B6Y A;  3PUZ A;  4JG2 A;  5H1S E;  1OTC A;  1PVO A;  4PG3 A;  1GM5 A;  4JI0 Q;  2YV5 A;  4A3G H;  1K9M C;  4DR2 L;  3G6E A;  4UP7 A;  1EUJ A;  4R4Q A;  1CKN B;  1N9W A;  4YHH L;  2OCE A;  3F2C A;  3CCQ A;  4OX9 Q;  1JJG A;  5IWA L;  1E22 A;  3M9B A;  4DK3 C;  1EIY B;  3STB C;  3VDY A;  5GRO A;  2UXB Q;  2B29 A;  1VQG A;  4HJ9 A;  4IOC A;  3K81 C;  1EOV A;  5M5X H;  3ER0 A;  1OXX K;  5IWA Q;  4HID A;  4A3I G;  1XTD A;  3T1H L;  3FKI H;  3BZC A;  4POF A;  3JAM c;  1XMO Q;  4C2M H;  3TS0 A;  3RLO A;  4A3D H;  1N32 L;  4K0K L;  2RHQ B;  1IZ6 A;  4QY7 A;  4R4I A;  4A3G G;  1SR3 A;  4DV4 Q;  4JOI A;  1I94 L;  1BBU A;  4BY7 H;  3S1M H;  4B3S Q;  1K0R A;  4KHP Q;  1A62 A;  1AE2 A;  3BZK A;  4YWK A;  2B63 G;  4X65 Q;  1IXR A;  1NJI C;  3I4M H;  3S2H H;  4IFD G;  4DR4 Q;  4MZ9 A;  3CC4 A;  3HOY G;  3L7Z C;  3CCR A;  2VUM H;  2K5H A;  3TRE A;  3HOW G;  2HIX A;  4DV7 Q;  4A3B G;  1KHI A;  2PQA B;  3CP0 A;  1I3Q H;  4OON A;  4B3S L;  4HIK A;  1NMF A;  4WJ3 M;  3HOZ H;  3GTP H;  5IYD H;  3BJU A;  3F2B A;  4AYB E;  1LUZ A;  4LF5 Q;  2N8N A;  4LF9 L;  5M5Y H;  3CCE A;  1UE5 A;  2E8G A;  4YY3 Q;  3J7A 5;  3PO3 H;  4DV0 L;  4JI5 Q;  4NXM Q;  1XMO L;  2R93 G;  3AQQ A;  1X9N A;  1YJN A;  2ZTE A;  4P75 A;  1IBL Q;  3HOW H;  2N78 A;  4JI4 Q;  1PH2 A;  2UU9 Q;  3H3V I;  2I5M X;  1K3R A;  2CCZ A;  3M4O H;  5GAD C;  4GNX A;  1XPO A;  2UXD Q;  2GN5 A;  2VL6 A;  3K8A A;  4X64 L;  4DKA C;  4YHH Q;  5E7N A;  2N49 A;  1K8G A;  1HNX Q;  4JV5 Q;  2C35 B;  4DV1 Q;  2IT1 A;  1VCI A;  4JI1 L;  1VQ6 A;  2I5L X;  1YJ9 A;  3UDG A;  1HNX L;  4O2D A;  4GOP C;  1Q86 C;  4LF7 L;  2GVA A;  3H0G H;  1N33 Q;  4J15 A;  1VQC A;  2A8V A;  3G48 A;  4R4T A;  3OTO Q;  4JCV E;  4APV A;  1TWF H;  1Q1E A;  2F4V L;  2IHE A;  3GTO H;  4DR5 Q;  4DV6 L;  3J80 i;  5C0X I;  3TQY A;  3S1Q H;  2UUC Q;  4LF8 Q;  1AE3 A;  4BBS G;  1HR0 L;  3M85 A;  2JA5 H;  5IYB H;  1S72 A;  4JI6 Q;  1HZ9 A;  2K5V A;  4YCU A;  1D8L A;  1NBW A;  3FHW A;  2VW9 A;  4GLV B;  4A3L H;  2MQH A;  3CCV A;  1PH5 A;  4P74 A;  3A5Z B;  4GKK L;  3OW2 A;  3GTM H;  2Q2H A;  3PUX A;  4GOP B;  1IBL L;  1XMQ Q;  3L0O A;  1KD1 C;  3PO2 G;  1LM0 A;  2I5H A;  3W1B A;  4A3I H;  4LW1 A;  1O7I A;  1G51 A;  2JEA I;  1N32 Q;  3CQZ H;  2Z0S A;  1HNZ Q;  4OO1 G;  3PSI A;  2JK8 A;  1WCM G;  4QL5 A;  3RN2 A;  4UY8 C;  1DGS A;  1FJG Q;  1PH9 A;  1VQ4 A;  2VNU D;  4LFC L;  2I0Q A;  3RLF A;  3CC7 A;  1I94 Q;  4QGU A;  2Y0S G;  2JA5 G;  3GO5 A;  3GTJ H;  4MTN A;  1L1O C;  3UDX A;  1HZC A;  2E2H H;  4A3E G;  4B3T Q;  4BXX G;  4DV2 Q;  2K50 A;  3CME A;  1PA6 A;  2UUA L;  2BH2 A;  3HOY H;  5ELN A;  3S17 H;  4GLA C;  4A3D G;  4QIW E;  1T9H A;  5C0X J;  4A3B H;  3MEF A;  2PMZ E;  2K5N A;  2ES2 A;  1VQE A;  1R9T H;  1Q8K A;  3HKZ E;  1E3P A;  4BA2 I;  4LUO A;  1XPU A;  1VQ8 A;  4JI0 L;  3HOZ G;  4HIO A;  1JB7 A;  1C9O A;  2JJQ A;  4GN3 B;  3J7Z C;  3I4O A;  5C4J H;  3FP9 A;  4JI3 Q;  2NZH A;  3CPW A;  1TWC H;  3EIV A;  5IP9 H;  3CW2 C;  3KJP A;  4RMF A;  4GN5 A;  3AEV A;  3HFZ B;  4GNX C;  4R4O A;  4JI4 L;  3RLN A;  2BA0 A;  4AIM A;  5K36 G;  1J6Q A;  4IPD A;  3F1Z A;  2NVX H;  1C7Y A;  4X6A H;  5AJ3 Q;  4JI8 Q;  4DUY Q;  2MO1 A;  5GQO A;  4JI2 Q;  4JV5 L;  1PH4 A;  4BA1 I;  2UXD L;  1BKB A;  1YVC A;  4JBW A;  4OWT B;  2N3S A;  3T1Y Q;  4LWC A;  2E2I H;  2K4K A;  2H5X A;  4NPS A;  3AFQ A;  4AQY Q;  2WAQ E;  1ASY A;  2PQA A;  2RCN A;  1Z9F A;  2VQE L;  4B3M Q;  2E5L Q;  3A5U A;  2F52 A;  4LFA L;  4DR7 Q;  4DR3 Q;  1P8L A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...