1IBMI

Structure of the thermus thermophilus 30s ribosomal subunit in complex with a messenger rna fragment and cognate transfer rna anticodon stem-loop bound at the a site
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
127
structure length
127
Chain Sequence
EQYYGTGRRKEAVARVFLRPGNGKVTVNGQDFNEYFQGLVRAVAALEPLRAVDALGRFDAYITVRGGGKSGQIDAIKLGIARALVQYNPDYRAKLKPLGFLTRDARVVERKKYGKHKARRAPQYSKR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S RIBOSOMAL RNA
publication title Recognition of cognate transfer RNA by the 30S ribosomal subunit.
pubmed doi rcsb
molecule tags Ribosome
total genus 31
structure length 127
sequence length 127
ec nomenclature
pdb deposition date 2001-03-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF00380 Ribosomal_S9 Ribosomal protein S9/S16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 1ibmI00
3D4JA 2HK2A 1ELOA 3LNUA 4JI3I 4JI5E 2UXBI 2UXDI 5L3JA 1MU5A 4JYAI 4AQYE 3PYFA 1IBKE 4X65I 4YY3I 2UXCI 4HACB 4DU8A 4MYUA 5LMNI 1HNWI 1FWLA 3OTOE 4JI0I 1Z5BA 4B3ME 4DR7I 4DV1E 4URLA 5A2QC 3T1HI 4X66E 2Q2EB 4DUZE 4GKKI 1N32E 3J81Q 4B3RE 4LFAI 2CZ9A 4FN5A 4LF4E 1Z0BA 3LPSA 1XNQE 2DEJA 1Z59A 1S4EA 4DR2I 1KTVA 3PYDA 4ED4A 4WUBA 4JI1I 1EA6A 4DV6I 2GS8A 5FLXC 1N36E 4JI2I 3K17A 4WUDA 1NZ0A 5BR8E 3WU3A 3JAMC 1HNZE 4DV7E 2E5LI 1D6TA 4B3TI 3LTOA 3GONA 1HR0I 2ZM6E 4NXME 4FWHA 4PRVA 4JI7I 5LL6R 3Q1QA 2VQFI 4DR4E 4DXLA 3F0NA 4DU7A 4LFBE 1N33E 1PVGA 2V2ZA 1NHHA 4DPXA 4B3SE 4LF6I 1Z0EA 4OX9E 2BV3A 4K0KE 5LMUE 1XNRE 1N34I 3HULA 4LF5E 1ZM9A 4X64I 2F4VE 5IT9C 4DV5E 1Z5AA 2R42A 4JI5I 5IWAE 4AQYI 2XEXA 1IBKI 4DV2E 4P7AA 2UU9E 1IBLE 4Z7CA 1WUUA 2BM1A 4NXNE 4DV4E 4X66I 3QT8A 4DUZI 1H72C 3V2UC 4YHHE 1N32I 4B3RI 2HHHE 1H7UA 1XMOE 2R3VA 4DR5E 4ZVIA 4LF4I 1H74A 4DV0E 1XNQI 2WW4A 4PRXA 3ZZUA 2UUBE 2HFUA 1Z0VA 4UT4A 1N36I 4JV5I 4DV3E 1ZM2A 3B78A 5BR8I 4MYTA 4LFCE 1H7SA 1HNZI 4DV7I 1ZM3A 2VQEE 4RPFA 1FNMA 1S16A 4GKJE 1KVKA 4HYMA 2UUCI 2E1RA 2ZM6I 1NHJA 4JI4I 1UEKA 4DPUA 2A2DA 4NXMI 1Z5CA 4YY3E 1Z0WA 3ZZ0A 2UXCE 1Z0GA 1RR9A 4DR4I 1N33I 4DR6I 4JI0E 4USMA 4OX9I 4DR3E 1EI1A 2HK3A 4K0KI 5LMUI 2UUAE 1XNRI 2DEIA 4LF5I 1U2RA 2OI2A 2HKEA 3WU4A 2F4VI 4DV5I 4X62I 3J80Q 4WUCA 3ZKBA 3T1YE 1A6FA 1N0UA 4DR2E 1FKAE 5IWAI 4JI8E 2ZBKB 3J81C 4JI6E 4JI1E 4DV2I 2UU9I 1PKPA 1IBLI 2ZITA 3B82A 3WU5A 4PU9A 1DARA 1B62A 1XMQE 4EMDA 1I94E 4LF8E 1QZRA 4NXNI 4HACA 4KHPE 4DV4I 1NHIA 1KKHA 4LF9E 4YHHI 5A2QQ 4JI7E 1ZXMA 2HHHI 1XMOI 4DR5I 1J5EE 1MX0A 4DV0I 1OJ4A 3PYEA 3OTOI 4B3MI 4DPYA 1HNXE 4DV1I 2UUBI 4DR1E 2AJ4A 4USKA 3J7AG 1XHKA 1FJGE 3QT6A 1BKNA 4DV3I 1KIJA 5GMEA 3WU6A 3H4LA 5FLXQ 4LFCI 4XTJA 1IBME 2BM0A 2VQEI 4GKJI 1MG7A 1ZXNA 3JAMQ 2V2QA 4DUYE 2VF3A 4P52A 1N0VC 3CWVA 2LJPA 4LF7E 1ZM4A 1FI4A 1RREA 4DR3I 4JI3E 2UXBE 2UXDE 2UUAI 4JYAE 4M1KA 2J7KA 4X65E 4R1FA 3M6AA 2HFSA 5LMNE 1HNWE 4LFBI 2V34A 3T1YI 4B3SI 5IT9Q 4DR7E 1H73A 4JG4A 4I3HA 3ZKDA 4JI8I 1Z0CA 4FWDA 3T1HE 4JI6I 3J7AM 4FW9A 4GKKE 3PYGA 3ZZTA 4JV5E 1FWKA 3B8HA 4LFAE 4HY1A 1XMQI 3V5RA 1I94I 4LF8I 4HXZA 3QT7A 2A2CA 4KHPI 2UUCE 4JI4E 4DV6E 1K47A 2HKJA 4LF9I 2V2VA 2X36A 4JI2E 4UTGA 1J5EI 4FWGA 1VISA 3ZM7A 4DR6E 2V8PA 1HNXI 2E5LE 4B3TE 2X7IA 1HR0E 3QT5A 4DR1I 1Z0TA 1FJGI 2EFGA 3K1JA 2VQFE 4X62E 1B63A 4DPTA 1IBMI 4LF6E 1PIEA 4KQVA 4DUYI 1N34E 4DPWA 3J80C 4Z7YA 5GMDA 2NPFA 4X64E 4LF7I
chains in the Genus database with same CATH superfamily
3D4JA 2HK2A 1ELOA 3LNUA 4JI3I 4JI5E 2UXBI 2UXDI 5L3JA 1MU5A 4OO1F 4JYAI 4AQYE 4IFDA 1R6LA 5JEAB 3PYFA 1IBKE 4X65I 3HJCA 2CG9A 4YY3I 3GLLA 4IZJD 5EL9A 1P42A 4LCGA 5K36E 2PO1B 4OKGA 3B4TA 2UXCI 4HACB 4DU8A 4MYUA 5LMNI 1HNWI 1FWLA 3OTOE 4JI0I 1Z5BA 4IFDC 4B3ME 4DR7I 4DV1E 4URLA 5A2QC 3T1HI 4X66E 2Q2EB 4DUZE 5C0XB 4GKKI 4LCHA 2NN6A 1N32E 2PNZB 4MU3A 3P3EA 3J81Q 4B3RE 4LFAI 2CZ9A 4FN5A 2BR2A 2O1TA 4LF4E 2JE6B 1Z0BA 3LPSA 1XNQE 4OO1A 2DEJA 1S4EA 1Z59A 4DR2I 1KTVA 3PYDA 2NN6C 1HK7A 4ED4A 4WUBA 2BA1G 4JI1I 1EA6A 4DV6I 1YHCA 2GS8A 2BA0D 5FLXC 1N36E 2CGEA 2GO4A 4JI2I 4BA1B 3K17A 4FW6A 4WUDA 1NZ0A 5BR8E 3WU3A 3JAMC 1HNZE 4U3BA 4IFDB 4DV7E 5JEAF 3HKMA 2E5LI 1D6TA 4B3TI 3LTOA 3GONA 1HR0I 2Z5CA 2ZM6E 4BA2A 5C0XD 4NXME 4FWHA 4PRVA 4JI7I 5LL6R 3Q1QA 3DD6A 1UDOA 2VQFI 4QNJA 4DR4E 4DXLA 3F0NA 3CDIA 4AIDA 4DU7A 1PVGA 4LFBE 1N33E 2V2ZA 1NHHA 4DPXA 4B3SE 4LF6I 1Z0EA 4FW5A 4OX9E 2BV3A 2NN6B 2PO2A 4K0KE 2O1WA 5K36A 5LMUE 2PO0B 1XNRE 1N34I 3HULA 4OO1E 4LF5E 1ZM9A 4X64I 2F4VE 5IT9C 4DV5E 3GMEA 4IFDD 5K36C 1Z5AA 2R42A 3GCMA 4JI5I 4IZKB 5IWAE 3PS2A 2XEXA 4AQYI 1IBKI 2O1VA 2C38A 4DV2E 4P7AA 2UU9E 1IBLE 3M7NG 5FWKA 4Z7CA 1WUUA 2Z5CB 4LPFA 3KRNA 2BM1A 4BA2B 2NN6D 4NXNE 1R6MA 4DV4E 4X66I 4U3DA 3QT8A 1OYRA 4DUZI 1H72C 3V2UC 2C39B 4YHHE 1N32I 4B3RI 2JEBA 2HHHE 1H7UA 1XMOE 2R3VA 4DR5E 4ZVIA 2Z5BB 4LF4I 1H74A 4DV0E 1XNQI 2WW4A 4PRXA 5JEAE 3ZZUA 2UUBE 2HFUA 1Z0VA 3M85D 2O1UA 4UT4A 1N36I 4JV5I 3Q6MA 4DV3E 1ZM2A 3B78A 5BR8I 4MYTA 4LFCE 1H7SA 1HNZI 1OYSA 1OYPA 2Z5EA 5DNLA 4DV7I 1ZM3A 2VQEE 4RPFA 1FNMA 1S16A 3PS3A 5DROA 4GKJE 1KVKA 4HYMA 5ELWA 4LOMA 2UUCI 2E1RA 3PRYA 2ZM6I 1NHJA 4JI4I 1UEKA 4DPUA 2A2DA 4MU1A 4AIMA 4NXMI 1Z5CA 4YY3E 1Z0WA 3ZZ0A 4OO1C 2WP8A 1USVA 2UXCE 1Z0GA 1RR9A 4LCFA 4DR4I 1N33I 4DR6I 4JI0E 4USMA 2IESA 4DR3E 2WNRA 1EI1A 4OX9I 2HK3A 2JT2A 4K0KI 5LMUI 2UUAE 1XNRI 2DEIA 4LF5I 1U2RA 1VI7A 2OI2A 2HKEA 3WU4A 5DRQA 2F4VI 4DV5I 3P3GA 4X62I 3J80Q 4WUCA 1UDQA 3ZKBA 3T1YE 1A6FA 2C37A 5C0XF 3P76A 3CDJA 1N0UA 4DR2E 1FKAE 5IWAI 1XXEA 4JI8E 2VESA 2ZBKB 3J81C 4JI6E 2BR2B 4JI1E 3P06A 4OZEA 4AM3A 4DV2I 2UU9I 1PKPA 1IBLI 2ZITA 3B82A 3L7ZA 4OO1B 3WU5A 4PU9A 5JEAA 1DARA 3H1CA 1B62A 1XMQE 4EMDA 4ISAA 1I94E 4LF8E 4FW7A 2BA0G 2PO1A 1QZRA 4NXNI 4HACA 4KHPE 4DV4I 1NHIA 1KKHA 5JEAC 4MU0A 4LF9E 4YHHI 4IFDF 5A2QQ 4JI7E 1ZXMA 2O3ZA 2HHHI 1XMOI 4DR5I 5DRPA 5C0XA 1J5EE 1MX0A 4DV0I 1OJ4A 3PS1A 3PYEA 3OTOI 2PNZA 1Y6ZA 4B3MI 4DPYA 1HNXE 4DV1I 2UUBI 4DR1E 2AJ4A 4USKA 3Q6NA 3J7AG 1XHKA 5C0XC 3QT6A 1BKNA 2GO3A 1FJGE 4DV3I 1KIJA 3K85A 2C37B 4OO1D 5GMEA 3WU6A 2BA1D 3H4LA 2PNLA 5FLXQ 2NN6F 4LFCI 4XTJA 2JEAA 2PO2B 1IBME 5K36B 2BM0A 1E3HA 4BA1A 2VQEI 4GKJI 1MG7A 1ZXNA 3L7ZB 4NBQA 3JAMQ 2V2QA 3P3CA 4DUYE 2VF3A 4P52A 1N0VC 3CWVA 2LJPA 4LF7E 1Y60A 1ZM4A 1FI4A 2C38B 1RREA 4DR3I 4JI3E 2UXBE 2UXDE 5C0XE 2UUAI 4JYAE 1Y4SA 4M1KA 2J7KA 4X65E 4R1FA 3M6AA 4N3OA 2PO0A 2HFSA 5LMNE 1HNWE 4LFBI 5K36D 4MQYA 2V34A 3T1YI 4IZJA 4B3SI 5IT9Q 4DR7E 1H73A 4JG4A 4I3HA 3ZKDA 4JI8I 2JEBB 1Z0CA 4FWDA 3T1HE 4JI6I 3J7AM 5JEAD 2JEAB 4FW9A 4GKKE 3PYGA 3ZZTA 5K36F 5DNXA 4IZKA 4JV5E 1FWKA 3B8HA 3NZKA 4LFAE 4IFDE 4HY1A 1XMQI 2F1DA 3V5RA 3M7ND 1I94I 4LF8I 3M85G 1RHYA 4FW3A 4HXZA 3QT7A 2A2CA 4KHPI 4GQUA 2UUCE 3UHMA 4JI4E 4IS9A 4DV6E 1K47A 2HKJA 4LF9I 2V2VA 2X36A 4JI2E 4QNKA 4MDTA 4UTGA 3U1YA 1J5EI 4FWGA 2C39A 1VISA 2AE8A 2NN6E 3ZM7A 4DR6E 2V8PA 1HNXI 2E5LE 4FW4A 4B3TE 2X7IA 2Z5BA 1UDNA 1HR0E 3QT5A 4DR1I 1USUA 2WP8B 4J3DA 1Z0TA 2PNMA 2IERA 1FJGI 1UDSA 4IZJB 2IOQA 3U1KA 2EFGA 2WNRB 3K1JA 2CVEA 4X62E 2VQFE 2IOPA 1B63A 1Y4UA 4DPTA 1IBMI 4MU4A 4LF6E 1PIEA 5DRRA 1Y5YA 2GQ0A 4KQVA 2JE6A 4DUYI 1N34E 1E3PA 4DPWA 1YH8A 3J80C 4Z7YA 5GMDA 2J65A 2NPFA 4X64E 4LF7I 5EKWA
chains in the Genus database with same CATH topology
3D4JA 2HK2A 1ELOA 3LNUA 4JI3I 4JI5E 2UXBI 2UXDI 5L3JA 1MU5A 4JYAI 4AQYE 3PYFA 1IBKE 4X65I 3HJCA 2CG9A 4YY3I 4IZJD 2UXCI 4HACB 4DU8A 4MYUA 5LMNI 1HNWI 1FWLA 3OTOE 4JI0I 1Z5BA 4B3ME 4DR7I 4DV1E 4URLA 5A2QC 3T1HI 4X66E 2Q2EB 4DUZE 4GKKI 1N32E 3J81Q 4B3RE 4LFAI 2CZ9A 4FN5A 2O1TA 4LF4E 1Z0BA 3LPSA 1XNQE 2DEJA 1Z59A 1S4EA 4DR2I 1KTVA 3PYDA 1HK7A 4ED4A 4WUBA 4JI1I 1EA6A 4DV6I 2GS8A 5FLXC 1N36E 2CGEA 4JI2I 3K17A 4WUDA 1NZ0A 5BR8E 3WU3A 3JAMC 1HNZE 4DV7E 2E5LI 1D6TA 4B3TI 3LTOA 3GONA 1HR0I 2Z5CA 2ZM6E 4NXME 4FWHA 4PRVA 4JI7I 5LL6R 3Q1QA 2VQFI 4DR4E 4DXLA 3F0NA 4DU7A 4LFBE 1N33E 1PVGA 2V2ZA 1NHHA 4DPXA 4B3SE 4LF6I 1Z0EA 4OX9E 2BV3A 4K0KE 2O1WA 5LMUE 1XNRE 1N34I 3HULA 4LF5E 1ZM9A 4X64I 2F4VE 5IT9C 4DV5E 1Z5AA 2R42A 4JI5I 4IZKB 5IWAE 4AQYI 2XEXA 1IBKI 2O1VA 4DV2E 4P7AA 2UU9E 1IBLE 5FWKA 4Z7CA 1WUUA 2Z5CB 2BM1A 4NXNE 4DV4E 4X66I 3QT8A 4DUZI 1H72C 3V2UC 4YHHE 1N32I 4B3RI 2HHHE 1H7UA 1XMOE 2R3VA 4DR5E 4ZVIA 2Z5BB 4LF4I 1H74A 4DV0E 1XNQI 2WW4A 4PRXA 3ZZUA 2UUBE 2HFUA 1Z0VA 2O1UA 4UT4A 1N36I 4JV5I 3Q6MA 4DV3E 1ZM2A 3B78A 5BR8I 4MYTA 4LFCE 1H7SA 1HNZI 2Z5EA 4DV7I 1ZM3A 2VQEE 4RPFA 1FNMA 1S16A 4GKJE 1KVKA 4HYMA 2UUCI 2E1RA 2ZM6I 3PRYA 1NHJA 4JI4I 1UEKA 4DPUA 2A2DA 4NXMI 1Z5CA 4YY3E 1Z0WA 3ZZ0A 1USVA 2UXCE 1Z0GA 1RR9A 4DR4I 1N33I 4DR6I 4JI0E 4USMA 4OX9I 4DR3E 1EI1A 2HK3A 4K0KI 5LMUI 2UUAE 1XNRI 2DEIA 4LF5I 1U2RA 2OI2A 2HKEA 3WU4A 2F4VI 4DV5I 4X62I 3J80Q 4WUCA 3ZKBA 3T1YE 1A6FA 1N0UA 4DR2E 1FKAE 5IWAI 4JI8E 2ZBKB 3J81C 4JI6E 4JI1E 3P06A 4DV2I 2UU9I 1PKPA 1IBLI 2ZITA 3B82A 3WU5A 4PU9A 1DARA 1B62A 1XMQE 4EMDA 1I94E 4LF8E 1QZRA 4NXNI 4HACA 4KHPE 4DV4I 1NHIA 1KKHA 4LF9E 4YHHI 5A2QQ 4JI7E 1ZXMA 2HHHI 1XMOI 4DR5I 1J5EE 1MX0A 4DV0I 1OJ4A 3PYEA 3OTOI 1Y6ZA 4B3MI 4DPYA 1HNXE 4DV1I 2UUBI 4DR1E 2AJ4A 4USKA 3Q6NA 3J7AG 1XHKA 1FJGE 3QT6A 1BKNA 4DV3I 1KIJA 3K85A 5GMEA 3WU6A 3H4LA 2PNLA 5FLXQ 4LFCI 4XTJA 1IBME 2BM0A 2VQEI 4GKJI 1MG7A 1ZXNA 3JAMQ 2V2QA 4DUYE 2VF3A 4P52A 1N0VC 3CWVA 2LJPA 4LF7E 1ZM4A 1FI4A 1RREA 4DR3I 4JI3E 2UXBE 2UXDE 2UUAI 4JYAE 1Y4SA 4M1KA 2J7KA 4X65E 4R1FA 3M6AA 4N3OA 2HFSA 5LMNE 1HNWE 4LFBI 2V34A 3T1YI 4IZJA 4B3SI 5IT9Q 4DR7E 1H73A 4JG4A 4I3HA 3ZKDA 4JI8I 1Z0CA 4FWDA 3T1HE 4JI6I 3J7AM 4FW9A 4GKKE 3PYGA 3ZZTA 4IZKA 4JV5E 1FWKA 3B8HA 4LFAE 4HY1A 1XMQI 3V5RA 1I94I 4LF8I 4HXZA 3QT7A 2A2CA 4KHPI 2UUCE 4JI4E 4DV6E 1K47A 2HKJA 4LF9I 2V2VA 2X36A 4JI2E 4UTGA 1J5EI 4FWGA 1VISA 3ZM7A 4DR6E 2V8PA 1HNXI 2E5LE 4B3TE 2X7IA 2Z5BA 1HR0E 3QT5A 4DR1I 1USUA 1Z0TA 2PNMA 1FJGI 4IZJB 2IOQA 2EFGA 3K1JA 4X62E 2VQFE 2IOPA 1B63A 1Y4UA 4DPTA 1IBMI 4LF6E 1PIEA 2GQ0A 4KQVA 4DUYI 1N34E 4DPWA 3J80C 4Z7YA 5GMDA 2NPFA 4X64E 4LF7I
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3D4J A;  2HK2 A;  1ELO A;  3LNU A;  4JI3 I;  4JI5 E;  2UXB I;  2UXD I;  5L3J A;  1MU5 A;  4JYA I;  4AQY E;  3PYF A;  1IBK E;  4X65 I;  4YY3 I;  2UXC I;  4HAC B;  4DU8 A;  4MYU A;  5LMN I;  1HNW I;  1FWL A;  3OTO E;  4JI0 I;  1Z5B A;  4B3M E;  4DR7 I;  4DV1 E;  4URL A;  5A2Q C;  3T1H I;  4X66 E;  2Q2E B;  4DUZ E;  4GKK I;  1N32 E;  3J81 Q;  4B3R E;  4LFA I;  2CZ9 A;  4FN5 A;  4LF4 E;  1Z0B A;  3LPS A;  1XNQ E;  2DEJ A;  1Z59 A;  1S4E A;  4DR2 I;  1KTV A;  3PYD A;  4ED4 A;  4WUB A;  4JI1 I;  1EA6 A;  4DV6 I;  2GS8 A;  5FLX C;  1N36 E;  4JI2 I;  3K17 A;  4WUD A;  1NZ0 A;  5BR8 E;  3WU3 A;  3JAM C;  1HNZ E;  4DV7 E;  2E5L I;  1D6T A;  4B3T I;  3LTO A;  3GON A;  1HR0 I;  2ZM6 E;  4NXM E;  4FWH A;  4PRV A;  4JI7 I;  5LL6 R;  3Q1Q A;  2VQF I;  4DR4 E;  4DXL A;  3F0N A;  4DU7 A;  4LFB E;  1N33 E;  1PVG A;  2V2Z A;  1NHH A;  4DPX A;  4B3S E;  4LF6 I;  1Z0E A;  4OX9 E;  2BV3 A;  4K0K E;  5LMU E;  1XNR E;  1N34 I;  3HUL A;  4LF5 E;  1ZM9 A;  4X64 I;  2F4V E;  5IT9 C;  4DV5 E;  1Z5A A;  2R42 A;  4JI5 I;  5IWA E;  4AQY I;  2XEX A;  1IBK I;  4DV2 E;  4P7A A;  2UU9 E;  1IBL E;  4Z7C A;  1WUU A;  2BM1 A;  4NXN E;  4DV4 E;  4X66 I;  3QT8 A;  4DUZ I;  1H72 C;  3V2U C;  4YHH E;  1N32 I;  4B3R I;  2HHH E;  1H7U A;  1XMO E;  2R3V A;  4DR5 E;  4ZVI A;  4LF4 I;  1H74 A;  4DV0 E;  1XNQ I;  2WW4 A;  4PRX A;  3ZZU A;  2UUB E;  2HFU A;  1Z0V A;  4UT4 A;  1N36 I;  4JV5 I;  4DV3 E;  1ZM2 A;  3B78 A;  5BR8 I;  4MYT A;  4LFC E;  1H7S A;  1HNZ I;  4DV7 I;  1ZM3 A;  2VQE E;  4RPF A;  1FNM A;  1S16 A;  4GKJ E;  1KVK A;  4HYM A;  2UUC I;  2E1R A;  2ZM6 I;  1NHJ A;  4JI4 I;  1UEK A;  4DPU A;  2A2D A;  4NXM I;  1Z5C A;  4YY3 E;  1Z0W A;  3ZZ0 A;  2UXC E;  1Z0G A;  1RR9 A;  4DR4 I;  1N33 I;  4DR6 I;  4JI0 E;  4USM A;  4OX9 I;  4DR3 E;  1EI1 A;  2HK3 A;  4K0K I;  5LMU I;  2UUA E;  1XNR I;  2DEI A;  4LF5 I;  1U2R A;  2OI2 A;  2HKE A;  3WU4 A;  2F4V I;  4DV5 I;  4X62 I;  3J80 Q;  4WUC A;  3ZKB A;  3T1Y E;  1A6F A;  1N0U A;  4DR2 E;  1FKA E;  5IWA I;  4JI8 E;  2ZBK B;  3J81 C;  4JI6 E;  4JI1 E;  4DV2 I;  2UU9 I;  1PKP A;  1IBL I;  2ZIT A;  3B82 A;  3WU5 A;  4PU9 A;  1DAR A;  1B62 A;  1XMQ E;  4EMD A;  1I94 E;  4LF8 E;  1QZR A;  4NXN I;  4HAC A;  4KHP E;  4DV4 I;  1NHI A;  1KKH A;  4LF9 E;  4YHH I;  5A2Q Q;  4JI7 E;  1ZXM A;  2HHH I;  1XMO I;  4DR5 I;  1J5E E;  1MX0 A;  4DV0 I;  1OJ4 A;  3PYE A;  3OTO I;  4B3M I;  4DPY A;  1HNX E;  4DV1 I;  2UUB I;  4DR1 E;  2AJ4 A;  4USK A;  3J7A G;  1XHK A;  1FJG E;  3QT6 A;  1BKN A;  4DV3 I;  1KIJ A;  5GME A;  3WU6 A;  3H4L A;  5FLX Q;  4LFC I;  4XTJ A;  1IBM E;  2BM0 A;  2VQE I;  4GKJ I;  1MG7 A;  1ZXN A;  3JAM Q;  2V2Q A;  4DUY E;  2VF3 A;  4P52 A;  1N0V C;  3CWV A;  2LJP A;  4LF7 E;  1ZM4 A;  1FI4 A;  1RRE A;  4DR3 I;  4JI3 E;  2UXB E;  2UXD E;  2UUA I;  4JYA E;  4M1K A;  2J7K A;  4X65 E;  4R1F A;  3M6A A;  2HFS A;  5LMN E;  1HNW E;  4LFB I;  2V34 A;  3T1Y I;  4B3S I;  5IT9 Q;  4DR7 E;  1H73 A;  4JG4 A;  4I3H A;  3ZKD A;  4JI8 I;  1Z0C A;  4FWD A;  3T1H E;  4JI6 I;  3J7A M;  4FW9 A;  4GKK E;  3PYG A;  3ZZT A;  4JV5 E;  1FWK A;  3B8H A;  4LFA E;  4HY1 A;  1XMQ I;  3V5R A;  1I94 I;  4LF8 I;  4HXZ A;  3QT7 A;  2A2C A;  4KHP I;  2UUC E;  4JI4 E;  4DV6 E;  1K47 A;  2HKJ A;  4LF9 I;  2V2V A;  2X36 A;  4JI2 E;  4UTG A;  1J5E I;  4FWG A;  1VIS A;  3ZM7 A;  4DR6 E;  2V8P A;  1HNX I;  2E5L E;  4B3T E;  2X7I A;  1HR0 E;  3QT5 A;  4DR1 I;  1Z0T A;  1FJG I;  2EFG A;  3K1J A;  2VQF E;  4X62 E;  1B63 A;  4DPT A;  1IBM I;  4LF6 E;  1PIE A;  4KQV A;  4DUY I;  1N34 E;  4DPW A;  3J80 C;  4Z7Y A;  5GMD A;  2NPF A;  4X64 E;  4LF7 I; 
#chains in the Genus database with same CATH topology
 3D4J A;  2HK2 A;  1ELO A;  3LNU A;  4JI3 I;  4JI5 E;  2UXB I;  2UXD I;  5L3J A;  1MU5 A;  4OO1 F;  4JYA I;  4AQY E;  4IFD A;  1R6L A;  5JEA B;  3PYF A;  1IBK E;  4X65 I;  3HJC A;  2CG9 A;  4YY3 I;  3GLL A;  4IZJ D;  5EL9 A;  1P42 A;  4LCG A;  5K36 E;  2PO1 B;  4OKG A;  3B4T A;  2UXC I;  4HAC B;  4DU8 A;  4MYU A;  5LMN I;  1HNW I;  1FWL A;  3OTO E;  4JI0 I;  1Z5B A;  4IFD C;  4B3M E;  4DR7 I;  4DV1 E;  4URL A;  5A2Q C;  3T1H I;  4X66 E;  2Q2E B;  4DUZ E;  5C0X B;  4GKK I;  4LCH A;  2NN6 A;  1N32 E;  2PNZ B;  4MU3 A;  3P3E A;  3J81 Q;  4B3R E;  4LFA I;  2CZ9 A;  4FN5 A;  2BR2 A;  2O1T A;  4LF4 E;  2JE6 B;  1Z0B A;  3LPS A;  1XNQ E;  4OO1 A;  2DEJ A;  1S4E A;  1Z59 A;  4DR2 I;  1KTV A;  3PYD A;  2NN6 C;  1HK7 A;  4ED4 A;  4WUB A;  2BA1 G;  4JI1 I;  1EA6 A;  4DV6 I;  1YHC A;  2GS8 A;  2BA0 D;  5FLX C;  1N36 E;  2CGE A;  2GO4 A;  4JI2 I;  4BA1 B;  3K17 A;  4FW6 A;  4WUD A;  1NZ0 A;  5BR8 E;  3WU3 A;  3JAM C;  1HNZ E;  4U3B A;  4IFD B;  4DV7 E;  5JEA F;  3HKM A;  2E5L I;  1D6T A;  4B3T I;  3LTO A;  3GON A;  1HR0 I;  2Z5C A;  2ZM6 E;  4BA2 A;  5C0X D;  4NXM E;  4FWH A;  4PRV A;  4JI7 I;  5LL6 R;  3Q1Q A;  3DD6 A;  1UDO A;  2VQF I;  4QNJ A;  4DR4 E;  4DXL A;  3F0N A;  3CDI A;  4AID A;  4DU7 A;  1PVG A;  4LFB E;  1N33 E;  2V2Z A;  1NHH A;  4DPX A;  4B3S E;  4LF6 I;  1Z0E A;  4FW5 A;  4OX9 E;  2BV3 A;  2NN6 B;  2PO2 A;  4K0K E;  2O1W A;  5K36 A;  5LMU E;  2PO0 B;  1XNR E;  1N34 I;  3HUL A;  4OO1 E;  4LF5 E;  1ZM9 A;  4X64 I;  2F4V E;  5IT9 C;  4DV5 E;  3GME A;  4IFD D;  5K36 C;  1Z5A A;  2R42 A;  3GCM A;  4JI5 I;  4IZK B;  5IWA E;  3PS2 A;  2XEX A;  4AQY I;  1IBK I;  2O1V A;  2C38 A;  4DV2 E;  4P7A A;  2UU9 E;  1IBL E;  3M7N G;  5FWK A;  4Z7C A;  1WUU A;  2Z5C B;  4LPF A;  3KRN A;  2BM1 A;  4BA2 B;  2NN6 D;  4NXN E;  1R6M A;  4DV4 E;  4X66 I;  4U3D A;  3QT8 A;  1OYR A;  4DUZ I;  1H72 C;  3V2U C;  2C39 B;  4YHH E;  1N32 I;  4B3R I;  2JEB A;  2HHH E;  1H7U A;  1XMO E;  2R3V A;  4DR5 E;  4ZVI A;  2Z5B B;  4LF4 I;  1H74 A;  4DV0 E;  1XNQ I;  2WW4 A;  4PRX A;  5JEA E;  3ZZU A;  2UUB E;  2HFU A;  1Z0V A;  3M85 D;  2O1U A;  4UT4 A;  1N36 I;  4JV5 I;  3Q6M A;  4DV3 E;  1ZM2 A;  3B78 A;  5BR8 I;  4MYT A;  4LFC E;  1H7S A;  1HNZ I;  1OYS A;  1OYP A;  2Z5E A;  5DNL A;  4DV7 I;  1ZM3 A;  2VQE E;  4RPF A;  1FNM A;  1S16 A;  3PS3 A;  5DRO A;  4GKJ E;  1KVK A;  4HYM A;  5ELW A;  4LOM A;  2UUC I;  2E1R A;  3PRY A;  2ZM6 I;  1NHJ A;  4JI4 I;  1UEK A;  4DPU A;  2A2D A;  4MU1 A;  4AIM A;  4NXM I;  1Z5C A;  4YY3 E;  1Z0W A;  3ZZ0 A;  4OO1 C;  2WP8 A;  1USV A;  2UXC E;  1Z0G A;  1RR9 A;  4LCF A;  4DR4 I;  1N33 I;  4DR6 I;  4JI0 E;  4USM A;  2IES A;  4DR3 E;  2WNR A;  1EI1 A;  4OX9 I;  2HK3 A;  2JT2 A;  4K0K I;  5LMU I;  2UUA E;  1XNR I;  2DEI A;  4LF5 I;  1U2R A;  1VI7 A;  2OI2 A;  2HKE A;  3WU4 A;  5DRQ A;  2F4V I;  4DV5 I;  3P3G A;  4X62 I;  3J80 Q;  4WUC A;  1UDQ A;  3ZKB A;  3T1Y E;  1A6F A;  2C37 A;  5C0X F;  3P76 A;  3CDJ A;  1N0U A;  4DR2 E;  1FKA E;  5IWA I;  1XXE A;  4JI8 E;  2VES A;  2ZBK B;  3J81 C;  4JI6 E;  2BR2 B;  4JI1 E;  3P06 A;  4OZE A;  4AM3 A;  4DV2 I;  2UU9 I;  1PKP A;  1IBL I;  2ZIT A;  3B82 A;  3L7Z A;  4OO1 B;  3WU5 A;  4PU9 A;  5JEA A;  1DAR A;  3H1C A;  1B62 A;  1XMQ E;  4EMD A;  4ISA A;  1I94 E;  4LF8 E;  4FW7 A;  2BA0 G;  2PO1 A;  1QZR A;  4NXN I;  4HAC A;  4KHP E;  4DV4 I;  1NHI A;  1KKH A;  5JEA C;  4MU0 A;  4LF9 E;  4YHH I;  4IFD F;  5A2Q Q;  4JI7 E;  1ZXM A;  2O3Z A;  2HHH I;  1XMO I;  4DR5 I;  5DRP A;  5C0X A;  1J5E E;  1MX0 A;  4DV0 I;  1OJ4 A;  3PS1 A;  3PYE A;  3OTO I;  2PNZ A;  1Y6Z A;  4B3M I;  4DPY A;  1HNX E;  4DV1 I;  2UUB I;  4DR1 E;  2AJ4 A;  4USK A;  3Q6N A;  3J7A G;  1XHK A;  5C0X C;  3QT6 A;  1BKN A;  2GO3 A;  1FJG E;  4DV3 I;  1KIJ A;  3K85 A;  2C37 B;  4OO1 D;  5GME A;  3WU6 A;  2BA1 D;  3H4L A;  2PNL A;  5FLX Q;  2NN6 F;  4LFC I;  4XTJ A;  2JEA A;  2PO2 B;  1IBM E;  5K36 B;  2BM0 A;  1E3H A;  4BA1 A;  2VQE I;  4GKJ I;  1MG7 A;  1ZXN A;  3L7Z B;  4NBQ A;  3JAM Q;  2V2Q A;  3P3C A;  4DUY E;  2VF3 A;  4P52 A;  1N0V C;  3CWV A;  2LJP A;  4LF7 E;  1Y60 A;  1ZM4 A;  1FI4 A;  2C38 B;  1RRE A;  4DR3 I;  4JI3 E;  2UXB E;  2UXD E;  5C0X E;  2UUA I;  4JYA E;  1Y4S A;  4M1K A;  2J7K A;  4X65 E;  4R1F A;  3M6A A;  4N3O A;  2PO0 A;  2HFS A;  5LMN E;  1HNW E;  4LFB I;  5K36 D;  4MQY A;  2V34 A;  3T1Y I;  4IZJ A;  4B3S I;  5IT9 Q;  4DR7 E;  1H73 A;  4JG4 A;  4I3H A;  3ZKD A;  4JI8 I;  2JEB B;  1Z0C A;  4FWD A;  3T1H E;  4JI6 I;  3J7A M;  5JEA D;  2JEA B;  4FW9 A;  4GKK E;  3PYG A;  3ZZT A;  5K36 F;  5DNX A;  4IZK A;  4JV5 E;  1FWK A;  3B8H A;  3NZK A;  4LFA E;  4IFD E;  4HY1 A;  1XMQ I;  2F1D A;  3V5R A;  3M7N D;  1I94 I;  4LF8 I;  3M85 G;  1RHY A;  4FW3 A;  4HXZ A;  3QT7 A;  2A2C A;  4KHP I;  4GQU A;  2UUC E;  3UHM A;  4JI4 E;  4IS9 A;  4DV6 E;  1K47 A;  2HKJ A;  4LF9 I;  2V2V A;  2X36 A;  4JI2 E;  4QNK A;  4MDT A;  4UTG A;  3U1Y A;  1J5E I;  4FWG A;  2C39 A;  1VIS A;  2AE8 A;  2NN6 E;  3ZM7 A;  4DR6 E;  2V8P A;  1HNX I;  2E5L E;  4FW4 A;  4B3T E;  2X7I A;  2Z5B A;  1UDN A;  1HR0 E;  3QT5 A;  4DR1 I;  1USU A;  2WP8 B;  4J3D A;  1Z0T A;  2PNM A;  2IER A;  1FJG I;  1UDS A;  4IZJ B;  2IOQ A;  3U1K A;  2EFG A;  2WNR B;  3K1J A;  2CVE A;  4X62 E;  2VQF E;  2IOP A;  1B63 A;  1Y4U A;  4DPT A;  1IBM I;  4MU4 A;  4LF6 E;  1PIE A;  5DRR A;  1Y5Y A;  2GQ0 A;  4KQV A;  2JE6 A;  4DUY I;  1N34 E;  1E3P A;  4DPW A;  1YH8 A;  3J80 C;  4Z7Y A;  5GMD A;  2J65 A;  2NPF A;  4X64 E;  4LF7 I;  5EKW A; 
#chains in the Genus database with same CATH homology
 3D4J A;  2HK2 A;  1ELO A;  3LNU A;  4JI3 I;  4JI5 E;  2UXB I;  2UXD I;  5L3J A;  1MU5 A;  4JYA I;  4AQY E;  3PYF A;  1IBK E;  4X65 I;  3HJC A;  2CG9 A;  4YY3 I;  4IZJ D;  2UXC I;  4HAC B;  4DU8 A;  4MYU A;  5LMN I;  1HNW I;  1FWL A;  3OTO E;  4JI0 I;  1Z5B A;  4B3M E;  4DR7 I;  4DV1 E;  4URL A;  5A2Q C;  3T1H I;  4X66 E;  2Q2E B;  4DUZ E;  4GKK I;  1N32 E;  3J81 Q;  4B3R E;  4LFA I;  2CZ9 A;  4FN5 A;  2O1T A;  4LF4 E;  1Z0B A;  3LPS A;  1XNQ E;  2DEJ A;  1Z59 A;  1S4E A;  4DR2 I;  1KTV A;  3PYD A;  1HK7 A;  4ED4 A;  4WUB A;  4JI1 I;  1EA6 A;  4DV6 I;  2GS8 A;  5FLX C;  1N36 E;  2CGE A;  4JI2 I;  3K17 A;  4WUD A;  1NZ0 A;  5BR8 E;  3WU3 A;  3JAM C;  1HNZ E;  4DV7 E;  2E5L I;  1D6T A;  4B3T I;  3LTO A;  3GON A;  1HR0 I;  2Z5C A;  2ZM6 E;  4NXM E;  4FWH A;  4PRV A;  4JI7 I;  5LL6 R;  3Q1Q A;  2VQF I;  4DR4 E;  4DXL A;  3F0N A;  4DU7 A;  4LFB E;  1N33 E;  1PVG A;  2V2Z A;  1NHH A;  4DPX A;  4B3S E;  4LF6 I;  1Z0E A;  4OX9 E;  2BV3 A;  4K0K E;  2O1W A;  5LMU E;  1XNR E;  1N34 I;  3HUL A;  4LF5 E;  1ZM9 A;  4X64 I;  2F4V E;  5IT9 C;  4DV5 E;  1Z5A A;  2R42 A;  4JI5 I;  4IZK B;  5IWA E;  4AQY I;  2XEX A;  1IBK I;  2O1V A;  4DV2 E;  4P7A A;  2UU9 E;  1IBL E;  5FWK A;  4Z7C A;  1WUU A;  2Z5C B;  2BM1 A;  4NXN E;  4DV4 E;  4X66 I;  3QT8 A;  4DUZ I;  1H72 C;  3V2U C;  4YHH E;  1N32 I;  4B3R I;  2HHH E;  1H7U A;  1XMO E;  2R3V A;  4DR5 E;  4ZVI A;  2Z5B B;  4LF4 I;  1H74 A;  4DV0 E;  1XNQ I;  2WW4 A;  4PRX A;  3ZZU A;  2UUB E;  2HFU A;  1Z0V A;  2O1U A;  4UT4 A;  1N36 I;  4JV5 I;  3Q6M A;  4DV3 E;  1ZM2 A;  3B78 A;  5BR8 I;  4MYT A;  4LFC E;  1H7S A;  1HNZ I;  2Z5E A;  4DV7 I;  1ZM3 A;  2VQE E;  4RPF A;  1FNM A;  1S16 A;  4GKJ E;  1KVK A;  4HYM A;  2UUC I;  2E1R A;  2ZM6 I;  3PRY A;  1NHJ A;  4JI4 I;  1UEK A;  4DPU A;  2A2D A;  4NXM I;  1Z5C A;  4YY3 E;  1Z0W A;  3ZZ0 A;  1USV A;  2UXC E;  1Z0G A;  1RR9 A;  4DR4 I;  1N33 I;  4DR6 I;  4JI0 E;  4USM A;  4OX9 I;  4DR3 E;  1EI1 A;  2HK3 A;  4K0K I;  5LMU I;  2UUA E;  1XNR I;  2DEI A;  4LF5 I;  1U2R A;  2OI2 A;  2HKE A;  3WU4 A;  2F4V I;  4DV5 I;  4X62 I;  3J80 Q;  4WUC A;  3ZKB A;  3T1Y E;  1A6F A;  1N0U A;  4DR2 E;  1FKA E;  5IWA I;  4JI8 E;  2ZBK B;  3J81 C;  4JI6 E;  4JI1 E;  3P06 A;  4DV2 I;  2UU9 I;  1PKP A;  1IBL I;  2ZIT A;  3B82 A;  3WU5 A;  4PU9 A;  1DAR A;  1B62 A;  1XMQ E;  4EMD A;  1I94 E;  4LF8 E;  1QZR A;  4NXN I;  4HAC A;  4KHP E;  4DV4 I;  1NHI A;  1KKH A;  4LF9 E;  4YHH I;  5A2Q Q;  4JI7 E;  1ZXM A;  2HHH I;  1XMO I;  4DR5 I;  1J5E E;  1MX0 A;  4DV0 I;  1OJ4 A;  3PYE A;  3OTO I;  1Y6Z A;  4B3M I;  4DPY A;  1HNX E;  4DV1 I;  2UUB I;  4DR1 E;  2AJ4 A;  4USK A;  3Q6N A;  3J7A G;  1XHK A;  1FJG E;  3QT6 A;  1BKN A;  4DV3 I;  1KIJ A;  3K85 A;  5GME A;  3WU6 A;  3H4L A;  2PNL A;  5FLX Q;  4LFC I;  4XTJ A;  1IBM E;  2BM0 A;  2VQE I;  4GKJ I;  1MG7 A;  1ZXN A;  3JAM Q;  2V2Q A;  4DUY E;  2VF3 A;  4P52 A;  1N0V C;  3CWV A;  2LJP A;  4LF7 E;  1ZM4 A;  1FI4 A;  1RRE A;  4DR3 I;  4JI3 E;  2UXB E;  2UXD E;  2UUA I;  4JYA E;  1Y4S A;  4M1K A;  2J7K A;  4X65 E;  4R1F A;  3M6A A;  4N3O A;  2HFS A;  5LMN E;  1HNW E;  4LFB I;  2V34 A;  3T1Y I;  4IZJ A;  4B3S I;  5IT9 Q;  4DR7 E;  1H73 A;  4JG4 A;  4I3H A;  3ZKD A;  4JI8 I;  1Z0C A;  4FWD A;  3T1H E;  4JI6 I;  3J7A M;  4FW9 A;  4GKK E;  3PYG A;  3ZZT A;  4IZK A;  4JV5 E;  1FWK A;  3B8H A;  4LFA E;  4HY1 A;  1XMQ I;  3V5R A;  1I94 I;  4LF8 I;  4HXZ A;  3QT7 A;  2A2C A;  4KHP I;  2UUC E;  4JI4 E;  4DV6 E;  1K47 A;  2HKJ A;  4LF9 I;  2V2V A;  2X36 A;  4JI2 E;  4UTG A;  1J5E I;  4FWG A;  1VIS A;  3ZM7 A;  4DR6 E;  2V8P A;  1HNX I;  2E5L E;  4B3T E;  2X7I A;  2Z5B A;  1HR0 E;  3QT5 A;  4DR1 I;  1USU A;  1Z0T A;  2PNM A;  1FJG I;  4IZJ B;  2IOQ A;  2EFG A;  3K1J A;  4X62 E;  2VQF E;  2IOP A;  1B63 A;  1Y4U A;  4DPT A;  1IBM I;  4LF6 E;  1PIE A;  2GQ0 A;  4KQV A;  4DUY I;  1N34 E;  4DPW A;  3J80 C;  4Z7Y A;  5GMD A;  2NPF A;  4X64 E;  4LF7 I; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...