1IBML

Structure of the thermus thermophilus 30s ribosomal subunit in complex with a messenger rna fragment and cognate transfer rna anticodon stem-loop bound at the a site
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
124
structure length
124
Chain Sequence
PTINQLVRKGREKVRKKSKVPALKGAPFRRGVCTVVRTVTPKKPNSALRKVAKVRLTSGYEVTAYIPGEGHNLQEHSVVLIRGGRVKDLPGVRYHIVRGVYDAAGVKDRKKSRSKYGTKKPKEA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S RIBOSOMAL RNA
publication title Recognition of cognate transfer RNA by the 30S ribosomal subunit.
pubmed doi rcsb
molecule tags Ribosome
total genus 14
structure length 124
sequence length 124
ec nomenclature
pdb deposition date 2001-03-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
L PF00164 Ribosom_S12_S23 Ribosomal protein S12/S23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 1ibmL00
2PNHA 3CCMA 4JYAQ 3FHWA 1VQEA 1YJNA 1Q1BA 4IFDG 5C0XJ 3ULPA 3D0FA 2IHFA 1E22A 3LGJA 1K73C 1CSQA 1LTLA 3HKZG 4DR1L 1QUQB 2ZTDA 3PSIA 1L1OA 1A8VA 1Q82C 1W3SA 1JJGA 5GROA 5JJIA 2OQKA 1AH9A 1E3PA 1XTDA 3M3YH 3I7FA 2AWNA 3JC66 5IY0A 2E2JH 3E0EA 1E24A 4YCVA 1N33L 1KL9A 4JBKA 3L7ZC 4XIGS 4RG1A 1I6HH 1W2BA 2IX0A 1K8AC 3ER0A 3UE1A 4UP7A 1XNRQ 1P16A 1Y1VH 3GTMH 1BKBA 4AQYL 2UUBL 1L1OB 1IZ6A 1HR0W 2B63G 4DV4L 4A75A 4R4QA 4QL5A 1HNWQ 3RN5A 3PUZA 1V1QA 4B3SQ 1J5EL 3CCUA 1VQ6A 4QJFA 2MNAA 3FP9A 2AWOA 4NB3A 3PO3G 4C2MH 2PQAA 1VQ5A 1FJGL 1WYDA 2HIVA 5M3MH 3JAMi 2JEAI 1K0RA 2JQOA 4OWTB 4HIMA 3HOWG 4DV6L 1UWVA 2OCEA 1GVPA 5LMNQ 3T1HL 2JA8G 1L1OC 4WJ4A 2YYZA 5E7NA 1B7YB 1KHIA 1SR3A 2Q2HA 3ULLA 1YHAA 5K36G 4B3RQ 2EQSA 4YWMA 2ZJQA 1S72A 1SFOH 2UXCL 4APVA 3I4MH 1RL2A 3GDEA 3PF4A 1V43A 1AE3A 4DV3L 1BVSA 2VQFL 2JK8A 2PQAB 2UUAQ 1TWFH 1QVCA 5HY6A 3SGIA 2XGTA 2HHHQ 4A3CH 2E5LL 1HZCA 1O7IA 4GOPB 4JI4L 1Y1VG 4QIWE 2JA6H 4DR4Q 2A1AA 1HR0Q 4B3TQ 4DV2L 2NN6I 2UXDL 3TEHB 3NEMA 2K50A 1X56A 3GTOH 4NXML 2NZOA 2D62A 4KLKA 2H5XA 5C3EG 1BBWA 2Q2IA 1VCIA 3CC2A 1DGSA 1NBWA 1NMFA 1L2FA 2RHSB 5M3MG 1IBMQ 4KHPQ 2CCZA 4JI7Q 1C7YA 2GVBA 2K5NA 2ID0A 5LMUL 4OONA 3CP0A 4A3JH 1VQGA 4QY7A 3AFPA 3TQYA 2I0QA 2BH2A 2UXBQ 1A0IA 1YHQA 1Y1WH 4LWCA 3I4MG 4BBSH 5IYCH 2N8NA 2YV5A 4YHHQ 3RR5A 4A3GH 4X6AH 3ZJYC 3T1YL 1SMXA 1VQ9A 3DM3A 4A3CG 3RNUA 3G48A 3BZCA 3H15A 3CQZH 3H3VI 3OTOQ 4PZ6A 2JA6G 2ALYB 2XTIA 1JT8A 4IO9A 5BR8L 3S15H 1B8AA 4UP9A 1EIYB 4JI5Q 2WAQE 3AEVA 1CSPA 1XPOA 3EBEA 4X62L 2JJQA 5JEAJ 2OWOA 3HOZH 3I55A 5FLXc 3L0OA 4DR7L 3W5OA 3J80c 3S1RH 1S3OA 3CCLA 3CD6A 3KF6A 5IT9c 4WJ3M 4AIMA 2K4KA 4DV1L 3OW2A 1WCMH 3BU2A 3KYHC 4LNQA 2VNUD 4X66Q 4A3MH 4LF4Q 2HT1A 5EAYA 1IBKQ 2ATWA 4A3JG 5GAEC 4DUZQ 4C3HH 4OWXB 1LUZA 3PO2H 4GKKQ 1VQNA 2B29A 2R6GA 2KBNA 3PCOB 4TVAB 4LFAQ 1Q7YC 1Y1WG 4JI6L 1SRUA 3A74A 4DAYB 4BBSG 5IYCG 4DV0Q 3CCVA 2CWAA 1VQKA 3HOUG 4X64L 3KF6B 1IYJB 1IBLQ 1FVIA 1WJJA 4FDBA 4JBWA 4BBRH 4GNXB 4OX9Q 4A3DG 3KOJA 3S16H 3PF5A 2RCNA 3F2DA 1QUQA 4JI3Q 1PH4A 5IP7H 4Y7NH 4DUYL 1PH9A 4R4OA 4H02A 3J80i 3DLLA 1HNZQ 4GN4B 4MZ9A 3J7ZC 3HOZG 1N34Q 3F1ZA 1Q8KA 2MQHA 4LUZA 3UE0A 4GN3B 4ALPA 1B70B 1MJEA 1PVOA 4A3IH 4PZ7A 5GADC 1N36Q 4DV5L 4O0AA 3HFZB 3CPWA 1OXTA 1WCMG 2VY3A 1EQQA 1N32L 1UE5A 5FLMH 3W1BA 5LMNW 5ELNA 2F4VL 2I5LX 4JI0Q 1EFWA 4IFDJ 3A5UA 2JA7H 4GKJL 1FL0A 3RLNA 3PO2G 3S2DH 4YY3L 2R7FA 4K0KL 1KXLA 3STBD 1TXYA 4R4CA 1OXXK 1JB7A 4NXNL 1Q46A 4JI8Q 5C0XG 1I94Q 1GD7A 4BBRG 1WI5A 2BA1A 3CAMA 3M4PA 3CXCA 1X3GA 3PUVA 3F2BA 1VQMA 1OXUA 4JV5L 4PZ8A 4OO1I 3GTLH 1YI2A 3S24A 2YTYA 2JA5H 1I50H 3KLWA 1IL2A 1XNQQ 3GTPH 1VQIA 3E9HA 2Z6KC 1X65A 5IWAQ 3G4SA 1M1KC 3S17H 2VQEL 1MKHA 2MO0A 1YZ6A 5GQOA 3S1MH 4LF6L 4B3MQ 4HJAA 5GAHC 5C4XG 3J81c 3L2PA 3I4NH 3TREA 1XMQL 1OXVA 1KRTA 1MJCA 5M5YH 1EYGA 3PV0A 2PI2A 3MXNB 1XMOQ 1FGUA 4NPSA 4HJ7A 4GOPA 2VW9A 3GTGH 1KD1C 4L5QA 1CKMA 1RIPA 1PYSB 1GO3E 2D0PA 3H3VH 1YBYA 3RZOH 2JA7G 4A3FH 4LF9Q 4DK6C 3HOVH 4DKAC 1VQ7A 4BXXH 3EN2A 4A4IA 2UUCQ 3GTKH 4LF5Q 1JMCA 2OTLA 4DR6Q 3M4OH 1K3RA 3AQQA 4X65L 2L15A 2QA4A 2I5MX 4DR2L 1TWGH 2KCTA 5AJ3Q 4JI2Q 4LFCQ 2ZM6Q 2Y0SG 1GKHA 4DV7L 4LF7L 4YWKA 2FXQA 1X9NA 2JA5G 4DR5Q 4DV0L 2KENA 1HNXQ 1WOCA 1T9HA 3U50C 4IPDA 1S40A 3Q8DA 3PUXA 4IJHA 2F52A 4XTCS 4JI1Q 5IYBH 2C35B 4DR3Q 2UU9L 2R92H 4LFBQ 1G291 1KQSA 1VQCA 2WB1G 2Q2UA 2OTJA 2Y0SE 3CCQA 2K5HA 4GOPC 3M7NA 5ELOA 4P71A 3UDFA 1JJ2A 4LW1A 2DUDA 3EIVA 3U4VA 1PH1A 4R4TA 3F2CA 4A3FG 2PMZE 3HOXH 1G51A 4LF8L 2NZHA 3HOVG 1PH5A 1VQBA 3GTJH 2WB1E 4BXXG 2WAQG 4O2DA 4JYAL 4A3KH 2R93H 4DR1Q 4P74A 1Q12A 1E1OA 5M3FH 3G71A 2B3GA 3AYHB 3STBC 1M90C 2YU9H 1ASYA 2HIXA 4OWWB 1CUKA 1E7ZA 1PHJA 1LYLA 1N33Q 3BZKA 4JC0A 5IP9H 1A62A 3KF8B 4HIKA 1OXSC 1X6OA 2R92G 2QGQA 4AQYQ 2UUBQ 4LF8Q 1PH7A 1XNRL 5C44H 4GNXA 3K8AA 4DV4Q 2DGYA 4AYBE 3CW2C 3WWVA 2Z0SA 5GAGC 4UP8A 2ZTEA 3K7UC 1J5EQ 3S2HH 1HNWL 4A3LH 4DNIA 2VL6A 1Q81C 2CKZB 2LXKA 4B3SL 1HZAA 3S1NH 1YVCA 1YHBA 1FJGQ 4OXPA 5JEAG 4YCUA 4DV6Q 3I2ZA 3M85A 3T1HQ 4A3KG 2R93G 1V9PA 4IPGA 5LMNL 5M3FG 4A3GG 3MEFA 2N78A 2QEXA 4MTNA 1Z9FA 4GS3A 4A3DH 2AHOB 2VZAA 3I4OA 4IPHA 2GN5A 4GLXA 2NVQH 4B3RL 1XJVA 2UXCQ 4RMFA 1EQRA 4HIDA 4DV3Q 2A19A 2VQFQ 1IXRA 3E9IA 4GN5A 4J15A 4IPCA 2UUAL 2E5LQ 1CKOA 2HHHL 4JI4Q 1VQJA 4IFDI 2Z6KA 3KDFB 4GNXC 3ULJA 1YJ9A 1I3QH 2BH8A 3RLOA 5C44G 3KJOA 4DV2Q 1HR0L 1NY4A 4DR4L 2UXDQ 4B3TL 1X54A 4PMWA 3GTQH 4NXMQ 4A3MG 3GD7A 5IE8A 4A3LG 4QGUA 3S14H 3W1GA 1VQFA 2VS1A 2VUMH 4R4IA 4P73A 5M5XH 2PI2E 1IBML 1H95A 5C4JH 3CCRA 2E2HH 4BA2I 1JE5A 2B63H 3J7A5 4KHPL 4JI7L 5JJLA 3U58A 3ICEA 3TRZA 4YWLA 3PUWA 1NE3A 2ASBA 2K52A 2OQ0A 4GLVB 3UDXA 4A3BH 2KHIA 3PO3H 2R7DA 1YIJA 4QQBX 2UXBL 2I5HA 4R1JA 1VQ4A 2F3IA 5IP7G 3HOWH 1UEBA 4IJLA 3CMAA 2JA8H 3T1YQ 4YHHL 1BBUA 2MO1A 1VQ8A 4KI0A 1KAWA 3JAMc 2N49A 1Q1EA 1TWHH 2AKWB 3OYYA 1SROA 4A3IG 2WFWA 1TWCH 3OTOL 5J3BA 5BR8Q 1Q86C 2E2IH 3ERSX 1QVFA 4Y52H 3KFUA 4JBJA 1X3EA 4BY7H 1D7QA 1VS0A 4JI5L 2EIFA 1HZBA 3K0XA 4JCVE 4X62Q 5FLMG 1PH6A 3HKZE 3RN2A 3HOYH 3B6YA 4DR7Q 1LM0A 1C9OA 3K7AH 4POFA 1EWIA 2HQLA 3I56A 2VUMG 2NN6G 4P75A 3CPFA 1ASZA 4DV1Q 4IOAA 3GO5A 2R7ZH 4L5SA 1G6PA 4X66L 4LF4L 3G6EA 1IBKL 1VQLA 1L0WA 5C3EH 1PH8A 5C0XI 4DUZL 4A3BG 1KIXA 1X55A 1HZ9A 1K83H 1E1TA 2ES2A 4JI6Q 4GKKL 3CC7A 1I5FA 3FKIH 3IRBA 4LFAL 1MIUA 1EUJA 4JBMA 3RLFA 4X64Q 1X3FA 2WP8J 1UE1A 2CWPA 1VQHA 1YNXA 1EOVA 2YTXA 3J81i 1GM5A 2K14A 1IBLL 1J6QA 1NMGA 4JG2A 1D8LA 4OX9L 3CC4A 3S1QH 2KHJA 3I4NG 3PIPA 4DUYQ 3M9BA 4JI3L 1U5KA 4BY7G 3CCEA 2EXDA 4C3IH 2IHEA 4BA1I 1HH2P 4DK3C 1HNZL 3HOYG 1XPRA 4HJ9A 1N34L 2CFMA 4DV5Q 3PUYA 1SLJA 4JOIA 1N36L 1Z47A 3UDIA 1XPUA 1PV4A 1N32Q 2F4VQ 2R7ZG 4EQ5A 2ZJPA 1YITA 2V1CC 2RHQB 2GVAA 4A76A 3VDYA 3F8TA 4JI0L 3TS2A 4GKJQ 3CMEA 4A3EH 2JA9A 3K81C 4HIOA 1UE7A 4YY3Q 3NELA 2IT1A 4IOCA 2AMCB 4AYBG 3FKIG 4C3JH 4K0KQ 2IX1A 1K8GA 4NXNQ 3BJUA 2K75A 2LXJA 1KRSA 2JEBI 1SN8A 1C0AA 4JI8L 4L5TA 2LSSA 1I94L 1PYBA 4JV5Q 3M4QA 1PFSA 3H0GH 5IYBG 2D0OA 1A63A 3A0JA 2A8VA 3D31A 1YEZA 1VQAA 4A93H 3HOUH 3KJPA 1XNQL 1AE2A 4DPGA 3CCSA 5IWAL 2VQEQ 2CQOA 3J81j 5JJKA 2K5VA 1PH3A 4LF6Q 4JOIC 4BY1H 3PGZA 4PG3A 3HOXG 3RZDH 1VQDA 1QZHA 1XMQQ 4B3ML 2NVXH 5M5WH 4L5RC 2BA0A 2JE6I 2IY5B 1VQPA 5FJ8H 1QZGA 1N8RC 1OTCA 2ZJRA 1XMOL 3KDFA 4UPAA 1WFQA 3CF5A 5IYDH 4POGA 4A3EG 3AFQA 2KCMA 3NENA 4LF9L 1EIFA 4TQUS 1K9MC 5DLQE 3CCJA 2UUCL 4DR6L 3TS0A 1P8LA 4LF5L 4X65Q 3UDGA 2E8GA 4DR2Q 4UY8C 5IP9G 1VQOA 2Q2TA 2NVTH 5AJ3L 3H0GG 3K80C 4LFCL 2ZM6L 1TWAH 4DV7Q 1KC8C 2ZTCA 4JI2L 1NTGA 4LF7Q 1CKNA 4EX5A 1QVGA 4KHZA 4HJ8A 4MNOA 4GLAC 1PH2A 5HGQA 4A93G 4DR5L 1NJIC 1U0LA 1HNXL 1YJWA 1R9TH 2UU9Q 4AH6A 4OO1G 3HKSA 1SE8A 4JI1L 1PA6A 4DR3L 4LFBL 1JJCB 4BY1G 3PIOA 1UE6A 1Y14B 3NBHB 2MFIA 4LUOA 5FJ8G 2YTVA 5H1SE 1CKNB 1HJPA 5LMUQ 4ME3A 5IYDG 2N3SA 4P72A 4YCWA 4DAMA 4LUVA 2RF4A 1N9WA 3U4ZA 3A5ZB 2NVYH 4HJ5A 5C4XH
chains in the Genus database with same CATH superfamily
2K04A 1HCZA 1LTLA 1TWFB 1H9SA 1QUQB 3GV3A 1L1OA 1W3SA 3J80L 5JJIA 2EYMA 1XTDA 3I7FA 1AZQA 1N33L 3BS1A 1PTOD 1L0XB 4XIGS 4RG1A 4JBKA 2KQ3A 1W2BA 1H9SB 3GTMH 4OL7A 1BKBA 3NWTA 1L1OB 2FFKB 4R4QA 4HAEA 1D6EC 3QR8A 2F0JA 2Z9HA 4B3SQ 1J5EL 1VQ6A 1DOMA 1BNZA 4IQZA 3JAMi 2LFNA 1EY9A 1K0RA 2JQOA 1DXMA 4OWTB 1S5ED 1UWVA 4A3GB 1GUGA 1L1OC 3QIAA 3VA7A 4WJ4A 2YYZA 1G6ZA 2EQSA 3K5LA 1S72A 2MGSA 2VQFL 4A3CH 5LL6S 4ZLTF 4EVOA 1Y1VG 2A5HA 3FVQA 4DV2L 1SYBA 3FPUB 2K50A 2PNRC 1ML0D 3GTOH 4ZCKA 4KLKA 3C2PA 2RA4A 2X69A 4P2CB 2D9UA 2HUGA 1Y8OB 1BBWA 3VYSA 1SMYC 2B2TA 4KHPQ 5M9OA 1FD7D 2OT2A 2Z6BA 3SK4A 3D8GA 4CBVA 3CP0A 1TS3A 3MC0B 1RDPD 1PTOB 3TP8A 1AEXA 2BH2A 1SE2A 5IGGA 1YHQA 1Y1WH 4BBSH 2A68D 3P1HA 4YHHQ 3RR5A 3H94A 3ZJYC 3G48A 3H15A 3CQZH 1PTOC 1STNA 2ALYB 2JA6G 1C48A 4IO9A 1A3TA 1VF7A 4J8QA 1DJRD 1B9MA 2WAQE 1TT2A 1CSPA 2BOSA 2OEOA 2OWOA 2B2TC 3S1RH 1W6KA 3S2DB 3CD6A 3KF6A 5C4JB 4WJ3M 1RKNA 2C5CA 4AIMA 1WCMH 3J7AV 4X66Q 4QF4A 5EAYA 5HGTA 4A3JG 4C3HH 2FJ2A 1LUZA 2B29A 1Q7YC 4LFAQ 3VYTA 1SRUA 5IYCG 2CWAA 5C3XA 3PIO3 1VQKA 1A6XA 4X64L 3KF6B 3S17B 1IBLQ 4JBWA 3A8JE 4GNXB 4BBRH 2PMZB 2K6AA 4OX9Q 1LT4D 4U673 4RFBA 1PH4A 1S5BD 4Y7NH 1V1OA 1PH9A 3U9OA 1NR4A 4KTAA 3DLLA 3K57A 1B3QA 1ET6A 4MZ9A 3K7AB 3J7ZC 3HOZG 1N34Q 2MJ8A 1Q8KA 4ALPA 4RGTA 4I7AA 1B70B 3OMCA 4A3IH 5GADC 3PQIA 4DV5L 3I90A 5A2QL 4O0AA 3C3LA 2OF1A 3CPWA 1JOKA 3W1BA 2IW3A 1KLGD 4XT3B 4GKJL 1CQVA 3RLNA 3PO2G 1JORA 4IZ8A 2CVRA 4K0KL 1TXYA 4NXNL 2A6HD 1AP0A 1I94Q 1STYA 5D65A 5IODA 2A68C 2R92B 2BA1A 4UAIA 3F2BA 4JV5L 1X3GA 1PFMA 5KNCA 4N9PA 5JVH3 4PZ8A 4OO1I 1YI2A 2YTYA 1IL2A 1VQIA 5IWAQ 1E2WA 4KJNA 2HDMA 3S1MH 2F0NA 1X3PA 1XXGA 2DY7A 4IUTA 4HJAA 4ZAIA 4A3KB 4YIJA 3HEJA 1EYGA 2R93B 1LTBD 3MXNB 1FGUA 1LT6D 1KD1C 1MSGA 2G9DA 2F0EA 4LF9Q 3HOVH 1EY8A 2UUCQ 2G5DA 2F0TA 3M4OH 3Q23A 1K3RA 2L15A 1BBXC 3H0GB 4LFCQ 2ZM6Q 4YWKA 4ILWA 2JA5G 3VR5A 2KENA 1HNXQ 3U50C 4QUFA 2LS01 4IJHA 3S1NB 4LAAA 2C35B 1KQSA 4FP5D 4XYOA 5CV4A 2B8GA 1G8ZD 2DUDA 1LT3D 2NTSA 2IL8A 3HOVB 1F9PA 3DHQA 4A3FG 2NVQB 3KK7A 1VQBA 3GTJH 4PMBA 2L55A 2AQ1B 2B3GA 1V8QA 1CHPD 1KAAA 4OIJA 1I3QB 3X3MA 1VF5C 2LKVA 4DU9A 1LYLA 1N33Q 4JC0A 5IP9H 4ZKCB 4HIKA 1DM0B 3S14B 1X6OA 3G7LA 2VUMB 2PZWA 3LWEA 2E2HB 2DGYA 4AYBE 3WWVA 4LMQD 3OW7A 1SSOA 5GAGC 2ZTEA 3K7UC 1J5EQ 1HZAA 2K03A 5JEAG 3M85A 5M3FG 3RMHA 2N78A 1U4PA 3I4OA 1TWCB 3HS0C 2GN5A 4HIDA 3R93A 3KLSX 2VQFQ 2F0IA 2E2JB 4J15A 4IPCA 3JAME 2UUAL 1HUNA 1KABA 2Z1CA 4K5VA 5E4XA 2O4XA 4DV2Q 3KJOA 5IGEA 1D5MC 5IE8A 4A3LG 1KLUD 4C3HG 2PQEA 3C1FA 4R4IA 1I4GA 5M5XH 2PI2E 1IBML 1H95A 5C4JH 1JE5A 1I4XA 4R8NA 3TRZA 4GLVB 4ME5A 1II3A 2EVBA 3I4LA 4R1JA 3HOWH 2F3IA 2J7ZA 4DK1A 1PRTD 3QJYA 4KI0A 2N49A 3FMCA 2PZTA 3OYYA 1Y8NB 1SROA 2JN4A 4A3IG 2WFWA 2JA6B 5J3BA 1QVFA 3KFUA 2F4IA 3DXJC 1CZGA 1T5XD 3K7AH 2DY8A 1ONLA 1GOZA 3GO5A 4EQOA 2R7ZH 1G6PA 4A3JB 1PH8A 3TP7A 4DUZL 2ES2A 2ZXRA 4GKKL 1CZWA 4X64Q 5JPNC 1X3FA 3J81i 1YNXA 1EOVA 2YTXA 5JJLA 1J6QA 3CC4A 1K8OA 2A6EC 4C56C 4JI3L 4V0BA 5EKIA 1HH2P 4DK3C 3HOZB 3HOYG 3KBXA 4DV5Q 3FPPA 4RA8A 5ELDA 4IUPA 1EIHA 1Z47A 3UDIA 1XPUA 3UI2A 3K5OA 1PRTB 2RHQB 3TS2A 4GKJQ 2EYHA 2F0FA 2B2YC 3NELA 4K0KQ 4NXNQ 3MXGA 4J6HA 2WIIB 3SR1A 1R9TB 4L5TA 4JV5Q 3H0GH 1PRTC 3NWSA 2E76C 1B4OA 4DNTB 1W6JA 1YEZA 4CJ2C 1XNQL 3CCSA 5JJKA 4BY1H 3PGZA 4PG3A 4B3ML 2EYPA 1JB3A 3Q6SA 1A3VA 2IY5B 1O80A 1B44D 3KLRA 5EGTA 1TS2A 1EIFA 3IAYA 5DLQE 4DR6L 3TS0A 4U68A 2DJGC 1B1ZA 1CFMA 1EEID 5IP9G 1VQOA 1IYUA 5AJ3L 3TSSA 1KC8C 2ZTCA 1TS4A 4EX5A 2EXZA 3BVZA 4F7XA 3GTPB 4HJ8A 2JA5B 2L0CA 1UUPA 5HGQA 4A93G 2EYFA 1U0LA 1YJWA 1R4PB 2L11A 2EYLA 3MEHA 3F2UA 2WKCA 2EJGC 3PIOA 1F2ZA 2MFIA 4LUOA 5FJ8G 5H1SE 1HJPA 5LMUQ 3RZOB 1WTOA 1TS5A 4YCWA 3MZ5A 3D3RA 1KNEA 3A5ZB 3BZDB 1EIGA 5C4XH 2E74C 1VQEA 3ULPA 2IHFA 1E22A 3A7AB 5EJWA 3HKZG 2V4DA 3I70A 1HRJA 4HMJA 5IT9L 3AB9A 1SYFA 1E2VA 2A73B 2AWNA 3JC66 1VMPA 2E2JH 1E24A 4YCVA 1EEFD 1Y1VH 4K5WA 1BOSA 4LJZC 5KYIA 3OPOA 1SNOA 2IPKD 4QL5A 4TSSA 1PZID 3NP8A 4HCEA 2MNAA 2AWOA 4NB3A 4JPBW 5FK9C 2BDNA 4IUNA 4BBSB 3HOWG 2OCEA 5M3FB 1GVPA 4PNYA 2RBMA 1B7YB 2AUKA 2Q2HA 5E7NA 2RDHA 1YHAA 3CQZB 3ULLA 4MTKA 1Y69U 4YWMA 2ZJQA 1ESRA 4TRDA 4APVA 3PF4A 1BVSA 2UUAQ 4O1NA 1QVCA 5HY6A 4DFAA 2XGTA 3SVMA 5KEEA 3S1RB 2E5LL 1O7IA 2Q8IB 2JA6H 4CJ1B 3GP7A 2A74C 2D62A 4C3HB 5FLXE 1HUMA 3CC2A 1DGSA 1NBWA 1STGA 2F3WA 2RHSB 1IBMQ 4JW0A 2CCZA 1C7YA 1WTWA 1ILQA 1HQMC 3OHXC 1WTVA 4A3JH 4NW2A 1VQGA 1ICWA 2EY1A 3AFPA 3TQYA 2K5QA 3I4MG 4Y7NB 2P5ZX 1NUCA 5IYCH 4NMZA 2AQ2B 1SMXA 3DM3A 2D5DA 4A3IB 5BN5A 3NQIA 4UP9A 2CH4W 1XPOA 3EBEA 2JJQA 3HOZH 3ERQA 2KCNA 3W5OA 3J80c 1S3OA 4RHRA 3CCLA 5BN4A 2XRSD 3RD4A 3QOLA 4S3SA 3KYHC 4RWSC 2G9HD 2F0SA 1ILPA 3DWPA 4DUZQ 2DN8A 1NSNS 3NBHA 2PO4A 3PO2H 4GKKQ 4RHSA 2PW7A 4TVAB 3A74A 4DAYB 3TBIB 1YNNC 3AU7A 3L9AX 1K8MA 1IYJB 2GA4B 3SXHA 1LO5D 3S1MB 3PF5A 3F2DA 1QUQA 4JI3Q 4DUYL 3J80i 5DM63 3PMFA 3NSWA 3F1ZA 4L8JA 2MQHA 4GN3B 3J81E 4B08A 3EFXD 1GXDC 3QOJA 1PFNA 3M4OB 1OXTA 1EQQA 1UE5A 3VYRA 5ELNA 1GUNA 2I5LX 1XWEA 1K83B 1A2TA 5I2XA 4Z9CB 1G2TA 3STBD 1UNSA 1JB7A 1Q46A 5C0XG 5FKAC 3OWEB 3M4PA 2QDBA 4KV6A 1TR5A 4KN7C 3S24A 3M7GA 2JA5H 3GTPH 3IFTA 4B9XA 1XNQQ 1IKMA 3E9HA 4ULLA 3T16A 3D4RA 2MO0A 4B3MQ 3Q22A 4HTHA 1RF2D 5GAHC 3GTJB 3L2PA 3I4NH 5C4XG 1QE6A 3PV0A 4KY7A 3GTGH 4HJ7A 2VW9A 2D0PA 1EWCA 3H3VH 3RZOH 1YBYA 4F87A 4A3FH 4DK6C 3CRKC 4DXFA 1F2LA 4DKAC 1VQ7A 4DR6Q 4N8FA 5CBEE 3TMEA 2QA4A 1O7YA 4DR2L 2KCTA 5AJ3Q 1LABA 2A69D 4CHTB 2Y0SG 2KECA 4DV0L 4IPDA 1S40A 3Q8DA 3RZDB 2WB1G 2Y0SE 4FXKC 4C1NK 3A54A 4P71A 3SK5A 3X3NA 2SNSA 1JJ2A 3FEWX 5CGKA 1LLRD 4R4TA 3F2CA 4OHJA 1G51A 4LF8L 3HG9A 1FYCA 5JEAH 1I4HA 3A56A 4BXXG 2WB1E 2WAQG 4O2DA 1JICA 3HKZB 4O42A 5M3FH 3N6RA 1HPCA 2PPBC 1H9KA 3STBC 4FO2A 1ASYA 1CUKA 1D1IA 4R8IA 1RODA 1PHJA 4TKOB 1DOLA 1A62A 1OXSC 4ZKBB 3R8BA 4M8AA 2B8FA 5M5XB 1CTMA 1XNRL 1PH7A 4GNXA 3K8AA 1PTOF 4WFN3 4G4KA 4A3LH 2K05A 4RKBA 1YHBA 3ITPA 4OXPA 3HOWB 4G7ZC 3I2ZA 1ENCA 1SNMA 5KIXA 4IPGA 5LMNL 1GJXA 4MTNA 2XRQD 4A3DH 4WORA 1FNUA 2VZAA 3J7YW 3K58A 1HA5A 2Q8RE 4B3RL 1HHVA 4IFDH 2OXPA 2A69C 4RMFA 3SDZA 4FNFA 1MGSA 1CI3M 2E5LQ 1CKOA 2HHHL 1DCZA 4GNXC 1SYCA 2BH8A 2HCIA 5C44G 5CV7A 1HR0L 4B3TL 2R7ZB 1X54A 2F03A 3GTQH 1BF4A 3GD7A 1PZKD 4XXEA 4P73A 4DNRB 1QCBD 2B63H 1V1PB 4G57A 3U58A 3ICEA 2CH4A 4YWLA 4CKBA 1NE3A 2K52A 3UDXA 1VMCA 2NUCA 3MXNA 4CKCA 1SFOB 2R7DA 1YIJA 3I4MB 2I5HA 3R3OA 1VQ4A 1RD9D 1UEBA 4IJLA 5KRUA 2JA8H 1BBUA 3TP5A 1D1KA 1CHQD 2AKWB 1JWMD 1NAPA 4OGQC 3DEOA 2FINB 1Q86C 4QMGA 3Q0AA 1ESFA 1X3EA 5CV9A 2ICIA 1IKLA 4JI5L 1U9RA 1HZBA 1O7ZA 4K14A 5IGCA 5IGDA 3HOYH 2E75C 3I56A 2NN6G 4P75A 4IOAA 2MUYA 3MFYA 1BR9A 4LF4L 1L0WA 5C3EH 4A3BG 1KIXA 1K83H 3IRBA 4KY5A 2SOBA 1SYGA 3T53B 4JBMA 2F1MA 2WP8J 5NUCA 2CWPA 4ZQ3A 2K14A 2NYZD 1KDAA 1F77A 4BY1B 3T13A 5ELEA 3I4NG 3S15B 2SEBD 4Q0FA 4DUYQ 3M9BA 4CDCC 1U5KA 4C3IH 1HNZL 2XIWA 1DD2A 3VA5A 4FF3A 4JOIA 1N36L 4N8X1 2EY2A 5EKLA 3VDYA 3CRLC 2A6HC 3MVVA 4KD4A 2JA9A 1RTOA 1JR0D 2AMCB 4AYBG 1EY4A 4H13C 4K2KA 5T1GA 1C0AA 3S16B 3M4QA 3IKJA 1A63A 5ELCA 3A0JA 2EJFC 1EU4A 3D31A 4J1MA 4A93H 1U4LA 3KJPA 3A7LA 3NTIA 2K5WA 3V2TA 5C4ZA 5FO9B 2CQOA 4JOIC 5C4XB 3RZDH 4KN4C 4ZK9B 5M5WH 2JE6I 1VQPA 5FJ8H 1N8RC 1XMOL 5CMDA 1FNWA 1WFQA 3NUCA 1YNJD 4LK1C 3AFQA 4TQUS 1K9MC 4C3JG 1ENFA 2PCFB 4LF5L 2J4XA 4PMCA 4DR2Q 4UY8C 4I7ZC 2NVTH 3K80C 1I6VC 1Y1VB 4K6DA 1NTGA 1EZ6A 2SNMA 2I46A 2K33A 2L9HA 1SE3A 4MNOA 4FXDA 5CYUA 1G2SA 4JI1L 1PA6A 1TKWB 5D3IB 1EQVA 5M5YB 1Y14B 2L5TA 3LX0A 4A3DG 1WTPA 4R9WA 4RGOS 4LF8Q 1DYQA 5D14A 5G3LD 3CCMA 3LNNA 2WAQB 3FHWA 5I9OA 4IFDG 1BXTA 1LTRD 1K73C 1CSQA 2WV6D 4DR1L 2NTTA 3PSIA 4K8IA 1A8VA 3ONAB 2WINB 1EWHA 1HFGA 3TDQA 5FLXL 2F0QA 5TSSA 1JQYD 1JJGA 1D2BA 5GROA 1Z6HA 2OQKA 1E3PA 5JOBA 1QNKA 3E0EA 3FRPB 1I6HH 3L7ZC 5A35A 1E2ZA 3TZUA 4XQJA 3UE1A 5LL6X 1XNRQ 2PZUA 1JCKB 4CDFC 5EPKA 1HR0W 2B63G 4DV4L 4A75A 5J39A 1LTGD 4FYDA 3RN5A 1V1QA 4KJOA 2F0MA 3CCUA 4QJFA 3A8IE 2F0VA 3FP9A 2MHVA 1CT1D 1JC7A 1VDZA 4FXGC 1WTHA 4C2MH 1FJGL 2JEAI 2HIVA 1YNJC 3T4AC 3TN2A 4DV6L 2B2YA 4MHEA 5LMNQ 3L3OC 3T1HL 2JA8G 1KHIA 2KCCA 2QILA 2CHBD 5K36G 1PLFA 1XYIA 2BDOA 4B3RQ 1SFOH 2UXCL 1CA6A 3I4MH 2B2UA 1AE3A 1U4RA 4DV3L 2JK8A 1QOHA 1F9SA 1XX8A 1SBBB 3SGIA 2HHHQ 2DNEA 3WDNA 3OIPA 1HZCA 4GOPB 5A2QE 5C44B 4ZUJA 1HR0Q 1C8CA 4B3TQ 3E3XA 3TEHB 2NWGA 3S2HB 1X56A 2VB2X 3K5MA 2NZOA 2H5XA 5C3EG 3PO2B 2Q2IA 1QJOA 3OIQA 1ZEQX 5M3MG 2EJMA 5J1ZA 2GVBA 2ID0A 3EROA 2R3ZA 4DGZA 5T1IA 4G7OC 1S5CD 4OONA 4QY7A 3NHHA 1HTLD 2I0QA 2B2UC 1A0IA 4DA2A 4C3IG 3T1YL 5G3LF 1STHA 1AW7A 3BZCA 1PRTF 4PZ6A 4HSPA 1JT8A 2XTIA 3S15H 1EIYB 4JI5Q 3AEVA 2ZXPA 4H44C 4X62L 4QIWB 5JEAJ 1RCVD 3L0OA 3EA6A 5IT9c 2NB0A 2K4KA 4DV1L 3OW2A 1MD2D 1CM9A 4A3MH 3QG1A 5I2YA 4LF4Q 4IUVA 2ATWA 4NP5A 1BCPD 4K6LA 4WRDA 4OWXB 4F88A 2Z4HA 3NTHA 2K1BA 3KLSA 1VQNA 2KBNA 5L37A 4I65A 3CCVA 1RJTA 4FDBA 5C0XH 1S5FD 1K3BC 1TWHB 5C6AA 1Z7TA 3S16H 4CDDC 2RCNA 3I4NB 2E2IB 1B2TA 2F0GA 5IP7H 3GTGB 1EYCA 4R4OA 2SDFA 4H02A 3MA2B 2RKSA 4X3UA 1HNZQ 5FO8B 4A3FB 3E0JA 3UE0A 3CHBD 1N36Q 1UEAB 2DNCA 1N32L 1XTCD 2F4VL 1EFWA 4IFDJ 3A5UA 3H3VC 1FL0A 2EY5A 2F0OA 4AYBB 3VR3A 2B2VC 1KXLA 1B3AA 1SJED 1PFBA 4R4CA 5IGBA 1STAA 4RKLA 1GD7A 2QEJC 1WI5A 5CV6A 1FNVA 3S1QB 1OXUA 3D6CA 2JXMB 4KKTA 1EOTA 4ID6A 3J7AF 1I50H 4JVZA 4X3SA 1X32A 4UHVA 2Z6KC 1X65A 1LTAD 4X3TA 1KTKA 3G4SA 1NCVA 2H4OA 3D4WA 1BCPB 2VQEL 2Z8LA 4LF6L 4FF2A 1ZKOA 2CQAA 4DXGA 1XMQL 1KRTA 5M5YH 1XMOQ 2PI2A 5F2DA 4NPSA 1HA6A 2K5DA 3BYYB 4L5QA 4DF7A 1CKMA 1RIPA 1PYSB 1GO3E 2MP1A 2JA7G 4L63B 3MXPA 4HR7B 4C3JB 1BCPC 4BXXH 3EN2A 4A4IA 4LF5Q 1S5DD 1JMCA 3AQQA 1J8IA 4X65L 2L1BA 2I5MX 1TWGH 3SK8A 3VYUA 1GKHA 2F0PA 1PZJD 3MAQA 4LF7L 1AFPA 1AN8A 1X9NA 1NR2A 1WOCA 1T9HA 3HZXA 3PUXA 3NXWA 2F52A 4XTCS 4JI1Q 5IYBH 2K01A 1G291 3CCQA 1HFNA 2K5HA 3HRZC 3M7NA 5ELOA 4LW1A 4A3DB 3TP6A 4K8JA 3MWYW 2PMZE 2VB3X 4XYQA 3HOXH 2NZHA 4JYAL 1CQFA 3QO2A 3Q24A 2ZXOA 4IUQA 1EZ8A 4DR1Q 1E1OA 3G71A 1EFID 1GUTA 3AYHB 2JSOA 1M90C 4RCNA 5IGFA 3URYA 2O5JC 1GUOA 3GTQB 2O2LD 2X6GA 2RDFA 3BZKA 5IIFA 4DAYA 2R92G 2QGQA 3HGBA 1LV9A 5C44H 2B63B 4DV4Q 1NNXA 3GQBA 3CW2C 2NBFA 1JWUD 3S2HH 1HNWL 1LTID 4DNIA 2CKZB 1YVCA 2FMMA 3DUZA 1FJGQ 4DV6Q 4A3KG 3T1HQ 1KDBA 2B39A 2JA8B 2R93G 2KHSA 2QEXA 1Z9FA 2AHOB 4IPHA 2UXCQ 5KNDA 1XJVA 1EQRA 4DV3Q 2A19A 3M3YB 1SNDA 1IXRA 4GN5A 3HOYB 4PV1C 4DAVA 5EBCA 3OWFA 1VQJA 3KDFB 3O13A 2KUMA 3ULJA 1YJ9A 3I72A 4NDXA 4DR4L 1NY4A 1SYEA 4A3MG 3I91A 5C3EB 1PMRA 2KEDA 2X6LA 2FHTA 1VQFA 3P75A 1MHWC 2FMCA 2NN6H 2L4NA 3CCRA 5ELBA 2IX3A 4JI7L 2ASBA 2OQ0A 2EY6A 4A3BH 2L12A 3PO3H 4QQBX 2UXBL 5IP7G 5E3FA 3CMAA 4C3IB 3T1YQ 2MO1A 1VQ8A 3JAMc 5C5LA 1TWHH 1GHJA 2EYJA 3OTOL 2XN9C 2E2IH 3D4DA 2E2DC 2K7VA 1VS0A 3K0XA 4JCVE 1SDFA 4X62Q 4L6TB 4CDEC 1C4QA 3B6YA 2HD3A 1LM0A 4POFA 1EWIA 2VUMG 1CA5A 3CPFA 1ASZA 3QWNA 5ISRA 4DV1Q 2LMCB 4HMIA 1TY2A 4L5SA 1LTSD 3I8ZA 1IBKL 1VQLA 1R4QB 1MBYA 5C0XI 3MXUA 1DONA 1X55A 3BVGA 1E1TA 1I5FA 1KNAA 1MIUA 3BDLA 4A93B 1QB5D 4RH6A 1IW7D 1VQHA 2AUJD 4JG2A 3S1QH 5M5WB 3PIPA 3E5SA 5C5MA 1DZ1A 4K5XA 4BY7G 2EXDA 2RVLA 3JAML 1XPRA 4HJ9A 1OO9B 1EU3A 2CFMA 3PUYA 1ZXTA 1N32Q 4CKEA 1LACA 4CGYB 2F4VQ 2ZJPA 1YITA 2NVTB 2V1CC 4JI0L 2KEEA 3ND8A 3K81C 5IT9E 4HIOA 1UE7A 4IOCA 2IT1A 3FKIG 4C3JH 1SEBD 2IX1A 3V96A 3DWQA 1K8GA 4FVMA 1SN8A 3A8KE 4JI8L 2LSSA 1Q90A 1PYBA 4B9WA 1SE4A 5IYBG 2F0DA 2D0OA 1STEA 5CR3A 4RCOA 3NE5B 1M8AA 2A8VA 3H91A 1WTQA 4KHVA 1PYWD 3N52A 5C4HA 3IL8A 2KOLA 5FO7B 3HOUH 4GZYC 1AE2A 3H09A 4WJWA 2XWBB 2VQEQ 2K5VA 2F0KA 3OOCA 1PH3A 4LF6Q 3HOXG 2XWJB 1VQDA 1XMQQ 2NVXH 1JWSD 4HN7A 1QZGA 1OTCA 1BQQT 2CW0D 1HXYD 4UPAA 5E1FA 3CF5A 1H9RA 2PW5A 1F9QA 2JA7B 4A3EG 2KCMA 3NENA 3CCJA 4ZRZA 5LHY1 4X65Q 3UDGA 2E8GA 1IL8A 1I6HB 2Q2TA 2XVSA 4JI2L 1IW7C 1CK1A 1TWAH 1V1PA 4LF7Q 3GTLB 4RGMA 1CKNA 3C1EA 1QVGA 3BG3A 1PH2A 3SK6A 4DR5L 3H6MA 1E0BA 4OO1G 3OSOA 3HKSA 1SE8A 4BS9A 4H0LC 2EYOA 4C2MB 4DR3L 1JJCB 4LFBL 1GUWA 4OIKA 1I4RA 1I4PA 1UE6A 4Q5VA 2RDGA 2YTVA 4C1NI 1CKNB 4ME3A 2EDGA 5IYDG 2N3SA 4DAMA 4HJ5A 1T5EA 3HFZB 2RF4A 1N9WA 1LT5D 2NVYH 1H9JA 4LUVA 4ABNA 2PNHA 3I3CA 3GTKB 4JYAQ 1YJNA 1TY0A 1Q1BA 5C0XJ 3D0FA 3LGJA 1TU2B 2ZTDA 1SNQA 3DEPA 1WTRA 1Q82C 5K36H 5J22A 1JE4A 1AH9A 1SJHD 3SE0A 4XDXA 3M3YH 3W3AA 5IY0A 1KL9A 1TIID 1K8AC 2IX0A 3ER0A 4UP7A 1P16A 4N9TA 4AQYL 2UUBL 1IZ6A 3MHBA 5EPJA 1WD0A 1S4ZA 4QB4A 1HNWQ 3NK9A 3PUZA 2QW7A 3K59A 2CW0C 3PO3G 1VQ5A 2PQAA 1SYDA 2F3VA 1WYDA 5M3MH 3I73A 4M1UB 4HIMA 5I6WA 3U9SA 4FF4A 1EQTA 2YU9B 1FR3A 5I6YA 2F0WA 1SR3A 2EZVA 3W2DA 1RL2A 3GDEA 1V43A 2N88A 2PQAB 1TWFH 3K0YA 3T51B 4JI4L 3KUPA 4QIWE 4DR4Q 2A1AA 1ZYRD 2NN6I 2UXDL 5JPMC 3NEMA 4A3MB 4MN3A 4NXML 3J80E 1K0SA 1HQRD 4MIUA 1VCIA 1NMFA 1L2FA 4JI7Q 3DM1A 2K5NA 2DJFC 3CU7A 5LMUL 2QCPX 4RAUC 5CC4A 3ZYYX 4DN4M 1WTXA 2UXBQ 4LWCA 5DEHA 2AQ3B 2N8NA 2YV5A 4A3GH 4X6AH 3BDOA 1VQ9A 3C46A 4A3CG 3RNUA 4IALA 5COYA 3H3VI 3OTOQ 1KDCA 5BR8L 4IUUA 1B8AA 4F8MA 1IHZA 3I55A 5FLXc 4DR7L 3EVQA 3KBGA 3WOFA 3BU2A 1O78A 4LNQA 2VNUD 5CBAE 2HT1A 1EY6A 1IBKQ 5GAEC 2Y0SB 3J7A5 2R6GA 3PCOB 4JI6L 2QKIC 1Y1WG 1I50B 4BBSG 4DV0Q 5JAVA 2KA7A 1I4QA 3HOUG 1Q3LA 1FVIA 1WJJA 3DMUA 5DAUA 1EYDA 3KOJA 4KKSA 2R61A 1B53A 2RQXA 1M4VA 1PTOH 2F0LA 2WB1B 3D6WA 1RHPA 2M9VA 4BY7B 1BO0A 1ZYRC 3M4YA 4GN4B 5CORA 2A6ED 3NPPA 4LUZA 1PVOA 1MJEA 1DOKA 4PZ7A 1STBA 1Q8IA 1WCMG 2TMPA 2VY3A 5FLMH 5LMNW 1TWGB 4JI0Q 2JA7H 2RSNA 3FKIB 3S2DH 1F9RA 4YY3L 2R7FA 4UDUC 2O5IC 1F2YA 1OXXK 1TVXA 1EY7A 4JI8Q 4IURA 4BBRG 1VQMA 3CAMA 3CXCA 3PUVA 2M2LA 3TZDA 4KMUC 3GTLH 4X3KA 1SNCA 3KLWA 1M1KC 3S17H 1MKHA 2VXWA 1YZ6A 5GQOA 3HOXB 5DNFA 3J81c 3TREA 1OXVA 1MJCA 3PIP3 4IFDI 4GOPA 3EQLC 1Y8PB 4XT1B 4DK0A 4A3EB 5EBDA 3GTKH 4HCSA 2OTLA 3IFDA 4JI2Q 4HEDA 4DV7L 5EPLA 2FXQA 3MTSA 4DR5Q 5ELFA 3V05A 1JOOA 2UU9L 4DR3Q 4LFBQ 1QILA 5JJZA 3E6ZX 2R92H 1VQCA 2Q2UA 2OTJA 5EKKA 2C9OA 2K28A 4GOPC 4KKUA 1EY5A 3SHLA 3WOEA 4EQNA 3UDFA 3R2TA 3EIVA 3U4VA 1PH1A 2WKDA 4PQXA 1QNUA 3HOVG 1PH5A 4KY6A 3J81L 3KF8A 4A3KH 2R93H 4P74A 1Q12A 1WVLA 2RSOA 2YU9H 2PYKA 1SNPA 2HIXA 5EQ0A 1FGBD 4K2LA 4OWWB 4FF1A 4EQPA 1D5XC 4KD3A 1E7ZA 3NQTA 5KNBA 2H1EA 3KF8B 5KGUA 2WACA 4AQYQ 2UUBQ 1A2UA 4ODGA 3BYTB 2Z0SA 4UP8A 3G6JB 2VL6A 1Q81C 4B3SL 2LXKA 4A3BB 3S1NH 3PO3B 2ENBA 1ENAA 5D3DA 4YCUA 3EJIA 1D5ZC 3K6OA 5I9PA 2BE5D 5I4DA 1V9PA 2B2VA 2QF7A 2F0UA 1U4MA 2J0TD 3MEFA 1LTTD 4OEMB 4A3GG 4BWGB 4GS3A 2MPMA 3SEBA 1ICFB 1GHKA 4GLXA 2NVQH 1TQOA 3E9IA 4ZUIA 3DWAA 4JI4Q 2Z6KA 3GTMB 3VR2A 5KYLA 2B2WA 1I3QH 1EYAA 3RLOA 2UXDQ 4CJ0B 1WD1A 4PMWA 4NXMQ 2I07B 3HP3A 1BDOA 2JYOA 4QGUA 3S14H 3W1GA 1H9MA 2VS1A 2VUMH 1B50A 2E2HH 4E6IA 4BA2I 4KHPL 4H7BA 3PUWA 5JVG3 2KHIA 2EE1A 2IJ0A 4DAPA 4YHHL 1KAWA 1L0YB 1Q1EA 2B2WC 3MFGA 2N55A 5HURA 1TWCH 5BR8Q 3ERSX 1J9OA 4Y52H 4JBJA 4BY7H 1D7QA 1UAPA 3GTOB 2EIFA 5FLMG 1PH6A 3HKZE 3RN2A 4DR7Q 3CKIB 1C9OA 2XNAC 2HQLA 5IOCA 4XQQA 3R2IA 5BN3A 3OMGA 4X66L 2XSCA 3G6EA 2BE5C 1HZ9A 4JI6Q 3VR4A 5DM73 1Y1WB 3CC7A 4V190 3FKIH 5E4WC 4LFAL 1BCPF 1EUJA 3HOUB 3RLFA 1GUSA 3AMUA 1GM5A 1UE1A 1PXUA 3LWUA 1IBLL 1NMGA 4OX9L 1D8LA 2KHJA 1YNND 1B9NA 2NVXB 1A3UA 3NBIA 4G7HC 2D2CC 1QWYA 2RCFA 3CCEA 2BCOA 2IHEA 1SXTA 3QB3A 4BA1I 1N34L 2ICEC 1SLJA 1WCMB 4KK7A 1PV4A 2IWHA 5FOBB 2R7ZG 4EQ5A 3K5NA 2GVAA 3S9WA 4A76A 3F8TA 2ZT9C 1TWAB 3CMEA 4A3EH 3FDTA 4YY3Q 3BJUA 2K75A 2LXJA 1KRSA 3P20A 2JEBI 3P7JA 4BBRB 1I94L 1RTNA 2HDLA 1PFSA 2EPBA 4OELB 4HSVA 1EY0A 1AZPA 2Q8TA 1ET9A 2Z4IA 1QG7A 1K28A 4QCLA 1VQAA 4NKLA 4DPGA 5IWAL 4OO1H 3VR6A 2NVYB 3J81j 1X3QA 5CV5A 2JP1A 1F2MA 1QZHA 4IN3A 4L5RC 4RGNA 3A55A 2BA0A 1PDQA 3T56B 3GV6A 2ZJRA 3KDFA 2NZ1D 5IYDH 2M00A 2F0HA 1MSHA 4POGA 2KVMA 3NTKA 4JK1C 4LF9L 1A15A 2HQEA 1O7LA 5AFWA 2UUCL 2HCCA 1P8LA 2KJXA 2LY7A 4XQNA 5C3WA 2K32A 1MI2A 3H0GG 1HTPA 4LFCL 2ZM6L 4DV7Q 3BDCA 1JOQA 4KHZA 4GLAC 2TSSA 1G91A 4EGVA 1SAPA 1NJIC 1HNXL 3RUZA 1R9TH 5CV8A 4AH6A 4QUCA 2UU9Q 4BY1G 5M3MB 5K5PA 3ND9A 3BVMA 1EL0A 4ZYSA 3NBHB 1SMYD 2EOTA 4P72A 3U4ZA 2QDLA 1IYVA 1BUVT
chains in the Genus database with same CATH topology
2PNHA 3CCMA 4JYAQ 3FHWA 1VQEA 1YJNA 1Q1BA 4IFDG 5C0XJ 3ULPA 3D0FA 2IHFA 1E22A 3LGJA 1K73C 1CSQA 1LTLA 3HKZG 4DR1L 1QUQB 2ZTDA 3PSIA 1L1OA 1A8VA 1Q82C 1W3SA 1JJGA 5GROA 5JJIA 2OQKA 1AH9A 1E3PA 1XTDA 3M3YH 3I7FA 2AWNA 3JC66 5IY0A 2E2JH 3E0EA 1E24A 4YCVA 1N33L 1KL9A 4JBKA 3L7ZC 4XIGS 4RG1A 1I6HH 1W2BA 2IX0A 1K8AC 3ER0A 3UE1A 4UP7A 1XNRQ 1P16A 1Y1VH 3GTMH 1BKBA 4AQYL 2UUBL 1L1OB 1IZ6A 1HR0W 2B63G 4DV4L 4A75A 4R4QA 4QL5A 1HNWQ 3RN5A 3PUZA 1V1QA 4B3SQ 1J5EL 3CCUA 1VQ6A 4QJFA 2MNAA 3FP9A 2AWOA 4NB3A 3PO3G 4C2MH 2PQAA 1VQ5A 1FJGL 1WYDA 2HIVA 5M3MH 3JAMi 2JEAI 1K0RA 2JQOA 4OWTB 4HIMA 3HOWG 4DV6L 1UWVA 2OCEA 1GVPA 5LMNQ 3T1HL 2JA8G 1L1OC 4WJ4A 2YYZA 5E7NA 1B7YB 1KHIA 1SR3A 2Q2HA 3ULLA 1YHAA 5K36G 4B3RQ 2EQSA 4YWMA 2ZJQA 1S72A 1SFOH 2UXCL 4APVA 3I4MH 1RL2A 3GDEA 3PF4A 1V43A 1AE3A 4DV3L 1BVSA 2VQFL 2JK8A 2PQAB 2UUAQ 1TWFH 1QVCA 5HY6A 3SGIA 2XGTA 2HHHQ 4A3CH 2E5LL 1HZCA 1O7IA 4GOPB 4JI4L 1Y1VG 4QIWE 2JA6H 4DR4Q 2A1AA 1HR0Q 4B3TQ 4DV2L 2NN6I 2UXDL 3TEHB 3NEMA 2K50A 1X56A 3GTOH 4NXML 2NZOA 2D62A 4KLKA 2H5XA 5C3EG 1BBWA 2Q2IA 1VCIA 3CC2A 1DGSA 1NBWA 1NMFA 1L2FA 2RHSB 5M3MG 1IBMQ 4KHPQ 2CCZA 4JI7Q 1C7YA 2GVBA 2K5NA 2ID0A 5LMUL 4OONA 3CP0A 4A3JH 1VQGA 4QY7A 3AFPA 3TQYA 2I0QA 2BH2A 2UXBQ 1A0IA 1YHQA 1Y1WH 4LWCA 3I4MG 4BBSH 5IYCH 2N8NA 2YV5A 4YHHQ 3RR5A 4A3GH 4X6AH 3ZJYC 3T1YL 1SMXA 1VQ9A 3DM3A 4A3CG 3RNUA 3G48A 3BZCA 3H15A 3CQZH 3H3VI 3OTOQ 4PZ6A 2JA6G 2ALYB 2XTIA 1JT8A 4IO9A 5BR8L 3S15H 1B8AA 4UP9A 1EIYB 4JI5Q 2WAQE 3AEVA 1CSPA 1XPOA 3EBEA 4X62L 2JJQA 5JEAJ 2OWOA 3HOZH 3I55A 5FLXc 3L0OA 4DR7L 3W5OA 3J80c 3S1RH 1S3OA 3CCLA 3CD6A 3KF6A 5IT9c 4WJ3M 4AIMA 2K4KA 4DV1L 3OW2A 1WCMH 3BU2A 3KYHC 4LNQA 2VNUD 4X66Q 4A3MH 4LF4Q 2HT1A 5EAYA 1IBKQ 2ATWA 4A3JG 5GAEC 4DUZQ 4C3HH 4OWXB 1LUZA 3PO2H 4GKKQ 1VQNA 2B29A 2R6GA 2KBNA 3PCOB 4TVAB 4LFAQ 1Q7YC 1Y1WG 4JI6L 1SRUA 3A74A 4DAYB 4BBSG 5IYCG 4DV0Q 3CCVA 2CWAA 1VQKA 3HOUG 4X64L 3KF6B 1IYJB 1IBLQ 1FVIA 1WJJA 4FDBA 4JBWA 4BBRH 4GNXB 4OX9Q 4A3DG 3KOJA 3S16H 3PF5A 2RCNA 3F2DA 1QUQA 4JI3Q 1PH4A 5IP7H 4Y7NH 4DUYL 1PH9A 4R4OA 4H02A 3J80i 3DLLA 1HNZQ 4GN4B 4MZ9A 3J7ZC 3HOZG 1N34Q 3F1ZA 1Q8KA 2MQHA 4LUZA 3UE0A 4GN3B 4ALPA 1B70B 1MJEA 1PVOA 4A3IH 4PZ7A 5GADC 1N36Q 4DV5L 4O0AA 3HFZB 3CPWA 1OXTA 1WCMG 2VY3A 1EQQA 1N32L 1UE5A 5FLMH 3W1BA 5LMNW 5ELNA 2F4VL 2I5LX 4JI0Q 1EFWA 4IFDJ 3A5UA 2JA7H 4GKJL 1FL0A 3RLNA 3PO2G 3S2DH 4YY3L 2R7FA 4K0KL 1KXLA 3STBD 1TXYA 4R4CA 1OXXK 1JB7A 4NXNL 1Q46A 4JI8Q 5C0XG 1I94Q 1GD7A 4BBRG 1WI5A 2BA1A 3CAMA 3M4PA 3CXCA 1X3GA 3PUVA 3F2BA 1VQMA 1OXUA 4JV5L 4PZ8A 4OO1I 3GTLH 1YI2A 3S24A 2YTYA 2JA5H 1I50H 3KLWA 1IL2A 1XNQQ 3GTPH 1VQIA 3E9HA 2Z6KC 1X65A 5IWAQ 3G4SA 1M1KC 3S17H 2VQEL 1MKHA 2MO0A 1YZ6A 5GQOA 3S1MH 4LF6L 4B3MQ 4HJAA 5GAHC 5C4XG 3J81c 3L2PA 3I4NH 3TREA 1XMQL 1OXVA 1KRTA 1MJCA 5M5YH 1EYGA 3PV0A 2PI2A 3MXNB 1XMOQ 1FGUA 4NPSA 4HJ7A 4GOPA 2VW9A 3GTGH 1KD1C 4L5QA 1CKMA 1RIPA 1PYSB 1GO3E 2D0PA 3H3VH 1YBYA 3RZOH 2JA7G 4A3FH 4LF9Q 4DK6C 3HOVH 4DKAC 1VQ7A 4BXXH 3EN2A 4A4IA 2UUCQ 3GTKH 4LF5Q 1JMCA 2OTLA 4DR6Q 3M4OH 1K3RA 3AQQA 4X65L 2L15A 2QA4A 2I5MX 4DR2L 1TWGH 2KCTA 5AJ3Q 4JI2Q 4LFCQ 2ZM6Q 2Y0SG 1GKHA 4DV7L 4LF7L 4YWKA 2FXQA 1X9NA 2JA5G 4DR5Q 4DV0L 2KENA 1HNXQ 1WOCA 1T9HA 3U50C 4IPDA 1S40A 3Q8DA 3PUXA 4IJHA 2F52A 4XTCS 4JI1Q 5IYBH 2C35B 4DR3Q 2UU9L 2R92H 4LFBQ 1G291 1KQSA 1VQCA 2WB1G 2Q2UA 2OTJA 2Y0SE 3CCQA 2K5HA 4GOPC 3M7NA 5ELOA 4P71A 3UDFA 1JJ2A 4LW1A 2DUDA 3EIVA 3U4VA 1PH1A 4R4TA 3F2CA 4A3FG 2PMZE 3HOXH 1G51A 4LF8L 2NZHA 3HOVG 1PH5A 1VQBA 3GTJH 2WB1E 4BXXG 2WAQG 4O2DA 4JYAL 4A3KH 2R93H 4DR1Q 4P74A 1Q12A 1E1OA 5M3FH 3G71A 2B3GA 3AYHB 3STBC 1M90C 2YU9H 1ASYA 2HIXA 4OWWB 1CUKA 1E7ZA 1PHJA 1LYLA 1N33Q 3BZKA 4JC0A 5IP9H 1A62A 3KF8B 4HIKA 1OXSC 1X6OA 2R92G 2QGQA 4AQYQ 2UUBQ 4LF8Q 1PH7A 1XNRL 5C44H 4GNXA 3K8AA 4DV4Q 2DGYA 4AYBE 3CW2C 3WWVA 2Z0SA 5GAGC 4UP8A 2ZTEA 3K7UC 1J5EQ 3S2HH 1HNWL 4A3LH 4DNIA 2VL6A 1Q81C 2CKZB 2LXKA 4B3SL 1HZAA 3S1NH 1YVCA 1YHBA 1FJGQ 4OXPA 5JEAG 4YCUA 4DV6Q 3I2ZA 3M85A 3T1HQ 4A3KG 2R93G 1V9PA 4IPGA 5LMNL 5M3FG 4A3GG 3MEFA 2N78A 2QEXA 4MTNA 1Z9FA 4GS3A 4A3DH 2AHOB 2VZAA 3I4OA 4IPHA 2GN5A 4GLXA 2NVQH 4B3RL 1XJVA 2UXCQ 4RMFA 1EQRA 4HIDA 4DV3Q 2A19A 2VQFQ 1IXRA 3E9IA 4GN5A 4J15A 4IPCA 2UUAL 2E5LQ 1CKOA 2HHHL 4JI4Q 1VQJA 4IFDI 2Z6KA 3KDFB 4GNXC 3ULJA 1YJ9A 1I3QH 2BH8A 3RLOA 5C44G 3KJOA 4DV2Q 1HR0L 1NY4A 4DR4L 2UXDQ 4B3TL 1X54A 4PMWA 3GTQH 4NXMQ 4A3MG 3GD7A 5IE8A 4A3LG 4QGUA 3S14H 3W1GA 1VQFA 2VS1A 2VUMH 4R4IA 4P73A 5M5XH 2PI2E 1IBML 1H95A 5C4JH 3CCRA 2E2HH 4BA2I 1JE5A 2B63H 3J7A5 4KHPL 4JI7L 5JJLA 3U58A 3ICEA 3TRZA 4YWLA 3PUWA 1NE3A 2ASBA 2K52A 2OQ0A 4GLVB 3UDXA 4A3BH 2KHIA 3PO3H 2R7DA 1YIJA 4QQBX 2UXBL 2I5HA 4R1JA 1VQ4A 2F3IA 5IP7G 3HOWH 1UEBA 4IJLA 3CMAA 2JA8H 3T1YQ 4YHHL 1BBUA 2MO1A 1VQ8A 4KI0A 1KAWA 3JAMc 2N49A 1Q1EA 1TWHH 2AKWB 3OYYA 1SROA 4A3IG 2WFWA 1TWCH 3OTOL 5J3BA 5BR8Q 1Q86C 2E2IH 3ERSX 1QVFA 4Y52H 3KFUA 4JBJA 1X3EA 4BY7H 1D7QA 1VS0A 4JI5L 2EIFA 1HZBA 3K0XA 4JCVE 4X62Q 5FLMG 1PH6A 3HKZE 3RN2A 3HOYH 3B6YA 4DR7Q 1LM0A 1C9OA 3K7AH 4POFA 1EWIA 2HQLA 3I56A 2VUMG 2NN6G 4P75A 3CPFA 1ASZA 4DV1Q 4IOAA 3GO5A 2R7ZH 4L5SA 1G6PA 4X66L 4LF4L 3G6EA 1IBKL 1VQLA 1L0WA 5C3EH 1PH8A 5C0XI 4DUZL 4A3BG 1KIXA 1X55A 1HZ9A 1K83H 1E1TA 2ES2A 4JI6Q 4GKKL 3CC7A 1I5FA 3FKIH 3IRBA 4LFAL 1MIUA 1EUJA 4JBMA 3RLFA 4X64Q 1X3FA 2WP8J 1UE1A 2CWPA 1VQHA 1YNXA 1EOVA 2YTXA 3J81i 1GM5A 2K14A 1IBLL 1J6QA 1NMGA 4JG2A 1D8LA 4OX9L 3CC4A 3S1QH 2KHJA 3I4NG 3PIPA 4DUYQ 3M9BA 4JI3L 1U5KA 4BY7G 3CCEA 2EXDA 4C3IH 2IHEA 4BA1I 1HH2P 4DK3C 1HNZL 3HOYG 1XPRA 4HJ9A 1N34L 2CFMA 4DV5Q 3PUYA 1SLJA 4JOIA 1N36L 1Z47A 3UDIA 1XPUA 1PV4A 1N32Q 2F4VQ 2R7ZG 4EQ5A 2ZJPA 1YITA 2V1CC 2RHQB 2GVAA 4A76A 3VDYA 3F8TA 4JI0L 3TS2A 4GKJQ 3CMEA 4A3EH 2JA9A 3K81C 4HIOA 1UE7A 4YY3Q 3NELA 2IT1A 4IOCA 2AMCB 4AYBG 3FKIG 4C3JH 4K0KQ 2IX1A 1K8GA 4NXNQ 3BJUA 2K75A 2LXJA 1KRSA 2JEBI 1SN8A 1C0AA 4JI8L 4L5TA 2LSSA 1I94L 1PYBA 4JV5Q 3M4QA 1PFSA 3H0GH 5IYBG 2D0OA 1A63A 3A0JA 2A8VA 3D31A 1YEZA 1VQAA 4A93H 3HOUH 3KJPA 1XNQL 1AE2A 4DPGA 3CCSA 5IWAL 2VQEQ 2CQOA 3J81j 5JJKA 2K5VA 1PH3A 4LF6Q 4JOIC 4BY1H 3PGZA 4PG3A 3HOXG 3RZDH 1VQDA 1QZHA 1XMQQ 4B3ML 2NVXH 5M5WH 4L5RC 2BA0A 2JE6I 2IY5B 1VQPA 5FJ8H 1QZGA 1N8RC 1OTCA 2ZJRA 1XMOL 3KDFA 4UPAA 1WFQA 3CF5A 5IYDH 4POGA 4A3EG 3AFQA 2KCMA 3NENA 4LF9L 1EIFA 4TQUS 1K9MC 5DLQE 3CCJA 2UUCL 4DR6L 3TS0A 1P8LA 4LF5L 4X65Q 3UDGA 2E8GA 4DR2Q 4UY8C 5IP9G 1VQOA 2Q2TA 2NVTH 5AJ3L 3H0GG 3K80C 4LFCL 2ZM6L 1TWAH 4DV7Q 1KC8C 2ZTCA 4JI2L 1NTGA 4LF7Q 1CKNA 4EX5A 1QVGA 4KHZA 4HJ8A 4MNOA 4GLAC 1PH2A 5HGQA 4A93G 4DR5L 1NJIC 1U0LA 1HNXL 1YJWA 1R9TH 2UU9Q 4AH6A 4OO1G 3HKSA 1SE8A 4JI1L 1PA6A 4DR3L 4LFBL 1JJCB 4BY1G 3PIOA 1UE6A 1Y14B 3NBHB 2MFIA 4LUOA 5FJ8G 2YTVA 5H1SE 1CKNB 1HJPA 5LMUQ 4ME3A 5IYDG 2N3SA 4P72A 4YCWA 4DAMA 4LUVA 2RF4A 1N9WA 3U4ZA 3A5ZB 2NVYH 4HJ5A 5C4XH
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2PNH A;  3CCM A;  4JYA Q;  3FHW A;  1VQE A;  1YJN A;  1Q1B A;  4IFD G;  5C0X J;  3ULP A;  3D0F A;  2IHF A;  1E22 A;  3LGJ A;  1K73 C;  1CSQ A;  1LTL A;  3HKZ G;  4DR1 L;  1QUQ B;  2ZTD A;  3PSI A;  1L1O A;  1A8V A;  1Q82 C;  1W3S A;  1JJG A;  5GRO A;  5JJI A;  2OQK A;  1AH9 A;  1E3P A;  1XTD A;  3M3Y H;  3I7F A;  2AWN A;  3JC6 6;  5IY0 A;  2E2J H;  3E0E A;  1E24 A;  4YCV A;  1N33 L;  1KL9 A;  4JBK A;  3L7Z C;  4XIG S;  4RG1 A;  1I6H H;  1W2B A;  2IX0 A;  1K8A C;  3ER0 A;  3UE1 A;  4UP7 A;  1XNR Q;  1P16 A;  1Y1V H;  3GTM H;  1BKB A;  4AQY L;  2UUB L;  1L1O B;  1IZ6 A;  1HR0 W;  2B63 G;  4DV4 L;  4A75 A;  4R4Q A;  4QL5 A;  1HNW Q;  3RN5 A;  3PUZ A;  1V1Q A;  4B3S Q;  1J5E L;  3CCU A;  1VQ6 A;  4QJF A;  2MNA A;  3FP9 A;  2AWO A;  4NB3 A;  3PO3 G;  4C2M H;  2PQA A;  1VQ5 A;  1FJG L;  1WYD A;  2HIV A;  5M3M H;  3JAM i;  2JEA I;  1K0R A;  2JQO A;  4OWT B;  4HIM A;  3HOW G;  4DV6 L;  1UWV A;  2OCE A;  1GVP A;  5LMN Q;  3T1H L;  2JA8 G;  1L1O C;  4WJ4 A;  2YYZ A;  5E7N A;  1B7Y B;  1KHI A;  1SR3 A;  2Q2H A;  3ULL A;  1YHA A;  5K36 G;  4B3R Q;  2EQS A;  4YWM A;  2ZJQ A;  1S72 A;  1SFO H;  2UXC L;  4APV A;  3I4M H;  1RL2 A;  3GDE A;  3PF4 A;  1V43 A;  1AE3 A;  4DV3 L;  1BVS A;  2VQF L;  2JK8 A;  2PQA B;  2UUA Q;  1TWF H;  1QVC A;  5HY6 A;  3SGI A;  2XGT A;  2HHH Q;  4A3C H;  2E5L L;  1HZC A;  1O7I A;  4GOP B;  4JI4 L;  1Y1V G;  4QIW E;  2JA6 H;  4DR4 Q;  2A1A A;  1HR0 Q;  4B3T Q;  4DV2 L;  2NN6 I;  2UXD L;  3TEH B;  3NEM A;  2K50 A;  1X56 A;  3GTO H;  4NXM L;  2NZO A;  2D62 A;  4KLK A;  2H5X A;  5C3E G;  1BBW A;  2Q2I A;  1VCI A;  3CC2 A;  1DGS A;  1NBW A;  1NMF A;  1L2F A;  2RHS B;  5M3M G;  1IBM Q;  4KHP Q;  2CCZ A;  4JI7 Q;  1C7Y A;  2GVB A;  2K5N A;  2ID0 A;  5LMU L;  4OON A;  3CP0 A;  4A3J H;  1VQG A;  4QY7 A;  3AFP A;  3TQY A;  2I0Q A;  2BH2 A;  2UXB Q;  1A0I A;  1YHQ A;  1Y1W H;  4LWC A;  3I4M G;  4BBS H;  5IYC H;  2N8N A;  2YV5 A;  4YHH Q;  3RR5 A;  4A3G H;  4X6A H;  3ZJY C;  3T1Y L;  1SMX A;  1VQ9 A;  3DM3 A;  4A3C G;  3RNU A;  3G48 A;  3BZC A;  3H15 A;  3CQZ H;  3H3V I;  3OTO Q;  4PZ6 A;  2JA6 G;  2ALY B;  2XTI A;  1JT8 A;  4IO9 A;  5BR8 L;  3S15 H;  1B8A A;  4UP9 A;  1EIY B;  4JI5 Q;  2WAQ E;  3AEV A;  1CSP A;  1XPO A;  3EBE A;  4X62 L;  2JJQ A;  5JEA J;  2OWO A;  3HOZ H;  3I55 A;  5FLX c;  3L0O A;  4DR7 L;  3W5O A;  3J80 c;  3S1R H;  1S3O A;  3CCL A;  3CD6 A;  3KF6 A;  5IT9 c;  4WJ3 M;  4AIM A;  2K4K A;  4DV1 L;  3OW2 A;  1WCM H;  3BU2 A;  3KYH C;  4LNQ A;  2VNU D;  4X66 Q;  4A3M H;  4LF4 Q;  2HT1 A;  5EAY A;  1IBK Q;  2ATW A;  4A3J G;  5GAE C;  4DUZ Q;  4C3H H;  4OWX B;  1LUZ A;  3PO2 H;  4GKK Q;  1VQN A;  2B29 A;  2R6G A;  2KBN A;  3PCO B;  4TVA B;  4LFA Q;  1Q7Y C;  1Y1W G;  4JI6 L;  1SRU A;  3A74 A;  4DAY B;  4BBS G;  5IYC G;  4DV0 Q;  3CCV A;  2CWA A;  1VQK A;  3HOU G;  4X64 L;  3KF6 B;  1IYJ B;  1IBL Q;  1FVI A;  1WJJ A;  4FDB A;  4JBW A;  4BBR H;  4GNX B;  4OX9 Q;  4A3D G;  3KOJ A;  3S16 H;  3PF5 A;  2RCN A;  3F2D A;  1QUQ A;  4JI3 Q;  1PH4 A;  5IP7 H;  4Y7N H;  4DUY L;  1PH9 A;  4R4O A;  4H02 A;  3J80 i;  3DLL A;  1HNZ Q;  4GN4 B;  4MZ9 A;  3J7Z C;  3HOZ G;  1N34 Q;  3F1Z A;  1Q8K A;  2MQH A;  4LUZ A;  3UE0 A;  4GN3 B;  4ALP A;  1B70 B;  1MJE A;  1PVO A;  4A3I H;  4PZ7 A;  5GAD C;  1N36 Q;  4DV5 L;  4O0A A;  3HFZ B;  3CPW A;  1OXT A;  1WCM G;  2VY3 A;  1EQQ A;  1N32 L;  1UE5 A;  5FLM H;  3W1B A;  5LMN W;  5ELN A;  2F4V L;  2I5L X;  4JI0 Q;  1EFW A;  4IFD J;  3A5U A;  2JA7 H;  4GKJ L;  1FL0 A;  3RLN A;  3PO2 G;  3S2D H;  4YY3 L;  2R7F A;  4K0K L;  1KXL A;  3STB D;  1TXY A;  4R4C A;  1OXX K;  1JB7 A;  4NXN L;  1Q46 A;  4JI8 Q;  5C0X G;  1I94 Q;  1GD7 A;  4BBR G;  1WI5 A;  2BA1 A;  3CAM A;  3M4P A;  3CXC A;  1X3G A;  3PUV A;  3F2B A;  1VQM A;  1OXU A;  4JV5 L;  4PZ8 A;  4OO1 I;  3GTL H;  1YI2 A;  3S24 A;  2YTY A;  2JA5 H;  1I50 H;  3KLW A;  1IL2 A;  1XNQ Q;  3GTP H;  1VQI A;  3E9H A;  2Z6K C;  1X65 A;  5IWA Q;  3G4S A;  1M1K C;  3S17 H;  2VQE L;  1MKH A;  2MO0 A;  1YZ6 A;  5GQO A;  3S1M H;  4LF6 L;  4B3M Q;  4HJA A;  5GAH C;  5C4X G;  3J81 c;  3L2P A;  3I4N H;  3TRE A;  1XMQ L;  1OXV A;  1KRT A;  1MJC A;  5M5Y H;  1EYG A;  3PV0 A;  2PI2 A;  3MXN B;  1XMO Q;  1FGU A;  4NPS A;  4HJ7 A;  4GOP A;  2VW9 A;  3GTG H;  1KD1 C;  4L5Q A;  1CKM A;  1RIP A;  1PYS B;  1GO3 E;  2D0P A;  3H3V H;  1YBY A;  3RZO H;  2JA7 G;  4A3F H;  4LF9 Q;  4DK6 C;  3HOV H;  4DKA C;  1VQ7 A;  4BXX H;  3EN2 A;  4A4I A;  2UUC Q;  3GTK H;  4LF5 Q;  1JMC A;  2OTL A;  4DR6 Q;  3M4O H;  1K3R A;  3AQQ A;  4X65 L;  2L15 A;  2QA4 A;  2I5M X;  4DR2 L;  1TWG H;  2KCT A;  5AJ3 Q;  4JI2 Q;  4LFC Q;  2ZM6 Q;  2Y0S G;  1GKH A;  4DV7 L;  4LF7 L;  4YWK A;  2FXQ A;  1X9N A;  2JA5 G;  4DR5 Q;  4DV0 L;  2KEN A;  1HNX Q;  1WOC A;  1T9H A;  3U50 C;  4IPD A;  1S40 A;  3Q8D A;  3PUX A;  4IJH A;  2F52 A;  4XTC S;  4JI1 Q;  5IYB H;  2C35 B;  4DR3 Q;  2UU9 L;  2R92 H;  4LFB Q;  1G29 1;  1KQS A;  1VQC A;  2WB1 G;  2Q2U A;  2OTJ A;  2Y0S E;  3CCQ A;  2K5H A;  4GOP C;  3M7N A;  5ELO A;  4P71 A;  3UDF A;  1JJ2 A;  4LW1 A;  2DUD A;  3EIV A;  3U4V A;  1PH1 A;  4R4T A;  3F2C A;  4A3F G;  2PMZ E;  3HOX H;  1G51 A;  4LF8 L;  2NZH A;  3HOV G;  1PH5 A;  1VQB A;  3GTJ H;  2WB1 E;  4BXX G;  2WAQ G;  4O2D A;  4JYA L;  4A3K H;  2R93 H;  4DR1 Q;  4P74 A;  1Q12 A;  1E1O A;  5M3F H;  3G71 A;  2B3G A;  3AYH B;  3STB C;  1M90 C;  2YU9 H;  1ASY A;  2HIX A;  4OWW B;  1CUK A;  1E7Z A;  1PHJ A;  1LYL A;  1N33 Q;  3BZK A;  4JC0 A;  5IP9 H;  1A62 A;  3KF8 B;  4HIK A;  1OXS C;  1X6O A;  2R92 G;  2QGQ A;  4AQY Q;  2UUB Q;  4LF8 Q;  1PH7 A;  1XNR L;  5C44 H;  4GNX A;  3K8A A;  4DV4 Q;  2DGY A;  4AYB E;  3CW2 C;  3WWV A;  2Z0S A;  5GAG C;  4UP8 A;  2ZTE A;  3K7U C;  1J5E Q;  3S2H H;  1HNW L;  4A3L H;  4DNI A;  2VL6 A;  1Q81 C;  2CKZ B;  2LXK A;  4B3S L;  1HZA A;  3S1N H;  1YVC A;  1YHB A;  1FJG Q;  4OXP A;  5JEA G;  4YCU A;  4DV6 Q;  3I2Z A;  3M85 A;  3T1H Q;  4A3K G;  2R93 G;  1V9P A;  4IPG A;  5LMN L;  5M3F G;  4A3G G;  3MEF A;  2N78 A;  2QEX A;  4MTN A;  1Z9F A;  4GS3 A;  4A3D H;  2AHO B;  2VZA A;  3I4O A;  4IPH A;  2GN5 A;  4GLX A;  2NVQ H;  4B3R L;  1XJV A;  2UXC Q;  4RMF A;  1EQR A;  4HID A;  4DV3 Q;  2A19 A;  2VQF Q;  1IXR A;  3E9I A;  4GN5 A;  4J15 A;  4IPC A;  2UUA L;  2E5L Q;  1CKO A;  2HHH L;  4JI4 Q;  1VQJ A;  4IFD I;  2Z6K A;  3KDF B;  4GNX C;  3ULJ A;  1YJ9 A;  1I3Q H;  2BH8 A;  3RLO A;  5C44 G;  3KJO A;  4DV2 Q;  1HR0 L;  1NY4 A;  4DR4 L;  2UXD Q;  4B3T L;  1X54 A;  4PMW A;  3GTQ H;  4NXM Q;  4A3M G;  3GD7 A;  5IE8 A;  4A3L G;  4QGU A;  3S14 H;  3W1G A;  1VQF A;  2VS1 A;  2VUM H;  4R4I A;  4P73 A;  5M5X H;  2PI2 E;  1IBM L;  1H95 A;  5C4J H;  3CCR A;  2E2H H;  4BA2 I;  1JE5 A;  2B63 H;  3J7A 5;  4KHP L;  4JI7 L;  5JJL A;  3U58 A;  3ICE A;  3TRZ A;  4YWL A;  3PUW A;  1NE3 A;  2ASB A;  2K52 A;  2OQ0 A;  4GLV B;  3UDX A;  4A3B H;  2KHI A;  3PO3 H;  2R7D A;  1YIJ A;  4QQB X;  2UXB L;  2I5H A;  4R1J A;  1VQ4 A;  2F3I A;  5IP7 G;  3HOW H;  1UEB A;  4IJL A;  3CMA A;  2JA8 H;  3T1Y Q;  4YHH L;  1BBU A;  2MO1 A;  1VQ8 A;  4KI0 A;  1KAW A;  3JAM c;  2N49 A;  1Q1E A;  1TWH H;  2AKW B;  3OYY A;  1SRO A;  4A3I G;  2WFW A;  1TWC H;  3OTO L;  5J3B A;  5BR8 Q;  1Q86 C;  2E2I H;  3ERS X;  1QVF A;  4Y52 H;  3KFU A;  4JBJ A;  1X3E A;  4BY7 H;  1D7Q A;  1VS0 A;  4JI5 L;  2EIF A;  1HZB A;  3K0X A;  4JCV E;  4X62 Q;  5FLM G;  1PH6 A;  3HKZ E;  3RN2 A;  3HOY H;  3B6Y A;  4DR7 Q;  1LM0 A;  1C9O A;  3K7A H;  4POF A;  1EWI A;  2HQL A;  3I56 A;  2VUM G;  2NN6 G;  4P75 A;  3CPF A;  1ASZ A;  4DV1 Q;  4IOA A;  3GO5 A;  2R7Z H;  4L5S A;  1G6P A;  4X66 L;  4LF4 L;  3G6E A;  1IBK L;  1VQL A;  1L0W A;  5C3E H;  1PH8 A;  5C0X I;  4DUZ L;  4A3B G;  1KIX A;  1X55 A;  1HZ9 A;  1K83 H;  1E1T A;  2ES2 A;  4JI6 Q;  4GKK L;  3CC7 A;  1I5F A;  3FKI H;  3IRB A;  4LFA L;  1MIU A;  1EUJ A;  4JBM A;  3RLF A;  4X64 Q;  1X3F A;  2WP8 J;  1UE1 A;  2CWP A;  1VQH A;  1YNX A;  1EOV A;  2YTX A;  3J81 i;  1GM5 A;  2K14 A;  1IBL L;  1J6Q A;  1NMG A;  4JG2 A;  1D8L A;  4OX9 L;  3CC4 A;  3S1Q H;  2KHJ A;  3I4N G;  3PIP A;  4DUY Q;  3M9B A;  4JI3 L;  1U5K A;  4BY7 G;  3CCE A;  2EXD A;  4C3I H;  2IHE A;  4BA1 I;  1HH2 P;  4DK3 C;  1HNZ L;  3HOY G;  1XPR A;  4HJ9 A;  1N34 L;  2CFM A;  4DV5 Q;  3PUY A;  1SLJ A;  4JOI A;  1N36 L;  1Z47 A;  3UDI A;  1XPU A;  1PV4 A;  1N32 Q;  2F4V Q;  2R7Z G;  4EQ5 A;  2ZJP A;  1YIT A;  2V1C C;  2RHQ B;  2GVA A;  4A76 A;  3VDY A;  3F8T A;  4JI0 L;  3TS2 A;  4GKJ Q;  3CME A;  4A3E H;  2JA9 A;  3K81 C;  4HIO A;  1UE7 A;  4YY3 Q;  3NEL A;  2IT1 A;  4IOC A;  2AMC B;  4AYB G;  3FKI G;  4C3J H;  4K0K Q;  2IX1 A;  1K8G A;  4NXN Q;  3BJU A;  2K75 A;  2LXJ A;  1KRS A;  2JEB I;  1SN8 A;  1C0A A;  4JI8 L;  4L5T A;  2LSS A;  1I94 L;  1PYB A;  4JV5 Q;  3M4Q A;  1PFS A;  3H0G H;  5IYB G;  2D0O A;  1A63 A;  3A0J A;  2A8V A;  3D31 A;  1YEZ A;  1VQA A;  4A93 H;  3HOU H;  3KJP A;  1XNQ L;  1AE2 A;  4DPG A;  3CCS A;  5IWA L;  2VQE Q;  2CQO A;  3J81 j;  5JJK A;  2K5V A;  1PH3 A;  4LF6 Q;  4JOI C;  4BY1 H;  3PGZ A;  4PG3 A;  3HOX G;  3RZD H;  1VQD A;  1QZH A;  1XMQ Q;  4B3M L;  2NVX H;  5M5W H;  4L5R C;  2BA0 A;  2JE6 I;  2IY5 B;  1VQP A;  5FJ8 H;  1QZG A;  1N8R C;  1OTC A;  2ZJR A;  1XMO L;  3KDF A;  4UPA A;  1WFQ A;  3CF5 A;  5IYD H;  4POG A;  4A3E G;  3AFQ A;  2KCM A;  3NEN A;  4LF9 L;  1EIF A;  4TQU S;  1K9M C;  5DLQ E;  3CCJ A;  2UUC L;  4DR6 L;  3TS0 A;  1P8L A;  4LF5 L;  4X65 Q;  3UDG A;  2E8G A;  4DR2 Q;  4UY8 C;  5IP9 G;  1VQO A;  2Q2T A;  2NVT H;  5AJ3 L;  3H0G G;  3K80 C;  4LFC L;  2ZM6 L;  1TWA H;  4DV7 Q;  1KC8 C;  2ZTC A;  4JI2 L;  1NTG A;  4LF7 Q;  1CKN A;  4EX5 A;  1QVG A;  4KHZ A;  4HJ8 A;  4MNO A;  4GLA C;  1PH2 A;  5HGQ A;  4A93 G;  4DR5 L;  1NJI C;  1U0L A;  1HNX L;  1YJW A;  1R9T H;  2UU9 Q;  4AH6 A;  4OO1 G;  3HKS A;  1SE8 A;  4JI1 L;  1PA6 A;  4DR3 L;  4LFB L;  1JJC B;  4BY1 G;  3PIO A;  1UE6 A;  1Y14 B;  3NBH B;  2MFI A;  4LUO A;  5FJ8 G;  2YTV A;  5H1S E;  1CKN B;  1HJP A;  5LMU Q;  4ME3 A;  5IYD G;  2N3S A;  4P72 A;  4YCW A;  4DAM A;  4LUV A;  2RF4 A;  1N9W A;  3U4Z A;  3A5Z B;  2NVY H;  4HJ5 A;  5C4X H; 
#chains in the Genus database with same CATH topology
 2K04 A;  1HCZ A;  1LTL A;  1TWF B;  1H9S A;  1QUQ B;  3GV3 A;  1L1O A;  1W3S A;  3J80 L;  5JJI A;  2EYM A;  1XTD A;  3I7F A;  1AZQ A;  1N33 L;  3BS1 A;  1PTO D;  1L0X B;  4XIG S;  4RG1 A;  4JBK A;  2KQ3 A;  1W2B A;  1H9S B;  3GTM H;  4OL7 A;  1BKB A;  3NWT A;  1L1O B;  2FFK B;  4R4Q A;  4HAE A;  1D6E C;  3QR8 A;  2F0J A;  2Z9H A;  4B3S Q;  1J5E L;  1VQ6 A;  1DOM A;  1BNZ A;  4IQZ A;  3JAM i;  2LFN A;  1EY9 A;  1K0R A;  2JQO A;  1DXM A;  4OWT B;  1S5E D;  1UWV A;  4A3G B;  1GUG A;  1L1O C;  3QIA A;  3VA7 A;  4WJ4 A;  2YYZ A;  1G6Z A;  2EQS A;  3K5L A;  1S72 A;  2MGS A;  2VQF L;  4A3C H;  5LL6 S;  4ZLT F;  4EVO A;  1Y1V G;  2A5H A;  3FVQ A;  4DV2 L;  1SYB A;  3FPU B;  2K50 A;  2PNR C;  1ML0 D;  3GTO H;  4ZCK A;  4KLK A;  3C2P A;  2RA4 A;  2X69 A;  4P2C B;  2D9U A;  2HUG A;  1Y8O B;  1BBW A;  3VYS A;  1SMY C;  2B2T A;  4KHP Q;  5M9O A;  1FD7 D;  2OT2 A;  2Z6B A;  3SK4 A;  3D8G A;  4CBV A;  3CP0 A;  1TS3 A;  3MC0 B;  1RDP D;  1PTO B;  3TP8 A;  1AEX A;  2BH2 A;  1SE2 A;  5IGG A;  1YHQ A;  1Y1W H;  4BBS H;  2A68 D;  3P1H A;  4YHH Q;  3RR5 A;  3H94 A;  3ZJY C;  3G48 A;  3H15 A;  3CQZ H;  1PTO C;  1STN A;  2ALY B;  2JA6 G;  1C48 A;  4IO9 A;  1A3T A;  1VF7 A;  4J8Q A;  1DJR D;  1B9M A;  2WAQ E;  1TT2 A;  1CSP A;  2BOS A;  2OEO A;  2OWO A;  2B2T C;  3S1R H;  1W6K A;  3S2D B;  3CD6 A;  3KF6 A;  5C4J B;  4WJ3 M;  1RKN A;  2C5C A;  4AIM A;  1WCM H;  3J7A V;  4X66 Q;  4QF4 A;  5EAY A;  5HGT A;  4A3J G;  4C3H H;  2FJ2 A;  1LUZ A;  2B29 A;  1Q7Y C;  4LFA Q;  3VYT A;  1SRU A;  5IYC G;  2CWA A;  5C3X A;  3PIO 3;  1VQK A;  1A6X A;  4X64 L;  3KF6 B;  3S17 B;  1IBL Q;  4JBW A;  3A8J E;  4GNX B;  4BBR H;  2PMZ B;  2K6A A;  4OX9 Q;  1LT4 D;  4U67 3;  4RFB A;  1PH4 A;  1S5B D;  4Y7N H;  1V1O A;  1PH9 A;  3U9O A;  1NR4 A;  4KTA A;  3DLL A;  3K57 A;  1B3Q A;  1ET6 A;  4MZ9 A;  3K7A B;  3J7Z C;  3HOZ G;  1N34 Q;  2MJ8 A;  1Q8K A;  4ALP A;  4RGT A;  4I7A A;  1B70 B;  3OMC A;  4A3I H;  5GAD C;  3PQI A;  4DV5 L;  3I90 A;  5A2Q L;  4O0A A;  3C3L A;  2OF1 A;  3CPW A;  1JOK A;  3W1B A;  2IW3 A;  1KLG D;  4XT3 B;  4GKJ L;  1CQV A;  3RLN A;  3PO2 G;  1JOR A;  4IZ8 A;  2CVR A;  4K0K L;  1TXY A;  4NXN L;  2A6H D;  1AP0 A;  1I94 Q;  1STY A;  5D65 A;  5IOD A;  2A68 C;  2R92 B;  2BA1 A;  4UAI A;  3F2B A;  4JV5 L;  1X3G A;  1PFM A;  5KNC A;  4N9P A;  5JVH 3;  4PZ8 A;  4OO1 I;  1YI2 A;  2YTY A;  1IL2 A;  1VQI A;  5IWA Q;  1E2W A;  4KJN A;  2HDM A;  3S1M H;  2F0N A;  1X3P A;  1XXG A;  2DY7 A;  4IUT A;  4HJA A;  4ZAI A;  4A3K B;  4YIJ A;  3HEJ A;  1EYG A;  2R93 B;  1LTB D;  3MXN B;  1FGU A;  1LT6 D;  1KD1 C;  1MSG A;  2G9D A;  2F0E A;  4LF9 Q;  3HOV H;  1EY8 A;  2UUC Q;  2G5D A;  2F0T A;  3M4O H;  3Q23 A;  1K3R A;  2L15 A;  1BBX C;  3H0G B;  4LFC Q;  2ZM6 Q;  4YWK A;  4ILW A;  2JA5 G;  3VR5 A;  2KEN A;  1HNX Q;  3U50 C;  4QUF A;  2LS0 1;  4IJH A;  3S1N B;  4LAA A;  2C35 B;  1KQS A;  4FP5 D;  4XYO A;  5CV4 A;  2B8G A;  1G8Z D;  2DUD A;  1LT3 D;  2NTS A;  2IL8 A;  3HOV B;  1F9P A;  3DHQ A;  4A3F G;  2NVQ B;  3KK7 A;  1VQB A;  3GTJ H;  4PMB A;  2L55 A;  2AQ1 B;  2B3G A;  1V8Q A;  1CHP D;  1KAA A;  4OIJ A;  1I3Q B;  3X3M A;  1VF5 C;  2LKV A;  4DU9 A;  1LYL A;  1N33 Q;  4JC0 A;  5IP9 H;  4ZKC B;  4HIK A;  1DM0 B;  3S14 B;  1X6O A;  3G7L A;  2VUM B;  2PZW A;  3LWE A;  2E2H B;  2DGY A;  4AYB E;  3WWV A;  4LMQ D;  3OW7 A;  1SSO A;  5GAG C;  2ZTE A;  3K7U C;  1J5E Q;  1HZA A;  2K03 A;  5JEA G;  3M85 A;  5M3F G;  3RMH A;  2N78 A;  1U4P A;  3I4O A;  1TWC B;  3HS0 C;  2GN5 A;  4HID A;  3R93 A;  3KLS X;  2VQF Q;  2F0I A;  2E2J B;  4J15 A;  4IPC A;  3JAM E;  2UUA L;  1HUN A;  1KAB A;  2Z1C A;  4K5V A;  5E4X A;  2O4X A;  4DV2 Q;  3KJO A;  5IGE A;  1D5M C;  5IE8 A;  4A3L G;  1KLU D;  4C3H G;  2PQE A;  3C1F A;  4R4I A;  1I4G A;  5M5X H;  2PI2 E;  1IBM L;  1H95 A;  5C4J H;  1JE5 A;  1I4X A;  4R8N A;  3TRZ A;  4GLV B;  4ME5 A;  1II3 A;  2EVB A;  3I4L A;  4R1J A;  3HOW H;  2F3I A;  2J7Z A;  4DK1 A;  1PRT D;  3QJY A;  4KI0 A;  2N49 A;  3FMC A;  2PZT A;  3OYY A;  1Y8N B;  1SRO A;  2JN4 A;  4A3I G;  2WFW A;  2JA6 B;  5J3B A;  1QVF A;  3KFU A;  2F4I A;  3DXJ C;  1CZG A;  1T5X D;  3K7A H;  2DY8 A;  1ONL A;  1GOZ A;  3GO5 A;  4EQO A;  2R7Z H;  1G6P A;  4A3J B;  1PH8 A;  3TP7 A;  4DUZ L;  2ES2 A;  2ZXR A;  4GKK L;  1CZW A;  4X64 Q;  5JPN C;  1X3F A;  3J81 i;  1YNX A;  1EOV A;  2YTX A;  5JJL A;  1J6Q A;  3CC4 A;  1K8O A;  2A6E C;  4C56 C;  4JI3 L;  4V0B A;  5EKI A;  1HH2 P;  4DK3 C;  3HOZ B;  3HOY G;  3KBX A;  4DV5 Q;  3FPP A;  4RA8 A;  5ELD A;  4IUP A;  1EIH A;  1Z47 A;  3UDI A;  1XPU A;  3UI2 A;  3K5O A;  1PRT B;  2RHQ B;  3TS2 A;  4GKJ Q;  2EYH A;  2F0F A;  2B2Y C;  3NEL A;  4K0K Q;  4NXN Q;  3MXG A;  4J6H A;  2WII B;  3SR1 A;  1R9T B;  4L5T A;  4JV5 Q;  3H0G H;  1PRT C;  3NWS A;  2E76 C;  1B4O A;  4DNT B;  1W6J A;  1YEZ A;  4CJ2 C;  1XNQ L;  3CCS A;  5JJK A;  4BY1 H;  3PGZ A;  4PG3 A;  4B3M L;  2EYP A;  1JB3 A;  3Q6S A;  1A3V A;  2IY5 B;  1O80 A;  1B44 D;  3KLR A;  5EGT A;  1TS2 A;  1EIF A;  3IAY A;  5DLQ E;  4DR6 L;  3TS0 A;  4U68 A;  2DJG C;  1B1Z A;  1CFM A;  1EEI D;  5IP9 G;  1VQO A;  1IYU A;  5AJ3 L;  3TSS A;  1KC8 C;  2ZTC A;  1TS4 A;  4EX5 A;  2EXZ A;  3BVZ A;  4F7X A;  3GTP B;  4HJ8 A;  2JA5 B;  2L0C A;  1UUP A;  5HGQ A;  4A93 G;  2EYF A;  1U0L A;  1YJW A;  1R4P B;  2L11 A;  2EYL A;  3MEH A;  3F2U A;  2WKC A;  2EJG C;  3PIO A;  1F2Z A;  2MFI A;  4LUO A;  5FJ8 G;  5H1S E;  1HJP A;  5LMU Q;  3RZO B;  1WTO A;  1TS5 A;  4YCW A;  3MZ5 A;  3D3R A;  1KNE A;  3A5Z B;  3BZD B;  1EIG A;  5C4X H;  2E74 C;  1VQE A;  3ULP A;  2IHF A;  1E22 A;  3A7A B;  5EJW A;  3HKZ G;  2V4D A;  3I70 A;  1HRJ A;  4HMJ A;  5IT9 L;  3AB9 A;  1SYF A;  1E2V A;  2A73 B;  2AWN A;  3JC6 6;  1VMP A;  2E2J H;  1E24 A;  4YCV A;  1EEF D;  1Y1V H;  4K5W A;  1BOS A;  4LJZ C;  5KYI A;  3OPO A;  1SNO A;  2IPK D;  4QL5 A;  4TSS A;  1PZI D;  3NP8 A;  4HCE A;  2MNA A;  2AWO A;  4NB3 A;  4JPB W;  5FK9 C;  2BDN A;  4IUN A;  4BBS B;  3HOW G;  2OCE A;  5M3F B;  1GVP A;  4PNY A;  2RBM A;  1B7Y B;  2AUK A;  2Q2H A;  5E7N A;  2RDH A;  1YHA A;  3CQZ B;  3ULL A;  4MTK A;  1Y69 U;  4YWM A;  2ZJQ A;  1ESR A;  4TRD A;  4APV A;  3PF4 A;  1BVS A;  2UUA Q;  4O1N A;  1QVC A;  5HY6 A;  4DFA A;  2XGT A;  3SVM A;  5KEE A;  3S1R B;  2E5L L;  1O7I A;  2Q8I B;  2JA6 H;  4CJ1 B;  3GP7 A;  2A74 C;  2D62 A;  4C3H B;  5FLX E;  1HUM A;  3CC2 A;  1DGS A;  1NBW A;  1STG A;  2F3W A;  2RHS B;  1IBM Q;  4JW0 A;  2CCZ A;  1C7Y A;  1WTW A;  1ILQ A;  1HQM C;  3OHX C;  1WTV A;  4A3J H;  4NW2 A;  1VQG A;  1ICW A;  2EY1 A;  3AFP A;  3TQY A;  2K5Q A;  3I4M G;  4Y7N B;  2P5Z X;  1NUC A;  5IYC H;  4NMZ A;  2AQ2 B;  1SMX A;  3DM3 A;  2D5D A;  4A3I B;  5BN5 A;  3NQI A;  4UP9 A;  2CH4 W;  1XPO A;  3EBE A;  2JJQ A;  3HOZ H;  3ERQ A;  2KCN A;  3W5O A;  3J80 c;  1S3O A;  4RHR A;  3CCL A;  5BN4 A;  2XRS D;  3RD4 A;  3QOL A;  4S3S A;  3KYH C;  4RWS C;  2G9H D;  2F0S A;  1ILP A;  3DWP A;  4DUZ Q;  2DN8 A;  1NSN S;  3NBH A;  2PO4 A;  3PO2 H;  4GKK Q;  4RHS A;  2PW7 A;  4TVA B;  3A74 A;  4DAY B;  3TBI B;  1YNN C;  3AU7 A;  3L9A X;  1K8M A;  1IYJ B;  2GA4 B;  3SXH A;  1LO5 D;  3S1M B;  3PF5 A;  3F2D A;  1QUQ A;  4JI3 Q;  4DUY L;  3J80 i;  5DM6 3;  3PMF A;  3NSW A;  3F1Z A;  4L8J A;  2MQH A;  4GN3 B;  3J81 E;  4B08 A;  3EFX D;  1GXD C;  3QOJ A;  1PFN A;  3M4O B;  1OXT A;  1EQQ A;  1UE5 A;  3VYR A;  5ELN A;  1GUN A;  2I5L X;  1XWE A;  1K83 B;  1A2T A;  5I2X A;  4Z9C B;  1G2T A;  3STB D;  1UNS A;  1JB7 A;  1Q46 A;  5C0X G;  5FKA C;  3OWE B;  3M4P A;  2QDB A;  4KV6 A;  1TR5 A;  4KN7 C;  3S24 A;  3M7G A;  2JA5 H;  3GTP H;  3IFT A;  4B9X A;  1XNQ Q;  1IKM A;  3E9H A;  4ULL A;  3T16 A;  3D4R A;  2MO0 A;  4B3M Q;  3Q22 A;  4HTH A;  1RF2 D;  5GAH C;  3GTJ B;  3L2P A;  3I4N H;  5C4X G;  1QE6 A;  3PV0 A;  4KY7 A;  3GTG H;  4HJ7 A;  2VW9 A;  2D0P A;  1EWC A;  3H3V H;  3RZO H;  1YBY A;  4F87 A;  4A3F H;  4DK6 C;  3CRK C;  4DXF A;  1F2L A;  4DKA C;  1VQ7 A;  4DR6 Q;  4N8F A;  5CBE E;  3TME A;  2QA4 A;  1O7Y A;  4DR2 L;  2KCT A;  5AJ3 Q;  1LAB A;  2A69 D;  4CHT B;  2Y0S G;  2KEC A;  4DV0 L;  4IPD A;  1S40 A;  3Q8D A;  3RZD B;  2WB1 G;  2Y0S E;  4FXK C;  4C1N K;  3A54 A;  4P71 A;  3SK5 A;  3X3N A;  2SNS A;  1JJ2 A;  3FEW X;  5CGK A;  1LLR D;  4R4T A;  3F2C A;  4OHJ A;  1G51 A;  4LF8 L;  3HG9 A;  1FYC A;  5JEA H;  1I4H A;  3A56 A;  4BXX G;  2WB1 E;  2WAQ G;  4O2D A;  1JIC A;  3HKZ B;  4O42 A;  5M3F H;  3N6R A;  1HPC A;  2PPB C;  1H9K A;  3STB C;  4FO2 A;  1ASY A;  1CUK A;  1D1I A;  4R8I A;  1ROD A;  1PHJ A;  4TKO B;  1DOL A;  1A62 A;  1OXS C;  4ZKB B;  3R8B A;  4M8A A;  2B8F A;  5M5X B;  1CTM A;  1XNR L;  1PH7 A;  4GNX A;  3K8A A;  1PTO F;  4WFN 3;  4G4K A;  4A3L H;  2K05 A;  4RKB A;  1YHB A;  3ITP A;  4OXP A;  3HOW B;  4G7Z C;  3I2Z A;  1ENC A;  1SNM A;  5KIX A;  4IPG A;  5LMN L;  1GJX A;  4MTN A;  2XRQ D;  4A3D H;  4WOR A;  1FNU A;  2VZA A;  3J7Y W;  3K58 A;  1HA5 A;  2Q8R E;  4B3R L;  1HHV A;  4IFD H;  2OXP A;  2A69 C;  4RMF A;  3SDZ A;  4FNF A;  1MGS A;  1CI3 M;  2E5L Q;  1CKO A;  2HHH L;  1DCZ A;  4GNX C;  1SYC A;  2BH8 A;  2HCI A;  5C44 G;  5CV7 A;  1HR0 L;  4B3T L;  2R7Z B;  1X54 A;  2F03 A;  3GTQ H;  1BF4 A;  3GD7 A;  1PZK D;  4XXE A;  4P73 A;  4DNR B;  1QCB D;  2B63 H;  1V1P B;  4G57 A;  3U58 A;  3ICE A;  2CH4 A;  4YWL A;  4CKB A;  1NE3 A;  2K52 A;  3UDX A;  1VMC A;  2NUC A;  3MXN A;  4CKC A;  1SFO B;  2R7D A;  1YIJ A;  3I4M B;  2I5H A;  3R3O A;  1VQ4 A;  1RD9 D;  1UEB A;  4IJL A;  5KRU A;  2JA8 H;  1BBU A;  3TP5 A;  1D1K A;  1CHQ D;  2AKW B;  1JWM D;  1NAP A;  4OGQ C;  3DEO A;  2FIN B;  1Q86 C;  4QMG A;  3Q0A A;  1ESF A;  1X3E A;  5CV9 A;  2ICI A;  1IKL A;  4JI5 L;  1U9R A;  1HZB A;  1O7Z A;  4K14 A;  5IGC A;  5IGD A;  3HOY H;  2E75 C;  3I56 A;  2NN6 G;  4P75 A;  4IOA A;  2MUY A;  3MFY A;  1BR9 A;  4LF4 L;  1L0W A;  5C3E H;  4A3B G;  1KIX A;  1K83 H;  3IRB A;  4KY5 A;  2SOB A;  1SYG A;  3T53 B;  4JBM A;  2F1M A;  2WP8 J;  5NUC A;  2CWP A;  4ZQ3 A;  2K14 A;  2NYZ D;  1KDA A;  1F77 A;  4BY1 B;  3T13 A;  5ELE A;  3I4N G;  3S15 B;  2SEB D;  4Q0F A;  4DUY Q;  3M9B A;  4CDC C;  1U5K A;  4C3I H;  1HNZ L;  2XIW A;  1DD2 A;  3VA5 A;  4FF3 A;  4JOI A;  1N36 L;  4N8X 1;  2EY2 A;  5EKL A;  3VDY A;  3CRL C;  2A6H C;  3MVV A;  4KD4 A;  2JA9 A;  1RTO A;  1JR0 D;  2AMC B;  4AYB G;  1EY4 A;  4H13 C;  4K2K A;  5T1G A;  1C0A A;  3S16 B;  3M4Q A;  3IKJ A;  1A63 A;  5ELC A;  3A0J A;  2EJF C;  1EU4 A;  3D31 A;  4J1M A;  4A93 H;  1U4L A;  3KJP A;  3A7L A;  3NTI A;  2K5W A;  3V2T A;  5C4Z A;  5FO9 B;  2CQO A;  4JOI C;  5C4X B;  3RZD H;  4KN4 C;  4ZK9 B;  5M5W H;  2JE6 I;  1VQP A;  5FJ8 H;  1N8R C;  1XMO L;  5CMD A;  1FNW A;  1WFQ A;  3NUC A;  1YNJ D;  4LK1 C;  3AFQ A;  4TQU S;  1K9M C;  4C3J G;  1ENF A;  2PCF B;  4LF5 L;  2J4X A;  4PMC A;  4DR2 Q;  4UY8 C;  4I7Z C;  2NVT H;  3K80 C;  1I6V C;  1Y1V B;  4K6D A;  1NTG A;  1EZ6 A;  2SNM A;  2I46 A;  2K33 A;  2L9H A;  1SE3 A;  4MNO A;  4FXD A;  5CYU A;  1G2S A;  4JI1 L;  1PA6 A;  1TKW B;  5D3I B;  1EQV A;  5M5Y B;  1Y14 B;  2L5T A;  3LX0 A;  4A3D G;  1WTP A;  4R9W A;  4RGO S;  4LF8 Q;  1DYQ A;  5D14 A;  5G3L D;  3CCM A;  3LNN A;  2WAQ B;  3FHW A;  5I9O A;  4IFD G;  1BXT A;  1LTR D;  1K73 C;  1CSQ A;  2WV6 D;  4DR1 L;  2NTT A;  3PSI A;  4K8I A;  1A8V A;  3ONA B;  2WIN B;  1EWH A;  1HFG A;  3TDQ A;  5FLX L;  2F0Q A;  5TSS A;  1JQY D;  1JJG A;  1D2B A;  5GRO A;  1Z6H A;  2OQK A;  1E3P A;  5JOB A;  1QNK A;  3E0E A;  3FRP B;  1I6H H;  3L7Z C;  5A35 A;  1E2Z A;  3TZU A;  4XQJ A;  3UE1 A;  5LL6 X;  1XNR Q;  2PZU A;  1JCK B;  4CDF C;  5EPK A;  1HR0 W;  2B63 G;  4DV4 L;  4A75 A;  5J39 A;  1LTG D;  4FYD A;  3RN5 A;  1V1Q A;  4KJO A;  2F0M A;  3CCU A;  4QJF A;  3A8I E;  2F0V A;  3FP9 A;  2MHV A;  1CT1 D;  1JC7 A;  1VDZ A;  4FXG C;  1WTH A;  4C2M H;  1FJG L;  2JEA I;  2HIV A;  1YNJ C;  3T4A C;  3TN2 A;  4DV6 L;  2B2Y A;  4MHE A;  5LMN Q;  3L3O C;  3T1H L;  2JA8 G;  1KHI A;  2KCC A;  2QIL A;  2CHB D;  5K36 G;  1PLF A;  1XYI A;  2BDO A;  4B3R Q;  1SFO H;  2UXC L;  1CA6 A;  3I4M H;  2B2U A;  1AE3 A;  1U4R A;  4DV3 L;  2JK8 A;  1QOH A;  1F9S A;  1XX8 A;  1SBB B;  3SGI A;  2HHH Q;  2DNE A;  3WDN A;  3OIP A;  1HZC A;  4GOP B;  5A2Q E;  5C44 B;  4ZUJ A;  1HR0 Q;  1C8C A;  4B3T Q;  3E3X A;  3TEH B;  2NWG A;  3S2H B;  1X56 A;  2VB2 X;  3K5M A;  2NZO A;  2H5X A;  5C3E G;  3PO2 B;  2Q2I A;  1QJO A;  3OIQ A;  1ZEQ X;  5M3M G;  2EJM A;  5J1Z A;  2GVB A;  2ID0 A;  3ERO A;  2R3Z A;  4DGZ A;  5T1I A;  4G7O C;  1S5C D;  4OON A;  4QY7 A;  3NHH A;  1HTL D;  2I0Q A;  2B2U C;  1A0I A;  4DA2 A;  4C3I G;  3T1Y L;  5G3L F;  1STH A;  1AW7 A;  3BZC A;  1PRT F;  4PZ6 A;  4HSP A;  1JT8 A;  2XTI A;  3S15 H;  1EIY B;  4JI5 Q;  3AEV A;  2ZXP A;  4H44 C;  4X62 L;  4QIW B;  5JEA J;  1RCV D;  3L0O A;  3EA6 A;  5IT9 c;  2NB0 A;  2K4K A;  4DV1 L;  3OW2 A;  1MD2 D;  1CM9 A;  4A3M H;  3QG1 A;  5I2Y A;  4LF4 Q;  4IUV A;  2ATW A;  4NP5 A;  1BCP D;  4K6L A;  4WRD A;  4OWX B;  4F88 A;  2Z4H A;  3NTH A;  2K1B A;  3KLS A;  1VQN A;  2KBN A;  5L37 A;  4I65 A;  3CCV A;  1RJT A;  4FDB A;  5C0X H;  1S5F D;  1K3B C;  1TWH B;  5C6A A;  1Z7T A;  3S16 H;  4CDD C;  2RCN A;  3I4N B;  2E2I B;  1B2T A;  2F0G A;  5IP7 H;  3GTG B;  1EYC A;  4R4O A;  2SDF A;  4H02 A;  3MA2 B;  2RKS A;  4X3U A;  1HNZ Q;  5FO8 B;  4A3F B;  3E0J A;  3UE0 A;  3CHB D;  1N36 Q;  1UEA B;  2DNC A;  1N32 L;  1XTC D;  2F4V L;  1EFW A;  4IFD J;  3A5U A;  3H3V C;  1FL0 A;  2EY5 A;  2F0O A;  4AYB B;  3VR3 A;  2B2V C;  1KXL A;  1B3A A;  1SJE D;  1PFB A;  4R4C A;  5IGB A;  1STA A;  4RKL A;  1GD7 A;  2QEJ C;  1WI5 A;  5CV6 A;  1FNV A;  3S1Q B;  1OXU A;  3D6C A;  2JXM B;  4KKT A;  1EOT A;  4ID6 A;  3J7A F;  1I50 H;  4JVZ A;  4X3S A;  1X32 A;  4UHV A;  2Z6K C;  1X65 A;  1LTA D;  4X3T A;  1KTK A;  3G4S A;  1NCV A;  2H4O A;  3D4W A;  1BCP B;  2VQE L;  2Z8L A;  4LF6 L;  4FF2 A;  1ZKO A;  2CQA A;  4DXG A;  1XMQ L;  1KRT A;  5M5Y H;  1XMO Q;  2PI2 A;  5F2D A;  4NPS A;  1HA6 A;  2K5D A;  3BYY B;  4L5Q A;  4DF7 A;  1CKM A;  1RIP A;  1PYS B;  1GO3 E;  2MP1 A;  2JA7 G;  4L63 B;  3MXP A;  4HR7 B;  4C3J B;  1BCP C;  4BXX H;  3EN2 A;  4A4I A;  4LF5 Q;  1S5D D;  1JMC A;  3AQQ A;  1J8I A;  4X65 L;  2L1B A;  2I5M X;  1TWG H;  3SK8 A;  3VYU A;  1GKH A;  2F0P A;  1PZJ D;  3MAQ A;  4LF7 L;  1AFP A;  1AN8 A;  1X9N A;  1NR2 A;  1WOC A;  1T9H A;  3HZX A;  3PUX A;  3NXW A;  2F52 A;  4XTC S;  4JI1 Q;  5IYB H;  2K01 A;  1G29 1;  3CCQ A;  1HFN A;  2K5H A;  3HRZ C;  3M7N A;  5ELO A;  4LW1 A;  4A3D B;  3TP6 A;  4K8J A;  3MWY W;  2PMZ E;  2VB3 X;  4XYQ A;  3HOX H;  2NZH A;  4JYA L;  1CQF A;  3QO2 A;  3Q24 A;  2ZXO A;  4IUQ A;  1EZ8 A;  4DR1 Q;  1E1O A;  3G71 A;  1EFI D;  1GUT A;  3AYH B;  2JSO A;  1M90 C;  4RCN A;  5IGF A;  3URY A;  2O5J C;  1GUO A;  3GTQ B;  2O2L D;  2X6G A;  2RDF A;  3BZK A;  5IIF A;  4DAY A;  2R92 G;  2QGQ A;  3HGB A;  1LV9 A;  5C44 H;  2B63 B;  4DV4 Q;  1NNX A;  3GQB A;  3CW2 C;  2NBF A;  1JWU D;  3S2H H;  1HNW L;  1LTI D;  4DNI A;  2CKZ B;  1YVC A;  2FMM A;  3DUZ A;  1FJG Q;  4DV6 Q;  4A3K G;  3T1H Q;  1KDB A;  2B39 A;  2JA8 B;  2R93 G;  2KHS A;  2QEX A;  1Z9F A;  2AHO B;  4IPH A;  2UXC Q;  5KND A;  1XJV A;  1EQR A;  4DV3 Q;  2A19 A;  3M3Y B;  1SND A;  1IXR A;  4GN5 A;  3HOY B;  4PV1 C;  4DAV A;  5EBC A;  3OWF A;  1VQJ A;  3KDF B;  3O13 A;  2KUM A;  3ULJ A;  1YJ9 A;  3I72 A;  4NDX A;  4DR4 L;  1NY4 A;  1SYE A;  4A3M G;  3I91 A;  5C3E B;  1PMR A;  2KED A;  2X6L A;  2FHT A;  1VQF A;  3P75 A;  1MHW C;  2FMC A;  2NN6 H;  2L4N A;  3CCR A;  5ELB A;  2IX3 A;  4JI7 L;  2ASB A;  2OQ0 A;  2EY6 A;  4A3B H;  2L12 A;  3PO3 H;  4QQB X;  2UXB L;  5IP7 G;  5E3F A;  3CMA A;  4C3I B;  3T1Y Q;  2MO1 A;  1VQ8 A;  3JAM c;  5C5L A;  1TWH H;  1GHJ A;  2EYJ A;  3OTO L;  2XN9 C;  2E2I H;  3D4D A;  2E2D C;  2K7V A;  1VS0 A;  3K0X A;  4JCV E;  1SDF A;  4X62 Q;  4L6T B;  4CDE C;  1C4Q A;  3B6Y A;  2HD3 A;  1LM0 A;  4POF A;  1EWI A;  2VUM G;  1CA5 A;  3CPF A;  1ASZ A;  3QWN A;  5ISR A;  4DV1 Q;  2LMC B;  4HMI A;  1TY2 A;  4L5S A;  1LTS D;  3I8Z A;  1IBK L;  1VQL A;  1R4Q B;  1MBY A;  5C0X I;  3MXU A;  1DON A;  1X55 A;  3BVG A;  1E1T A;  1I5F A;  1KNA A;  1MIU A;  3BDL A;  4A93 B;  1QB5 D;  4RH6 A;  1IW7 D;  1VQH A;  2AUJ D;  4JG2 A;  3S1Q H;  5M5W B;  3PIP A;  3E5S A;  5C5M A;  1DZ1 A;  4K5X A;  4BY7 G;  2EXD A;  2RVL A;  3JAM L;  1XPR A;  4HJ9 A;  1OO9 B;  1EU3 A;  2CFM A;  3PUY A;  1ZXT A;  1N32 Q;  4CKE A;  1LAC A;  4CGY B;  2F4V Q;  2ZJP A;  1YIT A;  2NVT B;  2V1C C;  4JI0 L;  2KEE A;  3ND8 A;  3K81 C;  5IT9 E;  4HIO A;  1UE7 A;  4IOC A;  2IT1 A;  3FKI G;  4C3J H;  1SEB D;  2IX1 A;  3V96 A;  3DWQ A;  1K8G A;  4FVM A;  1SN8 A;  3A8K E;  4JI8 L;  2LSS A;  1Q90 A;  1PYB A;  4B9W A;  1SE4 A;  5IYB G;  2F0D A;  2D0O A;  1STE A;  5CR3 A;  4RCO A;  3NE5 B;  1M8A A;  2A8V A;  3H91 A;  1WTQ A;  4KHV A;  1PYW D;  3N52 A;  5C4H A;  3IL8 A;  2KOL A;  5FO7 B;  3HOU H;  4GZY C;  1AE2 A;  3H09 A;  4WJW A;  2XWB B;  2VQE Q;  2K5V A;  2F0K A;  3OOC A;  1PH3 A;  4LF6 Q;  3HOX G;  2XWJ B;  1VQD A;  1XMQ Q;  2NVX H;  1JWS D;  4HN7 A;  1QZG A;  1OTC A;  1BQQ T;  2CW0 D;  1HXY D;  4UPA A;  5E1F A;  3CF5 A;  1H9R A;  2PW5 A;  1F9Q A;  2JA7 B;  4A3E G;  2KCM A;  3NEN A;  3CCJ A;  4ZRZ A;  5LHY 1;  4X65 Q;  3UDG A;  2E8G A;  1IL8 A;  1I6H B;  2Q2T A;  2XVS A;  4JI2 L;  1IW7 C;  1CK1 A;  1TWA H;  1V1P A;  4LF7 Q;  3GTL B;  4RGM A;  1CKN A;  3C1E A;  1QVG A;  3BG3 A;  1PH2 A;  3SK6 A;  4DR5 L;  3H6M A;  1E0B A;  4OO1 G;  3OSO A;  3HKS A;  1SE8 A;  4BS9 A;  4H0L C;  2EYO A;  4C2M B;  4DR3 L;  1JJC B;  4LFB L;  1GUW A;  4OIK A;  1I4R A;  1I4P A;  1UE6 A;  4Q5V A;  2RDG A;  2YTV A;  4C1N I;  1CKN B;  4ME3 A;  2EDG A;  5IYD G;  2N3S A;  4DAM A;  4HJ5 A;  1T5E A;  3HFZ B;  2RF4 A;  1N9W A;  1LT5 D;  2NVY H;  1H9J A;  4LUV A;  4ABN A;  2PNH A;  3I3C A;  3GTK B;  4JYA Q;  1YJN A;  1TY0 A;  1Q1B A;  5C0X J;  3D0F A;  3LGJ A;  1TU2 B;  2ZTD A;  1SNQ A;  3DEP A;  1WTR A;  1Q82 C;  5K36 H;  5J22 A;  1JE4 A;  1AH9 A;  1SJH D;  3SE0 A;  4XDX A;  3M3Y H;  3W3A A;  5IY0 A;  1KL9 A;  1TII D;  1K8A C;  2IX0 A;  3ER0 A;  4UP7 A;  1P16 A;  4N9T A;  4AQY L;  2UUB L;  1IZ6 A;  3MHB A;  5EPJ A;  1WD0 A;  1S4Z A;  4QB4 A;  1HNW Q;  3NK9 A;  3PUZ A;  2QW7 A;  3K59 A;  2CW0 C;  3PO3 G;  1VQ5 A;  2PQA A;  1SYD A;  2F3V A;  1WYD A;  5M3M H;  3I73 A;  4M1U B;  4HIM A;  5I6W A;  3U9S A;  4FF4 A;  1EQT A;  2YU9 B;  1FR3 A;  5I6Y A;  2F0W A;  1SR3 A;  2EZV A;  3W2D A;  1RL2 A;  3GDE A;  1V43 A;  2N88 A;  2PQA B;  1TWF H;  3K0Y A;  3T51 B;  4JI4 L;  3KUP A;  4QIW E;  4DR4 Q;  2A1A A;  1ZYR D;  2NN6 I;  2UXD L;  5JPM C;  3NEM A;  4A3M B;  4MN3 A;  4NXM L;  3J80 E;  1K0S A;  1HQR D;  4MIU A;  1VCI A;  1NMF A;  1L2F A;  4JI7 Q;  3DM1 A;  2K5N A;  2DJF C;  3CU7 A;  5LMU L;  2QCP X;  4RAU C;  5CC4 A;  3ZYY X;  4DN4 M;  1WTX A;  2UXB Q;  4LWC A;  5DEH A;  2AQ3 B;  2N8N A;  2YV5 A;  4A3G H;  4X6A H;  3BDO A;  1VQ9 A;  3C46 A;  4A3C G;  3RNU A;  4IAL A;  5COY A;  3H3V I;  3OTO Q;  1KDC A;  5BR8 L;  4IUU A;  1B8A A;  4F8M A;  1IHZ A;  3I55 A;  5FLX c;  4DR7 L;  3EVQ A;  3KBG A;  3WOF A;  3BU2 A;  1O78 A;  4LNQ A;  2VNU D;  5CBA E;  2HT1 A;  1EY6 A;  1IBK Q;  5GAE C;  2Y0S B;  3J7A 5;  2R6G A;  3PCO B;  4JI6 L;  2QKI C;  1Y1W G;  1I50 B;  4BBS G;  4DV0 Q;  5JAV A;  2KA7 A;  1I4Q A;  3HOU G;  1Q3L A;  1FVI A;  1WJJ A;  3DMU A;  5DAU A;  1EYD A;  3KOJ A;  4KKS A;  2R61 A;  1B53 A;  2RQX A;  1M4V A;  1PTO H;  2F0L A;  2WB1 B;  3D6W A;  1RHP A;  2M9V A;  4BY7 B;  1BO0 A;  1ZYR C;  3M4Y A;  4GN4 B;  5COR A;  2A6E D;  3NPP A;  4LUZ A;  1PVO A;  1MJE A;  1DOK A;  4PZ7 A;  1STB A;  1Q8I A;  1WCM G;  2TMP A;  2VY3 A;  5FLM H;  5LMN W;  1TWG B;  4JI0 Q;  2JA7 H;  2RSN A;  3FKI B;  3S2D H;  1F9R A;  4YY3 L;  2R7F A;  4UDU C;  2O5I C;  1F2Y A;  1OXX K;  1TVX A;  1EY7 A;  4JI8 Q;  4IUR A;  4BBR G;  1VQM A;  3CAM A;  3CXC A;  3PUV A;  2M2L A;  3TZD A;  4KMU C;  3GTL H;  4X3K A;  1SNC A;  3KLW A;  1M1K C;  3S17 H;  1MKH A;  2VXW A;  1YZ6 A;  5GQO A;  3HOX B;  5DNF A;  3J81 c;  3TRE A;  1OXV A;  1MJC A;  3PIP 3;  4IFD I;  4GOP A;  3EQL C;  1Y8P B;  4XT1 B;  4DK0 A;  4A3E B;  5EBD A;  3GTK H;  4HCS A;  2OTL A;  3IFD A;  4JI2 Q;  4HED A;  4DV7 L;  5EPL A;  2FXQ A;  3MTS A;  4DR5 Q;  5ELF A;  3V05 A;  1JOO A;  2UU9 L;  4DR3 Q;  4LFB Q;  1QIL A;  5JJZ A;  3E6Z X;  2R92 H;  1VQC A;  2Q2U A;  2OTJ A;  5EKK A;  2C9O A;  2K28 A;  4GOP C;  4KKU A;  1EY5 A;  3SHL A;  3WOE A;  4EQN A;  3UDF A;  3R2T A;  3EIV A;  3U4V A;  1PH1 A;  2WKD A;  4PQX A;  1QNU A;  3HOV G;  1PH5 A;  4KY6 A;  3J81 L;  3KF8 A;  4A3K H;  2R93 H;  4P74 A;  1Q12 A;  1WVL A;  2RSO A;  2YU9 H;  2PYK A;  1SNP A;  2HIX A;  5EQ0 A;  1FGB D;  4K2L A;  4OWW B;  4FF1 A;  4EQP A;  1D5X C;  4KD3 A;  1E7Z A;  3NQT A;  5KNB A;  2H1E A;  3KF8 B;  5KGU A;  2WAC A;  4AQY Q;  2UUB Q;  1A2U A;  4ODG A;  3BYT B;  2Z0S A;  4UP8 A;  3G6J B;  2VL6 A;  1Q81 C;  4B3S L;  2LXK A;  4A3B B;  3S1N H;  3PO3 B;  2ENB A;  1ENA A;  5D3D A;  4YCU A;  3EJI A;  1D5Z C;  3K6O A;  5I9P A;  2BE5 D;  5I4D A;  1V9P A;  2B2V A;  2QF7 A;  2F0U A;  1U4M A;  2J0T D;  3MEF A;  1LTT D;  4OEM B;  4A3G G;  4BWG B;  4GS3 A;  2MPM A;  3SEB A;  1ICF B;  1GHK A;  4GLX A;  2NVQ H;  1TQO A;  3E9I A;  4ZUI A;  3DWA A;  4JI4 Q;  2Z6K A;  3GTM B;  3VR2 A;  5KYL A;  2B2W A;  1I3Q H;  1EYA A;  3RLO A;  2UXD Q;  4CJ0 B;  1WD1 A;  4PMW A;  4NXM Q;  2I07 B;  3HP3 A;  1BDO A;  2JYO A;  4QGU A;  3S14 H;  3W1G A;  1H9M A;  2VS1 A;  2VUM H;  1B50 A;  2E2H H;  4E6I A;  4BA2 I;  4KHP L;  4H7B A;  3PUW A;  5JVG 3;  2KHI A;  2EE1 A;  2IJ0 A;  4DAP A;  4YHH L;  1KAW A;  1L0Y B;  1Q1E A;  2B2W C;  3MFG A;  2N55 A;  5HUR A;  1TWC H;  5BR8 Q;  3ERS X;  1J9O A;  4Y52 H;  4JBJ A;  4BY7 H;  1D7Q A;  1UAP A;  3GTO B;  2EIF A;  5FLM G;  1PH6 A;  3HKZ E;  3RN2 A;  4DR7 Q;  3CKI B;  1C9O A;  2XNA C;  2HQL A;  5IOC A;  4XQQ A;  3R2I A;  5BN3 A;  3OMG A;  4X66 L;  2XSC A;  3G6E A;  2BE5 C;  1HZ9 A;  4JI6 Q;  3VR4 A;  5DM7 3;  1Y1W B;  3CC7 A;  4V19 0;  3FKI H;  5E4W C;  4LFA L;  1BCP F;  1EUJ A;  3HOU B;  3RLF A;  1GUS A;  3AMU A;  1GM5 A;  1UE1 A;  1PXU A;  3LWU A;  1IBL L;  1NMG A;  4OX9 L;  1D8L A;  2KHJ A;  1YNN D;  1B9N A;  2NVX B;  1A3U A;  3NBI A;  4G7H C;  2D2C C;  1QWY A;  2RCF A;  3CCE A;  2BCO A;  2IHE A;  1SXT A;  3QB3 A;  4BA1 I;  1N34 L;  2ICE C;  1SLJ A;  1WCM B;  4KK7 A;  1PV4 A;  2IWH A;  5FOB B;  2R7Z G;  4EQ5 A;  3K5N A;  2GVA A;  3S9W A;  4A76 A;  3F8T A;  2ZT9 C;  1TWA B;  3CME A;  4A3E H;  3FDT A;  4YY3 Q;  3BJU A;  2K75 A;  2LXJ A;  1KRS A;  3P20 A;  2JEB I;  3P7J A;  4BBR B;  1I94 L;  1RTN A;  2HDL A;  1PFS A;  2EPB A;  4OEL B;  4HSV A;  1EY0 A;  1AZP A;  2Q8T A;  1ET9 A;  2Z4I A;  1QG7 A;  1K28 A;  4QCL A;  1VQA A;  4NKL A;  4DPG A;  5IWA L;  4OO1 H;  3VR6 A;  2NVY B;  3J81 j;  1X3Q A;  5CV5 A;  2JP1 A;  1F2M A;  1QZH A;  4IN3 A;  4L5R C;  4RGN A;  3A55 A;  2BA0 A;  1PDQ A;  3T56 B;  3GV6 A;  2ZJR A;  3KDF A;  2NZ1 D;  5IYD H;  2M00 A;  2F0H A;  1MSH A;  4POG A;  2KVM A;  3NTK A;  4JK1 C;  4LF9 L;  1A15 A;  2HQE A;  1O7L A;  5AFW A;  2UUC L;  2HCC A;  1P8L A;  2KJX A;  2LY7 A;  4XQN A;  5C3W A;  2K32 A;  1MI2 A;  3H0G G;  1HTP A;  4LFC L;  2ZM6 L;  4DV7 Q;  3BDC A;  1JOQ A;  4KHZ A;  4GLA C;  2TSS A;  1G91 A;  4EGV A;  1SAP A;  1NJI C;  1HNX L;  3RUZ A;  1R9T H;  5CV8 A;  4AH6 A;  4QUC A;  2UU9 Q;  4BY1 G;  5M3M B;  5K5P A;  3ND9 A;  3BVM A;  1EL0 A;  4ZYS A;  3NBH B;  1SMY D;  2EOT A;  4P72 A;  3U4Z A;  2QDL A;  1IYV A;  1BUV T; 
#chains in the Genus database with same CATH homology
 2PNH A;  3CCM A;  4JYA Q;  3FHW A;  1VQE A;  1YJN A;  1Q1B A;  4IFD G;  5C0X J;  3ULP A;  3D0F A;  2IHF A;  1E22 A;  3LGJ A;  1K73 C;  1CSQ A;  1LTL A;  3HKZ G;  4DR1 L;  1QUQ B;  2ZTD A;  3PSI A;  1L1O A;  1A8V A;  1Q82 C;  1W3S A;  1JJG A;  5GRO A;  5JJI A;  2OQK A;  1AH9 A;  1E3P A;  1XTD A;  3M3Y H;  3I7F A;  2AWN A;  3JC6 6;  5IY0 A;  2E2J H;  3E0E A;  1E24 A;  4YCV A;  1N33 L;  1KL9 A;  4JBK A;  3L7Z C;  4XIG S;  4RG1 A;  1I6H H;  1W2B A;  2IX0 A;  1K8A C;  3ER0 A;  3UE1 A;  4UP7 A;  1XNR Q;  1P16 A;  1Y1V H;  3GTM H;  1BKB A;  4AQY L;  2UUB L;  1L1O B;  1IZ6 A;  1HR0 W;  2B63 G;  4DV4 L;  4A75 A;  4R4Q A;  4QL5 A;  1HNW Q;  3RN5 A;  3PUZ A;  1V1Q A;  4B3S Q;  1J5E L;  3CCU A;  1VQ6 A;  4QJF A;  2MNA A;  3FP9 A;  2AWO A;  4NB3 A;  3PO3 G;  4C2M H;  2PQA A;  1VQ5 A;  1FJG L;  1WYD A;  2HIV A;  5M3M H;  3JAM i;  2JEA I;  1K0R A;  2JQO A;  4OWT B;  4HIM A;  3HOW G;  4DV6 L;  1UWV A;  2OCE A;  1GVP A;  5LMN Q;  3T1H L;  2JA8 G;  1L1O C;  4WJ4 A;  2YYZ A;  5E7N A;  1B7Y B;  1KHI A;  1SR3 A;  2Q2H A;  3ULL A;  1YHA A;  5K36 G;  4B3R Q;  2EQS A;  4YWM A;  2ZJQ A;  1S72 A;  1SFO H;  2UXC L;  4APV A;  3I4M H;  1RL2 A;  3GDE A;  3PF4 A;  1V43 A;  1AE3 A;  4DV3 L;  1BVS A;  2VQF L;  2JK8 A;  2PQA B;  2UUA Q;  1TWF H;  1QVC A;  5HY6 A;  3SGI A;  2XGT A;  2HHH Q;  4A3C H;  2E5L L;  1HZC A;  1O7I A;  4GOP B;  4JI4 L;  1Y1V G;  4QIW E;  2JA6 H;  4DR4 Q;  2A1A A;  1HR0 Q;  4B3T Q;  4DV2 L;  2NN6 I;  2UXD L;  3TEH B;  3NEM A;  2K50 A;  1X56 A;  3GTO H;  4NXM L;  2NZO A;  2D62 A;  4KLK A;  2H5X A;  5C3E G;  1BBW A;  2Q2I A;  1VCI A;  3CC2 A;  1DGS A;  1NBW A;  1NMF A;  1L2F A;  2RHS B;  5M3M G;  1IBM Q;  4KHP Q;  2CCZ A;  4JI7 Q;  1C7Y A;  2GVB A;  2K5N A;  2ID0 A;  5LMU L;  4OON A;  3CP0 A;  4A3J H;  1VQG A;  4QY7 A;  3AFP A;  3TQY A;  2I0Q A;  2BH2 A;  2UXB Q;  1A0I A;  1YHQ A;  1Y1W H;  4LWC A;  3I4M G;  4BBS H;  5IYC H;  2N8N A;  2YV5 A;  4YHH Q;  3RR5 A;  4A3G H;  4X6A H;  3ZJY C;  3T1Y L;  1SMX A;  1VQ9 A;  3DM3 A;  4A3C G;  3RNU A;  3G48 A;  3BZC A;  3H15 A;  3CQZ H;  3H3V I;  3OTO Q;  4PZ6 A;  2JA6 G;  2ALY B;  2XTI A;  1JT8 A;  4IO9 A;  5BR8 L;  3S15 H;  1B8A A;  4UP9 A;  1EIY B;  4JI5 Q;  2WAQ E;  3AEV A;  1CSP A;  1XPO A;  3EBE A;  4X62 L;  2JJQ A;  5JEA J;  2OWO A;  3HOZ H;  3I55 A;  5FLX c;  3L0O A;  4DR7 L;  3W5O A;  3J80 c;  3S1R H;  1S3O A;  3CCL A;  3CD6 A;  3KF6 A;  5IT9 c;  4WJ3 M;  4AIM A;  2K4K A;  4DV1 L;  3OW2 A;  1WCM H;  3BU2 A;  3KYH C;  4LNQ A;  2VNU D;  4X66 Q;  4A3M H;  4LF4 Q;  2HT1 A;  5EAY A;  1IBK Q;  2ATW A;  4A3J G;  5GAE C;  4DUZ Q;  4C3H H;  4OWX B;  1LUZ A;  3PO2 H;  4GKK Q;  1VQN A;  2B29 A;  2R6G A;  2KBN A;  3PCO B;  4TVA B;  4LFA Q;  1Q7Y C;  1Y1W G;  4JI6 L;  1SRU A;  3A74 A;  4DAY B;  4BBS G;  5IYC G;  4DV0 Q;  3CCV A;  2CWA A;  1VQK A;  3HOU G;  4X64 L;  3KF6 B;  1IYJ B;  1IBL Q;  1FVI A;  1WJJ A;  4FDB A;  4JBW A;  4BBR H;  4GNX B;  4OX9 Q;  4A3D G;  3KOJ A;  3S16 H;  3PF5 A;  2RCN A;  3F2D A;  1QUQ A;  4JI3 Q;  1PH4 A;  5IP7 H;  4Y7N H;  4DUY L;  1PH9 A;  4R4O A;  4H02 A;  3J80 i;  3DLL A;  1HNZ Q;  4GN4 B;  4MZ9 A;  3J7Z C;  3HOZ G;  1N34 Q;  3F1Z A;  1Q8K A;  2MQH A;  4LUZ A;  3UE0 A;  4GN3 B;  4ALP A;  1B70 B;  1MJE A;  1PVO A;  4A3I H;  4PZ7 A;  5GAD C;  1N36 Q;  4DV5 L;  4O0A A;  3HFZ B;  3CPW A;  1OXT A;  1WCM G;  2VY3 A;  1EQQ A;  1N32 L;  1UE5 A;  5FLM H;  3W1B A;  5LMN W;  5ELN A;  2F4V L;  2I5L X;  4JI0 Q;  1EFW A;  4IFD J;  3A5U A;  2JA7 H;  4GKJ L;  1FL0 A;  3RLN A;  3PO2 G;  3S2D H;  4YY3 L;  2R7F A;  4K0K L;  1KXL A;  3STB D;  1TXY A;  4R4C A;  1OXX K;  1JB7 A;  4NXN L;  1Q46 A;  4JI8 Q;  5C0X G;  1I94 Q;  1GD7 A;  4BBR G;  1WI5 A;  2BA1 A;  3CAM A;  3M4P A;  3CXC A;  1X3G A;  3PUV A;  3F2B A;  1VQM A;  1OXU A;  4JV5 L;  4PZ8 A;  4OO1 I;  3GTL H;  1YI2 A;  3S24 A;  2YTY A;  2JA5 H;  1I50 H;  3KLW A;  1IL2 A;  1XNQ Q;  3GTP H;  1VQI A;  3E9H A;  2Z6K C;  1X65 A;  5IWA Q;  3G4S A;  1M1K C;  3S17 H;  2VQE L;  1MKH A;  2MO0 A;  1YZ6 A;  5GQO A;  3S1M H;  4LF6 L;  4B3M Q;  4HJA A;  5GAH C;  5C4X G;  3J81 c;  3L2P A;  3I4N H;  3TRE A;  1XMQ L;  1OXV A;  1KRT A;  1MJC A;  5M5Y H;  1EYG A;  3PV0 A;  2PI2 A;  3MXN B;  1XMO Q;  1FGU A;  4NPS A;  4HJ7 A;  4GOP A;  2VW9 A;  3GTG H;  1KD1 C;  4L5Q A;  1CKM A;  1RIP A;  1PYS B;  1GO3 E;  2D0P A;  3H3V H;  1YBY A;  3RZO H;  2JA7 G;  4A3F H;  4LF9 Q;  4DK6 C;  3HOV H;  4DKA C;  1VQ7 A;  4BXX H;  3EN2 A;  4A4I A;  2UUC Q;  3GTK H;  4LF5 Q;  1JMC A;  2OTL A;  4DR6 Q;  3M4O H;  1K3R A;  3AQQ A;  4X65 L;  2L15 A;  2QA4 A;  2I5M X;  4DR2 L;  1TWG H;  2KCT A;  5AJ3 Q;  4JI2 Q;  4LFC Q;  2ZM6 Q;  2Y0S G;  1GKH A;  4DV7 L;  4LF7 L;  4YWK A;  2FXQ A;  1X9N A;  2JA5 G;  4DR5 Q;  4DV0 L;  2KEN A;  1HNX Q;  1WOC A;  1T9H A;  3U50 C;  4IPD A;  1S40 A;  3Q8D A;  3PUX A;  4IJH A;  2F52 A;  4XTC S;  4JI1 Q;  5IYB H;  2C35 B;  4DR3 Q;  2UU9 L;  2R92 H;  4LFB Q;  1G29 1;  1KQS A;  1VQC A;  2WB1 G;  2Q2U A;  2OTJ A;  2Y0S E;  3CCQ A;  2K5H A;  4GOP C;  3M7N A;  5ELO A;  4P71 A;  3UDF A;  1JJ2 A;  4LW1 A;  2DUD A;  3EIV A;  3U4V A;  1PH1 A;  4R4T A;  3F2C A;  4A3F G;  2PMZ E;  3HOX H;  1G51 A;  4LF8 L;  2NZH A;  3HOV G;  1PH5 A;  1VQB A;  3GTJ H;  2WB1 E;  4BXX G;  2WAQ G;  4O2D A;  4JYA L;  4A3K H;  2R93 H;  4DR1 Q;  4P74 A;  1Q12 A;  1E1O A;  5M3F H;  3G71 A;  2B3G A;  3AYH B;  3STB C;  1M90 C;  2YU9 H;  1ASY A;  2HIX A;  4OWW B;  1CUK A;  1E7Z A;  1PHJ A;  1LYL A;  1N33 Q;  3BZK A;  4JC0 A;  5IP9 H;  1A62 A;  3KF8 B;  4HIK A;  1OXS C;  1X6O A;  2R92 G;  2QGQ A;  4AQY Q;  2UUB Q;  4LF8 Q;  1PH7 A;  1XNR L;  5C44 H;  4GNX A;  3K8A A;  4DV4 Q;  2DGY A;  4AYB E;  3CW2 C;  3WWV A;  2Z0S A;  5GAG C;  4UP8 A;  2ZTE A;  3K7U C;  1J5E Q;  3S2H H;  1HNW L;  4A3L H;  4DNI A;  2VL6 A;  1Q81 C;  2CKZ B;  2LXK A;  4B3S L;  1HZA A;  3S1N H;  1YVC A;  1YHB A;  1FJG Q;  4OXP A;  5JEA G;  4YCU A;  4DV6 Q;  3I2Z A;  3M85 A;  3T1H Q;  4A3K G;  2R93 G;  1V9P A;  4IPG A;  5LMN L;  5M3F G;  4A3G G;  3MEF A;  2N78 A;  2QEX A;  4MTN A;  1Z9F A;  4GS3 A;  4A3D H;  2AHO B;  2VZA A;  3I4O A;  4IPH A;  2GN5 A;  4GLX A;  2NVQ H;  4B3R L;  1XJV A;  2UXC Q;  4RMF A;  1EQR A;  4HID A;  4DV3 Q;  2A19 A;  2VQF Q;  1IXR A;  3E9I A;  4GN5 A;  4J15 A;  4IPC A;  2UUA L;  2E5L Q;  1CKO A;  2HHH L;  4JI4 Q;  1VQJ A;  4IFD I;  2Z6K A;  3KDF B;  4GNX C;  3ULJ A;  1YJ9 A;  1I3Q H;  2BH8 A;  3RLO A;  5C44 G;  3KJO A;  4DV2 Q;  1HR0 L;  1NY4 A;  4DR4 L;  2UXD Q;  4B3T L;  1X54 A;  4PMW A;  3GTQ H;  4NXM Q;  4A3M G;  3GD7 A;  5IE8 A;  4A3L G;  4QGU A;  3S14 H;  3W1G A;  1VQF A;  2VS1 A;  2VUM H;  4R4I A;  4P73 A;  5M5X H;  2PI2 E;  1IBM L;  1H95 A;  5C4J H;  3CCR A;  2E2H H;  4BA2 I;  1JE5 A;  2B63 H;  3J7A 5;  4KHP L;  4JI7 L;  5JJL A;  3U58 A;  3ICE A;  3TRZ A;  4YWL A;  3PUW A;  1NE3 A;  2ASB A;  2K52 A;  2OQ0 A;  4GLV B;  3UDX A;  4A3B H;  2KHI A;  3PO3 H;  2R7D A;  1YIJ A;  4QQB X;  2UXB L;  2I5H A;  4R1J A;  1VQ4 A;  2F3I A;  5IP7 G;  3HOW H;  1UEB A;  4IJL A;  3CMA A;  2JA8 H;  3T1Y Q;  4YHH L;  1BBU A;  2MO1 A;  1VQ8 A;  4KI0 A;  1KAW A;  3JAM c;  2N49 A;  1Q1E A;  1TWH H;  2AKW B;  3OYY A;  1SRO A;  4A3I G;  2WFW A;  1TWC H;  3OTO L;  5J3B A;  5BR8 Q;  1Q86 C;  2E2I H;  3ERS X;  1QVF A;  4Y52 H;  3KFU A;  4JBJ A;  1X3E A;  4BY7 H;  1D7Q A;  1VS0 A;  4JI5 L;  2EIF A;  1HZB A;  3K0X A;  4JCV E;  4X62 Q;  5FLM G;  1PH6 A;  3HKZ E;  3RN2 A;  3HOY H;  3B6Y A;  4DR7 Q;  1LM0 A;  1C9O A;  3K7A H;  4POF A;  1EWI A;  2HQL A;  3I56 A;  2VUM G;  2NN6 G;  4P75 A;  3CPF A;  1ASZ A;  4DV1 Q;  4IOA A;  3GO5 A;  2R7Z H;  4L5S A;  1G6P A;  4X66 L;  4LF4 L;  3G6E A;  1IBK L;  1VQL A;  1L0W A;  5C3E H;  1PH8 A;  5C0X I;  4DUZ L;  4A3B G;  1KIX A;  1X55 A;  1HZ9 A;  1K83 H;  1E1T A;  2ES2 A;  4JI6 Q;  4GKK L;  3CC7 A;  1I5F A;  3FKI H;  3IRB A;  4LFA L;  1MIU A;  1EUJ A;  4JBM A;  3RLF A;  4X64 Q;  1X3F A;  2WP8 J;  1UE1 A;  2CWP A;  1VQH A;  1YNX A;  1EOV A;  2YTX A;  3J81 i;  1GM5 A;  2K14 A;  1IBL L;  1J6Q A;  1NMG A;  4JG2 A;  1D8L A;  4OX9 L;  3CC4 A;  3S1Q H;  2KHJ A;  3I4N G;  3PIP A;  4DUY Q;  3M9B A;  4JI3 L;  1U5K A;  4BY7 G;  3CCE A;  2EXD A;  4C3I H;  2IHE A;  4BA1 I;  1HH2 P;  4DK3 C;  1HNZ L;  3HOY G;  1XPR A;  4HJ9 A;  1N34 L;  2CFM A;  4DV5 Q;  3PUY A;  1SLJ A;  4JOI A;  1N36 L;  1Z47 A;  3UDI A;  1XPU A;  1PV4 A;  1N32 Q;  2F4V Q;  2R7Z G;  4EQ5 A;  2ZJP A;  1YIT A;  2V1C C;  2RHQ B;  2GVA A;  4A76 A;  3VDY A;  3F8T A;  4JI0 L;  3TS2 A;  4GKJ Q;  3CME A;  4A3E H;  2JA9 A;  3K81 C;  4HIO A;  1UE7 A;  4YY3 Q;  3NEL A;  2IT1 A;  4IOC A;  2AMC B;  4AYB G;  3FKI G;  4C3J H;  4K0K Q;  2IX1 A;  1K8G A;  4NXN Q;  3BJU A;  2K75 A;  2LXJ A;  1KRS A;  2JEB I;  1SN8 A;  1C0A A;  4JI8 L;  4L5T A;  2LSS A;  1I94 L;  1PYB A;  4JV5 Q;  3M4Q A;  1PFS A;  3H0G H;  5IYB G;  2D0O A;  1A63 A;  3A0J A;  2A8V A;  3D31 A;  1YEZ A;  1VQA A;  4A93 H;  3HOU H;  3KJP A;  1XNQ L;  1AE2 A;  4DPG A;  3CCS A;  5IWA L;  2VQE Q;  2CQO A;  3J81 j;  5JJK A;  2K5V A;  1PH3 A;  4LF6 Q;  4JOI C;  4BY1 H;  3PGZ A;  4PG3 A;  3HOX G;  3RZD H;  1VQD A;  1QZH A;  1XMQ Q;  4B3M L;  2NVX H;  5M5W H;  4L5R C;  2BA0 A;  2JE6 I;  2IY5 B;  1VQP A;  5FJ8 H;  1QZG A;  1N8R C;  1OTC A;  2ZJR A;  1XMO L;  3KDF A;  4UPA A;  1WFQ A;  3CF5 A;  5IYD H;  4POG A;  4A3E G;  3AFQ A;  2KCM A;  3NEN A;  4LF9 L;  1EIF A;  4TQU S;  1K9M C;  5DLQ E;  3CCJ A;  2UUC L;  4DR6 L;  3TS0 A;  1P8L A;  4LF5 L;  4X65 Q;  3UDG A;  2E8G A;  4DR2 Q;  4UY8 C;  5IP9 G;  1VQO A;  2Q2T A;  2NVT H;  5AJ3 L;  3H0G G;  3K80 C;  4LFC L;  2ZM6 L;  1TWA H;  4DV7 Q;  1KC8 C;  2ZTC A;  4JI2 L;  1NTG A;  4LF7 Q;  1CKN A;  4EX5 A;  1QVG A;  4KHZ A;  4HJ8 A;  4MNO A;  4GLA C;  1PH2 A;  5HGQ A;  4A93 G;  4DR5 L;  1NJI C;  1U0L A;  1HNX L;  1YJW A;  1R9T H;  2UU9 Q;  4AH6 A;  4OO1 G;  3HKS A;  1SE8 A;  4JI1 L;  1PA6 A;  4DR3 L;  4LFB L;  1JJC B;  4BY1 G;  3PIO A;  1UE6 A;  1Y14 B;  3NBH B;  2MFI A;  4LUO A;  5FJ8 G;  2YTV A;  5H1S E;  1CKN B;  1HJP A;  5LMU Q;  4ME3 A;  5IYD G;  2N3S A;  4P72 A;  4YCW A;  4DAM A;  4LUV A;  2RF4 A;  1N9W A;  3U4Z A;  3A5Z B;  2NVY H;  4HJ5 A;  5C4X H; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...