1IBML

Structure of the thermus thermophilus 30s ribosomal subunit in complex with a messenger rna fragment and cognate transfer rna anticodon stem-loop bound at the a site
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
124
structure length
124
Chain Sequence
PTINQLVRKGREKVRKKSKVPALKGAPFRRGVCTVVRTVTPKKPNSALRKVAKVRLTSGYEVTAYIPGEGHNLQEHSVVLIRGGRVKDLPGVRYHIVRGVYDAAGVKDRKKSRSKYGTKKPKEA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Recognition of cognate transfer RNA by the 30S ribosomal subunit.
pubmed doi rcsb
molecule tags Ribosome
molecule keywords 16S RIBOSOMAL RNA
total genus 14
structure length 124
sequence length 124
ec nomenclature
pdb deposition date 2001-03-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
L PF00164 Ribosom_S12_S23 Ribosomal protein S12/S23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 1ibmL00
4A3IG 1KAWA 2ASBA 3I4MG 1EOVA 3TEHB 2YV5A 3S1RH 1Q82C 2VUMH 3A74A 3E0EA 4DV5L 2DGYA 1LTLA 4DUZL 1FVIA 2VW9A 4B3RQ 5C4JH 4R4IA 2OTJA 4GKKQ 5M3MH 1O7IA 4LF8Q 1PYSB 3SGIA 1XJVA 3CMAA 1KRTA 2Z6KC 3GTPH 4X62Q 3MEFA 1GO3E 1NBWA 4JI8Q 5M5XH 2CWAA 1J5EQ 1VQHA 3TREA 4A3EH 4AQYQ 3TS2A 1IBMQ 2I5HA 4DR1L 2L15A 1Y14B 1PHJA 2WAQG 1VQDA 1XMQQ 2B3GA 4QQBX 4IPHA 2K52A 4NXNQ 2D0OA 2EQSA 1XMOQ 3S1QH 4AH6A 2ZTDA 1EIFA 5IWAL 3IRBA 2VY3A 3KF6A 4LUZA 1XPRA 5IYDH 5M5WH 4JOIC 4JI7Q 1N33Q 4H02A 2I5LX 3EBEA 1I6HH 3I7FA 4MZ9A 4A3BG 4JBKA 3OW2A 3CW2C 3CXCA 1ASZA 3RN5A 4A93H 3E9IA 2NVYH 4MTNA 4YCWA 3HOXH 5M3FH 2K5HA 2Q2UA 1EQQA 2JQOA 1PH2A 2CQOA 4HJ9A 5HGQA 3T1YQ 2BA1A 1AH9A 4DV6Q 2N78A 3HOUH 3H0GG 2JE6I 3PO3H 4B3SL 2VNUD 1QZHA 1X65A 3G6EA 2BH2A 3CF5A 2F4VQ 1GD7A 4JV5Q 3Q8DA 2UUAQ 2ZJRA 1D7QA 2K5NA 2JA9A 2R7FA 1G6PA 1YHBA 1U5KA 2ID0A 2RHSB 1VQAA 5JEAG 1JJCB 2BA0A 3FKIH 4UY8C 4A3LH 4DAYB 1AE2A 2D0PA 3H15A 1OTCA 4A3LG 1JMCA 4ME3A 4LFAQ 4DR2Q 5IE8A 3KLWA 4GN4B 2JA8G 2PMZE 1FL0A 3KF6B 4OX9Q 5ELOA 1VQ7A 3J81c 4YCVA 3B6YA 5IYCH 3RN2A 3KJOA 1FJGL 4A3DH 5C0XI 2R6GA 2N49A 4GKJL 1IZ6A 4NXML 4L5TA 3J80c 1HR0Q 3S2DH 4GNXC 2B63G 1SLJA 5IY0A 2R92H 2AWOA 4DUYQ 4GOPC 3VDYA 4A3KH 4A75A 4NXMQ 3HOWG 3KYHC 3CCVA 4KI0A 1XNQQ 5LMUQ 1OXXK 5FJ8G 1NJIC 3CC4A 1YI2A 1UE5A 1EWIA 5C44H 2NVXH 1TXYA 4DK6C 4X65Q 1WFQA 1WCMH 1CKNB 3G4SA 3CCUA 1QVGA 3HKZE 1V1QA 3F8TA 2IX0A 3K7AH 5LMNQ 1YJ9A 2NVQH 1Q1BA 2HHHQ 1T9HA 4GLAC 3FKIG 4A3DG 1XPOA 3UE1A 1YITA 1NMFA 1XMOL 4GLXA 2JA7G 3CCQA 1W2BA 2ATWA 3PCOB 1SR3A 3GTLH 3L0OA 3I4MH 1WI5A 1PV4A 1PYBA 1XNRL 2AKWB 1LYLA 4JI3Q 4JYAL 4OO1G 5JJIA 1N34L 2FXQA 2KCMA 1IL2A 2HQLA 4TVAB 1VQEA 3RNUA 1JJGA 3L2PA 4JI3L 4A3FG 1X56A 2I5MX 5AJ3L 4DV4L 3W1BA 2NVTH 1I94Q 1NTGA 1OXUA 1A8VA 3A0JA 1YBYA 3BZKA 2QA4A 4QIWE 5HY6A 4BY7G 5GAGC 2V1CC 4IJLA 3TS0A 1PH8A 4GKKL 3BJUA 4DV2L 4A93G 1N32L 2OTLA 4OWXB 4HJ7A 1Y1VG 3D31A 1VQ6A 4YWMA 2VUMG 3K80C 1Q81C 4OX9L 3STBC 4FDBA 4UP7A 2F52A 4R1JA 1GM5A 4LF6L 1UEBA 1PH3A 1KXLA 3G48A 4C3IH 1S72A 2WP8J 1IBML 2UUBQ 4O2DA 1C0AA 1VQFA 4L5QA 4L5RC 3S16H 3UDGA 4DR5L 4NB3A 3ICEA 5ELNA 2JEBI 2UUAL 1YEZA 3HOWH 1K0RA 4JI4Q 1M1KC 1HZ9A 3OYYA 1BKBA 4LF9L 3UDXA 1UE6A 1VCIA 4LF8L 2R7ZH 4JI0L 1L1OB 4MNOA 5AJ3Q 3J81j 4DV4Q 2Q2TA 4A3CH 4ALPA 2ZTCA 3E9HA 4DV6L 2E2HH 4BY1H 3H3VH 3GD7A 3AQQA 1HNXL 2K5VA 3MXNB 3J80i 5IYCG 1B8AA 1EQRA 2R7DA 1X3FA 2XTIA 5JJKA 1MKHA 2YYZA 4JC0A 4LUOA 3F2BA 3HOZG 1PA6A 1EFWA 5IYBG 3S14H 1YJWA 4JI7L 2A1AA 4JV5L 4A3KG 3RZOH 2MFIA 2UU9Q 4JBJA 2UXCL 4BXXG 5LMNL 2LXJA 1Q8KA 1WOCA 1MJEA 4JYAQ 4B3RL 4PG3A 4DR3Q 3U50C 4LF5Q 4JI6Q 1BBWA 1IXRA 1HNZQ 4A4IA 2IY5B 1E3PA 3G71A 5E7NA 2WB1E 3BU2A 4LFCL 4JI1L 1BBUA 4KHPL 4PZ7A 4LF5L 4IPDA 3GO5A 4HIMA 2K50A 3T1HQ 1SROA 4A3JG 3HOZH 1VQMA 2R93G 4C3JH 3PUXA 3RLNA 5GAHC 1IYJB 1YHQA 1I50H 2VL6A 3CCMA 4KHZA 4GKJQ 4IFDJ 3LGJA 1B70B 1N9WA 2QGQA 4QL5A 3M85A 1UE1A 3NBHB 3PUVA 4A3JH 2HIVA 3I56A 1XMQL 5IT9c 1IBKQ 2CKZB 1VQKA 2B29A 3D0FA 3M4PA 1QVCA 4JI2Q 5IYDG 5H1SE 2I0QA 1XNRQ 4OONA 2R7ZG 1EIYB 4B3MQ 1HNZL 1CSQA 2UXDL 1I3QH 2OCEA 1VS0A 3PSIA 1PH9A 2JEAI 4BY7H 1HZBA 3EIVA 2NZHA 1L2FA 1PH4A 4JI0Q 4DK3C 5M3FG 5C3EH 3CD6A 4JI5Q 3HOVG 3T1HL 3PUZA 4EX5A 4AIMA 1VQCA 4YCUA 3I2ZA 1TWCH 4DV3Q 2OWOA 4YWLA 5C0XG 3PIPA 1PFSA 1MIUA 1P16A 1JB7A 2R93H 4KHPQ 3CCEA 4JI5L 4J15A 1VQJA 2E2IH 1KL9A 4P71A 4HJAA 5IP7G 2E5LQ 1A63A 3S17H 5FLMG 1KQSA 3PUYA 3UDFA 4JI2L 1HNWL 2D62A 1WJJA 4DR7Q 2YU9H 4DR6L 2YTYA 3I55A 2UUCL 2E5LL 3DLLA 2UXBQ 2AWNA 1J6QA 3CPWA 1IBKL 4A3MH 4GN5A 4AYBE 2E2JH 1CSPA 3ER0A 3W5OA 1Q7YC 1EYGA 4PMWA 4DNIA 4APVA 1X3GA 2GN5A 2PNHA 3K8AA 3PIOA 4HJ8A 1K9MC 4LF7Q 4POGA 1JE5A 4B3TQ 4YY3L 4R4OA 4JI1Q 4LFCQ 4OWWB 3NENA 2A8VA 2LSSA 1V9PA 1D8LA 3CPFA 3PUWA 4PZ6A 5GROA 4X66L 2K4KA 2UUBL 2ZM6L 2CWPA 4DUZQ 4IFDG 5JJLA 4LWCA 1HR0W 4UP9A 1HNWQ 4BBSG 1RL2A 4XTCS 2B63H 4LF6Q 5FLMH 1XTDA 1IBLQ 2BH8A 3KDFB 5IYBH 5DLQE 4LNQA 2K75A 4JI4L 3CCSA 4DV7Q 5FLXc 4O0AA 1GVPA 4DR5Q 1Q46A 2Z6KA 4X64Q 3AEVA 3U4ZA 4A3GH 1OXSC 3BZCA 2HIXA 4R4QA 1HNXQ 1RIPA 5M5YH 2F3IA 5LMNW 4DV1L 2AMCB 2PI2E 4HIKA 2R92G 3CCJA 4KLKA 1PH7A 3JAMi 4OWTB 3S1NH 3PGZA 3ZJYC 2RHQB 4K0KL 2WB1G 5K36G 3OTOL 4P74A 1CKNA 2WAQE 1Y1VH 4IJHA 3UE0A 2UXCQ 2C35B 3GTMH 4DR4L 4GNXB 4DPGA 4BXXH 1VQOA 3CCLA 1Z47A 1YVCA 4HIDA 3U4VA 1SN8A 5BR8L 2ZJPA 1C7YA 3HKZG 1EUJA 4B3TL 4P73A 1E22A 4BBRH 1VQ8A 4R4CA 1UWVA 3GTKH 1H95A 3HOYG 3KOJA 3CC7A 3RZDH 3KDFA 4AYBG 3HFZB 2IX1A 3ULLA 3AYHB 5GADC 1VQLA 1TWAH 1VQNA 5C4XH 4DR3L 4JBWA 1C9OA 3K7UC 2KENA 3GTGH 1FGUA 2MO1A 1NY4A 2JA6G 1JJ2A 2EIFA 1P8LA 3CAMA 1VQGA 3KF8B 5IWAQ 4DR4Q 3GTOH 2UUCQ 2GVBA 1A62A 2PI2A 1PH5A 1SFOH 4GOPB 2MNAA 3TQYA 3GTQH 4RG1A 1SMXA 2Q2IA 4IPGA 5C44G 1PVOA 2JA7H 1ASYA 4L5SA 4YY3Q 3PF5A 2NN6G 1X54A 1A0IA 2EXDA 3CMEA 1J5EL 1B7YB 3S24A 5BR8Q 4HIOA 1SE8A 1VQBA 2PQAB 1WYDA 1QUQB 2N8NA 3CQZH 4P72A 2JJQA 4BY1G 4BBRG 1YZ6A 1LUZA 2ZTEA 1HR0L 4LF9Q 4A3CG 1HH2P 4JOIA 1Q1EA 1N36L 1L0WA 1R9TH 1L1OA 1CKOA 3J7ZC 4DV2Q 4RMFA 1YNXA 4UPAA 2AHOB 5IP9G 1VQ9A 1FJGQ 4PZ8A 2JA6H 1VQ4A 4WJ4A 5FJ8H 1X55A 1N36Q 4DV5Q 3HOYH 5IP7H 1KHIA 1BVSA 1QUQA 3F1ZA 1GKHA 5LMUL 4A3IH 1Q12A 3H3VI 4B3SQ 3U58A 3PO2H 1U0LA 2RCNA 4DR2L 3K81C 1V43A 3AFPA 1KRSA 3HKSA 1KIXA 2Q2HA 2JA5G 4IFDI 2MO0A 1X3EA 3J7A5 1CKMA 4DV0L 3M4OH 4JCVE 4GLVB 4OXPA 4QJFA 2RF4A 1HZAA 3HOXG 4X65L 1DGSA 3PO3G 2CCZA 1VQPA 1HZCA 4K0KQ 2YTVA 2A19A 2F4VL 3NELA 1Z9FA 4DKAC 3T1YL 2JA5H 3STBD 2OQ0A 2WFWA 4AQYL 1TWGH 4A3FH 1N34Q 3M9BA 4C2MH 1QVFA 4DR1Q 1WCMG 2K14A 2CFMA 2IT1A 2VS1A 2N3SA 3HOVH 4C3HH 1XNQL 1G291 3RLFA 3ULJA 1XPUA 5GQOA 4JBMA 5C0XJ 4A3GG 3OTOQ 4X62L 4LW1A 2MQHA 1UE7A 2YTXA 3M3YH 4A76A 2Y0SG 4GNXA 5IP9H 4DR6Q 3HOUG 1QZGA 4A3BH 1X9NA 5JEAJ 3F2DA 3I4OA 3M4QA 4GOPA 1I94L 2HHHL 2UXBL 1PH1A 1X6OA 4LFAL 2KHIA 3FP9A 1G51A 2HT1A 4YHHQ 4X66Q 4NPSA 2E8GA 5C4XG 1HJPA 3JC66 1OXVA 3A5ZB 4JG2A 4XIGS 4BA1I 2QEXA 1VQ5A 1OXTA 2Z0SA 4Y7NH 1KD1C 3PF4A 4LFBL 1YHAA 4TQUS 1I5FA 1K8GA 2PQAA 4GN3B 4BBSH 1N8RC 4UP8A 3J81i 2XGTA 3EN2A 4NXNL 3JAMc 2VQEL 3CCRA 1IBLL 2VQEQ 4DV3L 4A3MG 4IOAA 1SRUA 3PV0A 4JI6L 1K3RA 2VQFQ 4DV7L 2UXDQ 1PH6A 4DAMA 4DR7L 1E1TA 3FHWA 2KHJA 4X64L 2H5XA 1AE3A 1E7ZA 4IOCA 1CUKA 1Q86C 3I4NH 1VQIA 1KC8C 2ZM6Q 2KBNA 1NE3A 2JK8A 4LF4L 3KJPA 2JA8H 3L7ZC 5C3EG 3F2CA 1N32Q 1L1OC 3DM3A 4P75A 2GVAA 3A5UA 2ALYB 4DUYL 3M7NA 4LFBQ 5M3MG 4LF4Q 1E24A 2VZAA 2DUDA 4EQ5A 2UU9L 1K83H 3NEMA 2OQKA 2KCTA 5EAYA 3GTJH 3S2HH 4QGUA 3W1GA 4BA2I 2ES2A 1YIJA 1N33L 3WWVA 2IHFA 1S3OA 3RR5A 5J3BA 2NN6I 3GDEA 3CC2A 3TRZA 4B3ML 2VQFL 3AFQA 4LUVA 5GAEC 3UDIA 2Y0SE 3K0XA 2LXKA 4POFA 1Y1WH 3S15H 3S1MH 4OO1I 3H0GH 1YJNA 1TWFH 4YWKA 1K8AC 4DV1Q 4LF7L 3ULPA 2IHEA 3RLOA 1W3SA 4X6AH 1Y1WG 3ERSX 4HJ5A 4IO9A 4WJ3M 1S40A 1JT8A 4R4TA 1M90C 1TWHH 1E1OA 4GS3A 4DV0Q 1K73C 4A3EG 3CP0A 4JI8L 2NZOA 1LM0A 1MJCA 3I4NG 3KFUA 3PO2G 4YHHL 2ZJQA 4QY7A 4IPCA 1NMGA 4Y52H
chains in the Genus database with same CATH superfamily
2KEEA 1JC7A 1KAWA 3I4MG 2A68C 1E0BA 3S1RH 1MBYA 3A74A 3D4RA 2I07B 1FVIA 1HA5A 4B3RQ 2LS01 2OTJA 2IW3A 1B53A 3GTPH 1Y8NB 3SR1A 3MEFA 5A2QE 4DFAA 4A3EH 2K28A 1B3AA 4DR1L 2PZTA 3F2UA 1D6EC 1KAAA 3I90A 4QQBX 2EZVA 1I3QB 2D0OA 1XMOQ 3EVQA 5EBDA 1F9SA 4HR7B 4LUZA 3K0YA 4HEDA 5M5WH 1PFBA 4MZ9A 1B9MA 3ND8A 3CW2C 4HN7A 1ASZA 3RN5A 3FPPA 4YCWA 1HFGA 5JPNC 5M3FH 2K5HA 5EBCA 2Q2UA 1AH9A 4DV6Q 2N78A 2YU9B 1GXDC 4E6IA 2JE6I 5M3MB 2FINB 1QZHA 1X65A 1GD7A 4JK1C 2UUAQ 2B2TA 2ZJRA 2K5NA 2R7FA 3BVGA 1VQAA 1JJCB 3BDCA 4KD3A 1S5DD 1HUMA 2K05A 2XWBB 1AE2A 1OO9B 3H15A 1OTCA 2JA8G 2PMZE 2AQ2B 1UNSA 2AUJD 1HHVA 2J7ZA 2R6GA 4HTHA 4BS9A 4L5TA 2PPBC 3I73A 3IL8A 4A3IB 2NVYB 3OW7A 5CYUA 2AWOA 4A3KH 3RMHA 5CV9A 1SYEA 3KUPA 3J80L 2B2YC 3ND9A 2B2WC 2HD3A 2E75C 4LAAA 4XYQA 2KCCA 5T1IA 3S9WA 1TXYA 1IL8A 1CKNB 1LABA 4KJOA 1V1QA 3HKZE 3CCUA 5CV5A 5LMNQ 1AZPA 1EOTA 2NVQH 4AYBB 2JSOA 3DWAA 1T9HA 4GLAC 4QF4A 1X3QA 1NMFA 4GLXA 3CCQA 2HUGA 5FLXE 3E3XA 3GP7A 3PCOB 1K3BC 4EQPA 4FF4A 3L0OA 3MXNA 3OMCA 1EEID 2G9DA 2AKWB 1LYLA 4JI3Q 1XNRL 3CRLC 1ESFA 1IL2A 1V1PB 1MSGA 5HURA 4JI3L 3K57A 1X56A 2VNUD 2NVTH 5IGBA 1NTGA 3A0JA 2QA4A 1YBYA 5C44B 2NVXB 1SDFA 4BY7G 5GAGC 4IJLA 3MAQA 3TS0A 2MUYA 2OTLA 4ZLTF 2QCPX 1RTOA 3R2TA 4OHJA 3BYYB 1ZKOA 1EU4A 4KY5A 4F88A 4LF6L 4KKSA 1TS2A 1PH3A 4C3IH 1IBML 2WP8J 1FGBD 2B2WA 1VQFA 5ELFA 1SJHD 3S16H 4DR5L 4NB3A 5ELNA 2EY2A 1QOHA 5D3IB 1PLFA 4OL7A 4LF8L 1STGA 1L1OB 5AJ3Q 3J81j 4A3CH 4DV6L 2E2HH 5BN3A 2VB2X 1JR0D 3AQQA 5IYCG 1EQRA 1Q3LA 1SYCA 5EKKA 2XTIA 1MKHA 4IUPA 1B1ZA 2Z8LA 4QUCA 4ZYSA 1YJWA 1RDPD 4JI7L 4A3KG 3RZOH 2XRSD 5HGTA 2A5HA 4JBJA 5ELCA 1SYBA 1WOCA 1FNVA 2N88A 4ZAIA 2O5JC 4N9PA 3HOXB 4LF5Q 1BDOA 2IY5B 2CW0D 4FP5D 4JI1L 1WTVA 4NP5A 4KHPL 1SBBB 3E6ZX 2JA7B 4LMQD 1PZID 4HIMA 1PMRA 5C5LA 4U68A 1BUVT 4KHZA 4FNFA 4R8IA 1CZWA 4WRDA 1PTOC 4ILWA 1QWYA 2XWJB 1WD1A 2B29A 4B3MQ 1CSQA 1F2YA 1FNUA 3VYUA 1EWCA 3M7GA 2UXDL 1I3QH 1VS0A 3BVMA 4MN3A 3S17B 4JI0Q 4DK3C 3BZDB 5M3FG 1XX8A 4JI5Q 4YCUA 1SNMA 3QB3A 1PFSA 2J0TD 3VA7A 4JI5L 4J15A 1ZXTA 5FO8B 2E2IH 1KL9A 2E2DC 1HXYD 1QG7A 4JI2L 5L37A 4DR6L 2UUCL 5EJWA 5EGTA 1V8QA 4GN5A 3NQTA 1CSPA 2GN5A 2PNHA 4HJ8A 1Y1WB 3P7JA 3SDZA 4POGA 3SK6A 4YY3L 1T5EA 3NENA 5IOCA 5COYA 2LSSA 4RCOA 3NWTA 5JJLA 2F4IA 4ZQ3A 2NZ1D 4DUZQ 2XNAC 4M8AA 4UP9A 1HNWQ 5EPKA 5FLMH 1IBLQ 2K75A 4JI4L 2E2IB 1TWAB 1EY9A 1GVPA 2R3ZA 4OIKA 4X64Q 3NK9A 4M1UB 2HIXA 4IUUA 1Y1VB 5M5YH 3T53B 2PI2E 2NTTA 3MXGA 1EWHA 3NXWA 2SNSA 1T5XD 1XWEA 1CKNA 3TSSA 2C35B 1CA6A 2EPBA 2ICIA 1YVCA 4YIJA 3I70A 3QIAA 1CHQD 4B3TL 2SOBA 1LTGD 3H91A 4A3BB 2LMCB 2WIIB 4BBRH 3KK7A 4OEMB 1UWVA 3HOYG 2NN6H 4G4KA 1E2WA 3KDFA 3K5MA 3LX0A 5C4XH 2HCIA 5CV8A 5ELEA 3GTGH 2XVSA 1NY4A 4Q5VA 2EIFA 3CAMA 2A6EC 4DR4Q 1BQQT 1Y69U 1NNXA 5I2YA 4GOPB 4A3MB 1A3UA 2DY8A 1SMXA 2DN8A 2Q2IA 3S2DB 4CDCC 2JA7H 3OIQA 1D2BA 3PF5A 2EXDA 4FO2A 1J5EL 1BR9A 1SE8A 2VQEL 1WYDA 1QUQB 2EYHA 5JVG3 1YZ6A 1HR0L 1ET9A 2EYPA 1HH2P 5KNBA 1G2TA 1L0WA 1CKOA 3A8IE 5JEAH 3J7ZC 1GHKA 3K59A 4UPAA 5IP9G 1FJGQ 4K6DA 4KK7A 4H0LC 2KOLA 1KHIA 5CORA 5LMUL 4A3IH 1EIHA 2L0CA 2P5ZX 3K81C 1V43A 3AFPA 1KIXA 2Z9HA 2NYZD 1KNAA 3HP3A 1F77A 4DV0L 3M4OH 2OXPA 3SVMA 1TKWB 4KY7A 3K58A 1HZCA 4K0KQ 3NELA 1Z9FA 3T1YL 5I9PA 3STBD 1TWGH 4A3FH 2WINB 3M9BA 5CC4A 1QVFA 1SNQA 2ICEC 1D5ZC 2IT1A 3VR5A 1MD2D 2VS1A 2BOSA 3URYA 3HOVH 1A2TA 1G291 3L9AX 1XPUA 3D6WA 1SNPA 1UE7A 2YTXA 2V4DA 5IP9H 4QMGA 1X9NA 3F2DA 3I4OA 1I94L 3V96A 5CBAE 2KHIA 4OGQC 4RGMA 2HT1A 3K5NA 1FYCA 5C4XG 1OXVA 4JG2A 2L1BA 4XIGS 2QEXA 1VQ5A 1A3VA 1II3A 3JAML 3PF4A 4LFBL 2F0SA 1YHAA 1D1IA 2F0NA 4HSVA 1YNJC 4NMZA 5IGDA 4A3KB 1PRTD 4UP8A 2XGTA 3JAMc 2JXMB 3CCRA 3P75A 4DV7L 2HQEA 4KN7C 5C3WA 2H5XA 1Q86C 1JWUD 2NB0A 4K6LA 3CQZB 3T13A 2VUMB 1Z6HA 1L1OC 4IUQA 2ALYB 5M3MG 4RGNA 3J7AF 4X3SA 2UU9L 1K83H 5EAYA 2OQKA 2L55A 3K6OA 1G2SA 4KKUA 2IHFA 5EKIA 5J3BA 5CV6A 3GV6A 3QO2A 1LTAD 2Y0SE 4POFA 2LXKA 1STYA 2KCNA 5I6YA 4OO1I 1HQRD 4DV1Q 1G8ZD 2JN4A 3ULPA 4BWGB 1JT8A 4IO9A 4WJ3M 3ZYYX 1M90C 1TWHH 1E1OA 1RKNA 2OF1A 1LM0A 2PCFB 3PQIA 2FHTA 2B2TC 3K5OA 4IPCA 1NMGA 4QY7A 2PYKA 4PQXA 2ASBA 1B9NA 1EY6A 2YV5A 3TEHB 1K0SA 1LTLA 1Q8IA 2L12A 5C4JH 4R4IA 5BN4A 5M3MH 4DA2A 3E0JA 1XJVA 2M00A 3CMAA 3C3LA 2BE5C 1KRTA 2XSCA 4BY1B 4X62Q 4G7OC 2H4OA 1NBWA 4RWSC 5M5XH 3TREA 4JW0A 3DEPA 2QDBA 1JE4A 4XT3B 1KNEA 1VQDA 4IUVA 3EFXD 2K52A 3T51B 4NXNQ 3J80E 2O5IC 4H02A 4XDXA 3EBEA 3CKIB 3I7FA 1SJED 1SYGA 4CDEC 3OW2A 2PZWA 3C1EA 2JYOA 1SAPA 1CTMA 2NVYH 4MTNA 4G7ZC 1KLUD 1GJXA 1TS3A 2BA1A 1UAPA 3CF5A 1CA5A 4WJWA 3J7YW 2B2UA 1QNUA 3Q6SA 3OPOA 1G6PA 3FVQA 2RHSB 5JEAG 4OO1H 1BNZA 2CH4W 4G57A 1JMCA 4ME3A 3KLWA 3E5SA 3OMGA 3KF6B 1NCVA 5IYCH 3RN2A 1TQOA 1RF2D 1TWFB 1LTID 1DM0B 3LNNA 4UAIA 3J80c 1HR0Q 2B63G 4DUYQ 3VDYA 4NXMQ 4A75A 1MGSA 1W6KA 3ONAB 3OSOA 3BDOA 1SMYD 5KRUA 5LMUQ 1OXXK 1ENFA 3CC4A 1QILA 1BCPF 1EWIA 4K2KA 1V1PA 4X65Q 3NTIA 1WCMH 1QVGA 2IX0A 3K7AH 1NUCA 3RUZA 2OEOA 2F0MA 3FKIG 4A3DG 3HGBA 2JA7G 4A3JB 4QCLA 3H09A 1W2BA 3GTLH 2L5TA 1F9RA 4JYAL 1YNND 1WTHA 3RNUA 3L2PA 1BXTA 2F0IA 2I5MX 3W1BA 5C5MA 1GUSA 3PIP3 3D4DA 5HY6A 4GKKL 3BJUA 1N32L 4MHEA 3HEJA 4A93B 1DZ1A 1FD7D 3RZOB 2F0OA 2M2LA 4JVZA 3K80C 1A2UA 4KN4C 1I4PA 2F0TA 4UP7A 1I4HA 3M3YB 1M4VA 1UEBA 3MEHA 3P20A 2UUBQ 3Q23A 4O2DA 2X6LA 1I4RA 1AN8A 1QB5D 3MWYW 1KABA 3SHLA 3ICEA 2WACA 2UUAL 1RJTA 1EIGA 1CM9A 1CZGA 1VCIA 2R7ZH 2F3VA 4JI0L 2Q2TA 2F1MA 3ERQA 4ALPA 2ZTCA 5D14A 3GD7A 4A3EB 5JAVA 1HNXL 2K5VA 3J80i 4A3DB 1X3FA 4EGVA 3SXHA 5JJKA 4B08A 2F0JA 3F2BA 3HOZG 1IW7D 2MGSA 1B50A 3DUZA 1PA6A 1EYDA 3SK4A 4A3GB 2UU9Q 2EYLA 3TBIB 4ME5A 4A3FB 2CVRA 1VMCA 1C48A 2IJ0A 4PG3A 3WDNA 4QUFA 1BBWA 3QJYA 1E3PA 2B2UC 2WB1E 3BU2A 5E7NA 5C6AA 1S4ZA 4PZ7A 3A7AB 3PO3B 1WD0A 1PFMA 1ET6A 3TP8A 4MIUA 5ELBA 5E3FA 5GAHC 3EQLC 2VL6A 3MZ5A 3CCMA 4GKJQ 3LGJA 4QL5A 4DXGA 3PUVA 2HIVA 1IBKQ 1ICFB 4V190 5LL6S 2IL8A 3D0FA 1NR2A 5IYDG 1XNRQ 2I0QA 4QB4A 1HNZL 3IAYA 1GUNA 2EDGA 2F0VA 2JEAI 1O7LA 3PSIA 2L11A 2A6HC 1DYQA 5C3EH 3CD6A 3HOVG 4EX5A 3I2ZA 1TWCH 2FFKB 5C0XG 4O1NA 3A56A 3PIPA 1P16A 3C2PA 2R93H 4FXDA 3D6CA 4KHPQ 3CCEA 2CHBD 4P71A 4HJAA 5IP7G 1PRTB 1JOOA 4MTKA 1HNWL 1DOMA 2D62A 4C3JG 2UXBQ 2AWNA 1J6QA 2F0PA 3CPWA 1IBKL 4A3MH 3HOUB 2K04A 2E2JH 3W5OA 1SEBD 4APVA 3K8AA 1K9MC 4LF7Q 2FJ2A 3KBGA 4R4OA 4LFCQ 2A8VA 4CJ1B 1FR3A 3PUWA 5GROA 4KKTA 4LWCA 5IYBH 4LNQA 3OWEB 5D3DA 1PTOD 1K28A 4PNYA 4O0AA 3TP6A 5IGGA 1ONLA 2Z6KA 2DNCA 4A3GH 1NAPA 2Q8TA 2N55A 5NUCA 2DNEA 5M9OA 1B44D 1E2VA 3JAMi 2O4XA 3S1NH 1WCMB 5K36G 2E74C 3OTOL 1HA6A 1TWGB 3TDQA 4IJHA 5J1ZA 3UE0A 4DR4L 4DPGA 1VQOA 4C3IG 1Z47A 5BR8L 2TSSA 4X3KA 4R4CA 1H95A 3KOJA 1F2MA 3CC7A 3RZDH 2PW5A 3TN2A 2IX1A 3ULLA 1VQLA 1LACA 5CV7A 1C9OA 1S5BD 3K7UC 1SFOB 1SYDA 1NR4A 5CGKA 2JA6G 1JJ2A 1P8LA 1HTPA 2Z6BA 3KLSX 1SNCA 1A62A 1VDZA 1PH5A 4KD4A 1SFOH 3TQYA 2EJFC 1D5XC 1RHPA 4L5SA 2I46A 1A0IA 3CMEA 1B7YB 1Q81C 2WV6D 3I4NB 1H9SA 1YNXA 2JA6H 4F7XA 4PV1C 1LT5D 1X55A 5FJ8H 1A6XA 1XXGA 5IP7H 1BVSA 1QUQA 1Q12A 2D5DA 2D9UA 1D1KA 3PO2H 5EPLA 3HG9A 4IFDI 1HCZA 3A54A 4XXEA 4X65L 2CCZA 1VQPA 2A19A 2F4VL 3KBXA 2VB3X 3G6JB 2A74C 3PMFA 2OQ0A 2WFWA 2JA5H 2QEJC 1N34Q 2CFMA 3BYTB 4C3HH 4RFBA 3RLFA 3H6MA 5C0XJ 4A3GG 2MQHA 4DR6Q 2Y0SG 3MXUA 3M4QA 1IYUA 4BBRB 4LFAL 4K5XA 1X3PA 2EE1A 4IURA 1AW7A 1G51A 1BCPB 4X66Q 1IW7C 2PMZB 1SXTA 3A5ZB 5M5WB 1DJRD 4RKBA 1HFNA 2ZXOA 3EJIA 4Y7NH 1GUTA 1KD1C 4TQUS 4O42A 4XYOA 1GUOA 5JVH3 5E4XA 2QDLA 2JP1A 2MJ8A 1N8RC 1TWCB 5D65A 1O78A 1IBLL 4DV3L 4A3MG 4KJNA 4JI6L 4DAMA 5CV4A 5KNDA 2GA4B 3G7LA 1J9OA 1AE3A 1E7ZA 2NBFA 4IOCA 1G91A 1VQIA 4LF4L 2KBNA 1NE3A 2JK8A 3KJPA 2JA8H 3L7ZC 3A5UA 4CJ2C 4C3HG 5T1GA 4LF4Q 3NEMA 1W6JA 1UEAB 4I65A 4QGUA 4EQOA 1R9TB 4DU9A 3WWVA 1H9RA 2NN6I 1JQYD 2VQFL 3AFQA 1Y1WH 4KTAA 1EY8A 2LKVA 3ERSX 1S40A 4R4TA 4DV0Q 1AP0A 3NSWA 1MJCA 5I2XA 3PO2G 2H1EA 2NUCA 2ZJQA 4FYDA 4L6TB 3A55A 3QR8A 4IZ8A 4Z9CB 3GTJB 1EOVA 1H9MA 1Q82C 4RGOS 2LFNA 3E0EA 1DXMA 4DUZL 1H9JA 2VW9A 4HSPA 4LF8Q 3HKZB 2C5CA 4RH6A 2F0KA 1UUPA 1GO3E 4JI8Q 1J5EQ 1VQHA 2F3WA 3NHHA 1DOLA 2DJGC 2KQ3A 3FKIB 4CDDC 1IBMQ 1I6HB 2I5HA 1Y14B 1PHJA 2WAQG 1SSOA 2EJMA 2F0EA 3BS1A 2E2JB 2WKDA 3QG1A 2EQSA 3KLRA 4QIWB 5CBEE 1E2ZA 2VY3A 1GHJA 3KF8A 4JOIC 1N33Q 3NWSA 2I5LX 1I6HH 2EYMA 4HCEA 4JBKA 3OWFA 3CXCA 4C1NI 4A93H 2RDGA 3Q0AA 3NQIA 1I4XA 2JQOA 1RTNA 4RA8A 5I6WA 1LT4D 2K5WA 2RVLA 5IT9L 3HOUH 3PO3H 2X6GA 4NDXA 3Q8DA 5FO9B 5K36H 2K5DA 2JA9A 1O7ZA 1U5KA 4IQZA 4OIJA 2BA0A 2G5DA 2E2HB 2R7ZB 3SE0A 4UY8C 4A3LH 2D0PA 3K7AB 1FL0A 5ELOA 2BE5D 4V0BA 3GTMB 1VQ7A 3A8JE 3KJOA 4GKJL 4NXML 2MHVA 3S2DH 4IUTA 3GTKB 1DCZA 1SLJA 3T4AC 5IY0A 2R92H 4BBSB 4GOPC 3S1RB 3HOWG 1LLRD 3CCVA 1SYFA 5LL6X 1NJIC 4CKCA 3WOFA 2JA8B 5C4JB 2MPMA 4B3TQ 3G4SA 3F8TA 1YJ9A 1Q1BA 2HHHQ 1RD9D 3UE1A 3GTQB 1CK1A 1YITA 1XMOL 1TU2B 1JWMD 4ZUIA 2EY5A 2KVMA 1EL0A 1F9PA 3I4MH 3HRZC 1WI5A 1PV4A 3FDTA 3VR3A 1PZJD 1HQMC 2VXWA 5JJIA 1N34L 4RGTA 2HQLA 1JJGA 2KA7A 4A3FG 4DV4L 3MFYA 1L0XB 3IKJA 1A8VA 4I7AA 3BZKA 2Y0SB 2AUKA 2V1CC 1PH8A 4A93G 5K5PA 1H9SB 3X3MA 1VQ6A 3D31A 2VUMG 1EZ6A 4OX9L 3S14B 1A15A 4FDBA 4R1JA 1B3QA 1KXLA 3G48A 1MSHA 2FMCA 1LTSD 5E1FA 4L5QA 1C0AA 3UDGA 5KYLA 2EOTA 2JEBI 1YEZA 2HCCA 5FO7B 1SMYC 1K0RA 1HZ9A 3V2TA 3OYYA 1BKBA 2EVBA 2AQ3B 5M5XB 1S5ED 1UE6A 3UDXA 4MNOA 2BDOA 3E9HA 2LY7A 2XRQD 1EQTA 5I4DA 4ABNA 1CHPD 2R7DA 3HOZB 2RSNA 4LUOA 2YYZA 4JC0A 3S1QB 4U673 2CW0C 4RAUC 1EFWA 3S14H 4JV5L 3OOCA 1PTOH 2LXJA 1MJEA 5DNFA 1VMPA 1WTQA 3U50C 4JI6Q 1IXRA 1HNZQ 1LTBD 3G71A 1DOKA 4LFCL 3HOVB 1BBUA 2KECA 5JPMC 3IFDA 4IPDA 3S1NB 4PMBA 4A3JG 1BO0A 1VQMA 2BDNA 3RLNA 1IYJB 1I50H 3I4MB 4IFDJ 1N9WA 3M85A 2QGQA 1GOZA 1UE1A 1XMQL 5IT9c 2CKZB 4H13C 1VQKA 2RQXA 3M4PA 5LHY1 1QVCA 4JI2Q 3M4OB 4OONA 4PMCA 4RHSA 1MI2A 4TSSA 1PH9A 4DGZA 1HZBA 3EIVA 2NZHA 5KGUA 1L2FA 3SEBA 1XTCD 3T1HL 1WTOA 2OWOA 4YWLA 5C3XA 5FLXL 1PXUA 2A68D 2WB1B 1VQJA 1LO5D 1A63A 4CJ0B 3S17H 5FLMG 3PUYA 3UDFA 3S16B 1EY0A 2YTYA 3I55A 3M4YA 3DLLA 2IWHA 4AYBE 1Q7YC 4DNIA 1X3GA 2L4NA 3PIOA 3BDLA 2PO4A 4HCSA 4NW2A 1V9PA 3OIPA 1LT6D 3CPFA 5A2QL 4PZ6A 2UUBL 2ZM6L 2CWPA 1HR0W 1RL2A 2IPKD 4XTCS 4P2CB 1I4QA 2BH8A 3KDFB 5DLQE 4DNTB 4KV6A 3CCSA 4DV7Q 4CDFC 1GUWA 3C46A 5FLXc 4R9WA 2QKIC 3VYRA 1Q46A 1ENCA 3AEVA 3U4ZA 4H44C 1OXSC 3BZCA 5JOBA 1EQVA 2ZXPA 4R4QA 1HNXQ 1U4PA 1TY2A 3T56B 2AMCB 4HIKA 3T16A 2R92G 3AMUA 3CCJA 5DEHA 3D8GA 4R8NA 1Q90A 4OWTB 1SE3A 4XT1B 3PGZA 4DAPA 2RHQB 4K0KL 2K32A 2WB1G 4F8MA 5KNCA 3JAME 4P74A 1Y1VH 4C3IB 3CCLA 1VF7A 4DXFA 3Q24A 3U4VA 1SN8A 3HKZG 1EUJA 4KMUC 1E22A 1QE6A 4IALA 4HMJA 4AYBG 4KHVA 4J8QA 3HFZB 3AYHB 5GADC 1TWAH 2EXZA 4DR3L 3LWUA 4JBWA 5FOBB 2XN9C 5KYIA 1FGUA 2MO1A 4B9XA 2IX3A 1VQGA 3MXPA 3J7AV 3GTOH 2UUCQ 1S5FD 4WFN3 2PI2A 1ICWA 4DK1A 1Y8PB 4RG1A 3NTKA 5C44G 1PVOA 1M8AA 2F03A 1BOSA 4YY3Q 2NN6G 4L8JA 5BR8Q 2G9HD 2PQAB 2N8NA 1LV9A 4BBRG 2ZTEA 4A3CG 4LF9Q 4JOIA 1Q1EA 2F0LA 1L1OA 3L3OC 2NWGA 1VQ9A 2AHOB 1VQ4A 2SEBD 3HOYH 5E4WC 3CHBD 3F1ZA 4FXGC 1GKHA 1O7YA 3H3VI 4B3SQ 2KJXA 3P1HA 5FKAC 4UHVA 1U0LA 2RCNA 3HKSA 1TS5A 3NP8A 3SK5A 2JA5G 1X3EA 3K5LA 1S5CD 4QJFA 1LTTD 3PO3G 2Z4HA 1ZYRC 5DM63 5M3FB 2YTVA 2C9OA 1CFMA 5I9OA 4ZKBB 5J22A 4AQYL 3R3OA 4C2MH 4Y7NB 4DR1Q 1WCMG 3QOJA 1WTPA 2F0HA 4JBMA 4LW1A 2K33A 4J1MA 3HOUG 4A3BH 3KLSA 2UXBL 1YNNC 2EJGC 1I6VC 1X6OA 3FP9A 1HPCA 1AZQA 4NKLA 1STEA 4NPSA 2E8GA 3JC66 4FF1A 4BA1I 3H0GB 2B63B 3DMUA 4DAYA 1OXTA 2Z0SA 5IODA 1I5FA 1K8GA 4TRDA 2B39A 4RCNA 4BBSH 3EN2A 4NXNL 3MFGA 2VQEQ 3PV0A 3VA5A 1DD2A 1PH6A 4BY7B 1IKMA 2ENBA 1KTKA 3I3CA 4Q0FA 4X64L 3I4NH 1CUKA 4XQQA 4IFDG 2ZM6Q 1YNJD 5C3EG 5F2DA 2F0QA 3F2CA 4DUYL 3SK8A 3M7NA 2WAQB 5C0XH 4EQ5A 3GTJH 2ES2A 1V1OA 1N33L 1S3OA 1TWHB 2RKSA 1JOQA 4LUVA 3K0XA 1ZEQX 3TP7A 3S15H 3S1MH 1KDBA 1O80A 1R4PB 3DM1A 2NVTB 4GZYC 1TWFH 2M9VA 4YWKA 1K8AC 2IHEA 5CR3A 2K6AA 1D5MC 4K5WA 3RLOA 1Y1WG 4X6AH 4HJ5A 2F0UA 1CT1D 1LT3D 2A73B 4JI8L 1F2ZA 2NZOA 2A6HD 3FMCA 3DEOA 3I4NG 3KFUA 1AEXA 3ULJA 4ODGA 4A3IG 1I50B 4FVMA 2VUMH 2B2YA 5BN5A 4DV5L 2DGYA 3HOWB 1IYVA 5EKLA 3VR4A 3CRKC 4C2MB 4GKKQ 3U9SA 1O7IA 5C4ZA 1PYSB 1K8MA 3EA6A 3SGIA 3C1FA 1KLGD 2Z6KC 3V05A 2CWAA 3I8ZA 4AQYQ 3TS2A 2F0GA 2L15A 2JA6B 4LK1C 3A8KE 2B3GA 1XMQQ 4FF3A 2PZUA 4IPHA 1TVXA 4UDUC 3S1QH 1AFPA 4AH6A 2ZTDA 1EIFA 5IWAL 3IRBA 3KF6A 1XPRA 5IYDH 4JI7Q 4A3BG 2D2CC 1PRTF 3EROA 5G3LD 3E9IA 3HOXH 1STAA 1TT2A 1EQQA 2A6ED 1PH2A 2CQOA 4HJ9A 5HGQA 4KY6A 3T1YQ 3MC0B 3DWQA 3H0GG 4B3SL 2J4XA 4IUNA 3HZXA 3G6EA 2BH2A 3WOEA 2F4VQ 4JV5Q 3H94A 4C3HB 3FPUB 1EEFD 1D7QA 5FK9C 1YHBA 2ID0A 5C4HA 3FKIH 4DAYB 1PTOF 4A3LG 4DR2Q 4LFAQ 3S2HB 5IE8A 2XIWA 4GN4B 3VR6A 4DF7A 1EYAA 2F0DA 4IN3A 4RHRA 4OX9Q 2NVQB 3J81c 4YCVA 1ENAA 3B6YA 3TP5A 4DK0A 1EY7A 1FJGL 1BCPD 4A3DH 5C0XI 2N49A 1IZ6A 2EYOA 2DJFC 3R2IA 2RDHA 4GNXC 4N9TA 1SE4A 3R8BA 2K7VA 3KYHC 4KI0A 1XNQQ 3IFTA 5FJ8G 1STNA 1YI2A 1UE5A 3W3AA 5C44H 2NVXH 3A7LA 1HRJA 4DK6C 1WFQA 1CQVA 1IHZA 4EVOA 2R61A 1XPOA 1R4QB 2ATWA 1SR3A 5AFWA 1PYBA 5DM73 4ID6A 4OO1G 2B2VA 1JB3A 2EY6A 3NE5B 4WORA 2FXQA 2KCMA 1JORA 4TVAB 3FRPB 5JJZA 1VQEA 5AJ3L 2K01A 1I94Q 4CBVA 1OXUA 2JA5B 3LWEA 1EU3A 4QIWE 3NBIA 3Q22A 1ZYRD 4DV2L 2EY1A 5M5YB 4OWXB 4HJ7A 1Y1VG 4YWMA 2CQAA 3STBC 3VYTA 3H3VC 2F52A 1GM5A 1PRTC 2R93B 2TMPA 1ML0D 2A69C 2F0WA 1ILQA 1S72A 1F2LA 1STHA 4L5RC 1RCVD 2MP1A 1STBA 3HOWH 4JI4Q 4IFDH 1M1KC 2Z1CA 4K5VA 5IGCA 4LF9L 2PNRC 2EYJA 4J6HA 4DV4Q 4S3SA 4BY1H 3H3VH 2CH4A 1WVLA 3MXNB 1B4OA 1B8AA 1ESRA 1K8OA 2B8GA 1RODA 1Y8OB 2KUMA 3AB9A 5ELDA 2DY7A 5IYBG 1TR5A 2A1AA 1JOKA 2MFIA 3GTOB 2UXCL 4BXXG 1J8IA 1MHWC 2Q8RE 5LMNL 1G6ZA 1Q8KA 3UI2A 1TS4A 4B3RL 4K14A 4DR3Q 3MA2B 1EY4A 4A4IA 1PFNA 4L63B 4JPBW 5IGFA 4XQNA 4LF5L 1L0YB 4DAVA 2EYFA 1I4GA 3GO5A 3I4LA 2K50A 2PW7A 4G7HC 1SROA 3T1HQ 3HOZH 1GUGA 1SNDA 4C3JH 2R93G 1PZKD 3PUXA 1YHQA 3TZUA 4ZRZA 1B70B 3NBHB 4A3JH 3I56A 1PTOB 2R7ZG 5H1SE 2X69A 1EFID 1EIYB 1QJOA 4C3JB 4F87A 3GTPB 2OCEA 2O2LD 4BY7H 4ZK9B 1PH4A 1XYIA 3PUZA 3VYSA 4AIMA 1VQCA 1KDAA 1U4LA 1MIUA 1JB7A 2L9HA 1JICA 4XQJA 3PIO3 5CMDA 1QNKA 2E5LQ 4K2LA 1KQSA 1U4MA 1WJJA 4DR7Q 1SE2A 2E5LL 4CGYB 2YU9H 3ER0A 1EYGA 4PMWA 2WKCA 1JE5A 1IKLA 3S1MB 3S15B 4K8IA 2PQEA 4JI1Q 4OWWB 2B2VC 1D8LA 2E76C 3D4WA 3I91A 4X66L 2K4KA 3RD4A 4CHTB 5IT9E 4BBSG 3BVZA 2B63H 4LF6Q 3VR2A 1DONA 2Z4IA 1XTDA 1WTRA 2QILA 3TZDA 1BCPC 4CKBA 1TY0A 4DR5Q 3FEWX 4FXKC 1F9QA 1RIPA 3R93A 2F3IA 5LMNW 4DV1L 2R92B 4HMIA 4KLKA 4LJZC 1PH7A 3ZJYC 3DHQA 3QWNA 2KEDA 2QW7A 2WAQE 2UXCQ 3GTMH 1WTXA 4GNXB 4BXXH 4HIDA 2ZJPA 1C7YA 4P73A 3NBHA 3U9OA 3D3RA 1C4QA 1VQ8A 3GTKH 1EY5A 1VF5C 5EQ0A 2SDFA 4X3UA 5KIXA 3TMEA 1VQNA 4N8X1 2QF7A 3X3NA 3PO2B 2KENA 4X3TA 1ILPA 1TIID 3KF8B 5IWAQ 1NSNS 2GVBA 1LTRD 3MVVA 4EQNA 4ZUJA 1PDQA 2MNAA 3GTQH 1WTWA 4IPGA 4K8JA 4HAEA 1B2TA 2B8FA 1ASYA 1X54A 3S24A 1HTLD 4HIOA 1VQBA 3CQZH 4I7ZC 4BY1G 4DV3Q 4P72A 2JJQA 1LUZA 2HDMA 3W2DA 1N36L 1R9TH 4DV2Q 4RMFA 3S2HH 1K83B 4B9WA 4PZ8A 3RZDB 4WJ4A 1N36Q 4DV5Q 1H9KA 1EZ8A 5KEEA 3N52A 3U58A 4C56C 4DR2L 1KRSA 2Q2HA 4C1NK 2MO0A 3NTHA 3J7A5 1CKMA 4JCVE 4GLVB 3QOLA 4OXPA 3HOXG 2RF4A 1HZAA 5A35A 5ISRA 2ZT9C 1X32A 1DGSA 3O13A 4H7BA 4FF2A 4DKAC 2A69D 3NUCA 5C3EB 1SNOA 2K14A 4ZKCB 5IIFA 2N3SA 1XNQL 3MTSA 5GQOA 1JWSD 5G3LF 3OTOQ 4X62L 2Q8IB 3M3YH 2FMMA 4A76A 4GNXA 1QZGA 3CU7A 5JEAJ 2RA4A 3HOYB 4GOPA 2HHHL 4TKOB 4N8FA 1PH1A 5DAUA 5TSSA 3DWPA 1KDCA 2RDFA 3GTGB 3DXJC 4YHHQ 1U4RA 1BF4A 2K1BA 1HJPA 4OELB 5C4XB 2F0FA 2RBMA 2AQ1B 2KHSA 2RSOA 5J39A 3MHBA 5IGEA 4ULLA 3OHXC 2K5QA 2PQAA 4GN3B 3J81i 1Z7TA 4IOAA 2UXDQ 3J81L 1SRUA 1K3RA 2VQFQ 1CI3M 1U9RA 4DR7L 1PYWD 4DNRB 1C8CA 1E1TA 3FHWA 3NPPA 3J81E 2SNMA 3I72A 2KHJA 1BBXC 1FNWA 1KC8C 3N6RA 2HDLA 1N32Q 3DM3A 4P75A 2GVAA 2OT2A 4LFBQ 1A3TA 1E24A 2VZAA 2DUDA 2KCTA 1CQFA 3W1GA 4BA2I 3BG3A 1YIJA 3GTLB 3TRZA 3RR5A 3CC2A 3GDEA 4B3ML 4JYAQ 4DN4M 3UDIA 5GAEC 2NTSA 3H0GH 1YJNA 3GV3A 1JCKB 4LF7L 1QCBD 1W3SA 2K03A 4RKLA 1EYCA 2ZXRA 5EPJA 3HS0C 4GS3A 1K73C 3GQBA 4CKEA 2RCFA 2BCOA 3CP0A 4ZCKA 4A3EG 3ITPA 4YHHL 1HUNA 4Y52H 3AU7A
chains in the Genus database with same CATH topology
4A3IG 1KAWA 2ASBA 3I4MG 1EOVA 3TEHB 2YV5A 3S1RH 1Q82C 2VUMH 3A74A 3E0EA 4DV5L 2DGYA 1LTLA 4DUZL 1FVIA 2VW9A 4B3RQ 5C4JH 4R4IA 2OTJA 4GKKQ 5M3MH 1O7IA 4LF8Q 1PYSB 3SGIA 1XJVA 3CMAA 1KRTA 2Z6KC 3GTPH 4X62Q 3MEFA 1GO3E 1NBWA 4JI8Q 5M5XH 2CWAA 1J5EQ 1VQHA 3TREA 4A3EH 4AQYQ 3TS2A 1IBMQ 2I5HA 4DR1L 2L15A 1Y14B 1PHJA 2WAQG 1VQDA 1XMQQ 2B3GA 4QQBX 4IPHA 2K52A 4NXNQ 2D0OA 2EQSA 1XMOQ 3S1QH 4AH6A 2ZTDA 1EIFA 5IWAL 3IRBA 2VY3A 3KF6A 4LUZA 1XPRA 5IYDH 5M5WH 4JOIC 4JI7Q 1N33Q 4H02A 2I5LX 3EBEA 1I6HH 3I7FA 4MZ9A 4A3BG 4JBKA 3OW2A 3CW2C 3CXCA 1ASZA 3RN5A 4A93H 3E9IA 2NVYH 4MTNA 4YCWA 3HOXH 5M3FH 2K5HA 2Q2UA 1EQQA 2JQOA 1PH2A 2CQOA 4HJ9A 5HGQA 3T1YQ 2BA1A 1AH9A 4DV6Q 2N78A 3HOUH 3H0GG 2JE6I 3PO3H 4B3SL 2VNUD 1QZHA 1X65A 3G6EA 2BH2A 3CF5A 2F4VQ 1GD7A 4JV5Q 3Q8DA 2UUAQ 2ZJRA 1D7QA 2K5NA 2JA9A 2R7FA 1G6PA 1YHBA 1U5KA 2ID0A 2RHSB 1VQAA 5JEAG 1JJCB 2BA0A 3FKIH 4UY8C 4A3LH 4DAYB 1AE2A 2D0PA 3H15A 1OTCA 4A3LG 1JMCA 4ME3A 4LFAQ 4DR2Q 5IE8A 3KLWA 4GN4B 2JA8G 2PMZE 1FL0A 3KF6B 4OX9Q 5ELOA 1VQ7A 3J81c 4YCVA 3B6YA 5IYCH 3RN2A 3KJOA 1FJGL 4A3DH 5C0XI 2R6GA 2N49A 4GKJL 1IZ6A 4NXML 4L5TA 3J80c 1HR0Q 3S2DH 4GNXC 2B63G 1SLJA 5IY0A 2R92H 2AWOA 4DUYQ 4GOPC 3VDYA 4A3KH 4A75A 4NXMQ 3HOWG 3KYHC 3CCVA 4KI0A 1XNQQ 5LMUQ 1OXXK 5FJ8G 1NJIC 3CC4A 1YI2A 1UE5A 1EWIA 5C44H 2NVXH 1TXYA 4DK6C 4X65Q 1WFQA 1WCMH 1CKNB 3G4SA 3CCUA 1QVGA 3HKZE 1V1QA 3F8TA 2IX0A 3K7AH 5LMNQ 1YJ9A 2NVQH 1Q1BA 2HHHQ 1T9HA 4GLAC 3FKIG 4A3DG 1XPOA 3UE1A 1YITA 1NMFA 1XMOL 4GLXA 2JA7G 3CCQA 1W2BA 2ATWA 3PCOB 1SR3A 3GTLH 3L0OA 3I4MH 1WI5A 1PV4A 1PYBA 1XNRL 2AKWB 1LYLA 4JI3Q 4JYAL 4OO1G 5JJIA 1N34L 2FXQA 2KCMA 1IL2A 2HQLA 4TVAB 1VQEA 3RNUA 1JJGA 3L2PA 4JI3L 4A3FG 1X56A 2I5MX 5AJ3L 4DV4L 3W1BA 2NVTH 1I94Q 1NTGA 1OXUA 1A8VA 3A0JA 1YBYA 3BZKA 2QA4A 4QIWE 5HY6A 4BY7G 5GAGC 2V1CC 4IJLA 3TS0A 1PH8A 4GKKL 3BJUA 4DV2L 4A93G 1N32L 2OTLA 4OWXB 4HJ7A 1Y1VG 3D31A 1VQ6A 4YWMA 2VUMG 3K80C 1Q81C 4OX9L 3STBC 4FDBA 4UP7A 2F52A 4R1JA 1GM5A 4LF6L 1UEBA 1PH3A 1KXLA 3G48A 4C3IH 1S72A 2WP8J 1IBML 2UUBQ 4O2DA 1C0AA 1VQFA 4L5QA 4L5RC 3S16H 3UDGA 4DR5L 4NB3A 3ICEA 5ELNA 2JEBI 2UUAL 1YEZA 3HOWH 1K0RA 4JI4Q 1M1KC 1HZ9A 3OYYA 1BKBA 4LF9L 3UDXA 1UE6A 1VCIA 4LF8L 2R7ZH 4JI0L 1L1OB 4MNOA 5AJ3Q 3J81j 4DV4Q 2Q2TA 4A3CH 4ALPA 2ZTCA 3E9HA 4DV6L 2E2HH 4BY1H 3H3VH 3GD7A 3AQQA 1HNXL 2K5VA 3MXNB 3J80i 5IYCG 1B8AA 1EQRA 2R7DA 1X3FA 2XTIA 5JJKA 1MKHA 2YYZA 4JC0A 4LUOA 3F2BA 3HOZG 1PA6A 1EFWA 5IYBG 3S14H 1YJWA 4JI7L 2A1AA 4JV5L 4A3KG 3RZOH 2MFIA 2UU9Q 4JBJA 2UXCL 4BXXG 5LMNL 2LXJA 1Q8KA 1WOCA 1MJEA 4JYAQ 4B3RL 4PG3A 4DR3Q 3U50C 4LF5Q 4JI6Q 1BBWA 1IXRA 1HNZQ 4A4IA 2IY5B 1E3PA 3G71A 5E7NA 2WB1E 3BU2A 4LFCL 4JI1L 1BBUA 4KHPL 4PZ7A 4LF5L 4IPDA 3GO5A 4HIMA 2K50A 3T1HQ 1SROA 4A3JG 3HOZH 1VQMA 2R93G 4C3JH 3PUXA 3RLNA 5GAHC 1IYJB 1YHQA 1I50H 2VL6A 3CCMA 4KHZA 4GKJQ 4IFDJ 3LGJA 1B70B 1N9WA 2QGQA 4QL5A 3M85A 1UE1A 3NBHB 3PUVA 4A3JH 2HIVA 3I56A 1XMQL 5IT9c 1IBKQ 2CKZB 1VQKA 2B29A 3D0FA 3M4PA 1QVCA 4JI2Q 5IYDG 5H1SE 2I0QA 1XNRQ 4OONA 2R7ZG 1EIYB 4B3MQ 1HNZL 1CSQA 2UXDL 1I3QH 2OCEA 1VS0A 3PSIA 1PH9A 2JEAI 4BY7H 1HZBA 3EIVA 2NZHA 1L2FA 1PH4A 4JI0Q 4DK3C 5M3FG 5C3EH 3CD6A 4JI5Q 3HOVG 3T1HL 3PUZA 4EX5A 4AIMA 1VQCA 4YCUA 3I2ZA 1TWCH 4DV3Q 2OWOA 4YWLA 5C0XG 3PIPA 1PFSA 1MIUA 1P16A 1JB7A 2R93H 4KHPQ 3CCEA 4JI5L 4J15A 1VQJA 2E2IH 1KL9A 4P71A 4HJAA 5IP7G 2E5LQ 1A63A 3S17H 5FLMG 1KQSA 3PUYA 3UDFA 4JI2L 1HNWL 2D62A 1WJJA 4DR7Q 2YU9H 4DR6L 2YTYA 3I55A 2UUCL 2E5LL 3DLLA 2UXBQ 2AWNA 1J6QA 3CPWA 1IBKL 4A3MH 4GN5A 4AYBE 2E2JH 1CSPA 3ER0A 3W5OA 1Q7YC 1EYGA 4PMWA 4DNIA 4APVA 1X3GA 2GN5A 2PNHA 3K8AA 3PIOA 4HJ8A 1K9MC 4LF7Q 4POGA 1JE5A 4B3TQ 4YY3L 4R4OA 4JI1Q 4LFCQ 4OWWB 3NENA 2A8VA 2LSSA 1V9PA 1D8LA 3CPFA 3PUWA 4PZ6A 5GROA 4X66L 2K4KA 2UUBL 2ZM6L 2CWPA 4DUZQ 4IFDG 5JJLA 4LWCA 1HR0W 4UP9A 1HNWQ 4BBSG 1RL2A 4XTCS 2B63H 4LF6Q 5FLMH 1XTDA 1IBLQ 2BH8A 3KDFB 5IYBH 5DLQE 4LNQA 2K75A 4JI4L 3CCSA 4DV7Q 5FLXc 4O0AA 1GVPA 4DR5Q 1Q46A 2Z6KA 4X64Q 3AEVA 3U4ZA 4A3GH 1OXSC 3BZCA 2HIXA 4R4QA 1HNXQ 1RIPA 5M5YH 2F3IA 5LMNW 4DV1L 2AMCB 2PI2E 4HIKA 2R92G 3CCJA 4KLKA 1PH7A 3JAMi 4OWTB 3S1NH 3PGZA 3ZJYC 2RHQB 4K0KL 2WB1G 5K36G 3OTOL 4P74A 1CKNA 2WAQE 1Y1VH 4IJHA 3UE0A 2UXCQ 2C35B 3GTMH 4DR4L 4GNXB 4DPGA 4BXXH 1VQOA 3CCLA 1Z47A 1YVCA 4HIDA 3U4VA 1SN8A 5BR8L 2ZJPA 1C7YA 3HKZG 1EUJA 4B3TL 4P73A 1E22A 4BBRH 1VQ8A 4R4CA 1UWVA 3GTKH 1H95A 3HOYG 3KOJA 3CC7A 3RZDH 3KDFA 4AYBG 3HFZB 2IX1A 3ULLA 3AYHB 5GADC 1VQLA 1TWAH 1VQNA 5C4XH 4DR3L 4JBWA 1C9OA 3K7UC 2KENA 3GTGH 1FGUA 2MO1A 1NY4A 2JA6G 1JJ2A 2EIFA 1P8LA 3CAMA 1VQGA 3KF8B 5IWAQ 4DR4Q 3GTOH 2UUCQ 2GVBA 1A62A 2PI2A 1PH5A 1SFOH 4GOPB 2MNAA 3TQYA 3GTQH 4RG1A 1SMXA 2Q2IA 4IPGA 5C44G 1PVOA 2JA7H 1ASYA 4L5SA 4YY3Q 3PF5A 2NN6G 1X54A 1A0IA 2EXDA 3CMEA 1J5EL 1B7YB 3S24A 5BR8Q 4HIOA 1SE8A 1VQBA 2PQAB 1WYDA 1QUQB 2N8NA 3CQZH 4P72A 2JJQA 4BY1G 4BBRG 1YZ6A 1LUZA 2ZTEA 1HR0L 4LF9Q 4A3CG 1HH2P 4JOIA 1Q1EA 1N36L 1L0WA 1R9TH 1L1OA 1CKOA 3J7ZC 4DV2Q 4RMFA 1YNXA 4UPAA 2AHOB 5IP9G 1VQ9A 1FJGQ 4PZ8A 2JA6H 1VQ4A 4WJ4A 5FJ8H 1X55A 1N36Q 4DV5Q 3HOYH 5IP7H 1KHIA 1BVSA 1QUQA 3F1ZA 1GKHA 5LMUL 4A3IH 1Q12A 3H3VI 4B3SQ 3U58A 3PO2H 1U0LA 2RCNA 4DR2L 3K81C 1V43A 3AFPA 1KRSA 3HKSA 1KIXA 2Q2HA 2JA5G 4IFDI 2MO0A 1X3EA 3J7A5 1CKMA 4DV0L 3M4OH 4JCVE 4GLVB 4OXPA 4QJFA 2RF4A 1HZAA 3HOXG 4X65L 1DGSA 3PO3G 2CCZA 1VQPA 1HZCA 4K0KQ 2YTVA 2A19A 2F4VL 3NELA 1Z9FA 4DKAC 3T1YL 2JA5H 3STBD 2OQ0A 2WFWA 4AQYL 1TWGH 4A3FH 1N34Q 3M9BA 4C2MH 1QVFA 4DR1Q 1WCMG 2K14A 2CFMA 2IT1A 2VS1A 2N3SA 3HOVH 4C3HH 1XNQL 1G291 3RLFA 3ULJA 1XPUA 5GQOA 4JBMA 5C0XJ 4A3GG 3OTOQ 4X62L 4LW1A 2MQHA 1UE7A 2YTXA 3M3YH 4A76A 2Y0SG 4GNXA 5IP9H 4DR6Q 3HOUG 1QZGA 4A3BH 1X9NA 5JEAJ 3F2DA 3I4OA 3M4QA 4GOPA 1I94L 2HHHL 2UXBL 1PH1A 1X6OA 4LFAL 2KHIA 3FP9A 1G51A 2HT1A 4YHHQ 4X66Q 4NPSA 2E8GA 5C4XG 1HJPA 3JC66 1OXVA 3A5ZB 4JG2A 4XIGS 4BA1I 2QEXA 1VQ5A 1OXTA 2Z0SA 4Y7NH 1KD1C 3PF4A 4LFBL 1YHAA 4TQUS 1I5FA 1K8GA 2PQAA 4GN3B 4BBSH 1N8RC 4UP8A 3J81i 2XGTA 3EN2A 4NXNL 3JAMc 2VQEL 3CCRA 1IBLL 2VQEQ 4DV3L 4A3MG 4IOAA 1SRUA 3PV0A 4JI6L 1K3RA 2VQFQ 4DV7L 2UXDQ 1PH6A 4DAMA 4DR7L 1E1TA 3FHWA 2KHJA 4X64L 2H5XA 1AE3A 1E7ZA 4IOCA 1CUKA 1Q86C 3I4NH 1VQIA 1KC8C 2ZM6Q 2KBNA 1NE3A 2JK8A 4LF4L 3KJPA 2JA8H 3L7ZC 5C3EG 3F2CA 1N32Q 1L1OC 3DM3A 4P75A 2GVAA 3A5UA 2ALYB 4DUYL 3M7NA 4LFBQ 5M3MG 4LF4Q 1E24A 2VZAA 2DUDA 4EQ5A 2UU9L 1K83H 3NEMA 2OQKA 2KCTA 5EAYA 3GTJH 3S2HH 4QGUA 3W1GA 4BA2I 2ES2A 1YIJA 1N33L 3WWVA 2IHFA 1S3OA 3RR5A 5J3BA 2NN6I 3GDEA 3CC2A 3TRZA 4B3ML 2VQFL 3AFQA 4LUVA 5GAEC 3UDIA 2Y0SE 3K0XA 2LXKA 4POFA 1Y1WH 3S15H 3S1MH 4OO1I 3H0GH 1YJNA 1TWFH 4YWKA 1K8AC 4DV1Q 4LF7L 3ULPA 2IHEA 3RLOA 1W3SA 4X6AH 1Y1WG 3ERSX 4HJ5A 4IO9A 4WJ3M 1S40A 1JT8A 4R4TA 1M90C 1TWHH 1E1OA 4GS3A 4DV0Q 1K73C 4A3EG 3CP0A 4JI8L 2NZOA 1LM0A 1MJCA 3I4NG 3KFUA 3PO2G 4YHHL 2ZJQA 4QY7A 4IPCA 1NMGA 4Y52H
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4A3I G;  1KAW A;  2ASB A;  3I4M G;  1EOV A;  3TEH B;  2YV5 A;  3S1R H;  1Q82 C;  2VUM H;  3A74 A;  3E0E A;  4DV5 L;  2DGY A;  1LTL A;  4DUZ L;  1FVI A;  2VW9 A;  4B3R Q;  5C4J H;  4R4I A;  2OTJ A;  4GKK Q;  5M3M H;  1O7I A;  4LF8 Q;  1PYS B;  3SGI A;  1XJV A;  3CMA A;  1KRT A;  2Z6K C;  3GTP H;  4X62 Q;  3MEF A;  1GO3 E;  1NBW A;  4JI8 Q;  5M5X H;  2CWA A;  1J5E Q;  1VQH A;  3TRE A;  4A3E H;  4AQY Q;  3TS2 A;  1IBM Q;  2I5H A;  4DR1 L;  2L15 A;  1Y14 B;  1PHJ A;  2WAQ G;  1VQD A;  1XMQ Q;  2B3G A;  4QQB X;  4IPH A;  2K52 A;  4NXN Q;  2D0O A;  2EQS A;  1XMO Q;  3S1Q H;  4AH6 A;  2ZTD A;  1EIF A;  5IWA L;  3IRB A;  2VY3 A;  3KF6 A;  4LUZ A;  1XPR A;  5IYD H;  5M5W H;  4JOI C;  4JI7 Q;  1N33 Q;  4H02 A;  2I5L X;  3EBE A;  1I6H H;  3I7F A;  4MZ9 A;  4A3B G;  4JBK A;  3OW2 A;  3CW2 C;  3CXC A;  1ASZ A;  3RN5 A;  4A93 H;  3E9I A;  2NVY H;  4MTN A;  4YCW A;  3HOX H;  5M3F H;  2K5H A;  2Q2U A;  1EQQ A;  2JQO A;  1PH2 A;  2CQO A;  4HJ9 A;  5HGQ A;  3T1Y Q;  2BA1 A;  1AH9 A;  4DV6 Q;  2N78 A;  3HOU H;  3H0G G;  2JE6 I;  3PO3 H;  4B3S L;  2VNU D;  1QZH A;  1X65 A;  3G6E A;  2BH2 A;  3CF5 A;  2F4V Q;  1GD7 A;  4JV5 Q;  3Q8D A;  2UUA Q;  2ZJR A;  1D7Q A;  2K5N A;  2JA9 A;  2R7F A;  1G6P A;  1YHB A;  1U5K A;  2ID0 A;  2RHS B;  1VQA A;  5JEA G;  1JJC B;  2BA0 A;  3FKI H;  4UY8 C;  4A3L H;  4DAY B;  1AE2 A;  2D0P A;  3H15 A;  1OTC A;  4A3L G;  1JMC A;  4ME3 A;  4LFA Q;  4DR2 Q;  5IE8 A;  3KLW A;  4GN4 B;  2JA8 G;  2PMZ E;  1FL0 A;  3KF6 B;  4OX9 Q;  5ELO A;  1VQ7 A;  3J81 c;  4YCV A;  3B6Y A;  5IYC H;  3RN2 A;  3KJO A;  1FJG L;  4A3D H;  5C0X I;  2R6G A;  2N49 A;  4GKJ L;  1IZ6 A;  4NXM L;  4L5T A;  3J80 c;  1HR0 Q;  3S2D H;  4GNX C;  2B63 G;  1SLJ A;  5IY0 A;  2R92 H;  2AWO A;  4DUY Q;  4GOP C;  3VDY A;  4A3K H;  4A75 A;  4NXM Q;  3HOW G;  3KYH C;  3CCV A;  4KI0 A;  1XNQ Q;  5LMU Q;  1OXX K;  5FJ8 G;  1NJI C;  3CC4 A;  1YI2 A;  1UE5 A;  1EWI A;  5C44 H;  2NVX H;  1TXY A;  4DK6 C;  4X65 Q;  1WFQ A;  1WCM H;  1CKN B;  3G4S A;  3CCU A;  1QVG A;  3HKZ E;  1V1Q A;  3F8T A;  2IX0 A;  3K7A H;  5LMN Q;  1YJ9 A;  2NVQ H;  1Q1B A;  2HHH Q;  1T9H A;  4GLA C;  3FKI G;  4A3D G;  1XPO A;  3UE1 A;  1YIT A;  1NMF A;  1XMO L;  4GLX A;  2JA7 G;  3CCQ A;  1W2B A;  2ATW A;  3PCO B;  1SR3 A;  3GTL H;  3L0O A;  3I4M H;  1WI5 A;  1PV4 A;  1PYB A;  1XNR L;  2AKW B;  1LYL A;  4JI3 Q;  4JYA L;  4OO1 G;  5JJI A;  1N34 L;  2FXQ A;  2KCM A;  1IL2 A;  2HQL A;  4TVA B;  1VQE A;  3RNU A;  1JJG A;  3L2P A;  4JI3 L;  4A3F G;  1X56 A;  2I5M X;  5AJ3 L;  4DV4 L;  3W1B A;  2NVT H;  1I94 Q;  1NTG A;  1OXU A;  1A8V A;  3A0J A;  1YBY A;  3BZK A;  2QA4 A;  4QIW E;  5HY6 A;  4BY7 G;  5GAG C;  2V1C C;  4IJL A;  3TS0 A;  1PH8 A;  4GKK L;  3BJU A;  4DV2 L;  4A93 G;  1N32 L;  2OTL A;  4OWX B;  4HJ7 A;  1Y1V G;  3D31 A;  1VQ6 A;  4YWM A;  2VUM G;  3K80 C;  1Q81 C;  4OX9 L;  3STB C;  4FDB A;  4UP7 A;  2F52 A;  4R1J A;  1GM5 A;  4LF6 L;  1UEB A;  1PH3 A;  1KXL A;  3G48 A;  4C3I H;  1S72 A;  2WP8 J;  1IBM L;  2UUB Q;  4O2D A;  1C0A A;  1VQF A;  4L5Q A;  4L5R C;  3S16 H;  3UDG A;  4DR5 L;  4NB3 A;  3ICE A;  5ELN A;  2JEB I;  2UUA L;  1YEZ A;  3HOW H;  1K0R A;  4JI4 Q;  1M1K C;  1HZ9 A;  3OYY A;  1BKB A;  4LF9 L;  3UDX A;  1UE6 A;  1VCI A;  4LF8 L;  2R7Z H;  4JI0 L;  1L1O B;  4MNO A;  5AJ3 Q;  3J81 j;  4DV4 Q;  2Q2T A;  4A3C H;  4ALP A;  2ZTC A;  3E9H A;  4DV6 L;  2E2H H;  4BY1 H;  3H3V H;  3GD7 A;  3AQQ A;  1HNX L;  2K5V A;  3MXN B;  3J80 i;  5IYC G;  1B8A A;  1EQR A;  2R7D A;  1X3F A;  2XTI A;  5JJK A;  1MKH A;  2YYZ A;  4JC0 A;  4LUO A;  3F2B A;  3HOZ G;  1PA6 A;  1EFW A;  5IYB G;  3S14 H;  1YJW A;  4JI7 L;  2A1A A;  4JV5 L;  4A3K G;  3RZO H;  2MFI A;  2UU9 Q;  4JBJ A;  2UXC L;  4BXX G;  5LMN L;  2LXJ A;  1Q8K A;  1WOC A;  1MJE A;  4JYA Q;  4B3R L;  4PG3 A;  4DR3 Q;  3U50 C;  4LF5 Q;  4JI6 Q;  1BBW A;  1IXR A;  1HNZ Q;  4A4I A;  2IY5 B;  1E3P A;  3G71 A;  5E7N A;  2WB1 E;  3BU2 A;  4LFC L;  4JI1 L;  1BBU A;  4KHP L;  4PZ7 A;  4LF5 L;  4IPD A;  3GO5 A;  4HIM A;  2K50 A;  3T1H Q;  1SRO A;  4A3J G;  3HOZ H;  1VQM A;  2R93 G;  4C3J H;  3PUX A;  3RLN A;  5GAH C;  1IYJ B;  1YHQ A;  1I50 H;  2VL6 A;  3CCM A;  4KHZ A;  4GKJ Q;  4IFD J;  3LGJ A;  1B70 B;  1N9W A;  2QGQ A;  4QL5 A;  3M85 A;  1UE1 A;  3NBH B;  3PUV A;  4A3J H;  2HIV A;  3I56 A;  1XMQ L;  5IT9 c;  1IBK Q;  2CKZ B;  1VQK A;  2B29 A;  3D0F A;  3M4P A;  1QVC A;  4JI2 Q;  5IYD G;  5H1S E;  2I0Q A;  1XNR Q;  4OON A;  2R7Z G;  1EIY B;  4B3M Q;  1HNZ L;  1CSQ A;  2UXD L;  1I3Q H;  2OCE A;  1VS0 A;  3PSI A;  1PH9 A;  2JEA I;  4BY7 H;  1HZB A;  3EIV A;  2NZH A;  1L2F A;  1PH4 A;  4JI0 Q;  4DK3 C;  5M3F G;  5C3E H;  3CD6 A;  4JI5 Q;  3HOV G;  3T1H L;  3PUZ A;  4EX5 A;  4AIM A;  1VQC A;  4YCU A;  3I2Z A;  1TWC H;  4DV3 Q;  2OWO A;  4YWL A;  5C0X G;  3PIP A;  1PFS A;  1MIU A;  1P16 A;  1JB7 A;  2R93 H;  4KHP Q;  3CCE A;  4JI5 L;  4J15 A;  1VQJ A;  2E2I H;  1KL9 A;  4P71 A;  4HJA A;  5IP7 G;  2E5L Q;  1A63 A;  3S17 H;  5FLM G;  1KQS A;  3PUY A;  3UDF A;  4JI2 L;  1HNW L;  2D62 A;  1WJJ A;  4DR7 Q;  2YU9 H;  4DR6 L;  2YTY A;  3I55 A;  2UUC L;  2E5L L;  3DLL A;  2UXB Q;  2AWN A;  1J6Q A;  3CPW A;  1IBK L;  4A3M H;  4GN5 A;  4AYB E;  2E2J H;  1CSP A;  3ER0 A;  3W5O A;  1Q7Y C;  1EYG A;  4PMW A;  4DNI A;  4APV A;  1X3G A;  2GN5 A;  2PNH A;  3K8A A;  3PIO A;  4HJ8 A;  1K9M C;  4LF7 Q;  4POG A;  1JE5 A;  4B3T Q;  4YY3 L;  4R4O A;  4JI1 Q;  4LFC Q;  4OWW B;  3NEN A;  2A8V A;  2LSS A;  1V9P A;  1D8L A;  3CPF A;  3PUW A;  4PZ6 A;  5GRO A;  4X66 L;  2K4K A;  2UUB L;  2ZM6 L;  2CWP A;  4DUZ Q;  4IFD G;  5JJL A;  4LWC A;  1HR0 W;  4UP9 A;  1HNW Q;  4BBS G;  1RL2 A;  4XTC S;  2B63 H;  4LF6 Q;  5FLM H;  1XTD A;  1IBL Q;  2BH8 A;  3KDF B;  5IYB H;  5DLQ E;  4LNQ A;  2K75 A;  4JI4 L;  3CCS A;  4DV7 Q;  5FLX c;  4O0A A;  1GVP A;  4DR5 Q;  1Q46 A;  2Z6K A;  4X64 Q;  3AEV A;  3U4Z A;  4A3G H;  1OXS C;  3BZC A;  2HIX A;  4R4Q A;  1HNX Q;  1RIP A;  5M5Y H;  2F3I A;  5LMN W;  4DV1 L;  2AMC B;  2PI2 E;  4HIK A;  2R92 G;  3CCJ A;  4KLK A;  1PH7 A;  3JAM i;  4OWT B;  3S1N H;  3PGZ A;  3ZJY C;  2RHQ B;  4K0K L;  2WB1 G;  5K36 G;  3OTO L;  4P74 A;  1CKN A;  2WAQ E;  1Y1V H;  4IJH A;  3UE0 A;  2UXC Q;  2C35 B;  3GTM H;  4DR4 L;  4GNX B;  4DPG A;  4BXX H;  1VQO A;  3CCL A;  1Z47 A;  1YVC A;  4HID A;  3U4V A;  1SN8 A;  5BR8 L;  2ZJP A;  1C7Y A;  3HKZ G;  1EUJ A;  4B3T L;  4P73 A;  1E22 A;  4BBR H;  1VQ8 A;  4R4C A;  1UWV A;  3GTK H;  1H95 A;  3HOY G;  3KOJ A;  3CC7 A;  3RZD H;  3KDF A;  4AYB G;  3HFZ B;  2IX1 A;  3ULL A;  3AYH B;  5GAD C;  1VQL A;  1TWA H;  1VQN A;  5C4X H;  4DR3 L;  4JBW A;  1C9O A;  3K7U C;  2KEN A;  3GTG H;  1FGU A;  2MO1 A;  1NY4 A;  2JA6 G;  1JJ2 A;  2EIF A;  1P8L A;  3CAM A;  1VQG A;  3KF8 B;  5IWA Q;  4DR4 Q;  3GTO H;  2UUC Q;  2GVB A;  1A62 A;  2PI2 A;  1PH5 A;  1SFO H;  4GOP B;  2MNA A;  3TQY A;  3GTQ H;  4RG1 A;  1SMX A;  2Q2I A;  4IPG A;  5C44 G;  1PVO A;  2JA7 H;  1ASY A;  4L5S A;  4YY3 Q;  3PF5 A;  2NN6 G;  1X54 A;  1A0I A;  2EXD A;  3CME A;  1J5E L;  1B7Y B;  3S24 A;  5BR8 Q;  4HIO A;  1SE8 A;  1VQB A;  2PQA B;  1WYD A;  1QUQ B;  2N8N A;  3CQZ H;  4P72 A;  2JJQ A;  4BY1 G;  4BBR G;  1YZ6 A;  1LUZ A;  2ZTE A;  1HR0 L;  4LF9 Q;  4A3C G;  1HH2 P;  4JOI A;  1Q1E A;  1N36 L;  1L0W A;  1R9T H;  1L1O A;  1CKO A;  3J7Z C;  4DV2 Q;  4RMF A;  1YNX A;  4UPA A;  2AHO B;  5IP9 G;  1VQ9 A;  1FJG Q;  4PZ8 A;  2JA6 H;  1VQ4 A;  4WJ4 A;  5FJ8 H;  1X55 A;  1N36 Q;  4DV5 Q;  3HOY H;  5IP7 H;  1KHI A;  1BVS A;  1QUQ A;  3F1Z A;  1GKH A;  5LMU L;  4A3I H;  1Q12 A;  3H3V I;  4B3S Q;  3U58 A;  3PO2 H;  1U0L A;  2RCN A;  4DR2 L;  3K81 C;  1V43 A;  3AFP A;  1KRS A;  3HKS A;  1KIX A;  2Q2H A;  2JA5 G;  4IFD I;  2MO0 A;  1X3E A;  3J7A 5;  1CKM A;  4DV0 L;  3M4O H;  4JCV E;  4GLV B;  4OXP A;  4QJF A;  2RF4 A;  1HZA A;  3HOX G;  4X65 L;  1DGS A;  3PO3 G;  2CCZ A;  1VQP A;  1HZC A;  4K0K Q;  2YTV A;  2A19 A;  2F4V L;  3NEL A;  1Z9F A;  4DKA C;  3T1Y L;  2JA5 H;  3STB D;  2OQ0 A;  2WFW A;  4AQY L;  1TWG H;  4A3F H;  1N34 Q;  3M9B A;  4C2M H;  1QVF A;  4DR1 Q;  1WCM G;  2K14 A;  2CFM A;  2IT1 A;  2VS1 A;  2N3S A;  3HOV H;  4C3H H;  1XNQ L;  1G29 1;  3RLF A;  3ULJ A;  1XPU A;  5GQO A;  4JBM A;  5C0X J;  4A3G G;  3OTO Q;  4X62 L;  4LW1 A;  2MQH A;  1UE7 A;  2YTX A;  3M3Y H;  4A76 A;  2Y0S G;  4GNX A;  5IP9 H;  4DR6 Q;  3HOU G;  1QZG A;  4A3B H;  1X9N A;  5JEA J;  3F2D A;  3I4O A;  3M4Q A;  4GOP A;  1I94 L;  2HHH L;  2UXB L;  1PH1 A;  1X6O A;  4LFA L;  2KHI A;  3FP9 A;  1G51 A;  2HT1 A;  4YHH Q;  4X66 Q;  4NPS A;  2E8G A;  5C4X G;  1HJP A;  3JC6 6;  1OXV A;  3A5Z B;  4JG2 A;  4XIG S;  4BA1 I;  2QEX A;  1VQ5 A;  1OXT A;  2Z0S A;  4Y7N H;  1KD1 C;  3PF4 A;  4LFB L;  1YHA A;  4TQU S;  1I5F A;  1K8G A;  2PQA A;  4GN3 B;  4BBS H;  1N8R C;  4UP8 A;  3J81 i;  2XGT A;  3EN2 A;  4NXN L;  3JAM c;  2VQE L;  3CCR A;  1IBL L;  2VQE Q;  4DV3 L;  4A3M G;  4IOA A;  1SRU A;  3PV0 A;  4JI6 L;  1K3R A;  2VQF Q;  4DV7 L;  2UXD Q;  1PH6 A;  4DAM A;  4DR7 L;  1E1T A;  3FHW A;  2KHJ A;  4X64 L;  2H5X A;  1AE3 A;  1E7Z A;  4IOC A;  1CUK A;  1Q86 C;  3I4N H;  1VQI A;  1KC8 C;  2ZM6 Q;  2KBN A;  1NE3 A;  2JK8 A;  4LF4 L;  3KJP A;  2JA8 H;  3L7Z C;  5C3E G;  3F2C A;  1N32 Q;  1L1O C;  3DM3 A;  4P75 A;  2GVA A;  3A5U A;  2ALY B;  4DUY L;  3M7N A;  4LFB Q;  5M3M G;  4LF4 Q;  1E24 A;  2VZA A;  2DUD A;  4EQ5 A;  2UU9 L;  1K83 H;  3NEM A;  2OQK A;  2KCT A;  5EAY A;  3GTJ H;  3S2H H;  4QGU A;  3W1G A;  4BA2 I;  2ES2 A;  1YIJ A;  1N33 L;  3WWV A;  2IHF A;  1S3O A;  3RR5 A;  5J3B A;  2NN6 I;  3GDE A;  3CC2 A;  3TRZ A;  4B3M L;  2VQF L;  3AFQ A;  4LUV A;  5GAE C;  3UDI A;  2Y0S E;  3K0X A;  2LXK A;  4POF A;  1Y1W H;  3S15 H;  3S1M H;  4OO1 I;  3H0G H;  1YJN A;  1TWF H;  4YWK A;  1K8A C;  4DV1 Q;  4LF7 L;  3ULP A;  2IHE A;  3RLO A;  1W3S A;  4X6A H;  1Y1W G;  3ERS X;  4HJ5 A;  4IO9 A;  4WJ3 M;  1S40 A;  1JT8 A;  4R4T A;  1M90 C;  1TWH H;  1E1O A;  4GS3 A;  4DV0 Q;  1K73 C;  4A3E G;  3CP0 A;  4JI8 L;  2NZO A;  1LM0 A;  1MJC A;  3I4N G;  3KFU A;  3PO2 G;  4YHH L;  2ZJQ A;  4QY7 A;  4IPC A;  1NMG A;  4Y52 H; 
#chains in the Genus database with same CATH topology
 2KEE A;  1JC7 A;  1KAW A;  3I4M G;  2A68 C;  1E0B A;  3S1R H;  1MBY A;  3A74 A;  3D4R A;  2I07 B;  1FVI A;  1HA5 A;  4B3R Q;  2LS0 1;  2OTJ A;  2IW3 A;  1B53 A;  3GTP H;  1Y8N B;  3SR1 A;  3MEF A;  5A2Q E;  4DFA A;  4A3E H;  2K28 A;  1B3A A;  4DR1 L;  2PZT A;  3F2U A;  1D6E C;  1KAA A;  3I90 A;  4QQB X;  2EZV A;  1I3Q B;  2D0O A;  1XMO Q;  3EVQ A;  5EBD A;  1F9S A;  4HR7 B;  4LUZ A;  3K0Y A;  4HED A;  5M5W H;  1PFB A;  4MZ9 A;  1B9M A;  3ND8 A;  3CW2 C;  4HN7 A;  1ASZ A;  3RN5 A;  3FPP A;  4YCW A;  1HFG A;  5JPN C;  5M3F H;  2K5H A;  5EBC A;  2Q2U A;  1AH9 A;  4DV6 Q;  2N78 A;  2YU9 B;  1GXD C;  4E6I A;  2JE6 I;  5M3M B;  2FIN B;  1QZH A;  1X65 A;  1GD7 A;  4JK1 C;  2UUA Q;  2B2T A;  2ZJR A;  2K5N A;  2R7F A;  3BVG A;  1VQA A;  1JJC B;  3BDC A;  4KD3 A;  1S5D D;  1HUM A;  2K05 A;  2XWB B;  1AE2 A;  1OO9 B;  3H15 A;  1OTC A;  2JA8 G;  2PMZ E;  2AQ2 B;  1UNS A;  2AUJ D;  1HHV A;  2J7Z A;  2R6G A;  4HTH A;  4BS9 A;  4L5T A;  2PPB C;  3I73 A;  3IL8 A;  4A3I B;  2NVY B;  3OW7 A;  5CYU A;  2AWO A;  4A3K H;  3RMH A;  5CV9 A;  1SYE A;  3KUP A;  3J80 L;  2B2Y C;  3ND9 A;  2B2W C;  2HD3 A;  2E75 C;  4LAA A;  4XYQ A;  2KCC A;  5T1I A;  3S9W A;  1TXY A;  1IL8 A;  1CKN B;  1LAB A;  4KJO A;  1V1Q A;  3HKZ E;  3CCU A;  5CV5 A;  5LMN Q;  1AZP A;  1EOT A;  2NVQ H;  4AYB B;  2JSO A;  3DWA A;  1T9H A;  4GLA C;  4QF4 A;  1X3Q A;  1NMF A;  4GLX A;  3CCQ A;  2HUG A;  5FLX E;  3E3X A;  3GP7 A;  3PCO B;  1K3B C;  4EQP A;  4FF4 A;  3L0O A;  3MXN A;  3OMC A;  1EEI D;  2G9D A;  2AKW B;  1LYL A;  4JI3 Q;  1XNR L;  3CRL C;  1ESF A;  1IL2 A;  1V1P B;  1MSG A;  5HUR A;  4JI3 L;  3K57 A;  1X56 A;  2VNU D;  2NVT H;  5IGB A;  1NTG A;  3A0J A;  2QA4 A;  1YBY A;  5C44 B;  2NVX B;  1SDF A;  4BY7 G;  5GAG C;  4IJL A;  3MAQ A;  3TS0 A;  2MUY A;  2OTL A;  4ZLT F;  2QCP X;  1RTO A;  3R2T A;  4OHJ A;  3BYY B;  1ZKO A;  1EU4 A;  4KY5 A;  4F88 A;  4LF6 L;  4KKS A;  1TS2 A;  1PH3 A;  4C3I H;  1IBM L;  2WP8 J;  1FGB D;  2B2W A;  1VQF A;  5ELF A;  1SJH D;  3S16 H;  4DR5 L;  4NB3 A;  5ELN A;  2EY2 A;  1QOH A;  5D3I B;  1PLF A;  4OL7 A;  4LF8 L;  1STG A;  1L1O B;  5AJ3 Q;  3J81 j;  4A3C H;  4DV6 L;  2E2H H;  5BN3 A;  2VB2 X;  1JR0 D;  3AQQ A;  5IYC G;  1EQR A;  1Q3L A;  1SYC A;  5EKK A;  2XTI A;  1MKH A;  4IUP A;  1B1Z A;  2Z8L A;  4QUC A;  4ZYS A;  1YJW A;  1RDP D;  4JI7 L;  4A3K G;  3RZO H;  2XRS D;  5HGT A;  2A5H A;  4JBJ A;  5ELC A;  1SYB A;  1WOC A;  1FNV A;  2N88 A;  4ZAI A;  2O5J C;  4N9P A;  3HOX B;  4LF5 Q;  1BDO A;  2IY5 B;  2CW0 D;  4FP5 D;  4JI1 L;  1WTV A;  4NP5 A;  4KHP L;  1SBB B;  3E6Z X;  2JA7 B;  4LMQ D;  1PZI D;  4HIM A;  1PMR A;  5C5L A;  4U68 A;  1BUV T;  4KHZ A;  4FNF A;  4R8I A;  1CZW A;  4WRD A;  1PTO C;  4ILW A;  1QWY A;  2XWJ B;  1WD1 A;  2B29 A;  4B3M Q;  1CSQ A;  1F2Y A;  1FNU A;  3VYU A;  1EWC A;  3M7G A;  2UXD L;  1I3Q H;  1VS0 A;  3BVM A;  4MN3 A;  3S17 B;  4JI0 Q;  4DK3 C;  3BZD B;  5M3F G;  1XX8 A;  4JI5 Q;  4YCU A;  1SNM A;  3QB3 A;  1PFS A;  2J0T D;  3VA7 A;  4JI5 L;  4J15 A;  1ZXT A;  5FO8 B;  2E2I H;  1KL9 A;  2E2D C;  1HXY D;  1QG7 A;  4JI2 L;  5L37 A;  4DR6 L;  2UUC L;  5EJW A;  5EGT A;  1V8Q A;  4GN5 A;  3NQT A;  1CSP A;  2GN5 A;  2PNH A;  4HJ8 A;  1Y1W B;  3P7J A;  3SDZ A;  4POG A;  3SK6 A;  4YY3 L;  1T5E A;  3NEN A;  5IOC A;  5COY A;  2LSS A;  4RCO A;  3NWT A;  5JJL A;  2F4I A;  4ZQ3 A;  2NZ1 D;  4DUZ Q;  2XNA C;  4M8A A;  4UP9 A;  1HNW Q;  5EPK A;  5FLM H;  1IBL Q;  2K75 A;  4JI4 L;  2E2I B;  1TWA B;  1EY9 A;  1GVP A;  2R3Z A;  4OIK A;  4X64 Q;  3NK9 A;  4M1U B;  2HIX A;  4IUU A;  1Y1V B;  5M5Y H;  3T53 B;  2PI2 E;  2NTT A;  3MXG A;  1EWH A;  3NXW A;  2SNS A;  1T5X D;  1XWE A;  1CKN A;  3TSS A;  2C35 B;  1CA6 A;  2EPB A;  2ICI A;  1YVC A;  4YIJ A;  3I70 A;  3QIA A;  1CHQ D;  4B3T L;  2SOB A;  1LTG D;  3H91 A;  4A3B B;  2LMC B;  2WII B;  4BBR H;  3KK7 A;  4OEM B;  1UWV A;  3HOY G;  2NN6 H;  4G4K A;  1E2W A;  3KDF A;  3K5M A;  3LX0 A;  5C4X H;  2HCI A;  5CV8 A;  5ELE A;  3GTG H;  2XVS A;  1NY4 A;  4Q5V A;  2EIF A;  3CAM A;  2A6E C;  4DR4 Q;  1BQQ T;  1Y69 U;  1NNX A;  5I2Y A;  4GOP B;  4A3M B;  1A3U A;  2DY8 A;  1SMX A;  2DN8 A;  2Q2I A;  3S2D B;  4CDC C;  2JA7 H;  3OIQ A;  1D2B A;  3PF5 A;  2EXD A;  4FO2 A;  1J5E L;  1BR9 A;  1SE8 A;  2VQE L;  1WYD A;  1QUQ B;  2EYH A;  5JVG 3;  1YZ6 A;  1HR0 L;  1ET9 A;  2EYP A;  1HH2 P;  5KNB A;  1G2T A;  1L0W A;  1CKO A;  3A8I E;  5JEA H;  3J7Z C;  1GHK A;  3K59 A;  4UPA A;  5IP9 G;  1FJG Q;  4K6D A;  4KK7 A;  4H0L C;  2KOL A;  1KHI A;  5COR A;  5LMU L;  4A3I H;  1EIH A;  2L0C A;  2P5Z X;  3K81 C;  1V43 A;  3AFP A;  1KIX A;  2Z9H A;  2NYZ D;  1KNA A;  3HP3 A;  1F77 A;  4DV0 L;  3M4O H;  2OXP A;  3SVM A;  1TKW B;  4KY7 A;  3K58 A;  1HZC A;  4K0K Q;  3NEL A;  1Z9F A;  3T1Y L;  5I9P A;  3STB D;  1TWG H;  4A3F H;  2WIN B;  3M9B A;  5CC4 A;  1QVF A;  1SNQ A;  2ICE C;  1D5Z C;  2IT1 A;  3VR5 A;  1MD2 D;  2VS1 A;  2BOS A;  3URY A;  3HOV H;  1A2T A;  1G29 1;  3L9A X;  1XPU A;  3D6W A;  1SNP A;  1UE7 A;  2YTX A;  2V4D A;  5IP9 H;  4QMG A;  1X9N A;  3F2D A;  3I4O A;  1I94 L;  3V96 A;  5CBA E;  2KHI A;  4OGQ C;  4RGM A;  2HT1 A;  3K5N A;  1FYC A;  5C4X G;  1OXV A;  4JG2 A;  2L1B A;  4XIG S;  2QEX A;  1VQ5 A;  1A3V A;  1II3 A;  3JAM L;  3PF4 A;  4LFB L;  2F0S A;  1YHA A;  1D1I A;  2F0N A;  4HSV A;  1YNJ C;  4NMZ A;  5IGD A;  4A3K B;  1PRT D;  4UP8 A;  2XGT A;  3JAM c;  2JXM B;  3CCR A;  3P75 A;  4DV7 L;  2HQE A;  4KN7 C;  5C3W A;  2H5X A;  1Q86 C;  1JWU D;  2NB0 A;  4K6L A;  3CQZ B;  3T13 A;  2VUM B;  1Z6H A;  1L1O C;  4IUQ A;  2ALY B;  5M3M G;  4RGN A;  3J7A F;  4X3S A;  2UU9 L;  1K83 H;  5EAY A;  2OQK A;  2L55 A;  3K6O A;  1G2S A;  4KKU A;  2IHF A;  5EKI A;  5J3B A;  5CV6 A;  3GV6 A;  3QO2 A;  1LTA D;  2Y0S E;  4POF A;  2LXK A;  1STY A;  2KCN A;  5I6Y A;  4OO1 I;  1HQR D;  4DV1 Q;  1G8Z D;  2JN4 A;  3ULP A;  4BWG B;  1JT8 A;  4IO9 A;  4WJ3 M;  3ZYY X;  1M90 C;  1TWH H;  1E1O A;  1RKN A;  2OF1 A;  1LM0 A;  2PCF B;  3PQI A;  2FHT A;  2B2T C;  3K5O A;  4IPC A;  1NMG A;  4QY7 A;  2PYK A;  4PQX A;  2ASB A;  1B9N A;  1EY6 A;  2YV5 A;  3TEH B;  1K0S A;  1LTL A;  1Q8I A;  2L12 A;  5C4J H;  4R4I A;  5BN4 A;  5M3M H;  4DA2 A;  3E0J A;  1XJV A;  2M00 A;  3CMA A;  3C3L A;  2BE5 C;  1KRT A;  2XSC A;  4BY1 B;  4X62 Q;  4G7O C;  2H4O A;  1NBW A;  4RWS C;  5M5X H;  3TRE A;  4JW0 A;  3DEP A;  2QDB A;  1JE4 A;  4XT3 B;  1KNE A;  1VQD A;  4IUV A;  3EFX D;  2K52 A;  3T51 B;  4NXN Q;  3J80 E;  2O5I C;  4H02 A;  4XDX A;  3EBE A;  3CKI B;  3I7F A;  1SJE D;  1SYG A;  4CDE C;  3OW2 A;  2PZW A;  3C1E A;  2JYO A;  1SAP A;  1CTM A;  2NVY H;  4MTN A;  4G7Z C;  1KLU D;  1GJX A;  1TS3 A;  2BA1 A;  1UAP A;  3CF5 A;  1CA5 A;  4WJW A;  3J7Y W;  2B2U A;  1QNU A;  3Q6S A;  3OPO A;  1G6P A;  3FVQ A;  2RHS B;  5JEA G;  4OO1 H;  1BNZ A;  2CH4 W;  4G57 A;  1JMC A;  4ME3 A;  3KLW A;  3E5S A;  3OMG A;  3KF6 B;  1NCV A;  5IYC H;  3RN2 A;  1TQO A;  1RF2 D;  1TWF B;  1LTI D;  1DM0 B;  3LNN A;  4UAI A;  3J80 c;  1HR0 Q;  2B63 G;  4DUY Q;  3VDY A;  4NXM Q;  4A75 A;  1MGS A;  1W6K A;  3ONA B;  3OSO A;  3BDO A;  1SMY D;  5KRU A;  5LMU Q;  1OXX K;  1ENF A;  3CC4 A;  1QIL A;  1BCP F;  1EWI A;  4K2K A;  1V1P A;  4X65 Q;  3NTI A;  1WCM H;  1QVG A;  2IX0 A;  3K7A H;  1NUC A;  3RUZ A;  2OEO A;  2F0M A;  3FKI G;  4A3D G;  3HGB A;  2JA7 G;  4A3J B;  4QCL A;  3H09 A;  1W2B A;  3GTL H;  2L5T A;  1F9R A;  4JYA L;  1YNN D;  1WTH A;  3RNU A;  3L2P A;  1BXT A;  2F0I A;  2I5M X;  3W1B A;  5C5M A;  1GUS A;  3PIP 3;  3D4D A;  5HY6 A;  4GKK L;  3BJU A;  1N32 L;  4MHE A;  3HEJ A;  4A93 B;  1DZ1 A;  1FD7 D;  3RZO B;  2F0O A;  2M2L A;  4JVZ A;  3K80 C;  1A2U A;  4KN4 C;  1I4P A;  2F0T A;  4UP7 A;  1I4H A;  3M3Y B;  1M4V A;  1UEB A;  3MEH A;  3P20 A;  2UUB Q;  3Q23 A;  4O2D A;  2X6L A;  1I4R A;  1AN8 A;  1QB5 D;  3MWY W;  1KAB A;  3SHL A;  3ICE A;  2WAC A;  2UUA L;  1RJT A;  1EIG A;  1CM9 A;  1CZG A;  1VCI A;  2R7Z H;  2F3V A;  4JI0 L;  2Q2T A;  2F1M A;  3ERQ A;  4ALP A;  2ZTC A;  5D14 A;  3GD7 A;  4A3E B;  5JAV A;  1HNX L;  2K5V A;  3J80 i;  4A3D B;  1X3F A;  4EGV A;  3SXH A;  5JJK A;  4B08 A;  2F0J A;  3F2B A;  3HOZ G;  1IW7 D;  2MGS A;  1B50 A;  3DUZ A;  1PA6 A;  1EYD A;  3SK4 A;  4A3G B;  2UU9 Q;  2EYL A;  3TBI B;  4ME5 A;  4A3F B;  2CVR A;  1VMC A;  1C48 A;  2IJ0 A;  4PG3 A;  3WDN A;  4QUF A;  1BBW A;  3QJY A;  1E3P A;  2B2U C;  2WB1 E;  3BU2 A;  5E7N A;  5C6A A;  1S4Z A;  4PZ7 A;  3A7A B;  3PO3 B;  1WD0 A;  1PFM A;  1ET6 A;  3TP8 A;  4MIU A;  5ELB A;  5E3F A;  5GAH C;  3EQL C;  2VL6 A;  3MZ5 A;  3CCM A;  4GKJ Q;  3LGJ A;  4QL5 A;  4DXG A;  3PUV A;  2HIV A;  1IBK Q;  1ICF B;  4V19 0;  5LL6 S;  2IL8 A;  3D0F A;  1NR2 A;  5IYD G;  1XNR Q;  2I0Q A;  4QB4 A;  1HNZ L;  3IAY A;  1GUN A;  2EDG A;  2F0V A;  2JEA I;  1O7L A;  3PSI A;  2L11 A;  2A6H C;  1DYQ A;  5C3E H;  3CD6 A;  3HOV G;  4EX5 A;  3I2Z A;  1TWC H;  2FFK B;  5C0X G;  4O1N A;  3A56 A;  3PIP A;  1P16 A;  3C2P A;  2R93 H;  4FXD A;  3D6C A;  4KHP Q;  3CCE A;  2CHB D;  4P71 A;  4HJA A;  5IP7 G;  1PRT B;  1JOO A;  4MTK A;  1HNW L;  1DOM A;  2D62 A;  4C3J G;  2UXB Q;  2AWN A;  1J6Q A;  2F0P A;  3CPW A;  1IBK L;  4A3M H;  3HOU B;  2K04 A;  2E2J H;  3W5O A;  1SEB D;  4APV A;  3K8A A;  1K9M C;  4LF7 Q;  2FJ2 A;  3KBG A;  4R4O A;  4LFC Q;  2A8V A;  4CJ1 B;  1FR3 A;  3PUW A;  5GRO A;  4KKT A;  4LWC A;  5IYB H;  4LNQ A;  3OWE B;  5D3D A;  1PTO D;  1K28 A;  4PNY A;  4O0A A;  3TP6 A;  5IGG A;  1ONL A;  2Z6K A;  2DNC A;  4A3G H;  1NAP A;  2Q8T A;  2N55 A;  5NUC A;  2DNE A;  5M9O A;  1B44 D;  1E2V A;  3JAM i;  2O4X A;  3S1N H;  1WCM B;  5K36 G;  2E74 C;  3OTO L;  1HA6 A;  1TWG B;  3TDQ A;  4IJH A;  5J1Z A;  3UE0 A;  4DR4 L;  4DPG A;  1VQO A;  4C3I G;  1Z47 A;  5BR8 L;  2TSS A;  4X3K A;  4R4C A;  1H95 A;  3KOJ A;  1F2M A;  3CC7 A;  3RZD H;  2PW5 A;  3TN2 A;  2IX1 A;  3ULL A;  1VQL A;  1LAC A;  5CV7 A;  1C9O A;  1S5B D;  3K7U C;  1SFO B;  1SYD A;  1NR4 A;  5CGK A;  2JA6 G;  1JJ2 A;  1P8L A;  1HTP A;  2Z6B A;  3KLS X;  1SNC A;  1A62 A;  1VDZ A;  1PH5 A;  4KD4 A;  1SFO H;  3TQY A;  2EJF C;  1D5X C;  1RHP A;  4L5S A;  2I46 A;  1A0I A;  3CME A;  1B7Y B;  1Q81 C;  2WV6 D;  3I4N B;  1H9S A;  1YNX A;  2JA6 H;  4F7X A;  4PV1 C;  1LT5 D;  1X55 A;  5FJ8 H;  1A6X A;  1XXG A;  5IP7 H;  1BVS A;  1QUQ A;  1Q12 A;  2D5D A;  2D9U A;  1D1K A;  3PO2 H;  5EPL A;  3HG9 A;  4IFD I;  1HCZ A;  3A54 A;  4XXE A;  4X65 L;  2CCZ A;  1VQP A;  2A19 A;  2F4V L;  3KBX A;  2VB3 X;  3G6J B;  2A74 C;  3PMF A;  2OQ0 A;  2WFW A;  2JA5 H;  2QEJ C;  1N34 Q;  2CFM A;  3BYT B;  4C3H H;  4RFB A;  3RLF A;  3H6M A;  5C0X J;  4A3G G;  2MQH A;  4DR6 Q;  2Y0S G;  3MXU A;  3M4Q A;  1IYU A;  4BBR B;  4LFA L;  4K5X A;  1X3P A;  2EE1 A;  4IUR A;  1AW7 A;  1G51 A;  1BCP B;  4X66 Q;  1IW7 C;  2PMZ B;  1SXT A;  3A5Z B;  5M5W B;  1DJR D;  4RKB A;  1HFN A;  2ZXO A;  3EJI A;  4Y7N H;  1GUT A;  1KD1 C;  4TQU S;  4O42 A;  4XYO A;  1GUO A;  5JVH 3;  5E4X A;  2QDL A;  2JP1 A;  2MJ8 A;  1N8R C;  1TWC B;  5D65 A;  1O78 A;  1IBL L;  4DV3 L;  4A3M G;  4KJN A;  4JI6 L;  4DAM A;  5CV4 A;  5KND A;  2GA4 B;  3G7L A;  1J9O A;  1AE3 A;  1E7Z A;  2NBF A;  4IOC A;  1G91 A;  1VQI A;  4LF4 L;  2KBN A;  1NE3 A;  2JK8 A;  3KJP A;  2JA8 H;  3L7Z C;  3A5U A;  4CJ2 C;  4C3H G;  5T1G A;  4LF4 Q;  3NEM A;  1W6J A;  1UEA B;  4I65 A;  4QGU A;  4EQO A;  1R9T B;  4DU9 A;  3WWV A;  1H9R A;  2NN6 I;  1JQY D;  2VQF L;  3AFQ A;  1Y1W H;  4KTA A;  1EY8 A;  2LKV A;  3ERS X;  1S40 A;  4R4T A;  4DV0 Q;  1AP0 A;  3NSW A;  1MJC A;  5I2X A;  3PO2 G;  2H1E A;  2NUC A;  2ZJQ A;  4FYD A;  4L6T B;  3A55 A;  3QR8 A;  4IZ8 A;  4Z9C B;  3GTJ B;  1EOV A;  1H9M A;  1Q82 C;  4RGO S;  2LFN A;  3E0E A;  1DXM A;  4DUZ L;  1H9J A;  2VW9 A;  4HSP A;  4LF8 Q;  3HKZ B;  2C5C A;  4RH6 A;  2F0K A;  1UUP A;  1GO3 E;  4JI8 Q;  1J5E Q;  1VQH A;  2F3W A;  3NHH A;  1DOL A;  2DJG C;  2KQ3 A;  3FKI B;  4CDD C;  1IBM Q;  1I6H B;  2I5H A;  1Y14 B;  1PHJ A;  2WAQ G;  1SSO A;  2EJM A;  2F0E A;  3BS1 A;  2E2J B;  2WKD A;  3QG1 A;  2EQS A;  3KLR A;  4QIW B;  5CBE E;  1E2Z A;  2VY3 A;  1GHJ A;  3KF8 A;  4JOI C;  1N33 Q;  3NWS A;  2I5L X;  1I6H H;  2EYM A;  4HCE A;  4JBK A;  3OWF A;  3CXC A;  4C1N I;  4A93 H;  2RDG A;  3Q0A A;  3NQI A;  1I4X A;  2JQO A;  1RTN A;  4RA8 A;  5I6W A;  1LT4 D;  2K5W A;  2RVL A;  5IT9 L;  3HOU H;  3PO3 H;  2X6G A;  4NDX A;  3Q8D A;  5FO9 B;  5K36 H;  2K5D A;  2JA9 A;  1O7Z A;  1U5K A;  4IQZ A;  4OIJ A;  2BA0 A;  2G5D A;  2E2H B;  2R7Z B;  3SE0 A;  4UY8 C;  4A3L H;  2D0P A;  3K7A B;  1FL0 A;  5ELO A;  2BE5 D;  4V0B A;  3GTM B;  1VQ7 A;  3A8J E;  3KJO A;  4GKJ L;  4NXM L;  2MHV A;  3S2D H;  4IUT A;  3GTK B;  1DCZ A;  1SLJ A;  3T4A C;  5IY0 A;  2R92 H;  4BBS B;  4GOP C;  3S1R B;  3HOW G;  1LLR D;  3CCV A;  1SYF A;  5LL6 X;  1NJI C;  4CKC A;  3WOF A;  2JA8 B;  5C4J B;  2MPM A;  4B3T Q;  3G4S A;  3F8T A;  1YJ9 A;  1Q1B A;  2HHH Q;  1RD9 D;  3UE1 A;  3GTQ B;  1CK1 A;  1YIT A;  1XMO L;  1TU2 B;  1JWM D;  4ZUI A;  2EY5 A;  2KVM A;  1EL0 A;  1F9P A;  3I4M H;  3HRZ C;  1WI5 A;  1PV4 A;  3FDT A;  3VR3 A;  1PZJ D;  1HQM C;  2VXW A;  5JJI A;  1N34 L;  4RGT A;  2HQL A;  1JJG A;  2KA7 A;  4A3F G;  4DV4 L;  3MFY A;  1L0X B;  3IKJ A;  1A8V A;  4I7A A;  3BZK A;  2Y0S B;  2AUK A;  2V1C C;  1PH8 A;  4A93 G;  5K5P A;  1H9S B;  3X3M A;  1VQ6 A;  3D31 A;  2VUM G;  1EZ6 A;  4OX9 L;  3S14 B;  1A15 A;  4FDB A;  4R1J A;  1B3Q A;  1KXL A;  3G48 A;  1MSH A;  2FMC A;  1LTS D;  5E1F A;  4L5Q A;  1C0A A;  3UDG A;  5KYL A;  2EOT A;  2JEB I;  1YEZ A;  2HCC A;  5FO7 B;  1SMY C;  1K0R A;  1HZ9 A;  3V2T A;  3OYY A;  1BKB A;  2EVB A;  2AQ3 B;  5M5X B;  1S5E D;  1UE6 A;  3UDX A;  4MNO A;  2BDO A;  3E9H A;  2LY7 A;  2XRQ D;  1EQT A;  5I4D A;  4ABN A;  1CHP D;  2R7D A;  3HOZ B;  2RSN A;  4LUO A;  2YYZ A;  4JC0 A;  3S1Q B;  4U67 3;  2CW0 C;  4RAU C;  1EFW A;  3S14 H;  4JV5 L;  3OOC A;  1PTO H;  2LXJ A;  1MJE A;  5DNF A;  1VMP A;  1WTQ A;  3U50 C;  4JI6 Q;  1IXR A;  1HNZ Q;  1LTB D;  3G71 A;  1DOK A;  4LFC L;  3HOV B;  1BBU A;  2KEC A;  5JPM C;  3IFD A;  4IPD A;  3S1N B;  4PMB A;  4A3J G;  1BO0 A;  1VQM A;  2BDN A;  3RLN A;  1IYJ B;  1I50 H;  3I4M B;  4IFD J;  1N9W A;  3M85 A;  2QGQ A;  1GOZ A;  1UE1 A;  1XMQ L;  5IT9 c;  2CKZ B;  4H13 C;  1VQK A;  2RQX A;  3M4P A;  5LHY 1;  1QVC A;  4JI2 Q;  3M4O B;  4OON A;  4PMC A;  4RHS A;  1MI2 A;  4TSS A;  1PH9 A;  4DGZ A;  1HZB A;  3EIV A;  2NZH A;  5KGU A;  1L2F A;  3SEB A;  1XTC D;  3T1H L;  1WTO A;  2OWO A;  4YWL A;  5C3X A;  5FLX L;  1PXU A;  2A68 D;  2WB1 B;  1VQJ A;  1LO5 D;  1A63 A;  4CJ0 B;  3S17 H;  5FLM G;  3PUY A;  3UDF A;  3S16 B;  1EY0 A;  2YTY A;  3I55 A;  3M4Y A;  3DLL A;  2IWH A;  4AYB E;  1Q7Y C;  4DNI A;  1X3G A;  2L4N A;  3PIO A;  3BDL A;  2PO4 A;  4HCS A;  4NW2 A;  1V9P A;  3OIP A;  1LT6 D;  3CPF A;  5A2Q L;  4PZ6 A;  2UUB L;  2ZM6 L;  2CWP A;  1HR0 W;  1RL2 A;  2IPK D;  4XTC S;  4P2C B;  1I4Q A;  2BH8 A;  3KDF B;  5DLQ E;  4DNT B;  4KV6 A;  3CCS A;  4DV7 Q;  4CDF C;  1GUW A;  3C46 A;  5FLX c;  4R9W A;  2QKI C;  3VYR A;  1Q46 A;  1ENC A;  3AEV A;  3U4Z A;  4H44 C;  1OXS C;  3BZC A;  5JOB A;  1EQV A;  2ZXP A;  4R4Q A;  1HNX Q;  1U4P A;  1TY2 A;  3T56 B;  2AMC B;  4HIK A;  3T16 A;  2R92 G;  3AMU A;  3CCJ A;  5DEH A;  3D8G A;  4R8N A;  1Q90 A;  4OWT B;  1SE3 A;  4XT1 B;  3PGZ A;  4DAP A;  2RHQ B;  4K0K L;  2K32 A;  2WB1 G;  4F8M A;  5KNC A;  3JAM E;  4P74 A;  1Y1V H;  4C3I B;  3CCL A;  1VF7 A;  4DXF A;  3Q24 A;  3U4V A;  1SN8 A;  3HKZ G;  1EUJ A;  4KMU C;  1E22 A;  1QE6 A;  4IAL A;  4HMJ A;  4AYB G;  4KHV A;  4J8Q A;  3HFZ B;  3AYH B;  5GAD C;  1TWA H;  2EXZ A;  4DR3 L;  3LWU A;  4JBW A;  5FOB B;  2XN9 C;  5KYI A;  1FGU A;  2MO1 A;  4B9X A;  2IX3 A;  1VQG A;  3MXP A;  3J7A V;  3GTO H;  2UUC Q;  1S5F D;  4WFN 3;  2PI2 A;  1ICW A;  4DK1 A;  1Y8P B;  4RG1 A;  3NTK A;  5C44 G;  1PVO A;  1M8A A;  2F03 A;  1BOS A;  4YY3 Q;  2NN6 G;  4L8J A;  5BR8 Q;  2G9H D;  2PQA B;  2N8N A;  1LV9 A;  4BBR G;  2ZTE A;  4A3C G;  4LF9 Q;  4JOI A;  1Q1E A;  2F0L A;  1L1O A;  3L3O C;  2NWG A;  1VQ9 A;  2AHO B;  1VQ4 A;  2SEB D;  3HOY H;  5E4W C;  3CHB D;  3F1Z A;  4FXG C;  1GKH A;  1O7Y A;  3H3V I;  4B3S Q;  2KJX A;  3P1H A;  5FKA C;  4UHV A;  1U0L A;  2RCN A;  3HKS A;  1TS5 A;  3NP8 A;  3SK5 A;  2JA5 G;  1X3E A;  3K5L A;  1S5C D;  4QJF A;  1LTT D;  3PO3 G;  2Z4H A;  1ZYR C;  5DM6 3;  5M3F B;  2YTV A;  2C9O A;  1CFM A;  5I9O A;  4ZKB B;  5J22 A;  4AQY L;  3R3O A;  4C2M H;  4Y7N B;  4DR1 Q;  1WCM G;  3QOJ A;  1WTP A;  2F0H A;  4JBM A;  4LW1 A;  2K33 A;  4J1M A;  3HOU G;  4A3B H;  3KLS A;  2UXB L;  1YNN C;  2EJG C;  1I6V C;  1X6O A;  3FP9 A;  1HPC A;  1AZQ A;  4NKL A;  1STE A;  4NPS A;  2E8G A;  3JC6 6;  4FF1 A;  4BA1 I;  3H0G B;  2B63 B;  3DMU A;  4DAY A;  1OXT A;  2Z0S A;  5IOD A;  1I5F A;  1K8G A;  4TRD A;  2B39 A;  4RCN A;  4BBS H;  3EN2 A;  4NXN L;  3MFG A;  2VQE Q;  3PV0 A;  3VA5 A;  1DD2 A;  1PH6 A;  4BY7 B;  1IKM A;  2ENB A;  1KTK A;  3I3C A;  4Q0F A;  4X64 L;  3I4N H;  1CUK A;  4XQQ A;  4IFD G;  2ZM6 Q;  1YNJ D;  5C3E G;  5F2D A;  2F0Q A;  3F2C A;  4DUY L;  3SK8 A;  3M7N A;  2WAQ B;  5C0X H;  4EQ5 A;  3GTJ H;  2ES2 A;  1V1O A;  1N33 L;  1S3O A;  1TWH B;  2RKS A;  1JOQ A;  4LUV A;  3K0X A;  1ZEQ X;  3TP7 A;  3S15 H;  3S1M H;  1KDB A;  1O80 A;  1R4P B;  3DM1 A;  2NVT B;  4GZY C;  1TWF H;  2M9V A;  4YWK A;  1K8A C;  2IHE A;  5CR3 A;  2K6A A;  1D5M C;  4K5W A;  3RLO A;  1Y1W G;  4X6A H;  4HJ5 A;  2F0U A;  1CT1 D;  1LT3 D;  2A73 B;  4JI8 L;  1F2Z A;  2NZO A;  2A6H D;  3FMC A;  3DEO A;  3I4N G;  3KFU A;  1AEX A;  3ULJ A;  4ODG A;  4A3I G;  1I50 B;  4FVM A;  2VUM H;  2B2Y A;  5BN5 A;  4DV5 L;  2DGY A;  3HOW B;  1IYV A;  5EKL A;  3VR4 A;  3CRK C;  4C2M B;  4GKK Q;  3U9S A;  1O7I A;  5C4Z A;  1PYS B;  1K8M A;  3EA6 A;  3SGI A;  3C1F A;  1KLG D;  2Z6K C;  3V05 A;  2CWA A;  3I8Z A;  4AQY Q;  3TS2 A;  2F0G A;  2L15 A;  2JA6 B;  4LK1 C;  3A8K E;  2B3G A;  1XMQ Q;  4FF3 A;  2PZU A;  4IPH A;  1TVX A;  4UDU C;  3S1Q H;  1AFP A;  4AH6 A;  2ZTD A;  1EIF A;  5IWA L;  3IRB A;  3KF6 A;  1XPR A;  5IYD H;  4JI7 Q;  4A3B G;  2D2C C;  1PRT F;  3ERO A;  5G3L D;  3E9I A;  3HOX H;  1STA A;  1TT2 A;  1EQQ A;  2A6E D;  1PH2 A;  2CQO A;  4HJ9 A;  5HGQ A;  4KY6 A;  3T1Y Q;  3MC0 B;  3DWQ A;  3H0G G;  4B3S L;  2J4X A;  4IUN A;  3HZX A;  3G6E A;  2BH2 A;  3WOE A;  2F4V Q;  4JV5 Q;  3H94 A;  4C3H B;  3FPU B;  1EEF D;  1D7Q A;  5FK9 C;  1YHB A;  2ID0 A;  5C4H A;  3FKI H;  4DAY B;  1PTO F;  4A3L G;  4DR2 Q;  4LFA Q;  3S2H B;  5IE8 A;  2XIW A;  4GN4 B;  3VR6 A;  4DF7 A;  1EYA A;  2F0D A;  4IN3 A;  4RHR A;  4OX9 Q;  2NVQ B;  3J81 c;  4YCV A;  1ENA A;  3B6Y A;  3TP5 A;  4DK0 A;  1EY7 A;  1FJG L;  1BCP D;  4A3D H;  5C0X I;  2N49 A;  1IZ6 A;  2EYO A;  2DJF C;  3R2I A;  2RDH A;  4GNX C;  4N9T A;  1SE4 A;  3R8B A;  2K7V A;  3KYH C;  4KI0 A;  1XNQ Q;  3IFT A;  5FJ8 G;  1STN A;  1YI2 A;  1UE5 A;  3W3A A;  5C44 H;  2NVX H;  3A7L A;  1HRJ A;  4DK6 C;  1WFQ A;  1CQV A;  1IHZ A;  4EVO A;  2R61 A;  1XPO A;  1R4Q B;  2ATW A;  1SR3 A;  5AFW A;  1PYB A;  5DM7 3;  4ID6 A;  4OO1 G;  2B2V A;  1JB3 A;  2EY6 A;  3NE5 B;  4WOR A;  2FXQ A;  2KCM A;  1JOR A;  4TVA B;  3FRP B;  5JJZ A;  1VQE A;  5AJ3 L;  2K01 A;  1I94 Q;  4CBV A;  1OXU A;  2JA5 B;  3LWE A;  1EU3 A;  4QIW E;  3NBI A;  3Q22 A;  1ZYR D;  4DV2 L;  2EY1 A;  5M5Y B;  4OWX B;  4HJ7 A;  1Y1V G;  4YWM A;  2CQA A;  3STB C;  3VYT A;  3H3V C;  2F52 A;  1GM5 A;  1PRT C;  2R93 B;  2TMP A;  1ML0 D;  2A69 C;  2F0W A;  1ILQ A;  1S72 A;  1F2L A;  1STH A;  4L5R C;  1RCV D;  2MP1 A;  1STB A;  3HOW H;  4JI4 Q;  4IFD H;  1M1K C;  2Z1C A;  4K5V A;  5IGC A;  4LF9 L;  2PNR C;  2EYJ A;  4J6H A;  4DV4 Q;  4S3S A;  4BY1 H;  3H3V H;  2CH4 A;  1WVL A;  3MXN B;  1B4O A;  1B8A A;  1ESR A;  1K8O A;  2B8G A;  1ROD A;  1Y8O B;  2KUM A;  3AB9 A;  5ELD A;  2DY7 A;  5IYB G;  1TR5 A;  2A1A A;  1JOK A;  2MFI A;  3GTO B;  2UXC L;  4BXX G;  1J8I A;  1MHW C;  2Q8R E;  5LMN L;  1G6Z A;  1Q8K A;  3UI2 A;  1TS4 A;  4B3R L;  4K14 A;  4DR3 Q;  3MA2 B;  1EY4 A;  4A4I A;  1PFN A;  4L63 B;  4JPB W;  5IGF A;  4XQN A;  4LF5 L;  1L0Y B;  4DAV A;  2EYF A;  1I4G A;  3GO5 A;  3I4L A;  2K50 A;  2PW7 A;  4G7H C;  1SRO A;  3T1H Q;  3HOZ H;  1GUG A;  1SND A;  4C3J H;  2R93 G;  1PZK D;  3PUX A;  1YHQ A;  3TZU A;  4ZRZ A;  1B70 B;  3NBH B;  4A3J H;  3I56 A;  1PTO B;  2R7Z G;  5H1S E;  2X69 A;  1EFI D;  1EIY B;  1QJO A;  4C3J B;  4F87 A;  3GTP B;  2OCE A;  2O2L D;  4BY7 H;  4ZK9 B;  1PH4 A;  1XYI A;  3PUZ A;  3VYS A;  4AIM A;  1VQC A;  1KDA A;  1U4L A;  1MIU A;  1JB7 A;  2L9H A;  1JIC A;  4XQJ A;  3PIO 3;  5CMD A;  1QNK A;  2E5L Q;  4K2L A;  1KQS A;  1U4M A;  1WJJ A;  4DR7 Q;  1SE2 A;  2E5L L;  4CGY B;  2YU9 H;  3ER0 A;  1EYG A;  4PMW A;  2WKC A;  1JE5 A;  1IKL A;  3S1M B;  3S15 B;  4K8I A;  2PQE A;  4JI1 Q;  4OWW B;  2B2V C;  1D8L A;  2E76 C;  3D4W A;  3I91 A;  4X66 L;  2K4K A;  3RD4 A;  4CHT B;  5IT9 E;  4BBS G;  3BVZ A;  2B63 H;  4LF6 Q;  3VR2 A;  1DON A;  2Z4I A;  1XTD A;  1WTR A;  2QIL A;  3TZD A;  1BCP C;  4CKB A;  1TY0 A;  4DR5 Q;  3FEW X;  4FXK C;  1F9Q A;  1RIP A;  3R93 A;  2F3I A;  5LMN W;  4DV1 L;  2R92 B;  4HMI A;  4KLK A;  4LJZ C;  1PH7 A;  3ZJY C;  3DHQ A;  3QWN A;  2KED A;  2QW7 A;  2WAQ E;  2UXC Q;  3GTM H;  1WTX A;  4GNX B;  4BXX H;  4HID A;  2ZJP A;  1C7Y A;  4P73 A;  3NBH A;  3U9O A;  3D3R A;  1C4Q A;  1VQ8 A;  3GTK H;  1EY5 A;  1VF5 C;  5EQ0 A;  2SDF A;  4X3U A;  5KIX A;  3TME A;  1VQN A;  4N8X 1;  2QF7 A;  3X3N A;  3PO2 B;  2KEN A;  4X3T A;  1ILP A;  1TII D;  3KF8 B;  5IWA Q;  1NSN S;  2GVB A;  1LTR D;  3MVV A;  4EQN A;  4ZUJ A;  1PDQ A;  2MNA A;  3GTQ H;  1WTW A;  4IPG A;  4K8J A;  4HAE A;  1B2T A;  2B8F A;  1ASY A;  1X54 A;  3S24 A;  1HTL D;  4HIO A;  1VQB A;  3CQZ H;  4I7Z C;  4BY1 G;  4DV3 Q;  4P72 A;  2JJQ A;  1LUZ A;  2HDM A;  3W2D A;  1N36 L;  1R9T H;  4DV2 Q;  4RMF A;  3S2H H;  1K83 B;  4B9W A;  4PZ8 A;  3RZD B;  4WJ4 A;  1N36 Q;  4DV5 Q;  1H9K A;  1EZ8 A;  5KEE A;  3N52 A;  3U58 A;  4C56 C;  4DR2 L;  1KRS A;  2Q2H A;  4C1N K;  2MO0 A;  3NTH A;  3J7A 5;  1CKM A;  4JCV E;  4GLV B;  3QOL A;  4OXP A;  3HOX G;  2RF4 A;  1HZA A;  5A35 A;  5ISR A;  2ZT9 C;  1X32 A;  1DGS A;  3O13 A;  4H7B A;  4FF2 A;  4DKA C;  2A69 D;  3NUC A;  5C3E B;  1SNO A;  2K14 A;  4ZKC B;  5IIF A;  2N3S A;  1XNQ L;  3MTS A;  5GQO A;  1JWS D;  5G3L F;  3OTO Q;  4X62 L;  2Q8I B;  3M3Y H;  2FMM A;  4A76 A;  4GNX A;  1QZG A;  3CU7 A;  5JEA J;  2RA4 A;  3HOY B;  4GOP A;  2HHH L;  4TKO B;  4N8F A;  1PH1 A;  5DAU A;  5TSS A;  3DWP A;  1KDC A;  2RDF A;  3GTG B;  3DXJ C;  4YHH Q;  1U4R A;  1BF4 A;  2K1B A;  1HJP A;  4OEL B;  5C4X B;  2F0F A;  2RBM A;  2AQ1 B;  2KHS A;  2RSO A;  5J39 A;  3MHB A;  5IGE A;  4ULL A;  3OHX C;  2K5Q A;  2PQA A;  4GN3 B;  3J81 i;  1Z7T A;  4IOA A;  2UXD Q;  3J81 L;  1SRU A;  1K3R A;  2VQF Q;  1CI3 M;  1U9R A;  4DR7 L;  1PYW D;  4DNR B;  1C8C A;  1E1T A;  3FHW A;  3NPP A;  3J81 E;  2SNM A;  3I72 A;  2KHJ A;  1BBX C;  1FNW A;  1KC8 C;  3N6R A;  2HDL A;  1N32 Q;  3DM3 A;  4P75 A;  2GVA A;  2OT2 A;  4LFB Q;  1A3T A;  1E24 A;  2VZA A;  2DUD A;  2KCT A;  1CQF A;  3W1G A;  4BA2 I;  3BG3 A;  1YIJ A;  3GTL B;  3TRZ A;  3RR5 A;  3CC2 A;  3GDE A;  4B3M L;  4JYA Q;  4DN4 M;  3UDI A;  5GAE C;  2NTS A;  3H0G H;  1YJN A;  3GV3 A;  1JCK B;  4LF7 L;  1QCB D;  1W3S A;  2K03 A;  4RKL A;  1EYC A;  2ZXR A;  5EPJ A;  3HS0 C;  4GS3 A;  1K73 C;  3GQB A;  4CKE A;  2RCF A;  2BCO A;  3CP0 A;  4ZCK A;  4A3E G;  3ITP A;  4YHH L;  1HUN A;  4Y52 H;  3AU7 A; 
#chains in the Genus database with same CATH homology
 4A3I G;  1KAW A;  2ASB A;  3I4M G;  1EOV A;  3TEH B;  2YV5 A;  3S1R H;  1Q82 C;  2VUM H;  3A74 A;  3E0E A;  4DV5 L;  2DGY A;  1LTL A;  4DUZ L;  1FVI A;  2VW9 A;  4B3R Q;  5C4J H;  4R4I A;  2OTJ A;  4GKK Q;  5M3M H;  1O7I A;  4LF8 Q;  1PYS B;  3SGI A;  1XJV A;  3CMA A;  1KRT A;  2Z6K C;  3GTP H;  4X62 Q;  3MEF A;  1GO3 E;  1NBW A;  4JI8 Q;  5M5X H;  2CWA A;  1J5E Q;  1VQH A;  3TRE A;  4A3E H;  4AQY Q;  3TS2 A;  1IBM Q;  2I5H A;  4DR1 L;  2L15 A;  1Y14 B;  1PHJ A;  2WAQ G;  1VQD A;  1XMQ Q;  2B3G A;  4QQB X;  4IPH A;  2K52 A;  4NXN Q;  2D0O A;  2EQS A;  1XMO Q;  3S1Q H;  4AH6 A;  2ZTD A;  1EIF A;  5IWA L;  3IRB A;  2VY3 A;  3KF6 A;  4LUZ A;  1XPR A;  5IYD H;  5M5W H;  4JOI C;  4JI7 Q;  1N33 Q;  4H02 A;  2I5L X;  3EBE A;  1I6H H;  3I7F A;  4MZ9 A;  4A3B G;  4JBK A;  3OW2 A;  3CW2 C;  3CXC A;  1ASZ A;  3RN5 A;  4A93 H;  3E9I A;  2NVY H;  4MTN A;  4YCW A;  3HOX H;  5M3F H;  2K5H A;  2Q2U A;  1EQQ A;  2JQO A;  1PH2 A;  2CQO A;  4HJ9 A;  5HGQ A;  3T1Y Q;  2BA1 A;  1AH9 A;  4DV6 Q;  2N78 A;  3HOU H;  3H0G G;  2JE6 I;  3PO3 H;  4B3S L;  2VNU D;  1QZH A;  1X65 A;  3G6E A;  2BH2 A;  3CF5 A;  2F4V Q;  1GD7 A;  4JV5 Q;  3Q8D A;  2UUA Q;  2ZJR A;  1D7Q A;  2K5N A;  2JA9 A;  2R7F A;  1G6P A;  1YHB A;  1U5K A;  2ID0 A;  2RHS B;  1VQA A;  5JEA G;  1JJC B;  2BA0 A;  3FKI H;  4UY8 C;  4A3L H;  4DAY B;  1AE2 A;  2D0P A;  3H15 A;  1OTC A;  4A3L G;  1JMC A;  4ME3 A;  4LFA Q;  4DR2 Q;  5IE8 A;  3KLW A;  4GN4 B;  2JA8 G;  2PMZ E;  1FL0 A;  3KF6 B;  4OX9 Q;  5ELO A;  1VQ7 A;  3J81 c;  4YCV A;  3B6Y A;  5IYC H;  3RN2 A;  3KJO A;  1FJG L;  4A3D H;  5C0X I;  2R6G A;  2N49 A;  4GKJ L;  1IZ6 A;  4NXM L;  4L5T A;  3J80 c;  1HR0 Q;  3S2D H;  4GNX C;  2B63 G;  1SLJ A;  5IY0 A;  2R92 H;  2AWO A;  4DUY Q;  4GOP C;  3VDY A;  4A3K H;  4A75 A;  4NXM Q;  3HOW G;  3KYH C;  3CCV A;  4KI0 A;  1XNQ Q;  5LMU Q;  1OXX K;  5FJ8 G;  1NJI C;  3CC4 A;  1YI2 A;  1UE5 A;  1EWI A;  5C44 H;  2NVX H;  1TXY A;  4DK6 C;  4X65 Q;  1WFQ A;  1WCM H;  1CKN B;  3G4S A;  3CCU A;  1QVG A;  3HKZ E;  1V1Q A;  3F8T A;  2IX0 A;  3K7A H;  5LMN Q;  1YJ9 A;  2NVQ H;  1Q1B A;  2HHH Q;  1T9H A;  4GLA C;  3FKI G;  4A3D G;  1XPO A;  3UE1 A;  1YIT A;  1NMF A;  1XMO L;  4GLX A;  2JA7 G;  3CCQ A;  1W2B A;  2ATW A;  3PCO B;  1SR3 A;  3GTL H;  3L0O A;  3I4M H;  1WI5 A;  1PV4 A;  1PYB A;  1XNR L;  2AKW B;  1LYL A;  4JI3 Q;  4JYA L;  4OO1 G;  5JJI A;  1N34 L;  2FXQ A;  2KCM A;  1IL2 A;  2HQL A;  4TVA B;  1VQE A;  3RNU A;  1JJG A;  3L2P A;  4JI3 L;  4A3F G;  1X56 A;  2I5M X;  5AJ3 L;  4DV4 L;  3W1B A;  2NVT H;  1I94 Q;  1NTG A;  1OXU A;  1A8V A;  3A0J A;  1YBY A;  3BZK A;  2QA4 A;  4QIW E;  5HY6 A;  4BY7 G;  5GAG C;  2V1C C;  4IJL A;  3TS0 A;  1PH8 A;  4GKK L;  3BJU A;  4DV2 L;  4A93 G;  1N32 L;  2OTL A;  4OWX B;  4HJ7 A;  1Y1V G;  3D31 A;  1VQ6 A;  4YWM A;  2VUM G;  3K80 C;  1Q81 C;  4OX9 L;  3STB C;  4FDB A;  4UP7 A;  2F52 A;  4R1J A;  1GM5 A;  4LF6 L;  1UEB A;  1PH3 A;  1KXL A;  3G48 A;  4C3I H;  1S72 A;  2WP8 J;  1IBM L;  2UUB Q;  4O2D A;  1C0A A;  1VQF A;  4L5Q A;  4L5R C;  3S16 H;  3UDG A;  4DR5 L;  4NB3 A;  3ICE A;  5ELN A;  2JEB I;  2UUA L;  1YEZ A;  3HOW H;  1K0R A;  4JI4 Q;  1M1K C;  1HZ9 A;  3OYY A;  1BKB A;  4LF9 L;  3UDX A;  1UE6 A;  1VCI A;  4LF8 L;  2R7Z H;  4JI0 L;  1L1O B;  4MNO A;  5AJ3 Q;  3J81 j;  4DV4 Q;  2Q2T A;  4A3C H;  4ALP A;  2ZTC A;  3E9H A;  4DV6 L;  2E2H H;  4BY1 H;  3H3V H;  3GD7 A;  3AQQ A;  1HNX L;  2K5V A;  3MXN B;  3J80 i;  5IYC G;  1B8A A;  1EQR A;  2R7D A;  1X3F A;  2XTI A;  5JJK A;  1MKH A;  2YYZ A;  4JC0 A;  4LUO A;  3F2B A;  3HOZ G;  1PA6 A;  1EFW A;  5IYB G;  3S14 H;  1YJW A;  4JI7 L;  2A1A A;  4JV5 L;  4A3K G;  3RZO H;  2MFI A;  2UU9 Q;  4JBJ A;  2UXC L;  4BXX G;  5LMN L;  2LXJ A;  1Q8K A;  1WOC A;  1MJE A;  4JYA Q;  4B3R L;  4PG3 A;  4DR3 Q;  3U50 C;  4LF5 Q;  4JI6 Q;  1BBW A;  1IXR A;  1HNZ Q;  4A4I A;  2IY5 B;  1E3P A;  3G71 A;  5E7N A;  2WB1 E;  3BU2 A;  4LFC L;  4JI1 L;  1BBU A;  4KHP L;  4PZ7 A;  4LF5 L;  4IPD A;  3GO5 A;  4HIM A;  2K50 A;  3T1H Q;  1SRO A;  4A3J G;  3HOZ H;  1VQM A;  2R93 G;  4C3J H;  3PUX A;  3RLN A;  5GAH C;  1IYJ B;  1YHQ A;  1I50 H;  2VL6 A;  3CCM A;  4KHZ A;  4GKJ Q;  4IFD J;  3LGJ A;  1B70 B;  1N9W A;  2QGQ A;  4QL5 A;  3M85 A;  1UE1 A;  3NBH B;  3PUV A;  4A3J H;  2HIV A;  3I56 A;  1XMQ L;  5IT9 c;  1IBK Q;  2CKZ B;  1VQK A;  2B29 A;  3D0F A;  3M4P A;  1QVC A;  4JI2 Q;  5IYD G;  5H1S E;  2I0Q A;  1XNR Q;  4OON A;  2R7Z G;  1EIY B;  4B3M Q;  1HNZ L;  1CSQ A;  2UXD L;  1I3Q H;  2OCE A;  1VS0 A;  3PSI A;  1PH9 A;  2JEA I;  4BY7 H;  1HZB A;  3EIV A;  2NZH A;  1L2F A;  1PH4 A;  4JI0 Q;  4DK3 C;  5M3F G;  5C3E H;  3CD6 A;  4JI5 Q;  3HOV G;  3T1H L;  3PUZ A;  4EX5 A;  4AIM A;  1VQC A;  4YCU A;  3I2Z A;  1TWC H;  4DV3 Q;  2OWO A;  4YWL A;  5C0X G;  3PIP A;  1PFS A;  1MIU A;  1P16 A;  1JB7 A;  2R93 H;  4KHP Q;  3CCE A;  4JI5 L;  4J15 A;  1VQJ A;  2E2I H;  1KL9 A;  4P71 A;  4HJA A;  5IP7 G;  2E5L Q;  1A63 A;  3S17 H;  5FLM G;  1KQS A;  3PUY A;  3UDF A;  4JI2 L;  1HNW L;  2D62 A;  1WJJ A;  4DR7 Q;  2YU9 H;  4DR6 L;  2YTY A;  3I55 A;  2UUC L;  2E5L L;  3DLL A;  2UXB Q;  2AWN A;  1J6Q A;  3CPW A;  1IBK L;  4A3M H;  4GN5 A;  4AYB E;  2E2J H;  1CSP A;  3ER0 A;  3W5O A;  1Q7Y C;  1EYG A;  4PMW A;  4DNI A;  4APV A;  1X3G A;  2GN5 A;  2PNH A;  3K8A A;  3PIO A;  4HJ8 A;  1K9M C;  4LF7 Q;  4POG A;  1JE5 A;  4B3T Q;  4YY3 L;  4R4O A;  4JI1 Q;  4LFC Q;  4OWW B;  3NEN A;  2A8V A;  2LSS A;  1V9P A;  1D8L A;  3CPF A;  3PUW A;  4PZ6 A;  5GRO A;  4X66 L;  2K4K A;  2UUB L;  2ZM6 L;  2CWP A;  4DUZ Q;  4IFD G;  5JJL A;  4LWC A;  1HR0 W;  4UP9 A;  1HNW Q;  4BBS G;  1RL2 A;  4XTC S;  2B63 H;  4LF6 Q;  5FLM H;  1XTD A;  1IBL Q;  2BH8 A;  3KDF B;  5IYB H;  5DLQ E;  4LNQ A;  2K75 A;  4JI4 L;  3CCS A;  4DV7 Q;  5FLX c;  4O0A A;  1GVP A;  4DR5 Q;  1Q46 A;  2Z6K A;  4X64 Q;  3AEV A;  3U4Z A;  4A3G H;  1OXS C;  3BZC A;  2HIX A;  4R4Q A;  1HNX Q;  1RIP A;  5M5Y H;  2F3I A;  5LMN W;  4DV1 L;  2AMC B;  2PI2 E;  4HIK A;  2R92 G;  3CCJ A;  4KLK A;  1PH7 A;  3JAM i;  4OWT B;  3S1N H;  3PGZ A;  3ZJY C;  2RHQ B;  4K0K L;  2WB1 G;  5K36 G;  3OTO L;  4P74 A;  1CKN A;  2WAQ E;  1Y1V H;  4IJH A;  3UE0 A;  2UXC Q;  2C35 B;  3GTM H;  4DR4 L;  4GNX B;  4DPG A;  4BXX H;  1VQO A;  3CCL A;  1Z47 A;  1YVC A;  4HID A;  3U4V A;  1SN8 A;  5BR8 L;  2ZJP A;  1C7Y A;  3HKZ G;  1EUJ A;  4B3T L;  4P73 A;  1E22 A;  4BBR H;  1VQ8 A;  4R4C A;  1UWV A;  3GTK H;  1H95 A;  3HOY G;  3KOJ A;  3CC7 A;  3RZD H;  3KDF A;  4AYB G;  3HFZ B;  2IX1 A;  3ULL A;  3AYH B;  5GAD C;  1VQL A;  1TWA H;  1VQN A;  5C4X H;  4DR3 L;  4JBW A;  1C9O A;  3K7U C;  2KEN A;  3GTG H;  1FGU A;  2MO1 A;  1NY4 A;  2JA6 G;  1JJ2 A;  2EIF A;  1P8L A;  3CAM A;  1VQG A;  3KF8 B;  5IWA Q;  4DR4 Q;  3GTO H;  2UUC Q;  2GVB A;  1A62 A;  2PI2 A;  1PH5 A;  1SFO H;  4GOP B;  2MNA A;  3TQY A;  3GTQ H;  4RG1 A;  1SMX A;  2Q2I A;  4IPG A;  5C44 G;  1PVO A;  2JA7 H;  1ASY A;  4L5S A;  4YY3 Q;  3PF5 A;  2NN6 G;  1X54 A;  1A0I A;  2EXD A;  3CME A;  1J5E L;  1B7Y B;  3S24 A;  5BR8 Q;  4HIO A;  1SE8 A;  1VQB A;  2PQA B;  1WYD A;  1QUQ B;  2N8N A;  3CQZ H;  4P72 A;  2JJQ A;  4BY1 G;  4BBR G;  1YZ6 A;  1LUZ A;  2ZTE A;  1HR0 L;  4LF9 Q;  4A3C G;  1HH2 P;  4JOI A;  1Q1E A;  1N36 L;  1L0W A;  1R9T H;  1L1O A;  1CKO A;  3J7Z C;  4DV2 Q;  4RMF A;  1YNX A;  4UPA A;  2AHO B;  5IP9 G;  1VQ9 A;  1FJG Q;  4PZ8 A;  2JA6 H;  1VQ4 A;  4WJ4 A;  5FJ8 H;  1X55 A;  1N36 Q;  4DV5 Q;  3HOY H;  5IP7 H;  1KHI A;  1BVS A;  1QUQ A;  3F1Z A;  1GKH A;  5LMU L;  4A3I H;  1Q12 A;  3H3V I;  4B3S Q;  3U58 A;  3PO2 H;  1U0L A;  2RCN A;  4DR2 L;  3K81 C;  1V43 A;  3AFP A;  1KRS A;  3HKS A;  1KIX A;  2Q2H A;  2JA5 G;  4IFD I;  2MO0 A;  1X3E A;  3J7A 5;  1CKM A;  4DV0 L;  3M4O H;  4JCV E;  4GLV B;  4OXP A;  4QJF A;  2RF4 A;  1HZA A;  3HOX G;  4X65 L;  1DGS A;  3PO3 G;  2CCZ A;  1VQP A;  1HZC A;  4K0K Q;  2YTV A;  2A19 A;  2F4V L;  3NEL A;  1Z9F A;  4DKA C;  3T1Y L;  2JA5 H;  3STB D;  2OQ0 A;  2WFW A;  4AQY L;  1TWG H;  4A3F H;  1N34 Q;  3M9B A;  4C2M H;  1QVF A;  4DR1 Q;  1WCM G;  2K14 A;  2CFM A;  2IT1 A;  2VS1 A;  2N3S A;  3HOV H;  4C3H H;  1XNQ L;  1G29 1;  3RLF A;  3ULJ A;  1XPU A;  5GQO A;  4JBM A;  5C0X J;  4A3G G;  3OTO Q;  4X62 L;  4LW1 A;  2MQH A;  1UE7 A;  2YTX A;  3M3Y H;  4A76 A;  2Y0S G;  4GNX A;  5IP9 H;  4DR6 Q;  3HOU G;  1QZG A;  4A3B H;  1X9N A;  5JEA J;  3F2D A;  3I4O A;  3M4Q A;  4GOP A;  1I94 L;  2HHH L;  2UXB L;  1PH1 A;  1X6O A;  4LFA L;  2KHI A;  3FP9 A;  1G51 A;  2HT1 A;  4YHH Q;  4X66 Q;  4NPS A;  2E8G A;  5C4X G;  1HJP A;  3JC6 6;  1OXV A;  3A5Z B;  4JG2 A;  4XIG S;  4BA1 I;  2QEX A;  1VQ5 A;  1OXT A;  2Z0S A;  4Y7N H;  1KD1 C;  3PF4 A;  4LFB L;  1YHA A;  4TQU S;  1I5F A;  1K8G A;  2PQA A;  4GN3 B;  4BBS H;  1N8R C;  4UP8 A;  3J81 i;  2XGT A;  3EN2 A;  4NXN L;  3JAM c;  2VQE L;  3CCR A;  1IBL L;  2VQE Q;  4DV3 L;  4A3M G;  4IOA A;  1SRU A;  3PV0 A;  4JI6 L;  1K3R A;  2VQF Q;  4DV7 L;  2UXD Q;  1PH6 A;  4DAM A;  4DR7 L;  1E1T A;  3FHW A;  2KHJ A;  4X64 L;  2H5X A;  1AE3 A;  1E7Z A;  4IOC A;  1CUK A;  1Q86 C;  3I4N H;  1VQI A;  1KC8 C;  2ZM6 Q;  2KBN A;  1NE3 A;  2JK8 A;  4LF4 L;  3KJP A;  2JA8 H;  3L7Z C;  5C3E G;  3F2C A;  1N32 Q;  1L1O C;  3DM3 A;  4P75 A;  2GVA A;  3A5U A;  2ALY B;  4DUY L;  3M7N A;  4LFB Q;  5M3M G;  4LF4 Q;  1E24 A;  2VZA A;  2DUD A;  4EQ5 A;  2UU9 L;  1K83 H;  3NEM A;  2OQK A;  2KCT A;  5EAY A;  3GTJ H;  3S2H H;  4QGU A;  3W1G A;  4BA2 I;  2ES2 A;  1YIJ A;  1N33 L;  3WWV A;  2IHF A;  1S3O A;  3RR5 A;  5J3B A;  2NN6 I;  3GDE A;  3CC2 A;  3TRZ A;  4B3M L;  2VQF L;  3AFQ A;  4LUV A;  5GAE C;  3UDI A;  2Y0S E;  3K0X A;  2LXK A;  4POF A;  1Y1W H;  3S15 H;  3S1M H;  4OO1 I;  3H0G H;  1YJN A;  1TWF H;  4YWK A;  1K8A C;  4DV1 Q;  4LF7 L;  3ULP A;  2IHE A;  3RLO A;  1W3S A;  4X6A H;  1Y1W G;  3ERS X;  4HJ5 A;  4IO9 A;  4WJ3 M;  1S40 A;  1JT8 A;  4R4T A;  1M90 C;  1TWH H;  1E1O A;  4GS3 A;  4DV0 Q;  1K73 C;  4A3E G;  3CP0 A;  4JI8 L;  2NZO A;  1LM0 A;  1MJC A;  3I4N G;  3KFU A;  3PO2 G;  4YHH L;  2ZJQ A;  4QY7 A;  4IPC A;  1NMG A;  4Y52 H; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...