1IBML

Structure of the thermus thermophilus 30s ribosomal subunit in complex with a messenger rna fragment and cognate transfer rna anticodon stem-loop bound at the a site
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
124
structure length
124
Chain Sequence
PTINQLVRKGREKVRKKSKVPALKGAPFRRGVCTVVRTVTPKKPNSALRKVAKVRLTSGYEVTAYIPGEGHNLQEHSVVLIRGGRVKDLPGVRYHIVRGVYDAAGVKDRKKSRSKYGTKKPKEA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S RIBOSOMAL RNA
publication title Recognition of cognate transfer RNA by the 30S ribosomal subunit.
pubmed doi rcsb
molecule tags Ribosome
total genus 14
structure length 124
sequence length 124
ec nomenclature
pdb deposition date 2001-03-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
L PF00164 Ribosom_S12_S23 Ribosomal protein S12/S23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 1ibmL00
4JI0L 4LF9L 1VQIA 2RHQB 3JC66 1PHJA 4JBJA 3L2PA 2JA7G 1HNZQ 5FLMG 1VQ8A 1XNRQ 1C0AA 4GOPC 3RN5A 4DR1Q 4LUOA 4B3ML 4LNQA 4JI8L 1B70B 3AFQA 1E1TA 5GAGC 2VW9A 1X3EA 2D0OA 1VQOA 4JOIC 3J80i 3OW2A 3A0JA 1OXUA 4BY7G 4DR4L 4P74A 4LF4Q 3M4PA 3WWVA 5C0XG 4GLXA 1Y1WG 1K3RA 4C3IH 3I4MG 1WCMH 2DUDA 4IPCA 4IJHA 1L0WA 1IBLQ 2ES2A 4IPGA 1PYSB 1O7IA 1PV4A 4LWCA 1CSPA 5IP7H 4A3EH 1ASYA 3T1HL 3HFZB 3CCVA 2QGQA 4HJ7A 4GKKL 4QGUA 2F4VQ 4GOPB 2GN5A 2AWOA 1VQMA 1PVOA 4DR3L 3PGZA 1VQPA 4JI4L 2R7ZH 1E3PA 2UUBQ 3J81i 3RLFA 3CCLA 1HZ9A 1YNXA 3E9IA 3GTLH 3HOXH 1X3FA 2UXDQ 1TWFH 1SLJA 1PH1A 4JI2Q 4AQYQ 1R9TH 1YBYA 4BY1H 2JA8G 4JI6Q 3AQQA 1HNZL 5GQOA 1XNRL 5C44H 4DR1L 3S15H 3OTOQ 1JE5A 4LFCQ 1IYJB 1WFQA 2Q2TA 2A1AA 4GNXA 1KRSA 2PQAA 1Q7YC 5JEAJ 4ALPA 1VQ9A 4LF4L 1S40A 2B3GA 3HOWG 3W5OA 1N8RC 3RR5A 2HHHQ 1QZHA 2JK8A 4X64Q 1VQFA 1IBLL 3GTGH 4UY8C 1I50H 3PV0A 1TWGH 4YHHQ 1HNXQ 4BBSG 4J15A 3BU2A 3PUYA 2QA4A 2F4VL 2ID0A 3KJOA 3PIOA 4KLKA 5ELNA 1XPUA 2UUBL 5M5YH 1VQDA 3CC4A 3M4OH 3L7ZC 3TREA 2ZJRA 4JC0A 5ELOA 4IFDG 2UXDL 4A4IA 3RNUA 4A3DG 2IX0A 5FJ8G 4AQYL 4JI2L 1XMOQ 4JI6L 1L1OC 4A3BH 1Y14B 4GOPA 3OTOL 3GTMH 2K52A 4LFCL 4A3LG 3D0FA 1S3OA 3GTKH 2JA7H 3PF4A 4JOIA 4HIOA 2IHFA 3A74A 5FLMH 1K8GA 2VUMG 1X3GA 1GM5A 2H5XA 4JI1L 2HIXA 2HHHL 1FJGQ 1VQ6A 3CCSA 2CKZB 3ERSX 3ULJA 4DV6Q 3M7NA 4BY7H 2K5HA 4X64L 3TEHB 4DUYQ 4A3FG 4A3MG 3RN2A 1U5KA 3CPFA 4KI0A 3I7FA 4YHHL 1HNXL 2NN6G 3I4MH 4WJ4A 4DV3Q 5K36G 1L1OB 3LGJA 3K8AA 1KL9A 3U50C 3J80c 4UP8A 1Y1VG 1BVSA 1PH2A 3FKIG 1N33Q 2HT1A 4DV5Q 2CFMA 3KF6B 1AH9A 2JA5H 2I5MX 4Y52H 3MXNB 2WAQE 4APVA 2FXQA 1YIJA 1A0IA 1XMOL 3S1QH 1E7ZA 1VQJA 1VQLA 4NXNQ 2KHIA 3K80C 2HIVA 2ZTEA 1YHAA 4YCVA 1D8LA 1BKBA 3ER0A 1I5FA 4A3JH 5LMNW 4JBMA 2ZTDA 3J81c 4IPDA 3STBD 4DV7Q 2YV5A 1T9HA 4DKAC 5IYCG 1FVIA 3CF5A 4DR6Q 3A5UA 4BXXH 1FJGL 4R4IA 4GN3B 4DR7Q 1X56A 3UDXA 4IOAA 4DV6L 1C9OA 1Z47A 4DUYL 2IHEA 3HOVG 3HOWH 4JI3Q 5M3MG 3G4SA 4DV3L 4OO1G 3M85A 5IYDG 2B29A 4X65Q 4QL5A 1M1KC 1JJ2A 2WFWA 3K7UC 4YCUA 4PZ8A 3RZDH 1PH3A 2A19A 1N33L 1X54A 4DV5L 4DAYB 4BBSH 1V43A 3G6EA 1A63A 1HZBA 5J3BA 1EYGA 3KYHC 3CMEA 4HJ9A 3HOUH 1L1OA 1WYDA 1KAWA 3S14H 1N9WA 4NXNL 5H1SE 1NMFA 2OTJA 1AE3A 3KF6A 4HJ8A 5AJ3Q 2K75A 4L5QA 2UXBQ 3UDFA 3RLNA 4DV7L 1SR3A 5E7NA 4X66Q 1JJCB 4DR6L 4OXPA 4BA2I 4JBWA 4KHZA 4DR7L 2KCMA 4JCVE 2K4KA 1WOCA 1IL2A 4QY7A 2VQEQ 1C7YA 3PUVA 1HJPA 2VUMH 1XNQQ 2K50A 4JI3L 5BR8Q 1NBWA 3CCRA 4X65L 4GLVB 2UU9Q 1HNWQ 1E22A 5IYBG 4A3MH 3NENA 4A3FH 3CPWA 4IFDJ 1BBWA 5IT9c 2B63G 1Q82C 1YJ9A 2OQ0A 3I4NG 2I5LX 1EQRA 3CCUA 1LYLA 2WAQG 2JQOA 4NXMQ 3FKIH 4UPAA 1YVCA 2QEXA 2ZJQA 3GTJH 4LF8Q 1Q1EA 5EAYA 3DM3A 4Y7NH 1G51A 2GVAA 2EQSA 1HR0Q 5AJ3L 3U4VA 1RL2A 4O0AA 1D7QA 1GD7A 2LXKA 1K8AC 2UXBL 3UDIA 1UE1A 4X66L 1YITA 4C2MH 3E9HA 4JI1Q 4A3IG 4LF7Q 4QJFA 1PH4A 5IP9G 3KF8B 2NZOA 1Z9FA 2MO0A 2VQEL 2DGYA 1K73C 4JV5Q 4JYAQ 3W1BA 2VQFQ 1XNQL 5GROA 4BBRH 5BR8L 4IJLA 2CWAA 3H3VH 2ZJPA 3S16H 1KXLA 4POGA 2UU9L 2KHJA 2E5LQ 1QVFA 2K14A 2PI2A 2JA6G 1VQ7A 4HIKA 2YTXA 3I2ZA 2EIFA 3HOVH 1MKHA 4L5RC 2IY5B 1AE2A 5M3MH 1WJJA 1CUKA 5IYDH 1GVPA 5M5XH 1XPOA 1NMGA 3PSIA 3I55A 1SFOH 1Q81C 4NXML 3G71A 4DV2Q 2Q2HA 1HZCA 4R4TA 4POFA 2I5HA 1YZ6A 1PYBA 4LF8L 4K0KQ 1MJCA 4O2DA 4JI5Q 3CW2C 1TWHH 2RHSB 1HR0L 3PIPA 1W3SA 4DR5Q 3I4OA 4IPHA 1VS0A 2Z6KC 1I94Q 4R4QA 3S1NH 2JEAI 1LTLA 4LF7L 4DNIA 1LUZA 3S24A 1EQQA 2WB1E 2RCNA 3PUWA 2LSSA 4A75A 4JV5L 1VQGA 5M3FG 4JYAL 2R7FA 2VL6A 5C4XG 1Y1WH 2VQFL 3K81C 1M90C 3EIVA 5C0XI 3GTOH 2R93G 1VQ4A 1EFWA 1CSQA 1P16A 1YEZA 1QUQB 2YYZA 2E5LL 4A93G 5JJLA 5JJKA 1UEBA 3GDEA 5JJIA 3CAMA 4DPGA 3TRZA 2ATWA 5IWAQ 4R4CA 3STBC 3CCEA 2PI2E 2AWNA 1VQNA 4JBKA 4DV1Q 4DV2L 4MZ9A 3M9BA 5IP7G 4A3EG 2NVTH 3PUXA 1Q12A 3S1MH 1EWIA 4K0KL 4MTNA 1X55A 2R7DA 4JI5L 1VQCA 5GAHC 4PZ6A 2E8GA 3ULLA 3Q8DA 5C0XJ 2JA8H 2AHOB 1B7YB 4GN4B 4P71A 3UE0A 2R7ZG 4XTCS 1N32Q 2BA1A 1PH9A 4JI7Q 2R92G 4DR5L 3KFUA 4OWTB 4IOCA 1PH5A 1LM0A 1CKOA 3IRBA 3NBHB 1I94L 3HKSA 1OXSC 3RLOA 2PMZE 4HIMA 3F8TA 4ME3A 1QZGA 4B3RQ 2NVYH 1S72A 4A3CG 1FL0A 2D0PA 2F52A 4YWKA 1YJNA 4HIDA 3F2DA 1TWCH 1EIFA 5HY6A 2ASBA 1N36Q 2AKWB 2MO1A 1IBMQ 4YWMA 3F2BA 4PZ7A 1KC8C 3UDGA 2VNUD 3KDFB 3F2CA 3TQYA 1QVGA 4JG2A 4EQ5A 5IWAL 4WJ3M 2ZM6Q 1JJGA 2MFIA 4LF5Q 3PF5A 3VDYA 3CMAA 4DR2Q 4DV1L 4P72A 2OTLA 3FP9A 2JA6H 1J6QA 2ZTCA 1HZAA 3F1ZA 1KQSA 1Q46A 3JAMi 1QUQA 4QIWE 1OXXK 1X65A 4A76A 3S1RH 1A8VA 4A3DH 2JEBI 3B6YA 5FJ8H 2I0QA 4IFDI 3PCOB 1VQ5A 3E0EA 4R1JA 1I6HH 1N32L 4JI7L 2L15A 3J7A5 1UE6A 4B3TQ 1EUJA 3BZCA 3TS0A 3W1GA 1KRTA 2Z6KA 1XMQQ 3CD6A 4A3LH 2E2HH 1XTDA 1VCIA 4B3RL 2E2JH 2UUCQ 2XGTA 2WB1G 4A3BG 2MQHA 3M4QA 4LUZA 1N34Q 2PQAB 2BH8A 4AIMA 2CCZA 4DV0Q 2N49A 3L0OA 1X6OA 1J5EQ 1E24A 1N36L 1IBML 3CP0A 3S2DH 2PNHA 2OCEA 2K5VA 5M3FH 1NTGA 1IBKQ 2Q2IA 5C4XH 1PH6A 1BBUA 2VS1A 3MEFA 2IX1A 2MNAA 2KENA 1QVCA 3GTQH 2NN6I 2HQLA 2ZM6L 2R93H 4LF5L 1CKNB 4L5SA 2K5NA 4A93H 2NZHA 1Y1VH 4DR2L 4GN5A 1PFSA 3H0GG 3H15A 3TS2A 1SROA 2OWOA 3KDFA 1Q8KA 1KHIA 2WP8J 5FLXc 3KLWA 1VQAA 3HKZE 1KD1C 1L2FA 2NVXH 2JA5G 2UUAQ 4DUZQ 3OYYA 4B3TL 3ZJYC 2Z0SA 1XJVA 4QQBX 4KHPQ 1XMQL 1G291 1A62A 3D31A 1ASZA 4AH6A 2UUCL 3HOYG 4LF6Q 1TWAH 2KCTA 1N34L 2R92H 4AYBE 1IXRA 5IY0A 5M5WH 5C3EG 4LFBQ 2JA9A 4XIGS 5IYCH 4DV0L 3A5ZB 1J5EL 2IT1A 4C3HH 4A3JG 3H3VI 1YHBA 5GADC 4YWLA 5LMNQ 4DV4Q 4A3KG 1YJWA 3PO2G 4A3CH 1MJEA 1IBKL 3PO3G 3HOZG 3RZOH 4GS3A 4NB3A 4BXXG 4YY3Q 4HJ5A 4OO1I 4GKJQ 3NELA 1EIYB 1XPRA 2CWPA 4C3JH 5DLQE 4A3GG 4MNOA 5LMUQ 1WI5A 1FGUA 1V1QA 4PMWA 3T1YQ 2UXCQ 4LUVA 1K9MC 3S2HH 1YHQA 2ALYB 4LFAQ 4RMFA 3DLLA 3M3YH 1SE8A 2YU9H 4X62Q 1E1OA 1CKNA 1DGSA 3I56A 2Y0SE 3U4ZA 2UUAL 4DUZL 3CC7A 3NEMA 3ICEA 2V1CC 4KHPL 1RIPA 3ULPA 3HOUG 1HH2P 1GKHA 1UWVA 2GVBA 1VQKA 3JAMc 4LF6L 3S17H 4BA1I 1OXTA 3PUZA 1W2BA 4LFBL 3J81j 1NE3A 4IO9A 1EOVA 2OQKA 3GD7A 4TQUS 5LMNL 4DV4L 1OTCA 4B3SQ 4UP7A 3CCJA 4UP9A 1B8AA 3UE1A 4YY3L 3KJPA 1GO3E 4GKJL 1WCMG 2N3SA 1P8LA 2XTIA 5IYBH 3AYHB 4YCWA 1Q1BA 4OWWB 2LXJA 3AFPA 4H02A 4TVAB 2B63H 1X9NA 1K0RA 4FDBA 5LMUL 3I4NH 3T1YL 3EBEA 2KBNA 4DAMA 5HGQA 5IE8A 5JEAG 2UXCL 3SGIA 2F3IA 4PG3A 5C4JH 2BH2A 1VQEA 3HKZG 1NJIC 4LFAL 2EXDA 1JMCA 4NPSA 3H0GH 1I3QH 4X62L 3BJUA 1V9PA 3HOXG 3GTPH 4R4OA 4OWXB 1VQHA 1HR0W 1SN8A 4OX9Q 4RG1A 4BY1G 1NY4A 1JT8A 1HNWL 1PA6A 2RF4A 3GO5A 3FHWA 5C44G 4AYBG 1Q86C 1H95A 2YTVA 2CQOA 2YTYA 1OXVA 4P75A 4JI0Q 2VZAA 4LF9Q 1MIUA 3U58A 4A3IH 3G48A 5GAEC 1VQBA 3AEVA 4X6AH 5IP9H 3HOYH 4B3MQ 5C3EH 4B3SL 4JI8Q 1IZ6A 2D62A 2N8NA 2Q2UA 1G6PA 4L5TA 4GNXC 4OONA 4A3KH 4DR4Q 2JE6I 2R6GA 3PO2H 2A8VA 1SMXA 3CCQA 2AMCB 3CCMA 3HOZH 3K7AH 1TXYA 1UE5A 4BBRG 3PO3H 1CKMA 4EX5A 3EN2A 4P73A 2C35B 4LW1A 4DK6C 3CXCA 1PH8A 1JB7A 1YI2A 3BZKA 1K83H 4A3GH 3K0XA 1PH7A 3KOJA 3T1HQ 2Y0SG 2N78A 3CQZH 4GKKQ 2E2IH 4OX9L 1UE7A 1SRUA 4DK3C 1U0LA 4DR3Q 3CC2A 4JI4Q 2JJQA 4HJAA 1KIXA 2VY3A 3J7ZC 2BA0A 4GNXB 2NVQH 4GLAC
chains in the Genus database with same CATH superfamily
4LF9L 3JC66 4JBJA 3L2PA 1CHQD 3VYRA 2JA7G 1XNRQ 2XRSD 1ONLA 2K5WA 4LUOA 1ML0D 4CKBA 5CV4A 1B70B 3KK7A 5F2DA 1X3EA 3QWNA 1II3A 4JOIC 1F9PA 2B63B 3L9AX 3A0JA 1OXUA 4DR4L 3S1MB 2HDMA 3M4PA 3WDNA 2TMPA 5CMDA 3SK8A 4IJHA 4IUPA 5EKKA 1PMRA 2LKVA 1PV4A 3T1HL 3ITPA 5JEAH 4HJ7A 2F4VQ 4GOPB 2GN5A 2AWOA 1PVOA 2HCCA 1VQPA 4JI4L 1E3PA 1SE4A 3TN2A 1IW7C 1TWCB 4JPBW 3HOXH 1LV9A 4AQYQ 4J8QA 4JVZA 3AQQA 1EY0A 5C44H 4DR1L 5COYA 4XT3B 1IYJB 1D5ZC 1VQ9A 1V1PB 3HOWG 4A3DB 1N8RC 4ULLA 1IBLL 4UY8C 3CQZB 4YHHQ 3KBGA 2L4NA 4I65A 2E2HB 1T5XD 2RDHA 1RJTA 2C5CA 1XPUA 4H44C 3MWYW 5IGDA 1EFID 3M4OH 1F9RA 2I46A 5G3LD 4JI2L 1XMOQ 4JI6L 1WVLA 3VYTA 4FNFA 3LWEA 4GOPA 1LTID 5CV8A 5I6WA 4LFCL 4A3LG 2BOSA 3PF4A 3HS0C 5FLMH 1K8GA 2HD3A 1QJOA 2Q8RE 2H5XA 4RGNA 4CGYB 2CKZB 1STAA 4DV6Q 3M7NA 4BY7H 2K5HA 3TEHB 4A3MG 1U5KA 1HNXL 3I4MH 4DV3Q 3DXJC 5K36G 1M8AA 1V1PA 3U50C 3T56B 5M5WB 3GTLB 3ND9A 3KF6B 1AH9A 1R9TB 3MXNB 5EGTA 1CA5A 1B1ZA 2EYMA 4J1MA 1YIJA 3UI2A 1VQLA 4NXNQ 1EY8A 3OOCA 4YCVA 2MJ8A 4ILWA 2EY2A 5LMNW 1PRTB 4JW0A 2ZTDA 1E2ZA 2K04A 2VXWA 3SK6A 1H9MA 4WORA 1FJGL 2BDOA 2X6GA 4DR7Q 1X56A 3M3YB 1STGA 1Z47A 1LACA 2CW0D 3K0YA 2DNEA 4HSVA 1ENAA 3NSWA 2K6AA 5M3MG 3A8JE 3TZDA 3K7UC 3A8KE 3RZDH 5KEEA 4BBSH 3TP5A 1I4RA 2RA4A 1A63A 1SYGA 2L0CA 2WB1B 5J3BA 1EL0A 3HOUH 3G7LA 1BOSA 2XN9C 4O42A 2K03A 1NMFA 3CHBD 3KF6A 1ZXTA 1PLFA 5AJ3Q 1K8MA 3MXNA 3UDFA 4DV7L 1DYQA 3DMUA 3DWPA 4BA2I 2QW7A 5IGEA 1RKNA 4XYOA 1STEA 4QY7A 3PUVA 4F87A 1GUGA 5A2QL 2VUMH 1XNQQ 1EY6A 2K50A 3CCRA 1F77A 4OIJA 1JB3A 4WRDA 4GLVB 2UU9Q 1STYA 2F0WA 1BBWA 5IT9c 2FMMA 1EQRA 1LYLA 2WAQG 4NXMQ 3FKIH 4UPAA 3GTJH 1ILQA 2B2UA 4A3JB 1Q1EA 1GUNA 3URYA 3PO3B 3HOZB 1GD7A 2L55A 4X66L 5DM63 1HQMC 2OT2A 4JI1Q 3SXHA 4LF7Q 5IP9G 1K83B 2NZOA 2EXZA 3W1BA 2VQFQ 5BR8L 1KXLA 2ZJPA 4POGA 2AUJD 1I4HA 1ZKOA 2KHJA 1QVFA 4C56C 1TQOA 2NVQB 4ZLTF 2MP1A 1MKHA 4L5RC 1WJJA 1GVPA 1TR5A 3PSIA 3G71A 4DV2Q 1HZCA 4R4TA 3QIAA 4C1NI 1WTXA 1MJCA 1DOLA 4JI5Q 1FNUA 1HR0L 1DZ1A 4ZKBB 1EZ8A 1I4GA 3PIPA 4C3IB 1RTOA 1FR3A 1WCMB 2B2TA 4R4QA 3S1NH 1LTLA 4RA8A 3S24A 2WB1E 2RCNA 3NP8A 3PUWA 4MIUA 2A68D 1VQGA 3I70A 5M3FG 3EQLC 1PXUA 1PTOH 5C4XG 4L63B 1JOQA 3BZDB 1BCPC 3OIPA 3MTSA 3GTOH 5KNBA 2F0VA 1CSQA 4G7HC 1ILPA 3GDEA 1O78A 2F0GA 3R93A 4DV1Q 4FP5D 3Q23A 3M9BA 5IP7G 1ZEQX 4PZ6A 2E8GA 3OPOA 3Q8DA 3ULLA 2R7ZG 4GN4B 3I4LA 1N32Q 2R92G 4DR5L 4IOCA 1LM0A 1I94L 1V8QA 4C3HG 5JVG3 1AZPA 4ME3A 2NVYH 1FL0A 5CV7A 4YWKA 2XWJB 5KIXA 5HY6A 2ASBA 1IBMQ 4YWMA 4PZ7A 3KDFB 1D2BA 3H6MA 5DM73 5KYIA 2A6EC 1QVGA 4EQ5A 5IWAL 1JJGA 3HG9A 2MFIA 2JN4A 1Q3LA 2JA6H 2KJXA 2KEDA 2ZTCA 3F1ZA 1KQSA 4A76A 3PCOB 2EYOA 1WTOA 5C6AA 1E0BA 1UE6A 2IWHA 1EUJA 2M00A 1XMQQ 4A3LH 1XTDA 1VCIA 4QB4A 4A3BG 2MQHA 1N34Q 4OIKA 3N6RA 2N49A 3L0OA 1EYCA 3KLSA 1J5EQ 3X3NA 2PNHA 2OCEA 2K5VA 1IBKQ 5KNDA 2VS1A 3MEFA 3KUPA 2MNAA 1QVCA 3GTQH 5K36H 4EQPA 1NCVA 2ZM6L 4LF5L 2K5NA 1D5MC 1B4OA 3T13A 1EY4A 1S5DD 3H0GG 2OWOA 3HP3A 4KKUA 3KDFA 2EOTA 3C2PA 1LT4D 2F3VA 1VQAA 2F0UA 5FLXc 1KD1C 1UNSA 4DUZQ 3OYYA 2VB2X 2Z0SA 1JWMD 4KHPQ 1A62A 1X3QA 1AN8A 4AH6A 1ASZA 4LF6Q 1TWAH 5JJZA 4XXEA 2JA9A 4R8NA 1AZQA 3QR8A 3A5ZB 1GUWA 5GADC 4DV4Q 4IALA 4GS3A 4GKJQ 1XPRA 2F0JA 4A3GG 3QJYA 4KJNA 4PMWA 2NTTA 4K6LA 3R2IA 3D6WA 4LFAQ 2YU9H 1SNQA 4KTAA 3J80L 4O1NA 3NEMA 1WTRA 1UWVA 4U68A 2F0MA 1U9RA 3S2DB 4IO9A 4A3FB 5LMNL 4B3SQ 1B8AA 4YY3L 1GO3E 2RDFA 3CRKC 5AFWA 1P8LA 3M7GA 3OWEB 5A2QE 3P1HA 4RKLA 2QILA 2BDNA 5IGGA 1X9NA 1JWSD 3T1YL 4DAMA 5JEAG 4PG3A 2BH2A 1LT3D 3HKZG 2EXDA 1DOKA 1I3QH 4KD3A 4OHJA 3HOXG 4R4OA 1NY4A 4J6HA 4BBRB 3E6ZX 5C44G 3S16B 2CQOA 1VF7A 4LF9Q 3U58A 4NP5A 3RZOB 2KA7A 5IP9H 1GHKA 1CT1D 1VMPA 5C3EH 2A73B 1SFOB 4K8IA 3D3RA 5LL6S 4G57A 4PQXA 4A3KH 3R2TA 4DR4Q 1SYEA 3IFDA 2A8VA 3PO2H 3K7AH 1FD7D 2B2WC 2Z9HA 1TWHB 3MXUA 5J39A 4LW1A 3CXCA 1M4VA 1JB7A 3PQIA 4DXGA 3BZKA 5C5MA 4YIJA 1LTBD 1CTMA 1EWHA 3T1HQ 2N78A 3BYYB 4OX9L 2DY7A 4DK3C 4JI4Q 2L12A 1ESRA 4KY5A 1EQTA 2BA0A 2EYLA 4GNXB 1SMYD 4GLAC 4JI0L 3PMFA 1J8IA 2RHQB 1PHJA 3AMUA 1VQ8A 5FLMG 1C0AA 1DD2A 3RN5A 4DR1Q 1D6EC 5FO9B 2B2VC 4GZYC 2VW9A 1A3TA 4Q5VA 3OW2A 4BY7G 2AQ2B 3MFGA 3VYUA 3WWVA 1Y1WG 2NZ1D 3I4MG 1BBXC 2A6HC 1DXMA 4B9WA 2DUDA 3P7JA 2R61A 4QMGA 1IBLQ 1PTOF 3AU7A 1PYSB 2PCFB 4LWCA 5IP7H 1MGSA 2IX3A 5E3FA 1WTPA 3HFZB 3CCVA 2QGQA 4GKKL 4QGUA 4DR3L 3PGZA 2R7ZH 3J81i 3BDOA 3CCLA 1HZ9A 3E9IA 1IHZA 4TKOB 1TWFH 2WKCA 4ZK9B 4JI2Q 1YBYA 4JI6Q 3OMCA 1HNZL 1JE5A 4LFCQ 1QWYA 4GNXA 2PQAA 5JEAJ 4LF4L 1DCZA 2B3GA 3W5OA 3RR5A 3VYSA 1TU2B 3H09A 2K01A 1I6HB 1VQFA 3GTGH 4MTKA 5CR3A 1HNXQ 1LT5D 3FMCA 4BBSG 1B9NA 3RMHA 1STNA 2BE5C 4F7XA 2E2JB 5FKAC 2OF1A 1SYDA 3K5LA 2UUBL 2K33A 1VQDA 1Q90A 2E76C 3CC4A 2UXDL 2ZJRA 5ISRA 3RNUA 4A3DG 4IUVA 1CQVA 5FJ8G 3EJIA 2H1EA 4A3BH 1JOOA 2F0IA 3GTMH 2R93B 4A93B 3D0FA 3GTKH 4JOIA 3A74A 2VUMG 1GM5A 3K5NA 3G6JB 4EQNA 4QUCA 2HHHL 1FJGQ 1ZYRC 3CCSA 1XX8A 1MHWC 2NVXB 4X64L 3RN2A 3CPFA 1STHA 3I7FA 3C46A 3LGJA 4KV6A 3OHXC 5EPKA 1Y1VG 3FDTA 3FKIG 1ET9A 1HCZA 1RD9D 2I5MX 4DAVA 2CH4A 5G3LF 4APVA 2ICEC 1A0IA 3S1QH 1PRTD 2EY1A 3Q24A 1BCPD 3K80C 4ZKCB 3ER0A 5KNCA 4C3JB 1IL8A 4PV1C 3J81c 4DNRB 2KOLA 4DV7Q 4CKEA 1T9HA 5IYCG 1FVIA 3S2HB 3IKJA 2ZXOA 3A5UA 4GN3B 4IOAA 1C9OA 1D1IA 2B29A 1M1KC 3S17B 1PH3A 1SBBB 3ERQA 2A19A 1N33L 1LT6D 1O7LA 4E6IA 1V43A 3G6EA 3A56A 3VR5A 3KYHC 4HJ9A 4S3SA 4K5XA 1I6VC 2RVLA 3J80E 3S14H 1XYIA 3E0JA 3K5OA 3GQBA 4IFDH 2OTJA 2Z4HA 4HCEA 1S5ED 4LK1C 2K75A 2A6ED 4X66Q 5C4JB 4JBWA 3T4AC 2K4KA 2PQEA 2KHSA 2F03A 2EDGA 4JI3L 5BR8Q 4RWSC 5CBEE 1YNND 3K58A 2OQ0A 3DHQA 3J7YW 3I4NG 3HOYB 3R8BA 2JQOA 4CDDC 2QEXA 2LY7A 1BXTA 3DM3A 4Y7NH 1HR0Q 5CV6A 2B2YA 3U4VA 4O0AA 1D7QA 1UE1A 4OGQC 4DGZA 4C2MH 3V2TA 2RBMA 4A3IG 3JAML 1DOMA 1WTQA 2VQEL 2MO0A 2DGYA 4QIWB 4CDFC 2PNRC 5GROA 1W6KA 3RZDB 1F9SA 2JA6G 3C3LA 1EU4A 3HOVH 2IY5B 4FXGC 1XPOA 1KNAA 2Q2HA 2XVSA 2LS01 2F0NA 2X6LA 2G9DA 3QOLA 4LF8L 3OWFA 4NKLA 3CW2C 1EU3A 1GUSA 1VF5C 2SNMA 5BN3A 4DR5Q 3I4OA 1LTSD 2IJ0A 4IPHA 1NAPA 1VS0A 2Z6KC 3DWAA 1I94Q 4DNIA 1LUZA 4JV5L 4JYAL 5NUCA 1Y1WH 3K81C 5LL6X 3EIVA 5CV9A 5EJWA 1YNJD 3EFXD 2HUGA 1YEZA 5JJLA 2YYZA 3Q22A 2E5LL 1TS2A 2RCFA 5C4ZA 5JJKA 1LTRD 3CAMA 1B2TA 4DPGA 3TRZA 1AEXA 2CH4W 3STBC 5IWAQ 4BY1B 4FXDA 2AWNA 5FO7B 1BQQT 2K32A 1ET6A 4AYBB 3S15B 3I8ZA 4A3EG 4UAIA 4X3SA 3S1MH 4K0KL 5GAHC 1BCPB 1PH9A 1A2UA 4ABNA 4DXFA 2XIWA 1CKOA 3P75A 1CQFA 1HRJA 1U4RA 3RLOA 4HIMA 1I50B 1U4PA 1TWGB 1NNXA 3KLRA 3F2DA 1TWCH 1MI2A 2AUKA 1CM9A 2D2CC 4HSPA 3F2BA 2VNUD 5M5YB 3F2CA 1KDCA 3HRZC 3TQYA 4U673 4JG2A 2ZM6Q 3MEHA 4LF5Q 1W6JA 3NQIA 2QDBA 3TMEA 3FP9A 1J6QA 1HZAA 1Q46A 3MA2B 4QIWE 2J0TD 3VR4A 2JA7B 4A3DH 3BDCA 5FJ8H 5D14A 4X3KA 4JI7L 2L15A 3J7A5 5FOBB 2N88A 2F1MA 2WACA 2E2HH 1CZWA 3M4QA 2BH8A 3A7AB 1N36L 1PH6A 2EJGC 3SEBA 4KKSA 1JWUD 2IX1A 5DEHA 4DA2A 2HQLA 3KLSX 1H9JA 5I9PA 1CKNB 4HEDA 2NZHA 1Y1VH 4DR2L 4XQQA 1PFSA 1HUNA 1SROA 3J7AV 1Q8KA 3D8GA 1CHPD 2WP8J 2TSSA 3KLWA 2GA4B 4KJOA 3V05A 4KHVA 2JA5G 4KN7C 4B3TL 1G2TA 2F0PA 1S5CD 1WTVA 2JYOA 1EOTA 3LX0A 4KMUC 2UUCL 3HOWB 1BR9A 1Y8PB 2A6HD 4AYBE 1IXRA 5IY0A 5M5WH 5C3EG 4IUNA 2RSOA 5IYCH 4DV0L 3CRLC 1PDQA 4M8AA 1SE3A 3BDLA 5LMNQ 1K0SA 4A3KG 4A3CH 3PO2G 1MJEA 5A35A 3NTKA 4NB3A 4BXXG 4YY3Q 2LFNA 4NDXA 1PFNA 5DLQE 3T1YQ 1MD2D 3VR3A 1YHQA 3M3YH 1E1OA 1CKNA 1U4MA 2UUAL 3ICEA 2V1CC 4CKCA 1LTTD 3NHHA 2GVBA 1JQYD 4BA1I 3K57A 4F8MA 2IW3A 2F0TA 1SNMA 3J81j 1EOVA 4RHRA 4A3MB 4TQUS 1F2YA 1ICWA 1GHJA 3QB3A 4DF7A 3CCJA 4UP9A 4OEMB 4YCWA 4OWWB 4H02A 4N9PA 4TVAB 5M9OA 2AQ3B 2XNAC 1K0RA 4FDBA 5LMUL 3I4NH 1QE6A 2KBNA 3EBEA 5IE8A 2UXCL 3SGIA 1JMCA 2L1BA 3BJUA 1PZJD 3M4YA 1Z7TA 3HGBA 1SN8A 4OX9Q 5K5PA 2OEOA 1HNWL 2RF4A 3GO5A 2OXPA 4ZRZA 1I4XA 4JI0Q 4A3IH 1BDOA 3AEVA 5GAEC 5M3MB 4K8JA 5KGUA 1IZ6A 1PTOC 2N8NA 5M5XB 1HXYD 3JAME 2EY5A 4L5TA 3VR6A 5C3XA 2JE6I 2R6GA 3H94A 4RGOS 3TP7A 3CCQA 3CCMA 3HOZH 3PO3H 1SNDA 1TXYA 4H7BA 4BBRG 2Z8LA 4EQOA 2C35B 4Q0FA 4DK6C 1PH8A 4QF4A 2YU9B 1K83H 3VA5A 1PH7A 3KOJA 2Y0SG 4GKKQ 1AP0A 5IT9L 1UE7A 4DR3Q 1U0LA 3V96A 3PIO3 1KIXA 3U9OA 3J7ZC 2NVQH 3NBIA 1O7YA 1CFMA 1VDZA 4FF3A 4DN4M 1HNZQ 4B3ML 3AFQA 5T1IA 1E1TA 5GAGC 1EIHA 5KRUA 1F2ZA 1JORA 4LMQD 2RKSA 4K2KA 2NVTB 3Q6SA 4P74A 4LF4Q 5C0XG 5D3DA 4C3IH 2WAQB 1LTAD 4Z9CB 1WCMH 2ZXPA 3A54A 1L0WA 2EE1A 5CC4A 3WOEA 4WFN3 2EPBA 3I3CA 2ES2A 4IPGA 1O7IA 3MAQA 2Q8TA 2KEEA 4A3EH 1ASYA 3J7AF 3FPUB 1DONA 2UUBQ 3BVZA 1YNXA 2UXDQ 1SLJA 1PH1A 2JA8G 2NTSA 2XWBB 1B3QA 5GQOA 3BVGA 3T53B 3A7LA 2NYZD 1Q7YC 1IW7D 3SDZA 4ALPA 4RKBA 2B2WA 2HHHQ 2G5DA 4X64Q 5I9OA 3PV0A 1EEFD 3BU2A 3PUYA 2QA4A 2ID0A 3KJOA 1WD1A 4KLKA 5ELNA 4BS9A 3BYTB 2BCOA 1S5BD 3TREA 4JC0A 4IFDG 4A4IA 2IX0A 5M3FB 1L1OC 5C4XB 3DUZA 3T16A 1Y14B 2XRQD 2HQEA 3OTOL 2K52A 2B2VA 5D65A 4HIOA 4HAEA 1VMCA 1NSNS 4JI1L 5IGCA 1G8ZD 4KI0A 4WJ4A 2NN6G 1B3AA 1NUCA 4CBVA 3K8AA 1C8CA 2R7ZB 1KL9A 5D3IB 2R92B 1GJXA 1TY0A 1N33Q 2CFMA 2JA5H 1K3BC 4C3HB 5L37A 2WAQE 2B8GA 1L0YB 2CW0C 2KHIA 2ZTEA 1I5FA 1RF2D 3STBD 2EZVA 3CF5A 3FPPA 2MUYA 2JXMB 2MPMA 2X69A 2K05A 3NQTA 4FF2A 4BXXH 3FVQA 5JVH3 2EYJA 4DUYL 2IHEA 3HOVG 3K6OA 1ESFA 4JI3Q 3G4SA 4KD4A 1JJ2A 2WFWA 3GV3A 3GV6A 4DV5L 4FF1A 4P2CB 3S9WA 4XT1B 1WTHA 4A3BB 4IZ8A 1PRTF 1WYDA 3TZUA 1KAWA 2K7VA 1N9WA 4TRDA 5H1SE 5FLXL 4ME5A 2ICIA 3GTKB 3H91A 5E4WC 1GUTA 1AE3A 4HJ8A 1H9RA 1GXDC 1EY7A 4L5QA 3RLNA 1SR3A 5I4DA 2WINB 4OXPA 4DR6L 2KCMA 1WOCA 3H0GB 2VQEQ 1SYCA 1IL2A 2SNSA 2SDFA 4LAAA 3GTPB 5EQ0A 1EEID 4IUUA 4X65L 1E22A 5KYLA 4A3FH 4IFDJ 2B63G 1Q82C 3CKIB 2PMZB 4K6DA 2F3WA 2EJFC 4LF8Q 1LO5D 5EAYA 2GVAA 2EQSA 5ELBA 2QEJC 1K8AC 2UXBL 2PYKA 4QJFA 1PH4A 2QKIC 3KF8B 4JV5Q 4A3GB 4JYAQ 1K73C 1KAAA 4BBRH 3H3VH 2CWAA 2E2IB 3S16H 5CV5A 2DNCA 2E5LQ 3E5SA 3BS1A 1G91A 2PI2A 1VQ7A 4HIKA 2YTXA 3I2ZA 2EIFA 1RHPA 5BN5A 4ZQ3A 2F0LA 1X32A 4OO1H 2QF7A 1CUKA 1EQVA 2Z1CA 4CHTB 5IYDH 1TS3A 1SFOH 2DJFC 3D4DA 1Q81C 2XSCA 1YZ6A 4K0KQ 1CA6A 4O2DA 5IT9E 1TWHH 2HCIA 2RHSB 4IN3A 1A3UA 1TT2A 2LSSA 1QOHA 5C0XH 3MFYA 5HURA 1M90C 5C0XI 4FXKC 3HKZB 1VQ4A 1V1OA 1QUQB 3QG1A 3IAYA 1CK1A 1UEBA 2PW5A 3HOXB 5JJIA 5CYUA 2ATWA 1TS4A 3CCEA 3KF8A 4R4CA 4F88A 2PI2E 4CJ1B 1SNPA 4EVOA 4JBKA 4MZ9A 5C44B 4ZCKA 1Q12A 1EWIA 1X55A 2R7DA 1PZID 2JA8H 4P71A 1B7YB 3O13A 1FYCA 4KKTA 4JI7Q 4OWTB 3WOFA 1PH5A 4ZAIA 2PMZE 1DJRD 3F8TA 1QZGA 5JPNC 4A3CG 2K28A 1YJNA 4HIDA 1EIFA 4G7OC 1AFPA 3GP7A 2AKWB 2MO1A 4B9XA 1N36Q 1KC8C 2Q8IB 3UDGA 5E1FA 3M4OB 4RFBA 4X3UA 5EBCA 4WJ3M 3QO2A 4BWGB 4FF4A 3CMAA 4DR2Q 1ENFA 4P72A 1QCBD 1FNWA 3S1RH 1QUQA 2B39A 5ELDA 1G2SA 1A8VA 4C1NK 2JEBI 3B6YA 2I0QA 4IFDI 1O80A 2I07B 1PTOD 1RDPD 1I6HH 3OMGA 3EVQA 1KDAA 1UAPA 2V4DA 4B3TQ 3TS0A 4UHVA 4BY7B 1HQRD 1ENCA 2Z6KA 3D4WA 1Y1WB 4B3RL 2E2JH 2UUCQ 2XGTA 2WB1G 3I4MB 4NMZA 1JICA 3C1FA 4AIMA 4DV0Q 1OO9B 1QILA 3R3OA 1GOZA 3A55A 3CP0A 1IKLA 2Q2IA 4HCSA 1BBUA 2NN6H 2KENA 5T1GA 2NN6I 2R93H 1HA6A 2R3ZA 4L5SA 4A93H 4R8IA 3H15A 1KHIA 1TKWB 3HKZE 4CJ0B 1XTCD 1F9QA 1L2FA 2NVXH 2UUAQ 2DJGC 5I6YA 3SVMA 3ZJYC 1SNCA 2A74C 3D31A 2KCTA 4TSSA 1BNZA 4N8X1 2H4OA 5DNFA 4A3JG 1YHBA 1RTNA 2F4IA 4CJ2C 4BBSB 1STBA 3PO3G 3HOZG 3C1EA 1QG7A 1PZKD 1SYFA 4HJ5A 1EIYB 3HOUB 4C3JH 4WJWA 3VR2A 5LMUQ 1V1QA 2UXCQ 4RCNA 3S2HH 2ALYB 3DLLA 1SE8A 1FGBD 3LWUA 1MSHA 4FO2A 4HMJA 5FK9C 1RIPA 1PFBA 3ULPA 5EBDA 2VUMB 3S17H 1VQKA 1HNWQ 5FLXE 1W2BA 3K59A 4LFBL 1SJED 2M2LA 1HUMA 3I90A 3TSSA 3GD7A 3OW7A 4CDCC 4FVMA 1H9SB 4I7ZC 4MN3A 2F0HA 4UP7A 1ICFB 1K28A 4C3IG 3UE1A 1Y1VB 3J81L 3FKIB 1WCMG 2N3SA 3NK9A 4OL7A 3GTJB 3AYHB 4X3TA 2LXJA 2IPKD 3AFPA 2B63H 2JP1A 4V190 5IIFA 2K5DA 3NWSA 5HGQA 4R9WA 3D6CA 4HR7B 1NR2A 5C4JH 5J22A 3IFTA 1NJIC 4NPSA 4X62L 4ZUJA 1V9PA 2MHVA 1JT8A 1EIGA 3SE0A 3FHWA 1H95A 1B44D 2YTYA 4P75A 2VZAA 4RGMA 1SDFA 1VQBA 1XXGA 4X6AH 3HOYH 1JE4A 4B3MQ 1R4PB 2D62A 2K1BA 1G6PA 1SXTA 2B2YC 4OONA 4OELB 5I2XA 1UE5A 2FMCA 4EX5A 1KDBA 1SMYC 1H9SA 1KTKA 4H0LC 2PZWA 3K0XA 3S1NB 2A5HA 3CQZH 1QB5D 3DM1A 4ZUIA 5JOBA 3CC2A 2SOBA 1PTOB 2JJQA 4HJAA 1TS5A 4HN7A 3GTOB 5C5LA 1VQIA 3TP8A 2RQXA 1EY9A 3RUZA 4GOPC 4LNQA 4JI8L 1Q8IA 5JAVA 1A3VA 2D0OA 1VQOA 4XDXA 3J80i 3HEJA 3IL8A 3I4NB 4GLXA 1K3RA 3FRPB 1EYAA 2NB0A 2RDGA 5J1ZA 4IPCA 1A15A 3DEPA 1FNVA 1CSPA 2KUMA 1C48A 3T51B 1KLGD 3A8IE 3KBXA 2HDLA 2NVYB 1VQMA 4HMIA 3RLFA 4A3IB 3GTLH 1X3FA 1R9TH 4BY1H 2WIIB 1XNRL 1A6XA 3S15H 3OTOQ 3CU7A 3TP6A 2F0FA 2JA6B 1WFQA 2Q2TA 2A1AA 3OSOA 1KRSA 1J9OA 4I7AA 2EYPA 1S40A 1SE2A 3QOJA 4L6TB 1QZHA 2JK8A 1B50A 1I50H 1TWGH 1SJHD 4J15A 3DEOA 3SK4A 2JSOA 2F4VL 3PIOA 4ZYSA 2G9HD 2Z4IA 5ELCA 5M5YH 3TDQA 3L7ZC 2A69C 5ELOA 4ODGA 4G7ZC 4L8JA 4AQYL 3I91A 1CZGA 2EVBA 3GTQB 2BE5D 1RODA 3MC0B 3NTIA 1IYUA 1JR0D 1S3OA 4IQZA 2JA7H 4DFAA 2IHFA 4QUFA 3NXWA 1X3GA 2L5TA 1UEAB 2HIXA 2N55A 1VQ6A 2WKDA 1SNOA 3ERSX 3ULJA 4XYQA 4A3EB 1MSGA 4DUYQ 4A3FG 2L11A 4YHHL 1PRTC 3U9SA 1L1OB 2J4XA 2CVRA 3J80c 1Y8NB 2D5DA 4UP8A 1TWAB 1BVSA 1PH2A 2HT1A 4DV5Q 1ZYRD 4Y52H 4PMCA 4RGTA 2FXQA 1U4LA 1IYVA 1XMOL 1B53A 1E7ZA 1HPCA 1VQJA 5IOCA 2B2UC 2HIVA 2DY8A 1YHAA 1D8LA 1BKBA 4A3JH 1BUVT 4JBMA 2DN8A 4IPDA 1D1KA 4IURA 2PO4A 4B08A 3NUCA 2YV5A 4DKAC 4DR6Q 4R4IA 3UDXA 4DV6L 4M1UB 2KCNA 3HOWH 4OO1G 4DV3L 2KQ3A 3MVVA 3M85A 5IYDG 4X65Q 4QL5A 4YCUA 4PZ8A 2RSNA 1X54A 2IL8A 2CHBD 4DAYB 2NUCA 1NR4A 1HZBA 1EYGA 3CMEA 1Y8OB 4DU9A 1L1OA 1F2MA 2O2LD 1KLUD 1PFMA 4NXNL 1QNKA 4N8FA 3SR1A 2UXBQ 1KNEA 2ZT9C 1YNNC 5E7NA 1JJCB 3PIP3 2B2TC 4QCLA 2PW7A 4KHZA 4DR7L 4JCVE 1I3QB 1C7YA 1HJPA 2QCPX 3J81E 1NBWA 2Z6BA 4RCOA 1HTLD 2NBFA 3MXGA 5IYBG 4A3MH 3NENA 2JA5B 1SSOA 3CPWA 1YJ9A 1HFGA 2I5LX 4IUTA 3CCUA 3BVMA 1RCVD 5C3EB 1YVCA 2ZJQA 3NWTA 2NWGA 1G51A 4A3KB 3PO2B 4DAYA 5AJ3L 3K7AB 1RL2A 2LXKA 1TY2A 3UDIA 1YITA 4DAPA 3E9HA 2FJ2A 3TBIB 2F0QA 4K5VA 1Z9FA 3BG3A 1XNQL 4G4KA 4IJLA 2KECA 5LHY1 2EJMA 2UU9L 5C3WA 4K2LA 2K14A 1DM0B 1JCKB 1AE2A 5M3MH 1UUPA 5CBAE 5FO8B 2AQ1B 5M5XH 5HGTA 1NMGA 3I55A 1G6ZA 4NXML 3Q0AA 4POFA 2I5HA 1PYBA 4DK0A 4NW2A 2FHTA 2CQAA 1YNJC 1BO0A 3FEWX 5EKIA 1W3SA 1TIID 4PNYA 2K5QA 2JEAI 4LF7L 1EQQA 2F0DA 4A75A 2R7FA 2VL6A 2VQFL 3VA7A 2O5JC 4KY7A 4FYDA 2E75C 2R93G 1EFWA 1P16A 4A93G 3MHBA 1C4QA 1TWFB 3SK5A 1HTPA 2B8FA 4HTHA 4KY6A 1VQNA 3X3MA 4DV2L 1S4ZA 2NVTH 3PUXA 2FINB 4LJZC 4MTNA 1L0XB 5EPLA 4JI5L 1VQCA 5C0XJ 3N52A 3SHLA 2AHOB 5E4XA 3UE0A 4XTCS 2BA1A 3KFUA 3NBHB 2PZTA 3IRBA 3HKSA 1OXSC 3GTGB 1Y69U 5CORA 3AB9A 4B3RQ 4DK1A 1S72A 1S5FD 2F52A 2D0PA 1PYWD 1JC7A 4UDUC 1JOKA 5EKLA 4K5WA 4C3JG 2Y0SB 5ELFA 1A2TA 3L3OC 5TSSA 1SYBA 3PF5A 3VDYA 4DV1L 1HHVA 2OTLA 3GTMB 1BCPF 3JAMi 3NE5B 1D5XC 1OXXK 1X65A 4DNTB 1F2LA 1WTWA 3RD4A 1LLRD 2F0OA 3MZ5A 1HA5A 1VQ5A 3E0EA 4R1JA 4XQNA 1N32L 2KVMA 3OIQA 3BZCA 3W1GA 1KRTA 2SEBD 3CD6A 1R4QB 1XWEA 2M9VA 3F2UA 4LUZA 2ENBA 2PQAB 1EZ6A 2CCZA 1X6OA 1E24A 1IBML 3S2DH 1LABA 5EPJA 5M3FH 3NBHA 1NTGA 4EGVA 5C4XH 1B9MA 2ZXRA 1E2VA 4KK7A 3S1QB 3LNNA 4CDEC 2F0KA 4GN5A 3I73A 2E74C 3TS2A 2JA8B 5IGFA 3K5MA 5BN4A 1WD0A 1H9KA 1QNUA 5CGKA 1XJVA 4QQBX 1XMQL 1G291 3HOYG 2R92H 1N34L 2WV6D 3NTHA 4LFBQ 2L9HA 4XIGS 5IGBA 1J5EL 2IT1A 4C3HH 3H3VI 2KCCA 1YJWA 2MGSA 3EROA 4YWLA 1Z6HA 4V0BA 1IBKL 3MXPA 3ONAB 3RZOH 4PMBA 5JPMC 2PPBC 3HZXA 3NPPA 4OO1I 2O4XA 3NELA 2CWPA 3S1RB 3S14B 1I4QA 2VB3X 1SAPA 4MNOA 2A68C 1WI5A 1FGUA 2QDLA 3ND8A 1BF4A 4LUVA 1K9MC 1X3PA 1CI3M 4RMFA 4JK1C 2E2DC 4X62Q 1DGSA 3I56A 2Y0SE 3U4ZA 4DUZL 4MHEA 3CC7A 4KHPL 2EY6A 3HOUG 1HH2P 1GKHA 3JAMc 4LF6L 1OXTA 3PUZA 1NE3A 3I72A 2OQKA 1KABA 4ID6A 4DV4L 2F0EA 3D4RA 1OTCA 4XQJA 3H3VC 4RHSA 3KJPA 2O5IC 4GKJL 2XTIA 5IYBH 2EYFA 1Q1BA 5ELEA 2A69D 3W3AA 1EYDA 2J7ZA 4Y7NB 1I4PA 1O7ZA 1LTGD 5IODA 2F3IA 1EY5A 1VQEA 4LFAL 3H0GH 3ZYYX 4C2MB 2FFKB 3GTPH 1IKMA 2D9UA 4OWXB 1VQHA 1HR0W 3EA6A 4RAUC 4RG1A 4BY1G 2LMCB 4KN4C 1PA6A 1Q86C 4AYBG 2YTVA 1GUOA 1OXVA 1MBYA 5DAUA 1MIUA 3G48A 1K8OA 4IUQA 1HFNA 3HOVB 4N9TA 4RH6A 2C9OA 4B3SL 4JI8Q 2Q2UA 2PZUA 4H13C 4K14A 2F0SA 4GNXC 3P20A 1TVXA 1SMXA 2AMCB 1AW7A 5C4HA 1E2WA 3W2DA 1CKMA 2P5ZX 3EN2A 4P73A 1YI2A 3E3XA 4A3GH 3DWQA 2E2IH 2EYHA 1SRUA 1SEBD 1EWCA 5I2YA 2VY3A 1T5EA
chains in the Genus database with same CATH topology
4JI0L 4LF9L 1VQIA 2RHQB 3JC66 1PHJA 4JBJA 3L2PA 2JA7G 1HNZQ 5FLMG 1VQ8A 1XNRQ 1C0AA 4GOPC 3RN5A 4DR1Q 4LUOA 4B3ML 4LNQA 4JI8L 1B70B 3AFQA 1E1TA 5GAGC 2VW9A 1X3EA 2D0OA 1VQOA 4JOIC 3J80i 3OW2A 3A0JA 1OXUA 4BY7G 4DR4L 4P74A 4LF4Q 3M4PA 3WWVA 5C0XG 4GLXA 1Y1WG 1K3RA 4C3IH 3I4MG 1WCMH 2DUDA 4IPCA 4IJHA 1L0WA 1IBLQ 2ES2A 4IPGA 1PYSB 1O7IA 1PV4A 4LWCA 1CSPA 5IP7H 4A3EH 1ASYA 3T1HL 3HFZB 3CCVA 2QGQA 4HJ7A 4GKKL 4QGUA 2F4VQ 4GOPB 2GN5A 2AWOA 1VQMA 1PVOA 4DR3L 3PGZA 1VQPA 4JI4L 2R7ZH 1E3PA 2UUBQ 3J81i 3RLFA 3CCLA 1HZ9A 1YNXA 3E9IA 3GTLH 3HOXH 1X3FA 2UXDQ 1TWFH 1SLJA 1PH1A 4JI2Q 4AQYQ 1R9TH 1YBYA 4BY1H 2JA8G 4JI6Q 3AQQA 1HNZL 5GQOA 1XNRL 5C44H 4DR1L 3S15H 3OTOQ 1JE5A 4LFCQ 1IYJB 1WFQA 2Q2TA 2A1AA 4GNXA 1KRSA 2PQAA 1Q7YC 5JEAJ 4ALPA 1VQ9A 4LF4L 1S40A 2B3GA 3HOWG 3W5OA 1N8RC 3RR5A 2HHHQ 1QZHA 2JK8A 4X64Q 1VQFA 1IBLL 3GTGH 4UY8C 1I50H 3PV0A 1TWGH 4YHHQ 1HNXQ 4BBSG 4J15A 3BU2A 3PUYA 2QA4A 2F4VL 2ID0A 3KJOA 3PIOA 4KLKA 5ELNA 1XPUA 2UUBL 5M5YH 1VQDA 3CC4A 3M4OH 3L7ZC 3TREA 2ZJRA 4JC0A 5ELOA 4IFDG 2UXDL 4A4IA 3RNUA 4A3DG 2IX0A 5FJ8G 4AQYL 4JI2L 1XMOQ 4JI6L 1L1OC 4A3BH 1Y14B 4GOPA 3OTOL 3GTMH 2K52A 4LFCL 4A3LG 3D0FA 1S3OA 3GTKH 2JA7H 3PF4A 4JOIA 4HIOA 2IHFA 3A74A 5FLMH 1K8GA 2VUMG 1X3GA 1GM5A 2H5XA 4JI1L 2HIXA 2HHHL 1FJGQ 1VQ6A 3CCSA 2CKZB 3ERSX 3ULJA 4DV6Q 3M7NA 4BY7H 2K5HA 4X64L 3TEHB 4DUYQ 4A3FG 4A3MG 3RN2A 1U5KA 3CPFA 4KI0A 3I7FA 4YHHL 1HNXL 2NN6G 3I4MH 4WJ4A 4DV3Q 5K36G 1L1OB 3LGJA 3K8AA 1KL9A 3U50C 3J80c 4UP8A 1Y1VG 1BVSA 1PH2A 3FKIG 1N33Q 2HT1A 4DV5Q 2CFMA 3KF6B 1AH9A 2JA5H 2I5MX 4Y52H 3MXNB 2WAQE 4APVA 2FXQA 1YIJA 1A0IA 1XMOL 3S1QH 1E7ZA 1VQJA 1VQLA 4NXNQ 2KHIA 3K80C 2HIVA 2ZTEA 1YHAA 4YCVA 1D8LA 1BKBA 3ER0A 1I5FA 4A3JH 5LMNW 4JBMA 2ZTDA 3J81c 4IPDA 3STBD 4DV7Q 2YV5A 1T9HA 4DKAC 5IYCG 1FVIA 3CF5A 4DR6Q 3A5UA 4BXXH 1FJGL 4R4IA 4GN3B 4DR7Q 1X56A 3UDXA 4IOAA 4DV6L 1C9OA 1Z47A 4DUYL 2IHEA 3HOVG 3HOWH 4JI3Q 5M3MG 3G4SA 4DV3L 4OO1G 3M85A 5IYDG 2B29A 4X65Q 4QL5A 1M1KC 1JJ2A 2WFWA 3K7UC 4YCUA 4PZ8A 3RZDH 1PH3A 2A19A 1N33L 1X54A 4DV5L 4DAYB 4BBSH 1V43A 3G6EA 1A63A 1HZBA 5J3BA 1EYGA 3KYHC 3CMEA 4HJ9A 3HOUH 1L1OA 1WYDA 1KAWA 3S14H 1N9WA 4NXNL 5H1SE 1NMFA 2OTJA 1AE3A 3KF6A 4HJ8A 5AJ3Q 2K75A 4L5QA 2UXBQ 3UDFA 3RLNA 4DV7L 1SR3A 5E7NA 4X66Q 1JJCB 4DR6L 4OXPA 4BA2I 4JBWA 4KHZA 4DR7L 2KCMA 4JCVE 2K4KA 1WOCA 1IL2A 4QY7A 2VQEQ 1C7YA 3PUVA 1HJPA 2VUMH 1XNQQ 2K50A 4JI3L 5BR8Q 1NBWA 3CCRA 4X65L 4GLVB 2UU9Q 1HNWQ 1E22A 5IYBG 4A3MH 3NENA 4A3FH 3CPWA 4IFDJ 1BBWA 5IT9c 2B63G 1Q82C 1YJ9A 2OQ0A 3I4NG 2I5LX 1EQRA 3CCUA 1LYLA 2WAQG 2JQOA 4NXMQ 3FKIH 4UPAA 1YVCA 2QEXA 2ZJQA 3GTJH 4LF8Q 1Q1EA 5EAYA 3DM3A 4Y7NH 1G51A 2GVAA 2EQSA 1HR0Q 5AJ3L 3U4VA 1RL2A 4O0AA 1D7QA 1GD7A 2LXKA 1K8AC 2UXBL 3UDIA 1UE1A 4X66L 1YITA 4C2MH 3E9HA 4JI1Q 4A3IG 4LF7Q 4QJFA 1PH4A 5IP9G 3KF8B 2NZOA 1Z9FA 2MO0A 2VQEL 2DGYA 1K73C 4JV5Q 4JYAQ 3W1BA 2VQFQ 1XNQL 5GROA 4BBRH 5BR8L 4IJLA 2CWAA 3H3VH 2ZJPA 3S16H 1KXLA 4POGA 2UU9L 2KHJA 2E5LQ 1QVFA 2K14A 2PI2A 2JA6G 1VQ7A 4HIKA 2YTXA 3I2ZA 2EIFA 3HOVH 1MKHA 4L5RC 2IY5B 1AE2A 5M3MH 1WJJA 1CUKA 5IYDH 1GVPA 5M5XH 1XPOA 1NMGA 3PSIA 3I55A 1SFOH 1Q81C 4NXML 3G71A 4DV2Q 2Q2HA 1HZCA 4R4TA 4POFA 2I5HA 1YZ6A 1PYBA 4LF8L 4K0KQ 1MJCA 4O2DA 4JI5Q 3CW2C 1TWHH 2RHSB 1HR0L 3PIPA 1W3SA 4DR5Q 3I4OA 4IPHA 1VS0A 2Z6KC 1I94Q 4R4QA 3S1NH 2JEAI 1LTLA 4LF7L 4DNIA 1LUZA 3S24A 1EQQA 2WB1E 2RCNA 3PUWA 2LSSA 4A75A 4JV5L 1VQGA 5M3FG 4JYAL 2R7FA 2VL6A 5C4XG 1Y1WH 2VQFL 3K81C 1M90C 3EIVA 5C0XI 3GTOH 2R93G 1VQ4A 1EFWA 1CSQA 1P16A 1YEZA 1QUQB 2YYZA 2E5LL 4A93G 5JJLA 5JJKA 1UEBA 3GDEA 5JJIA 3CAMA 4DPGA 3TRZA 2ATWA 5IWAQ 4R4CA 3STBC 3CCEA 2PI2E 2AWNA 1VQNA 4JBKA 4DV1Q 4DV2L 4MZ9A 3M9BA 5IP7G 4A3EG 2NVTH 3PUXA 1Q12A 3S1MH 1EWIA 4K0KL 4MTNA 1X55A 2R7DA 4JI5L 1VQCA 5GAHC 4PZ6A 2E8GA 3ULLA 3Q8DA 5C0XJ 2JA8H 2AHOB 1B7YB 4GN4B 4P71A 3UE0A 2R7ZG 4XTCS 1N32Q 2BA1A 1PH9A 4JI7Q 2R92G 4DR5L 3KFUA 4OWTB 4IOCA 1PH5A 1LM0A 1CKOA 3IRBA 3NBHB 1I94L 3HKSA 1OXSC 3RLOA 2PMZE 4HIMA 3F8TA 4ME3A 1QZGA 4B3RQ 2NVYH 1S72A 4A3CG 1FL0A 2D0PA 2F52A 4YWKA 1YJNA 4HIDA 3F2DA 1TWCH 1EIFA 5HY6A 2ASBA 1N36Q 2AKWB 2MO1A 1IBMQ 4YWMA 3F2BA 4PZ7A 1KC8C 3UDGA 2VNUD 3KDFB 3F2CA 3TQYA 1QVGA 4JG2A 4EQ5A 5IWAL 4WJ3M 2ZM6Q 1JJGA 2MFIA 4LF5Q 3PF5A 3VDYA 3CMAA 4DR2Q 4DV1L 4P72A 2OTLA 3FP9A 2JA6H 1J6QA 2ZTCA 1HZAA 3F1ZA 1KQSA 1Q46A 3JAMi 1QUQA 4QIWE 1OXXK 1X65A 4A76A 3S1RH 1A8VA 4A3DH 2JEBI 3B6YA 5FJ8H 2I0QA 4IFDI 3PCOB 1VQ5A 3E0EA 4R1JA 1I6HH 1N32L 4JI7L 2L15A 3J7A5 1UE6A 4B3TQ 1EUJA 3BZCA 3TS0A 3W1GA 1KRTA 2Z6KA 1XMQQ 3CD6A 4A3LH 2E2HH 1XTDA 1VCIA 4B3RL 2E2JH 2UUCQ 2XGTA 2WB1G 4A3BG 2MQHA 3M4QA 4LUZA 1N34Q 2PQAB 2BH8A 4AIMA 2CCZA 4DV0Q 2N49A 3L0OA 1X6OA 1J5EQ 1E24A 1N36L 1IBML 3CP0A 3S2DH 2PNHA 2OCEA 2K5VA 5M3FH 1NTGA 1IBKQ 2Q2IA 5C4XH 1PH6A 1BBUA 2VS1A 3MEFA 2IX1A 2MNAA 2KENA 1QVCA 3GTQH 2NN6I 2HQLA 2ZM6L 2R93H 4LF5L 1CKNB 4L5SA 2K5NA 4A93H 2NZHA 1Y1VH 4DR2L 4GN5A 1PFSA 3H0GG 3H15A 3TS2A 1SROA 2OWOA 3KDFA 1Q8KA 1KHIA 2WP8J 5FLXc 3KLWA 1VQAA 3HKZE 1KD1C 1L2FA 2NVXH 2JA5G 2UUAQ 4DUZQ 3OYYA 4B3TL 3ZJYC 2Z0SA 1XJVA 4QQBX 4KHPQ 1XMQL 1G291 1A62A 3D31A 1ASZA 4AH6A 2UUCL 3HOYG 4LF6Q 1TWAH 2KCTA 1N34L 2R92H 4AYBE 1IXRA 5IY0A 5M5WH 5C3EG 4LFBQ 2JA9A 4XIGS 5IYCH 4DV0L 3A5ZB 1J5EL 2IT1A 4C3HH 4A3JG 3H3VI 1YHBA 5GADC 4YWLA 5LMNQ 4DV4Q 4A3KG 1YJWA 3PO2G 4A3CH 1MJEA 1IBKL 3PO3G 3HOZG 3RZOH 4GS3A 4NB3A 4BXXG 4YY3Q 4HJ5A 4OO1I 4GKJQ 3NELA 1EIYB 1XPRA 2CWPA 4C3JH 5DLQE 4A3GG 4MNOA 5LMUQ 1WI5A 1FGUA 1V1QA 4PMWA 3T1YQ 2UXCQ 4LUVA 1K9MC 3S2HH 1YHQA 2ALYB 4LFAQ 4RMFA 3DLLA 3M3YH 1SE8A 2YU9H 4X62Q 1E1OA 1CKNA 1DGSA 3I56A 2Y0SE 3U4ZA 2UUAL 4DUZL 3CC7A 3NEMA 3ICEA 2V1CC 4KHPL 1RIPA 3ULPA 3HOUG 1HH2P 1GKHA 1UWVA 2GVBA 1VQKA 3JAMc 4LF6L 3S17H 4BA1I 1OXTA 3PUZA 1W2BA 4LFBL 3J81j 1NE3A 4IO9A 1EOVA 2OQKA 3GD7A 4TQUS 5LMNL 4DV4L 1OTCA 4B3SQ 4UP7A 3CCJA 4UP9A 1B8AA 3UE1A 4YY3L 3KJPA 1GO3E 4GKJL 1WCMG 2N3SA 1P8LA 2XTIA 5IYBH 3AYHB 4YCWA 1Q1BA 4OWWB 2LXJA 3AFPA 4H02A 4TVAB 2B63H 1X9NA 1K0RA 4FDBA 5LMUL 3I4NH 3T1YL 3EBEA 2KBNA 4DAMA 5HGQA 5IE8A 5JEAG 2UXCL 3SGIA 2F3IA 4PG3A 5C4JH 2BH2A 1VQEA 3HKZG 1NJIC 4LFAL 2EXDA 1JMCA 4NPSA 3H0GH 1I3QH 4X62L 3BJUA 1V9PA 3HOXG 3GTPH 4R4OA 4OWXB 1VQHA 1HR0W 1SN8A 4OX9Q 4RG1A 4BY1G 1NY4A 1JT8A 1HNWL 1PA6A 2RF4A 3GO5A 3FHWA 5C44G 4AYBG 1Q86C 1H95A 2YTVA 2CQOA 2YTYA 1OXVA 4P75A 4JI0Q 2VZAA 4LF9Q 1MIUA 3U58A 4A3IH 3G48A 5GAEC 1VQBA 3AEVA 4X6AH 5IP9H 3HOYH 4B3MQ 5C3EH 4B3SL 4JI8Q 1IZ6A 2D62A 2N8NA 2Q2UA 1G6PA 4L5TA 4GNXC 4OONA 4A3KH 4DR4Q 2JE6I 2R6GA 3PO2H 2A8VA 1SMXA 3CCQA 2AMCB 3CCMA 3HOZH 3K7AH 1TXYA 1UE5A 4BBRG 3PO3H 1CKMA 4EX5A 3EN2A 4P73A 2C35B 4LW1A 4DK6C 3CXCA 1PH8A 1JB7A 1YI2A 3BZKA 1K83H 4A3GH 3K0XA 1PH7A 3KOJA 3T1HQ 2Y0SG 2N78A 3CQZH 4GKKQ 2E2IH 4OX9L 1UE7A 1SRUA 4DK3C 1U0LA 4DR3Q 3CC2A 4JI4Q 2JJQA 4HJAA 1KIXA 2VY3A 3J7ZC 2BA0A 4GNXB 2NVQH 4GLAC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4JI0 L;  4LF9 L;  1VQI A;  2RHQ B;  3JC6 6;  1PHJ A;  4JBJ A;  3L2P A;  2JA7 G;  1HNZ Q;  5FLM G;  1VQ8 A;  1XNR Q;  1C0A A;  4GOP C;  3RN5 A;  4DR1 Q;  4LUO A;  4B3M L;  4LNQ A;  4JI8 L;  1B70 B;  3AFQ A;  1E1T A;  5GAG C;  2VW9 A;  1X3E A;  2D0O A;  1VQO A;  4JOI C;  3J80 i;  3OW2 A;  3A0J A;  1OXU A;  4BY7 G;  4DR4 L;  4P74 A;  4LF4 Q;  3M4P A;  3WWV A;  5C0X G;  4GLX A;  1Y1W G;  1K3R A;  4C3I H;  3I4M G;  1WCM H;  2DUD A;  4IPC A;  4IJH A;  1L0W A;  1IBL Q;  2ES2 A;  4IPG A;  1PYS B;  1O7I A;  1PV4 A;  4LWC A;  1CSP A;  5IP7 H;  4A3E H;  1ASY A;  3T1H L;  3HFZ B;  3CCV A;  2QGQ A;  4HJ7 A;  4GKK L;  4QGU A;  2F4V Q;  4GOP B;  2GN5 A;  2AWO A;  1VQM A;  1PVO A;  4DR3 L;  3PGZ A;  1VQP A;  4JI4 L;  2R7Z H;  1E3P A;  2UUB Q;  3J81 i;  3RLF A;  3CCL A;  1HZ9 A;  1YNX A;  3E9I A;  3GTL H;  3HOX H;  1X3F A;  2UXD Q;  1TWF H;  1SLJ A;  1PH1 A;  4JI2 Q;  4AQY Q;  1R9T H;  1YBY A;  4BY1 H;  2JA8 G;  4JI6 Q;  3AQQ A;  1HNZ L;  5GQO A;  1XNR L;  5C44 H;  4DR1 L;  3S15 H;  3OTO Q;  1JE5 A;  4LFC Q;  1IYJ B;  1WFQ A;  2Q2T A;  2A1A A;  4GNX A;  1KRS A;  2PQA A;  1Q7Y C;  5JEA J;  4ALP A;  1VQ9 A;  4LF4 L;  1S40 A;  2B3G A;  3HOW G;  3W5O A;  1N8R C;  3RR5 A;  2HHH Q;  1QZH A;  2JK8 A;  4X64 Q;  1VQF A;  1IBL L;  3GTG H;  4UY8 C;  1I50 H;  3PV0 A;  1TWG H;  4YHH Q;  1HNX Q;  4BBS G;  4J15 A;  3BU2 A;  3PUY A;  2QA4 A;  2F4V L;  2ID0 A;  3KJO A;  3PIO A;  4KLK A;  5ELN A;  1XPU A;  2UUB L;  5M5Y H;  1VQD A;  3CC4 A;  3M4O H;  3L7Z C;  3TRE A;  2ZJR A;  4JC0 A;  5ELO A;  4IFD G;  2UXD L;  4A4I A;  3RNU A;  4A3D G;  2IX0 A;  5FJ8 G;  4AQY L;  4JI2 L;  1XMO Q;  4JI6 L;  1L1O C;  4A3B H;  1Y14 B;  4GOP A;  3OTO L;  3GTM H;  2K52 A;  4LFC L;  4A3L G;  3D0F A;  1S3O A;  3GTK H;  2JA7 H;  3PF4 A;  4JOI A;  4HIO A;  2IHF A;  3A74 A;  5FLM H;  1K8G A;  2VUM G;  1X3G A;  1GM5 A;  2H5X A;  4JI1 L;  2HIX A;  2HHH L;  1FJG Q;  1VQ6 A;  3CCS A;  2CKZ B;  3ERS X;  3ULJ A;  4DV6 Q;  3M7N A;  4BY7 H;  2K5H A;  4X64 L;  3TEH B;  4DUY Q;  4A3F G;  4A3M G;  3RN2 A;  1U5K A;  3CPF A;  4KI0 A;  3I7F A;  4YHH L;  1HNX L;  2NN6 G;  3I4M H;  4WJ4 A;  4DV3 Q;  5K36 G;  1L1O B;  3LGJ A;  3K8A A;  1KL9 A;  3U50 C;  3J80 c;  4UP8 A;  1Y1V G;  1BVS A;  1PH2 A;  3FKI G;  1N33 Q;  2HT1 A;  4DV5 Q;  2CFM A;  3KF6 B;  1AH9 A;  2JA5 H;  2I5M X;  4Y52 H;  3MXN B;  2WAQ E;  4APV A;  2FXQ A;  1YIJ A;  1A0I A;  1XMO L;  3S1Q H;  1E7Z A;  1VQJ A;  1VQL A;  4NXN Q;  2KHI A;  3K80 C;  2HIV A;  2ZTE A;  1YHA A;  4YCV A;  1D8L A;  1BKB A;  3ER0 A;  1I5F A;  4A3J H;  5LMN W;  4JBM A;  2ZTD A;  3J81 c;  4IPD A;  3STB D;  4DV7 Q;  2YV5 A;  1T9H A;  4DKA C;  5IYC G;  1FVI A;  3CF5 A;  4DR6 Q;  3A5U A;  4BXX H;  1FJG L;  4R4I A;  4GN3 B;  4DR7 Q;  1X56 A;  3UDX A;  4IOA A;  4DV6 L;  1C9O A;  1Z47 A;  4DUY L;  2IHE A;  3HOV G;  3HOW H;  4JI3 Q;  5M3M G;  3G4S A;  4DV3 L;  4OO1 G;  3M85 A;  5IYD G;  2B29 A;  4X65 Q;  4QL5 A;  1M1K C;  1JJ2 A;  2WFW A;  3K7U C;  4YCU A;  4PZ8 A;  3RZD H;  1PH3 A;  2A19 A;  1N33 L;  1X54 A;  4DV5 L;  4DAY B;  4BBS H;  1V43 A;  3G6E A;  1A63 A;  1HZB A;  5J3B A;  1EYG A;  3KYH C;  3CME A;  4HJ9 A;  3HOU H;  1L1O A;  1WYD A;  1KAW A;  3S14 H;  1N9W A;  4NXN L;  5H1S E;  1NMF A;  2OTJ A;  1AE3 A;  3KF6 A;  4HJ8 A;  5AJ3 Q;  2K75 A;  4L5Q A;  2UXB Q;  3UDF A;  3RLN A;  4DV7 L;  1SR3 A;  5E7N A;  4X66 Q;  1JJC B;  4DR6 L;  4OXP A;  4BA2 I;  4JBW A;  4KHZ A;  4DR7 L;  2KCM A;  4JCV E;  2K4K A;  1WOC A;  1IL2 A;  4QY7 A;  2VQE Q;  1C7Y A;  3PUV A;  1HJP A;  2VUM H;  1XNQ Q;  2K50 A;  4JI3 L;  5BR8 Q;  1NBW A;  3CCR A;  4X65 L;  4GLV B;  2UU9 Q;  1HNW Q;  1E22 A;  5IYB G;  4A3M H;  3NEN A;  4A3F H;  3CPW A;  4IFD J;  1BBW A;  5IT9 c;  2B63 G;  1Q82 C;  1YJ9 A;  2OQ0 A;  3I4N G;  2I5L X;  1EQR A;  3CCU A;  1LYL A;  2WAQ G;  2JQO A;  4NXM Q;  3FKI H;  4UPA A;  1YVC A;  2QEX A;  2ZJQ A;  3GTJ H;  4LF8 Q;  1Q1E A;  5EAY A;  3DM3 A;  4Y7N H;  1G51 A;  2GVA A;  2EQS A;  1HR0 Q;  5AJ3 L;  3U4V A;  1RL2 A;  4O0A A;  1D7Q A;  1GD7 A;  2LXK A;  1K8A C;  2UXB L;  3UDI A;  1UE1 A;  4X66 L;  1YIT A;  4C2M H;  3E9H A;  4JI1 Q;  4A3I G;  4LF7 Q;  4QJF A;  1PH4 A;  5IP9 G;  3KF8 B;  2NZO A;  1Z9F A;  2MO0 A;  2VQE L;  2DGY A;  1K73 C;  4JV5 Q;  4JYA Q;  3W1B A;  2VQF Q;  1XNQ L;  5GRO A;  4BBR H;  5BR8 L;  4IJL A;  2CWA A;  3H3V H;  2ZJP A;  3S16 H;  1KXL A;  4POG A;  2UU9 L;  2KHJ A;  2E5L Q;  1QVF A;  2K14 A;  2PI2 A;  2JA6 G;  1VQ7 A;  4HIK A;  2YTX A;  3I2Z A;  2EIF A;  3HOV H;  1MKH A;  4L5R C;  2IY5 B;  1AE2 A;  5M3M H;  1WJJ A;  1CUK A;  5IYD H;  1GVP A;  5M5X H;  1XPO A;  1NMG A;  3PSI A;  3I55 A;  1SFO H;  1Q81 C;  4NXM L;  3G71 A;  4DV2 Q;  2Q2H A;  1HZC A;  4R4T A;  4POF A;  2I5H A;  1YZ6 A;  1PYB A;  4LF8 L;  4K0K Q;  1MJC A;  4O2D A;  4JI5 Q;  3CW2 C;  1TWH H;  2RHS B;  1HR0 L;  3PIP A;  1W3S A;  4DR5 Q;  3I4O A;  4IPH A;  1VS0 A;  2Z6K C;  1I94 Q;  4R4Q A;  3S1N H;  2JEA I;  1LTL A;  4LF7 L;  4DNI A;  1LUZ A;  3S24 A;  1EQQ A;  2WB1 E;  2RCN A;  3PUW A;  2LSS A;  4A75 A;  4JV5 L;  1VQG A;  5M3F G;  4JYA L;  2R7F A;  2VL6 A;  5C4X G;  1Y1W H;  2VQF L;  3K81 C;  1M90 C;  3EIV A;  5C0X I;  3GTO H;  2R93 G;  1VQ4 A;  1EFW A;  1CSQ A;  1P16 A;  1YEZ A;  1QUQ B;  2YYZ A;  2E5L L;  4A93 G;  5JJL A;  5JJK A;  1UEB A;  3GDE A;  5JJI A;  3CAM A;  4DPG A;  3TRZ A;  2ATW A;  5IWA Q;  4R4C A;  3STB C;  3CCE A;  2PI2 E;  2AWN A;  1VQN A;  4JBK A;  4DV1 Q;  4DV2 L;  4MZ9 A;  3M9B A;  5IP7 G;  4A3E G;  2NVT H;  3PUX A;  1Q12 A;  3S1M H;  1EWI A;  4K0K L;  4MTN A;  1X55 A;  2R7D A;  4JI5 L;  1VQC A;  5GAH C;  4PZ6 A;  2E8G A;  3ULL A;  3Q8D A;  5C0X J;  2JA8 H;  2AHO B;  1B7Y B;  4GN4 B;  4P71 A;  3UE0 A;  2R7Z G;  4XTC S;  1N32 Q;  2BA1 A;  1PH9 A;  4JI7 Q;  2R92 G;  4DR5 L;  3KFU A;  4OWT B;  4IOC A;  1PH5 A;  1LM0 A;  1CKO A;  3IRB A;  3NBH B;  1I94 L;  3HKS A;  1OXS C;  3RLO A;  2PMZ E;  4HIM A;  3F8T A;  4ME3 A;  1QZG A;  4B3R Q;  2NVY H;  1S72 A;  4A3C G;  1FL0 A;  2D0P A;  2F52 A;  4YWK A;  1YJN A;  4HID A;  3F2D A;  1TWC H;  1EIF A;  5HY6 A;  2ASB A;  1N36 Q;  2AKW B;  2MO1 A;  1IBM Q;  4YWM A;  3F2B A;  4PZ7 A;  1KC8 C;  3UDG A;  2VNU D;  3KDF B;  3F2C A;  3TQY A;  1QVG A;  4JG2 A;  4EQ5 A;  5IWA L;  4WJ3 M;  2ZM6 Q;  1JJG A;  2MFI A;  4LF5 Q;  3PF5 A;  3VDY A;  3CMA A;  4DR2 Q;  4DV1 L;  4P72 A;  2OTL A;  3FP9 A;  2JA6 H;  1J6Q A;  2ZTC A;  1HZA A;  3F1Z A;  1KQS A;  1Q46 A;  3JAM i;  1QUQ A;  4QIW E;  1OXX K;  1X65 A;  4A76 A;  3S1R H;  1A8V A;  4A3D H;  2JEB I;  3B6Y A;  5FJ8 H;  2I0Q A;  4IFD I;  3PCO B;  1VQ5 A;  3E0E A;  4R1J A;  1I6H H;  1N32 L;  4JI7 L;  2L15 A;  3J7A 5;  1UE6 A;  4B3T Q;  1EUJ A;  3BZC A;  3TS0 A;  3W1G A;  1KRT A;  2Z6K A;  1XMQ Q;  3CD6 A;  4A3L H;  2E2H H;  1XTD A;  1VCI A;  4B3R L;  2E2J H;  2UUC Q;  2XGT A;  2WB1 G;  4A3B G;  2MQH A;  3M4Q A;  4LUZ A;  1N34 Q;  2PQA B;  2BH8 A;  4AIM A;  2CCZ A;  4DV0 Q;  2N49 A;  3L0O A;  1X6O A;  1J5E Q;  1E24 A;  1N36 L;  1IBM L;  3CP0 A;  3S2D H;  2PNH A;  2OCE A;  2K5V A;  5M3F H;  1NTG A;  1IBK Q;  2Q2I A;  5C4X H;  1PH6 A;  1BBU A;  2VS1 A;  3MEF A;  2IX1 A;  2MNA A;  2KEN A;  1QVC A;  3GTQ H;  2NN6 I;  2HQL A;  2ZM6 L;  2R93 H;  4LF5 L;  1CKN B;  4L5S A;  2K5N A;  4A93 H;  2NZH A;  1Y1V H;  4DR2 L;  4GN5 A;  1PFS A;  3H0G G;  3H15 A;  3TS2 A;  1SRO A;  2OWO A;  3KDF A;  1Q8K A;  1KHI A;  2WP8 J;  5FLX c;  3KLW A;  1VQA A;  3HKZ E;  1KD1 C;  1L2F A;  2NVX H;  2JA5 G;  2UUA Q;  4DUZ Q;  3OYY A;  4B3T L;  3ZJY C;  2Z0S A;  1XJV A;  4QQB X;  4KHP Q;  1XMQ L;  1G29 1;  1A62 A;  3D31 A;  1ASZ A;  4AH6 A;  2UUC L;  3HOY G;  4LF6 Q;  1TWA H;  2KCT A;  1N34 L;  2R92 H;  4AYB E;  1IXR A;  5IY0 A;  5M5W H;  5C3E G;  4LFB Q;  2JA9 A;  4XIG S;  5IYC H;  4DV0 L;  3A5Z B;  1J5E L;  2IT1 A;  4C3H H;  4A3J G;  3H3V I;  1YHB A;  5GAD C;  4YWL A;  5LMN Q;  4DV4 Q;  4A3K G;  1YJW A;  3PO2 G;  4A3C H;  1MJE A;  1IBK L;  3PO3 G;  3HOZ G;  3RZO H;  4GS3 A;  4NB3 A;  4BXX G;  4YY3 Q;  4HJ5 A;  4OO1 I;  4GKJ Q;  3NEL A;  1EIY B;  1XPR A;  2CWP A;  4C3J H;  5DLQ E;  4A3G G;  4MNO A;  5LMU Q;  1WI5 A;  1FGU A;  1V1Q A;  4PMW A;  3T1Y Q;  2UXC Q;  4LUV A;  1K9M C;  3S2H H;  1YHQ A;  2ALY B;  4LFA Q;  4RMF A;  3DLL A;  3M3Y H;  1SE8 A;  2YU9 H;  4X62 Q;  1E1O A;  1CKN A;  1DGS A;  3I56 A;  2Y0S E;  3U4Z A;  2UUA L;  4DUZ L;  3CC7 A;  3NEM A;  3ICE A;  2V1C C;  4KHP L;  1RIP A;  3ULP A;  3HOU G;  1HH2 P;  1GKH A;  1UWV A;  2GVB A;  1VQK A;  3JAM c;  4LF6 L;  3S17 H;  4BA1 I;  1OXT A;  3PUZ A;  1W2B A;  4LFB L;  3J81 j;  1NE3 A;  4IO9 A;  1EOV A;  2OQK A;  3GD7 A;  4TQU S;  5LMN L;  4DV4 L;  1OTC A;  4B3S Q;  4UP7 A;  3CCJ A;  4UP9 A;  1B8A A;  3UE1 A;  4YY3 L;  3KJP A;  1GO3 E;  4GKJ L;  1WCM G;  2N3S A;  1P8L A;  2XTI A;  5IYB H;  3AYH B;  4YCW A;  1Q1B A;  4OWW B;  2LXJ A;  3AFP A;  4H02 A;  4TVA B;  2B63 H;  1X9N A;  1K0R A;  4FDB A;  5LMU L;  3I4N H;  3T1Y L;  3EBE A;  2KBN A;  4DAM A;  5HGQ A;  5IE8 A;  5JEA G;  2UXC L;  3SGI A;  2F3I A;  4PG3 A;  5C4J H;  2BH2 A;  1VQE A;  3HKZ G;  1NJI C;  4LFA L;  2EXD A;  1JMC A;  4NPS A;  3H0G H;  1I3Q H;  4X62 L;  3BJU A;  1V9P A;  3HOX G;  3GTP H;  4R4O A;  4OWX B;  1VQH A;  1HR0 W;  1SN8 A;  4OX9 Q;  4RG1 A;  4BY1 G;  1NY4 A;  1JT8 A;  1HNW L;  1PA6 A;  2RF4 A;  3GO5 A;  3FHW A;  5C44 G;  4AYB G;  1Q86 C;  1H95 A;  2YTV A;  2CQO A;  2YTY A;  1OXV A;  4P75 A;  4JI0 Q;  2VZA A;  4LF9 Q;  1MIU A;  3U58 A;  4A3I H;  3G48 A;  5GAE C;  1VQB A;  3AEV A;  4X6A H;  5IP9 H;  3HOY H;  4B3M Q;  5C3E H;  4B3S L;  4JI8 Q;  1IZ6 A;  2D62 A;  2N8N A;  2Q2U A;  1G6P A;  4L5T A;  4GNX C;  4OON A;  4A3K H;  4DR4 Q;  2JE6 I;  2R6G A;  3PO2 H;  2A8V A;  1SMX A;  3CCQ A;  2AMC B;  3CCM A;  3HOZ H;  3K7A H;  1TXY A;  1UE5 A;  4BBR G;  3PO3 H;  1CKM A;  4EX5 A;  3EN2 A;  4P73 A;  2C35 B;  4LW1 A;  4DK6 C;  3CXC A;  1PH8 A;  1JB7 A;  1YI2 A;  3BZK A;  1K83 H;  4A3G H;  3K0X A;  1PH7 A;  3KOJ A;  3T1H Q;  2Y0S G;  2N78 A;  3CQZ H;  4GKK Q;  2E2I H;  4OX9 L;  1UE7 A;  1SRU A;  4DK3 C;  1U0L A;  4DR3 Q;  3CC2 A;  4JI4 Q;  2JJQ A;  4HJA A;  1KIX A;  2VY3 A;  3J7Z C;  2BA0 A;  4GNX B;  2NVQ H;  4GLA C; 
#chains in the Genus database with same CATH topology
 4LF9 L;  3JC6 6;  4JBJ A;  3L2P A;  1CHQ D;  3VYR A;  2JA7 G;  1XNR Q;  2XRS D;  1ONL A;  2K5W A;  4LUO A;  1ML0 D;  4CKB A;  5CV4 A;  1B70 B;  3KK7 A;  5F2D A;  1X3E A;  3QWN A;  1II3 A;  4JOI C;  1F9P A;  2B63 B;  3L9A X;  3A0J A;  1OXU A;  4DR4 L;  3S1M B;  2HDM A;  3M4P A;  3WDN A;  2TMP A;  5CMD A;  3SK8 A;  4IJH A;  4IUP A;  5EKK A;  1PMR A;  2LKV A;  1PV4 A;  3T1H L;  3ITP A;  5JEA H;  4HJ7 A;  2F4V Q;  4GOP B;  2GN5 A;  2AWO A;  1PVO A;  2HCC A;  1VQP A;  4JI4 L;  1E3P A;  1SE4 A;  3TN2 A;  1IW7 C;  1TWC B;  4JPB W;  3HOX H;  1LV9 A;  4AQY Q;  4J8Q A;  4JVZ A;  3AQQ A;  1EY0 A;  5C44 H;  4DR1 L;  5COY A;  4XT3 B;  1IYJ B;  1D5Z C;  1VQ9 A;  1V1P B;  3HOW G;  4A3D B;  1N8R C;  4ULL A;  1IBL L;  4UY8 C;  3CQZ B;  4YHH Q;  3KBG A;  2L4N A;  4I65 A;  2E2H B;  1T5X D;  2RDH A;  1RJT A;  2C5C A;  1XPU A;  4H44 C;  3MWY W;  5IGD A;  1EFI D;  3M4O H;  1F9R A;  2I46 A;  5G3L D;  4JI2 L;  1XMO Q;  4JI6 L;  1WVL A;  3VYT A;  4FNF A;  3LWE A;  4GOP A;  1LTI D;  5CV8 A;  5I6W A;  4LFC L;  4A3L G;  2BOS A;  3PF4 A;  3HS0 C;  5FLM H;  1K8G A;  2HD3 A;  1QJO A;  2Q8R E;  2H5X A;  4RGN A;  4CGY B;  2CKZ B;  1STA A;  4DV6 Q;  3M7N A;  4BY7 H;  2K5H A;  3TEH B;  4A3M G;  1U5K A;  1HNX L;  3I4M H;  4DV3 Q;  3DXJ C;  5K36 G;  1M8A A;  1V1P A;  3U50 C;  3T56 B;  5M5W B;  3GTL B;  3ND9 A;  3KF6 B;  1AH9 A;  1R9T B;  3MXN B;  5EGT A;  1CA5 A;  1B1Z A;  2EYM A;  4J1M A;  1YIJ A;  3UI2 A;  1VQL A;  4NXN Q;  1EY8 A;  3OOC A;  4YCV A;  2MJ8 A;  4ILW A;  2EY2 A;  5LMN W;  1PRT B;  4JW0 A;  2ZTD A;  1E2Z A;  2K04 A;  2VXW A;  3SK6 A;  1H9M A;  4WOR A;  1FJG L;  2BDO A;  2X6G A;  4DR7 Q;  1X56 A;  3M3Y B;  1STG A;  1Z47 A;  1LAC A;  2CW0 D;  3K0Y A;  2DNE A;  4HSV A;  1ENA A;  3NSW A;  2K6A A;  5M3M G;  3A8J E;  3TZD A;  3K7U C;  3A8K E;  3RZD H;  5KEE A;  4BBS H;  3TP5 A;  1I4R A;  2RA4 A;  1A63 A;  1SYG A;  2L0C A;  2WB1 B;  5J3B A;  1EL0 A;  3HOU H;  3G7L A;  1BOS A;  2XN9 C;  4O42 A;  2K03 A;  1NMF A;  3CHB D;  3KF6 A;  1ZXT A;  1PLF A;  5AJ3 Q;  1K8M A;  3MXN A;  3UDF A;  4DV7 L;  1DYQ A;  3DMU A;  3DWP A;  4BA2 I;  2QW7 A;  5IGE A;  1RKN A;  4XYO A;  1STE A;  4QY7 A;  3PUV A;  4F87 A;  1GUG A;  5A2Q L;  2VUM H;  1XNQ Q;  1EY6 A;  2K50 A;  3CCR A;  1F77 A;  4OIJ A;  1JB3 A;  4WRD A;  4GLV B;  2UU9 Q;  1STY A;  2F0W A;  1BBW A;  5IT9 c;  2FMM A;  1EQR A;  1LYL A;  2WAQ G;  4NXM Q;  3FKI H;  4UPA A;  3GTJ H;  1ILQ A;  2B2U A;  4A3J B;  1Q1E A;  1GUN A;  3URY A;  3PO3 B;  3HOZ B;  1GD7 A;  2L55 A;  4X66 L;  5DM6 3;  1HQM C;  2OT2 A;  4JI1 Q;  3SXH A;  4LF7 Q;  5IP9 G;  1K83 B;  2NZO A;  2EXZ A;  3W1B A;  2VQF Q;  5BR8 L;  1KXL A;  2ZJP A;  4POG A;  2AUJ D;  1I4H A;  1ZKO A;  2KHJ A;  1QVF A;  4C56 C;  1TQO A;  2NVQ B;  4ZLT F;  2MP1 A;  1MKH A;  4L5R C;  1WJJ A;  1GVP A;  1TR5 A;  3PSI A;  3G71 A;  4DV2 Q;  1HZC A;  4R4T A;  3QIA A;  4C1N I;  1WTX A;  1MJC A;  1DOL A;  4JI5 Q;  1FNU A;  1HR0 L;  1DZ1 A;  4ZKB B;  1EZ8 A;  1I4G A;  3PIP A;  4C3I B;  1RTO A;  1FR3 A;  1WCM B;  2B2T A;  4R4Q A;  3S1N H;  1LTL A;  4RA8 A;  3S24 A;  2WB1 E;  2RCN A;  3NP8 A;  3PUW A;  4MIU A;  2A68 D;  1VQG A;  3I70 A;  5M3F G;  3EQL C;  1PXU A;  1PTO H;  5C4X G;  4L63 B;  1JOQ A;  3BZD B;  1BCP C;  3OIP A;  3MTS A;  3GTO H;  5KNB A;  2F0V A;  1CSQ A;  4G7H C;  1ILP A;  3GDE A;  1O78 A;  2F0G A;  3R93 A;  4DV1 Q;  4FP5 D;  3Q23 A;  3M9B A;  5IP7 G;  1ZEQ X;  4PZ6 A;  2E8G A;  3OPO A;  3Q8D A;  3ULL A;  2R7Z G;  4GN4 B;  3I4L A;  1N32 Q;  2R92 G;  4DR5 L;  4IOC A;  1LM0 A;  1I94 L;  1V8Q A;  4C3H G;  5JVG 3;  1AZP A;  4ME3 A;  2NVY H;  1FL0 A;  5CV7 A;  4YWK A;  2XWJ B;  5KIX A;  5HY6 A;  2ASB A;  1IBM Q;  4YWM A;  4PZ7 A;  3KDF B;  1D2B A;  3H6M A;  5DM7 3;  5KYI A;  2A6E C;  1QVG A;  4EQ5 A;  5IWA L;  1JJG A;  3HG9 A;  2MFI A;  2JN4 A;  1Q3L A;  2JA6 H;  2KJX A;  2KED A;  2ZTC A;  3F1Z A;  1KQS A;  4A76 A;  3PCO B;  2EYO A;  1WTO A;  5C6A A;  1E0B A;  1UE6 A;  2IWH A;  1EUJ A;  2M00 A;  1XMQ Q;  4A3L H;  1XTD A;  1VCI A;  4QB4 A;  4A3B G;  2MQH A;  1N34 Q;  4OIK A;  3N6R A;  2N49 A;  3L0O A;  1EYC A;  3KLS A;  1J5E Q;  3X3N A;  2PNH A;  2OCE A;  2K5V A;  1IBK Q;  5KND A;  2VS1 A;  3MEF A;  3KUP A;  2MNA A;  1QVC A;  3GTQ H;  5K36 H;  4EQP A;  1NCV A;  2ZM6 L;  4LF5 L;  2K5N A;  1D5M C;  1B4O A;  3T13 A;  1EY4 A;  1S5D D;  3H0G G;  2OWO A;  3HP3 A;  4KKU A;  3KDF A;  2EOT A;  3C2P A;  1LT4 D;  2F3V A;  1VQA A;  2F0U A;  5FLX c;  1KD1 C;  1UNS A;  4DUZ Q;  3OYY A;  2VB2 X;  2Z0S A;  1JWM D;  4KHP Q;  1A62 A;  1X3Q A;  1AN8 A;  4AH6 A;  1ASZ A;  4LF6 Q;  1TWA H;  5JJZ A;  4XXE A;  2JA9 A;  4R8N A;  1AZQ A;  3QR8 A;  3A5Z B;  1GUW A;  5GAD C;  4DV4 Q;  4IAL A;  4GS3 A;  4GKJ Q;  1XPR A;  2F0J A;  4A3G G;  3QJY A;  4KJN A;  4PMW A;  2NTT A;  4K6L A;  3R2I A;  3D6W A;  4LFA Q;  2YU9 H;  1SNQ A;  4KTA A;  3J80 L;  4O1N A;  3NEM A;  1WTR A;  1UWV A;  4U68 A;  2F0M A;  1U9R A;  3S2D B;  4IO9 A;  4A3F B;  5LMN L;  4B3S Q;  1B8A A;  4YY3 L;  1GO3 E;  2RDF A;  3CRK C;  5AFW A;  1P8L A;  3M7G A;  3OWE B;  5A2Q E;  3P1H A;  4RKL A;  2QIL A;  2BDN A;  5IGG A;  1X9N A;  1JWS D;  3T1Y L;  4DAM A;  5JEA G;  4PG3 A;  2BH2 A;  1LT3 D;  3HKZ G;  2EXD A;  1DOK A;  1I3Q H;  4KD3 A;  4OHJ A;  3HOX G;  4R4O A;  1NY4 A;  4J6H A;  4BBR B;  3E6Z X;  5C44 G;  3S16 B;  2CQO A;  1VF7 A;  4LF9 Q;  3U58 A;  4NP5 A;  3RZO B;  2KA7 A;  5IP9 H;  1GHK A;  1CT1 D;  1VMP A;  5C3E H;  2A73 B;  1SFO B;  4K8I A;  3D3R A;  5LL6 S;  4G57 A;  4PQX A;  4A3K H;  3R2T A;  4DR4 Q;  1SYE A;  3IFD A;  2A8V A;  3PO2 H;  3K7A H;  1FD7 D;  2B2W C;  2Z9H A;  1TWH B;  3MXU A;  5J39 A;  4LW1 A;  3CXC A;  1M4V A;  1JB7 A;  3PQI A;  4DXG A;  3BZK A;  5C5M A;  4YIJ A;  1LTB D;  1CTM A;  1EWH A;  3T1H Q;  2N78 A;  3BYY B;  4OX9 L;  2DY7 A;  4DK3 C;  4JI4 Q;  2L12 A;  1ESR A;  4KY5 A;  1EQT A;  2BA0 A;  2EYL A;  4GNX B;  1SMY D;  4GLA C;  4JI0 L;  3PMF A;  1J8I A;  2RHQ B;  1PHJ A;  3AMU A;  1VQ8 A;  5FLM G;  1C0A A;  1DD2 A;  3RN5 A;  4DR1 Q;  1D6E C;  5FO9 B;  2B2V C;  4GZY C;  2VW9 A;  1A3T A;  4Q5V A;  3OW2 A;  4BY7 G;  2AQ2 B;  3MFG A;  3VYU A;  3WWV A;  1Y1W G;  2NZ1 D;  3I4M G;  1BBX C;  2A6H C;  1DXM A;  4B9W A;  2DUD A;  3P7J A;  2R61 A;  4QMG A;  1IBL Q;  1PTO F;  3AU7 A;  1PYS B;  2PCF B;  4LWC A;  5IP7 H;  1MGS A;  2IX3 A;  5E3F A;  1WTP A;  3HFZ B;  3CCV A;  2QGQ A;  4GKK L;  4QGU A;  4DR3 L;  3PGZ A;  2R7Z H;  3J81 i;  3BDO A;  3CCL A;  1HZ9 A;  3E9I A;  1IHZ A;  4TKO B;  1TWF H;  2WKC A;  4ZK9 B;  4JI2 Q;  1YBY A;  4JI6 Q;  3OMC A;  1HNZ L;  1JE5 A;  4LFC Q;  1QWY A;  4GNX A;  2PQA A;  5JEA J;  4LF4 L;  1DCZ A;  2B3G A;  3W5O A;  3RR5 A;  3VYS A;  1TU2 B;  3H09 A;  2K01 A;  1I6H B;  1VQF A;  3GTG H;  4MTK A;  5CR3 A;  1HNX Q;  1LT5 D;  3FMC A;  4BBS G;  1B9N A;  3RMH A;  1STN A;  2BE5 C;  4F7X A;  2E2J B;  5FKA C;  2OF1 A;  1SYD A;  3K5L A;  2UUB L;  2K33 A;  1VQD A;  1Q90 A;  2E76 C;  3CC4 A;  2UXD L;  2ZJR A;  5ISR A;  3RNU A;  4A3D G;  4IUV A;  1CQV A;  5FJ8 G;  3EJI A;  2H1E A;  4A3B H;  1JOO A;  2F0I A;  3GTM H;  2R93 B;  4A93 B;  3D0F A;  3GTK H;  4JOI A;  3A74 A;  2VUM G;  1GM5 A;  3K5N A;  3G6J B;  4EQN A;  4QUC A;  2HHH L;  1FJG Q;  1ZYR C;  3CCS A;  1XX8 A;  1MHW C;  2NVX B;  4X64 L;  3RN2 A;  3CPF A;  1STH A;  3I7F A;  3C46 A;  3LGJ A;  4KV6 A;  3OHX C;  5EPK A;  1Y1V G;  3FDT A;  3FKI G;  1ET9 A;  1HCZ A;  1RD9 D;  2I5M X;  4DAV A;  2CH4 A;  5G3L F;  4APV A;  2ICE C;  1A0I A;  3S1Q H;  1PRT D;  2EY1 A;  3Q24 A;  1BCP D;  3K80 C;  4ZKC B;  3ER0 A;  5KNC A;  4C3J B;  1IL8 A;  4PV1 C;  3J81 c;  4DNR B;  2KOL A;  4DV7 Q;  4CKE A;  1T9H A;  5IYC G;  1FVI A;  3S2H B;  3IKJ A;  2ZXO A;  3A5U A;  4GN3 B;  4IOA A;  1C9O A;  1D1I A;  2B29 A;  1M1K C;  3S17 B;  1PH3 A;  1SBB B;  3ERQ A;  2A19 A;  1N33 L;  1LT6 D;  1O7L A;  4E6I A;  1V43 A;  3G6E A;  3A56 A;  3VR5 A;  3KYH C;  4HJ9 A;  4S3S A;  4K5X A;  1I6V C;  2RVL A;  3J80 E;  3S14 H;  1XYI A;  3E0J A;  3K5O A;  3GQB A;  4IFD H;  2OTJ A;  2Z4H A;  4HCE A;  1S5E D;  4LK1 C;  2K75 A;  2A6E D;  4X66 Q;  5C4J B;  4JBW A;  3T4A C;  2K4K A;  2PQE A;  2KHS A;  2F03 A;  2EDG A;  4JI3 L;  5BR8 Q;  4RWS C;  5CBE E;  1YNN D;  3K58 A;  2OQ0 A;  3DHQ A;  3J7Y W;  3I4N G;  3HOY B;  3R8B A;  2JQO A;  4CDD C;  2QEX A;  2LY7 A;  1BXT A;  3DM3 A;  4Y7N H;  1HR0 Q;  5CV6 A;  2B2Y A;  3U4V A;  4O0A A;  1D7Q A;  1UE1 A;  4OGQ C;  4DGZ A;  4C2M H;  3V2T A;  2RBM A;  4A3I G;  3JAM L;  1DOM A;  1WTQ A;  2VQE L;  2MO0 A;  2DGY A;  4QIW B;  4CDF C;  2PNR C;  5GRO A;  1W6K A;  3RZD B;  1F9S A;  2JA6 G;  3C3L A;  1EU4 A;  3HOV H;  2IY5 B;  4FXG C;  1XPO A;  1KNA A;  2Q2H A;  2XVS A;  2LS0 1;  2F0N A;  2X6L A;  2G9D A;  3QOL A;  4LF8 L;  3OWF A;  4NKL A;  3CW2 C;  1EU3 A;  1GUS A;  1VF5 C;  2SNM A;  5BN3 A;  4DR5 Q;  3I4O A;  1LTS D;  2IJ0 A;  4IPH A;  1NAP A;  1VS0 A;  2Z6K C;  3DWA A;  1I94 Q;  4DNI A;  1LUZ A;  4JV5 L;  4JYA L;  5NUC A;  1Y1W H;  3K81 C;  5LL6 X;  3EIV A;  5CV9 A;  5EJW A;  1YNJ D;  3EFX D;  2HUG A;  1YEZ A;  5JJL A;  2YYZ A;  3Q22 A;  2E5L L;  1TS2 A;  2RCF A;  5C4Z A;  5JJK A;  1LTR D;  3CAM A;  1B2T A;  4DPG A;  3TRZ A;  1AEX A;  2CH4 W;  3STB C;  5IWA Q;  4BY1 B;  4FXD A;  2AWN A;  5FO7 B;  1BQQ T;  2K32 A;  1ET6 A;  4AYB B;  3S15 B;  3I8Z A;  4A3E G;  4UAI A;  4X3S A;  3S1M H;  4K0K L;  5GAH C;  1BCP B;  1PH9 A;  1A2U A;  4ABN A;  4DXF A;  2XIW A;  1CKO A;  3P75 A;  1CQF A;  1HRJ A;  1U4R A;  3RLO A;  4HIM A;  1I50 B;  1U4P A;  1TWG B;  1NNX A;  3KLR A;  3F2D A;  1TWC H;  1MI2 A;  2AUK A;  1CM9 A;  2D2C C;  4HSP A;  3F2B A;  2VNU D;  5M5Y B;  3F2C A;  1KDC A;  3HRZ C;  3TQY A;  4U67 3;  4JG2 A;  2ZM6 Q;  3MEH A;  4LF5 Q;  1W6J A;  3NQI A;  2QDB A;  3TME A;  3FP9 A;  1J6Q A;  1HZA A;  1Q46 A;  3MA2 B;  4QIW E;  2J0T D;  3VR4 A;  2JA7 B;  4A3D H;  3BDC A;  5FJ8 H;  5D14 A;  4X3K A;  4JI7 L;  2L15 A;  3J7A 5;  5FOB B;  2N88 A;  2F1M A;  2WAC A;  2E2H H;  1CZW A;  3M4Q A;  2BH8 A;  3A7A B;  1N36 L;  1PH6 A;  2EJG C;  3SEB A;  4KKS A;  1JWU D;  2IX1 A;  5DEH A;  4DA2 A;  2HQL A;  3KLS X;  1H9J A;  5I9P A;  1CKN B;  4HED A;  2NZH A;  1Y1V H;  4DR2 L;  4XQQ A;  1PFS A;  1HUN A;  1SRO A;  3J7A V;  1Q8K A;  3D8G A;  1CHP D;  2WP8 J;  2TSS A;  3KLW A;  2GA4 B;  4KJO A;  3V05 A;  4KHV A;  2JA5 G;  4KN7 C;  4B3T L;  1G2T A;  2F0P A;  1S5C D;  1WTV A;  2JYO A;  1EOT A;  3LX0 A;  4KMU C;  2UUC L;  3HOW B;  1BR9 A;  1Y8P B;  2A6H D;  4AYB E;  1IXR A;  5IY0 A;  5M5W H;  5C3E G;  4IUN A;  2RSO A;  5IYC H;  4DV0 L;  3CRL C;  1PDQ A;  4M8A A;  1SE3 A;  3BDL A;  5LMN Q;  1K0S A;  4A3K G;  4A3C H;  3PO2 G;  1MJE A;  5A35 A;  3NTK A;  4NB3 A;  4BXX G;  4YY3 Q;  2LFN A;  4NDX A;  1PFN A;  5DLQ E;  3T1Y Q;  1MD2 D;  3VR3 A;  1YHQ A;  3M3Y H;  1E1O A;  1CKN A;  1U4M A;  2UUA L;  3ICE A;  2V1C C;  4CKC A;  1LTT D;  3NHH A;  2GVB A;  1JQY D;  4BA1 I;  3K57 A;  4F8M A;  2IW3 A;  2F0T A;  1SNM A;  3J81 j;  1EOV A;  4RHR A;  4A3M B;  4TQU S;  1F2Y A;  1ICW A;  1GHJ A;  3QB3 A;  4DF7 A;  3CCJ A;  4UP9 A;  4OEM B;  4YCW A;  4OWW B;  4H02 A;  4N9P A;  4TVA B;  5M9O A;  2AQ3 B;  2XNA C;  1K0R A;  4FDB A;  5LMU L;  3I4N H;  1QE6 A;  2KBN A;  3EBE A;  5IE8 A;  2UXC L;  3SGI A;  1JMC A;  2L1B A;  3BJU A;  1PZJ D;  3M4Y A;  1Z7T A;  3HGB A;  1SN8 A;  4OX9 Q;  5K5P A;  2OEO A;  1HNW L;  2RF4 A;  3GO5 A;  2OXP A;  4ZRZ A;  1I4X A;  4JI0 Q;  4A3I H;  1BDO A;  3AEV A;  5GAE C;  5M3M B;  4K8J A;  5KGU A;  1IZ6 A;  1PTO C;  2N8N A;  5M5X B;  1HXY D;  3JAM E;  2EY5 A;  4L5T A;  3VR6 A;  5C3X A;  2JE6 I;  2R6G A;  3H94 A;  4RGO S;  3TP7 A;  3CCQ A;  3CCM A;  3HOZ H;  3PO3 H;  1SND A;  1TXY A;  4H7B A;  4BBR G;  2Z8L A;  4EQO A;  2C35 B;  4Q0F A;  4DK6 C;  1PH8 A;  4QF4 A;  2YU9 B;  1K83 H;  3VA5 A;  1PH7 A;  3KOJ A;  2Y0S G;  4GKK Q;  1AP0 A;  5IT9 L;  1UE7 A;  4DR3 Q;  1U0L A;  3V96 A;  3PIO 3;  1KIX A;  3U9O A;  3J7Z C;  2NVQ H;  3NBI A;  1O7Y A;  1CFM A;  1VDZ A;  4FF3 A;  4DN4 M;  1HNZ Q;  4B3M L;  3AFQ A;  5T1I A;  1E1T A;  5GAG C;  1EIH A;  5KRU A;  1F2Z A;  1JOR A;  4LMQ D;  2RKS A;  4K2K A;  2NVT B;  3Q6S A;  4P74 A;  4LF4 Q;  5C0X G;  5D3D A;  4C3I H;  2WAQ B;  1LTA D;  4Z9C B;  1WCM H;  2ZXP A;  3A54 A;  1L0W A;  2EE1 A;  5CC4 A;  3WOE A;  4WFN 3;  2EPB A;  3I3C A;  2ES2 A;  4IPG A;  1O7I A;  3MAQ A;  2Q8T A;  2KEE A;  4A3E H;  1ASY A;  3J7A F;  3FPU B;  1DON A;  2UUB Q;  3BVZ A;  1YNX A;  2UXD Q;  1SLJ A;  1PH1 A;  2JA8 G;  2NTS A;  2XWB B;  1B3Q A;  5GQO A;  3BVG A;  3T53 B;  3A7L A;  2NYZ D;  1Q7Y C;  1IW7 D;  3SDZ A;  4ALP A;  4RKB A;  2B2W A;  2HHH Q;  2G5D A;  4X64 Q;  5I9O A;  3PV0 A;  1EEF D;  3BU2 A;  3PUY A;  2QA4 A;  2ID0 A;  3KJO A;  1WD1 A;  4KLK A;  5ELN A;  4BS9 A;  3BYT B;  2BCO A;  1S5B D;  3TRE A;  4JC0 A;  4IFD G;  4A4I A;  2IX0 A;  5M3F B;  1L1O C;  5C4X B;  3DUZ A;  3T16 A;  1Y14 B;  2XRQ D;  2HQE A;  3OTO L;  2K52 A;  2B2V A;  5D65 A;  4HIO A;  4HAE A;  1VMC A;  1NSN S;  4JI1 L;  5IGC A;  1G8Z D;  4KI0 A;  4WJ4 A;  2NN6 G;  1B3A A;  1NUC A;  4CBV A;  3K8A A;  1C8C A;  2R7Z B;  1KL9 A;  5D3I B;  2R92 B;  1GJX A;  1TY0 A;  1N33 Q;  2CFM A;  2JA5 H;  1K3B C;  4C3H B;  5L37 A;  2WAQ E;  2B8G A;  1L0Y B;  2CW0 C;  2KHI A;  2ZTE A;  1I5F A;  1RF2 D;  3STB D;  2EZV A;  3CF5 A;  3FPP A;  2MUY A;  2JXM B;  2MPM A;  2X69 A;  2K05 A;  3NQT A;  4FF2 A;  4BXX H;  3FVQ A;  5JVH 3;  2EYJ A;  4DUY L;  2IHE A;  3HOV G;  3K6O A;  1ESF A;  4JI3 Q;  3G4S A;  4KD4 A;  1JJ2 A;  2WFW A;  3GV3 A;  3GV6 A;  4DV5 L;  4FF1 A;  4P2C B;  3S9W A;  4XT1 B;  1WTH A;  4A3B B;  4IZ8 A;  1PRT F;  1WYD A;  3TZU A;  1KAW A;  2K7V A;  1N9W A;  4TRD A;  5H1S E;  5FLX L;  4ME5 A;  2ICI A;  3GTK B;  3H91 A;  5E4W C;  1GUT A;  1AE3 A;  4HJ8 A;  1H9R A;  1GXD C;  1EY7 A;  4L5Q A;  3RLN A;  1SR3 A;  5I4D A;  2WIN B;  4OXP A;  4DR6 L;  2KCM A;  1WOC A;  3H0G B;  2VQE Q;  1SYC A;  1IL2 A;  2SNS A;  2SDF A;  4LAA A;  3GTP B;  5EQ0 A;  1EEI D;  4IUU A;  4X65 L;  1E22 A;  5KYL A;  4A3F H;  4IFD J;  2B63 G;  1Q82 C;  3CKI B;  2PMZ B;  4K6D A;  2F3W A;  2EJF C;  4LF8 Q;  1LO5 D;  5EAY A;  2GVA A;  2EQS A;  5ELB A;  2QEJ C;  1K8A C;  2UXB L;  2PYK A;  4QJF A;  1PH4 A;  2QKI C;  3KF8 B;  4JV5 Q;  4A3G B;  4JYA Q;  1K73 C;  1KAA A;  4BBR H;  3H3V H;  2CWA A;  2E2I B;  3S16 H;  5CV5 A;  2DNC A;  2E5L Q;  3E5S A;  3BS1 A;  1G91 A;  2PI2 A;  1VQ7 A;  4HIK A;  2YTX A;  3I2Z A;  2EIF A;  1RHP A;  5BN5 A;  4ZQ3 A;  2F0L A;  1X32 A;  4OO1 H;  2QF7 A;  1CUK A;  1EQV A;  2Z1C A;  4CHT B;  5IYD H;  1TS3 A;  1SFO H;  2DJF C;  3D4D A;  1Q81 C;  2XSC A;  1YZ6 A;  4K0K Q;  1CA6 A;  4O2D A;  5IT9 E;  1TWH H;  2HCI A;  2RHS B;  4IN3 A;  1A3U A;  1TT2 A;  2LSS A;  1QOH A;  5C0X H;  3MFY A;  5HUR A;  1M90 C;  5C0X I;  4FXK C;  3HKZ B;  1VQ4 A;  1V1O A;  1QUQ B;  3QG1 A;  3IAY A;  1CK1 A;  1UEB A;  2PW5 A;  3HOX B;  5JJI A;  5CYU A;  2ATW A;  1TS4 A;  3CCE A;  3KF8 A;  4R4C A;  4F88 A;  2PI2 E;  4CJ1 B;  1SNP A;  4EVO A;  4JBK A;  4MZ9 A;  5C44 B;  4ZCK A;  1Q12 A;  1EWI A;  1X55 A;  2R7D A;  1PZI D;  2JA8 H;  4P71 A;  1B7Y B;  3O13 A;  1FYC A;  4KKT A;  4JI7 Q;  4OWT B;  3WOF A;  1PH5 A;  4ZAI A;  2PMZ E;  1DJR D;  3F8T A;  1QZG A;  5JPN C;  4A3C G;  2K28 A;  1YJN A;  4HID A;  1EIF A;  4G7O C;  1AFP A;  3GP7 A;  2AKW B;  2MO1 A;  4B9X A;  1N36 Q;  1KC8 C;  2Q8I B;  3UDG A;  5E1F A;  3M4O B;  4RFB A;  4X3U A;  5EBC A;  4WJ3 M;  3QO2 A;  4BWG B;  4FF4 A;  3CMA A;  4DR2 Q;  1ENF A;  4P72 A;  1QCB D;  1FNW A;  3S1R H;  1QUQ A;  2B39 A;  5ELD A;  1G2S A;  1A8V A;  4C1N K;  2JEB I;  3B6Y A;  2I0Q A;  4IFD I;  1O80 A;  2I07 B;  1PTO D;  1RDP D;  1I6H H;  3OMG A;  3EVQ A;  1KDA A;  1UAP A;  2V4D A;  4B3T Q;  3TS0 A;  4UHV A;  4BY7 B;  1HQR D;  1ENC A;  2Z6K A;  3D4W A;  1Y1W B;  4B3R L;  2E2J H;  2UUC Q;  2XGT A;  2WB1 G;  3I4M B;  4NMZ A;  1JIC A;  3C1F A;  4AIM A;  4DV0 Q;  1OO9 B;  1QIL A;  3R3O A;  1GOZ A;  3A55 A;  3CP0 A;  1IKL A;  2Q2I A;  4HCS A;  1BBU A;  2NN6 H;  2KEN A;  5T1G A;  2NN6 I;  2R93 H;  1HA6 A;  2R3Z A;  4L5S A;  4A93 H;  4R8I A;  3H15 A;  1KHI A;  1TKW B;  3HKZ E;  4CJ0 B;  1XTC D;  1F9Q A;  1L2F A;  2NVX H;  2UUA Q;  2DJG C;  5I6Y A;  3SVM A;  3ZJY C;  1SNC A;  2A74 C;  3D31 A;  2KCT A;  4TSS A;  1BNZ A;  4N8X 1;  2H4O A;  5DNF A;  4A3J G;  1YHB A;  1RTN A;  2F4I A;  4CJ2 C;  4BBS B;  1STB A;  3PO3 G;  3HOZ G;  3C1E A;  1QG7 A;  1PZK D;  1SYF A;  4HJ5 A;  1EIY B;  3HOU B;  4C3J H;  4WJW A;  3VR2 A;  5LMU Q;  1V1Q A;  2UXC Q;  4RCN A;  3S2H H;  2ALY B;  3DLL A;  1SE8 A;  1FGB D;  3LWU A;  1MSH A;  4FO2 A;  4HMJ A;  5FK9 C;  1RIP A;  1PFB A;  3ULP A;  5EBD A;  2VUM B;  3S17 H;  1VQK A;  1HNW Q;  5FLX E;  1W2B A;  3K59 A;  4LFB L;  1SJE D;  2M2L A;  1HUM A;  3I90 A;  3TSS A;  3GD7 A;  3OW7 A;  4CDC C;  4FVM A;  1H9S B;  4I7Z C;  4MN3 A;  2F0H A;  4UP7 A;  1ICF B;  1K28 A;  4C3I G;  3UE1 A;  1Y1V B;  3J81 L;  3FKI B;  1WCM G;  2N3S A;  3NK9 A;  4OL7 A;  3GTJ B;  3AYH B;  4X3T A;  2LXJ A;  2IPK D;  3AFP A;  2B63 H;  2JP1 A;  4V19 0;  5IIF A;  2K5D A;  3NWS A;  5HGQ A;  4R9W A;  3D6C A;  4HR7 B;  1NR2 A;  5C4J H;  5J22 A;  3IFT A;  1NJI C;  4NPS A;  4X62 L;  4ZUJ A;  1V9P A;  2MHV A;  1JT8 A;  1EIG A;  3SE0 A;  3FHW A;  1H95 A;  1B44 D;  2YTY A;  4P75 A;  2VZA A;  4RGM A;  1SDF A;  1VQB A;  1XXG A;  4X6A H;  3HOY H;  1JE4 A;  4B3M Q;  1R4P B;  2D62 A;  2K1B A;  1G6P A;  1SXT A;  2B2Y C;  4OON A;  4OEL B;  5I2X A;  1UE5 A;  2FMC A;  4EX5 A;  1KDB A;  1SMY C;  1H9S A;  1KTK A;  4H0L C;  2PZW A;  3K0X A;  3S1N B;  2A5H A;  3CQZ H;  1QB5 D;  3DM1 A;  4ZUI A;  5JOB A;  3CC2 A;  2SOB A;  1PTO B;  2JJQ A;  4HJA A;  1TS5 A;  4HN7 A;  3GTO B;  5C5L A;  1VQI A;  3TP8 A;  2RQX A;  1EY9 A;  3RUZ A;  4GOP C;  4LNQ A;  4JI8 L;  1Q8I A;  5JAV A;  1A3V A;  2D0O A;  1VQO A;  4XDX A;  3J80 i;  3HEJ A;  3IL8 A;  3I4N B;  4GLX A;  1K3R A;  3FRP B;  1EYA A;  2NB0 A;  2RDG A;  5J1Z A;  4IPC A;  1A15 A;  3DEP A;  1FNV A;  1CSP A;  2KUM A;  1C48 A;  3T51 B;  1KLG D;  3A8I E;  3KBX A;  2HDL A;  2NVY B;  1VQM A;  4HMI A;  3RLF A;  4A3I B;  3GTL H;  1X3F A;  1R9T H;  4BY1 H;  2WII B;  1XNR L;  1A6X A;  3S15 H;  3OTO Q;  3CU7 A;  3TP6 A;  2F0F A;  2JA6 B;  1WFQ A;  2Q2T A;  2A1A A;  3OSO A;  1KRS A;  1J9O A;  4I7A A;  2EYP A;  1S40 A;  1SE2 A;  3QOJ A;  4L6T B;  1QZH A;  2JK8 A;  1B50 A;  1I50 H;  1TWG H;  1SJH D;  4J15 A;  3DEO A;  3SK4 A;  2JSO A;  2F4V L;  3PIO A;  4ZYS A;  2G9H D;  2Z4I A;  5ELC A;  5M5Y H;  3TDQ A;  3L7Z C;  2A69 C;  5ELO A;  4ODG A;  4G7Z C;  4L8J A;  4AQY L;  3I91 A;  1CZG A;  2EVB A;  3GTQ B;  2BE5 D;  1ROD A;  3MC0 B;  3NTI A;  1IYU A;  1JR0 D;  1S3O A;  4IQZ A;  2JA7 H;  4DFA A;  2IHF A;  4QUF A;  3NXW A;  1X3G A;  2L5T A;  1UEA B;  2HIX A;  2N55 A;  1VQ6 A;  2WKD A;  1SNO A;  3ERS X;  3ULJ A;  4XYQ A;  4A3E B;  1MSG A;  4DUY Q;  4A3F G;  2L11 A;  4YHH L;  1PRT C;  3U9S A;  1L1O B;  2J4X A;  2CVR A;  3J80 c;  1Y8N B;  2D5D A;  4UP8 A;  1TWA B;  1BVS A;  1PH2 A;  2HT1 A;  4DV5 Q;  1ZYR D;  4Y52 H;  4PMC A;  4RGT A;  2FXQ A;  1U4L A;  1IYV A;  1XMO L;  1B53 A;  1E7Z A;  1HPC A;  1VQJ A;  5IOC A;  2B2U C;  2HIV A;  2DY8 A;  1YHA A;  1D8L A;  1BKB A;  4A3J H;  1BUV T;  4JBM A;  2DN8 A;  4IPD A;  1D1K A;  4IUR A;  2PO4 A;  4B08 A;  3NUC A;  2YV5 A;  4DKA C;  4DR6 Q;  4R4I A;  3UDX A;  4DV6 L;  4M1U B;  2KCN A;  3HOW H;  4OO1 G;  4DV3 L;  2KQ3 A;  3MVV A;  3M85 A;  5IYD G;  4X65 Q;  4QL5 A;  4YCU A;  4PZ8 A;  2RSN A;  1X54 A;  2IL8 A;  2CHB D;  4DAY B;  2NUC A;  1NR4 A;  1HZB A;  1EYG A;  3CME A;  1Y8O B;  4DU9 A;  1L1O A;  1F2M A;  2O2L D;  1KLU D;  1PFM A;  4NXN L;  1QNK A;  4N8F A;  3SR1 A;  2UXB Q;  1KNE A;  2ZT9 C;  1YNN C;  5E7N A;  1JJC B;  3PIP 3;  2B2T C;  4QCL A;  2PW7 A;  4KHZ A;  4DR7 L;  4JCV E;  1I3Q B;  1C7Y A;  1HJP A;  2QCP X;  3J81 E;  1NBW A;  2Z6B A;  4RCO A;  1HTL D;  2NBF A;  3MXG A;  5IYB G;  4A3M H;  3NEN A;  2JA5 B;  1SSO A;  3CPW A;  1YJ9 A;  1HFG A;  2I5L X;  4IUT A;  3CCU A;  3BVM A;  1RCV D;  5C3E B;  1YVC A;  2ZJQ A;  3NWT A;  2NWG A;  1G51 A;  4A3K B;  3PO2 B;  4DAY A;  5AJ3 L;  3K7A B;  1RL2 A;  2LXK A;  1TY2 A;  3UDI A;  1YIT A;  4DAP A;  3E9H A;  2FJ2 A;  3TBI B;  2F0Q A;  4K5V A;  1Z9F A;  3BG3 A;  1XNQ L;  4G4K A;  4IJL A;  2KEC A;  5LHY 1;  2EJM A;  2UU9 L;  5C3W A;  4K2L A;  2K14 A;  1DM0 B;  1JCK B;  1AE2 A;  5M3M H;  1UUP A;  5CBA E;  5FO8 B;  2AQ1 B;  5M5X H;  5HGT A;  1NMG A;  3I55 A;  1G6Z A;  4NXM L;  3Q0A A;  4POF A;  2I5H A;  1PYB A;  4DK0 A;  4NW2 A;  2FHT A;  2CQA A;  1YNJ C;  1BO0 A;  3FEW X;  5EKI A;  1W3S A;  1TII D;  4PNY A;  2K5Q A;  2JEA I;  4LF7 L;  1EQQ A;  2F0D A;  4A75 A;  2R7F A;  2VL6 A;  2VQF L;  3VA7 A;  2O5J C;  4KY7 A;  4FYD A;  2E75 C;  2R93 G;  1EFW A;  1P16 A;  4A93 G;  3MHB A;  1C4Q A;  1TWF B;  3SK5 A;  1HTP A;  2B8F A;  4HTH A;  4KY6 A;  1VQN A;  3X3M A;  4DV2 L;  1S4Z A;  2NVT H;  3PUX A;  2FIN B;  4LJZ C;  4MTN A;  1L0X B;  5EPL A;  4JI5 L;  1VQC A;  5C0X J;  3N52 A;  3SHL A;  2AHO B;  5E4X A;  3UE0 A;  4XTC S;  2BA1 A;  3KFU A;  3NBH B;  2PZT A;  3IRB A;  3HKS A;  1OXS C;  3GTG B;  1Y69 U;  5COR A;  3AB9 A;  4B3R Q;  4DK1 A;  1S72 A;  1S5F D;  2F52 A;  2D0P A;  1PYW D;  1JC7 A;  4UDU C;  1JOK A;  5EKL A;  4K5W A;  4C3J G;  2Y0S B;  5ELF A;  1A2T A;  3L3O C;  5TSS A;  1SYB A;  3PF5 A;  3VDY A;  4DV1 L;  1HHV A;  2OTL A;  3GTM B;  1BCP F;  3JAM i;  3NE5 B;  1D5X C;  1OXX K;  1X65 A;  4DNT B;  1F2L A;  1WTW A;  3RD4 A;  1LLR D;  2F0O A;  3MZ5 A;  1HA5 A;  1VQ5 A;  3E0E A;  4R1J A;  4XQN A;  1N32 L;  2KVM A;  3OIQ A;  3BZC A;  3W1G A;  1KRT A;  2SEB D;  3CD6 A;  1R4Q B;  1XWE A;  2M9V A;  3F2U A;  4LUZ A;  2ENB A;  2PQA B;  1EZ6 A;  2CCZ A;  1X6O A;  1E24 A;  1IBM L;  3S2D H;  1LAB A;  5EPJ A;  5M3F H;  3NBH A;  1NTG A;  4EGV A;  5C4X H;  1B9M A;  2ZXR A;  1E2V A;  4KK7 A;  3S1Q B;  3LNN A;  4CDE C;  2F0K A;  4GN5 A;  3I73 A;  2E74 C;  3TS2 A;  2JA8 B;  5IGF A;  3K5M A;  5BN4 A;  1WD0 A;  1H9K A;  1QNU A;  5CGK A;  1XJV A;  4QQB X;  1XMQ L;  1G29 1;  3HOY G;  2R92 H;  1N34 L;  2WV6 D;  3NTH A;  4LFB Q;  2L9H A;  4XIG S;  5IGB A;  1J5E L;  2IT1 A;  4C3H H;  3H3V I;  2KCC A;  1YJW A;  2MGS A;  3ERO A;  4YWL A;  1Z6H A;  4V0B A;  1IBK L;  3MXP A;  3ONA B;  3RZO H;  4PMB A;  5JPM C;  2PPB C;  3HZX A;  3NPP A;  4OO1 I;  2O4X A;  3NEL A;  2CWP A;  3S1R B;  3S14 B;  1I4Q A;  2VB3 X;  1SAP A;  4MNO A;  2A68 C;  1WI5 A;  1FGU A;  2QDL A;  3ND8 A;  1BF4 A;  4LUV A;  1K9M C;  1X3P A;  1CI3 M;  4RMF A;  4JK1 C;  2E2D C;  4X62 Q;  1DGS A;  3I56 A;  2Y0S E;  3U4Z A;  4DUZ L;  4MHE A;  3CC7 A;  4KHP L;  2EY6 A;  3HOU G;  1HH2 P;  1GKH A;  3JAM c;  4LF6 L;  1OXT A;  3PUZ A;  1NE3 A;  3I72 A;  2OQK A;  1KAB A;  4ID6 A;  4DV4 L;  2F0E A;  3D4R A;  1OTC A;  4XQJ A;  3H3V C;  4RHS A;  3KJP A;  2O5I C;  4GKJ L;  2XTI A;  5IYB H;  2EYF A;  1Q1B A;  5ELE A;  2A69 D;  3W3A A;  1EYD A;  2J7Z A;  4Y7N B;  1I4P A;  1O7Z A;  1LTG D;  5IOD A;  2F3I A;  1EY5 A;  1VQE A;  4LFA L;  3H0G H;  3ZYY X;  4C2M B;  2FFK B;  3GTP H;  1IKM A;  2D9U A;  4OWX B;  1VQH A;  1HR0 W;  3EA6 A;  4RAU C;  4RG1 A;  4BY1 G;  2LMC B;  4KN4 C;  1PA6 A;  1Q86 C;  4AYB G;  2YTV A;  1GUO A;  1OXV A;  1MBY A;  5DAU A;  1MIU A;  3G48 A;  1K8O A;  4IUQ A;  1HFN A;  3HOV B;  4N9T A;  4RH6 A;  2C9O A;  4B3S L;  4JI8 Q;  2Q2U A;  2PZU A;  4H13 C;  4K14 A;  2F0S A;  4GNX C;  3P20 A;  1TVX A;  1SMX A;  2AMC B;  1AW7 A;  5C4H A;  1E2W A;  3W2D A;  1CKM A;  2P5Z X;  3EN2 A;  4P73 A;  1YI2 A;  3E3X A;  4A3G H;  3DWQ A;  2E2I H;  2EYH A;  1SRU A;  1SEB D;  1EWC A;  5I2Y A;  2VY3 A;  1T5E A; 
#chains in the Genus database with same CATH homology
 4JI0 L;  4LF9 L;  1VQI A;  2RHQ B;  3JC6 6;  1PHJ A;  4JBJ A;  3L2P A;  2JA7 G;  1HNZ Q;  5FLM G;  1VQ8 A;  1XNR Q;  1C0A A;  4GOP C;  3RN5 A;  4DR1 Q;  4LUO A;  4B3M L;  4LNQ A;  4JI8 L;  1B70 B;  3AFQ A;  1E1T A;  5GAG C;  2VW9 A;  1X3E A;  2D0O A;  1VQO A;  4JOI C;  3J80 i;  3OW2 A;  3A0J A;  1OXU A;  4BY7 G;  4DR4 L;  4P74 A;  4LF4 Q;  3M4P A;  3WWV A;  5C0X G;  4GLX A;  1Y1W G;  1K3R A;  4C3I H;  3I4M G;  1WCM H;  2DUD A;  4IPC A;  4IJH A;  1L0W A;  1IBL Q;  2ES2 A;  4IPG A;  1PYS B;  1O7I A;  1PV4 A;  4LWC A;  1CSP A;  5IP7 H;  4A3E H;  1ASY A;  3T1H L;  3HFZ B;  3CCV A;  2QGQ A;  4HJ7 A;  4GKK L;  4QGU A;  2F4V Q;  4GOP B;  2GN5 A;  2AWO A;  1VQM A;  1PVO A;  4DR3 L;  3PGZ A;  1VQP A;  4JI4 L;  2R7Z H;  1E3P A;  2UUB Q;  3J81 i;  3RLF A;  3CCL A;  1HZ9 A;  1YNX A;  3E9I A;  3GTL H;  3HOX H;  1X3F A;  2UXD Q;  1TWF H;  1SLJ A;  1PH1 A;  4JI2 Q;  4AQY Q;  1R9T H;  1YBY A;  4BY1 H;  2JA8 G;  4JI6 Q;  3AQQ A;  1HNZ L;  5GQO A;  1XNR L;  5C44 H;  4DR1 L;  3S15 H;  3OTO Q;  1JE5 A;  4LFC Q;  1IYJ B;  1WFQ A;  2Q2T A;  2A1A A;  4GNX A;  1KRS A;  2PQA A;  1Q7Y C;  5JEA J;  4ALP A;  1VQ9 A;  4LF4 L;  1S40 A;  2B3G A;  3HOW G;  3W5O A;  1N8R C;  3RR5 A;  2HHH Q;  1QZH A;  2JK8 A;  4X64 Q;  1VQF A;  1IBL L;  3GTG H;  4UY8 C;  1I50 H;  3PV0 A;  1TWG H;  4YHH Q;  1HNX Q;  4BBS G;  4J15 A;  3BU2 A;  3PUY A;  2QA4 A;  2F4V L;  2ID0 A;  3KJO A;  3PIO A;  4KLK A;  5ELN A;  1XPU A;  2UUB L;  5M5Y H;  1VQD A;  3CC4 A;  3M4O H;  3L7Z C;  3TRE A;  2ZJR A;  4JC0 A;  5ELO A;  4IFD G;  2UXD L;  4A4I A;  3RNU A;  4A3D G;  2IX0 A;  5FJ8 G;  4AQY L;  4JI2 L;  1XMO Q;  4JI6 L;  1L1O C;  4A3B H;  1Y14 B;  4GOP A;  3OTO L;  3GTM H;  2K52 A;  4LFC L;  4A3L G;  3D0F A;  1S3O A;  3GTK H;  2JA7 H;  3PF4 A;  4JOI A;  4HIO A;  2IHF A;  3A74 A;  5FLM H;  1K8G A;  2VUM G;  1X3G A;  1GM5 A;  2H5X A;  4JI1 L;  2HIX A;  2HHH L;  1FJG Q;  1VQ6 A;  3CCS A;  2CKZ B;  3ERS X;  3ULJ A;  4DV6 Q;  3M7N A;  4BY7 H;  2K5H A;  4X64 L;  3TEH B;  4DUY Q;  4A3F G;  4A3M G;  3RN2 A;  1U5K A;  3CPF A;  4KI0 A;  3I7F A;  4YHH L;  1HNX L;  2NN6 G;  3I4M H;  4WJ4 A;  4DV3 Q;  5K36 G;  1L1O B;  3LGJ A;  3K8A A;  1KL9 A;  3U50 C;  3J80 c;  4UP8 A;  1Y1V G;  1BVS A;  1PH2 A;  3FKI G;  1N33 Q;  2HT1 A;  4DV5 Q;  2CFM A;  3KF6 B;  1AH9 A;  2JA5 H;  2I5M X;  4Y52 H;  3MXN B;  2WAQ E;  4APV A;  2FXQ A;  1YIJ A;  1A0I A;  1XMO L;  3S1Q H;  1E7Z A;  1VQJ A;  1VQL A;  4NXN Q;  2KHI A;  3K80 C;  2HIV A;  2ZTE A;  1YHA A;  4YCV A;  1D8L A;  1BKB A;  3ER0 A;  1I5F A;  4A3J H;  5LMN W;  4JBM A;  2ZTD A;  3J81 c;  4IPD A;  3STB D;  4DV7 Q;  2YV5 A;  1T9H A;  4DKA C;  5IYC G;  1FVI A;  3CF5 A;  4DR6 Q;  3A5U A;  4BXX H;  1FJG L;  4R4I A;  4GN3 B;  4DR7 Q;  1X56 A;  3UDX A;  4IOA A;  4DV6 L;  1C9O A;  1Z47 A;  4DUY L;  2IHE A;  3HOV G;  3HOW H;  4JI3 Q;  5M3M G;  3G4S A;  4DV3 L;  4OO1 G;  3M85 A;  5IYD G;  2B29 A;  4X65 Q;  4QL5 A;  1M1K C;  1JJ2 A;  2WFW A;  3K7U C;  4YCU A;  4PZ8 A;  3RZD H;  1PH3 A;  2A19 A;  1N33 L;  1X54 A;  4DV5 L;  4DAY B;  4BBS H;  1V43 A;  3G6E A;  1A63 A;  1HZB A;  5J3B A;  1EYG A;  3KYH C;  3CME A;  4HJ9 A;  3HOU H;  1L1O A;  1WYD A;  1KAW A;  3S14 H;  1N9W A;  4NXN L;  5H1S E;  1NMF A;  2OTJ A;  1AE3 A;  3KF6 A;  4HJ8 A;  5AJ3 Q;  2K75 A;  4L5Q A;  2UXB Q;  3UDF A;  3RLN A;  4DV7 L;  1SR3 A;  5E7N A;  4X66 Q;  1JJC B;  4DR6 L;  4OXP A;  4BA2 I;  4JBW A;  4KHZ A;  4DR7 L;  2KCM A;  4JCV E;  2K4K A;  1WOC A;  1IL2 A;  4QY7 A;  2VQE Q;  1C7Y A;  3PUV A;  1HJP A;  2VUM H;  1XNQ Q;  2K50 A;  4JI3 L;  5BR8 Q;  1NBW A;  3CCR A;  4X65 L;  4GLV B;  2UU9 Q;  1HNW Q;  1E22 A;  5IYB G;  4A3M H;  3NEN A;  4A3F H;  3CPW A;  4IFD J;  1BBW A;  5IT9 c;  2B63 G;  1Q82 C;  1YJ9 A;  2OQ0 A;  3I4N G;  2I5L X;  1EQR A;  3CCU A;  1LYL A;  2WAQ G;  2JQO A;  4NXM Q;  3FKI H;  4UPA A;  1YVC A;  2QEX A;  2ZJQ A;  3GTJ H;  4LF8 Q;  1Q1E A;  5EAY A;  3DM3 A;  4Y7N H;  1G51 A;  2GVA A;  2EQS A;  1HR0 Q;  5AJ3 L;  3U4V A;  1RL2 A;  4O0A A;  1D7Q A;  1GD7 A;  2LXK A;  1K8A C;  2UXB L;  3UDI A;  1UE1 A;  4X66 L;  1YIT A;  4C2M H;  3E9H A;  4JI1 Q;  4A3I G;  4LF7 Q;  4QJF A;  1PH4 A;  5IP9 G;  3KF8 B;  2NZO A;  1Z9F A;  2MO0 A;  2VQE L;  2DGY A;  1K73 C;  4JV5 Q;  4JYA Q;  3W1B A;  2VQF Q;  1XNQ L;  5GRO A;  4BBR H;  5BR8 L;  4IJL A;  2CWA A;  3H3V H;  2ZJP A;  3S16 H;  1KXL A;  4POG A;  2UU9 L;  2KHJ A;  2E5L Q;  1QVF A;  2K14 A;  2PI2 A;  2JA6 G;  1VQ7 A;  4HIK A;  2YTX A;  3I2Z A;  2EIF A;  3HOV H;  1MKH A;  4L5R C;  2IY5 B;  1AE2 A;  5M3M H;  1WJJ A;  1CUK A;  5IYD H;  1GVP A;  5M5X H;  1XPO A;  1NMG A;  3PSI A;  3I55 A;  1SFO H;  1Q81 C;  4NXM L;  3G71 A;  4DV2 Q;  2Q2H A;  1HZC A;  4R4T A;  4POF A;  2I5H A;  1YZ6 A;  1PYB A;  4LF8 L;  4K0K Q;  1MJC A;  4O2D A;  4JI5 Q;  3CW2 C;  1TWH H;  2RHS B;  1HR0 L;  3PIP A;  1W3S A;  4DR5 Q;  3I4O A;  4IPH A;  1VS0 A;  2Z6K C;  1I94 Q;  4R4Q A;  3S1N H;  2JEA I;  1LTL A;  4LF7 L;  4DNI A;  1LUZ A;  3S24 A;  1EQQ A;  2WB1 E;  2RCN A;  3PUW A;  2LSS A;  4A75 A;  4JV5 L;  1VQG A;  5M3F G;  4JYA L;  2R7F A;  2VL6 A;  5C4X G;  1Y1W H;  2VQF L;  3K81 C;  1M90 C;  3EIV A;  5C0X I;  3GTO H;  2R93 G;  1VQ4 A;  1EFW A;  1CSQ A;  1P16 A;  1YEZ A;  1QUQ B;  2YYZ A;  2E5L L;  4A93 G;  5JJL A;  5JJK A;  1UEB A;  3GDE A;  5JJI A;  3CAM A;  4DPG A;  3TRZ A;  2ATW A;  5IWA Q;  4R4C A;  3STB C;  3CCE A;  2PI2 E;  2AWN A;  1VQN A;  4JBK A;  4DV1 Q;  4DV2 L;  4MZ9 A;  3M9B A;  5IP7 G;  4A3E G;  2NVT H;  3PUX A;  1Q12 A;  3S1M H;  1EWI A;  4K0K L;  4MTN A;  1X55 A;  2R7D A;  4JI5 L;  1VQC A;  5GAH C;  4PZ6 A;  2E8G A;  3ULL A;  3Q8D A;  5C0X J;  2JA8 H;  2AHO B;  1B7Y B;  4GN4 B;  4P71 A;  3UE0 A;  2R7Z G;  4XTC S;  1N32 Q;  2BA1 A;  1PH9 A;  4JI7 Q;  2R92 G;  4DR5 L;  3KFU A;  4OWT B;  4IOC A;  1PH5 A;  1LM0 A;  1CKO A;  3IRB A;  3NBH B;  1I94 L;  3HKS A;  1OXS C;  3RLO A;  2PMZ E;  4HIM A;  3F8T A;  4ME3 A;  1QZG A;  4B3R Q;  2NVY H;  1S72 A;  4A3C G;  1FL0 A;  2D0P A;  2F52 A;  4YWK A;  1YJN A;  4HID A;  3F2D A;  1TWC H;  1EIF A;  5HY6 A;  2ASB A;  1N36 Q;  2AKW B;  2MO1 A;  1IBM Q;  4YWM A;  3F2B A;  4PZ7 A;  1KC8 C;  3UDG A;  2VNU D;  3KDF B;  3F2C A;  3TQY A;  1QVG A;  4JG2 A;  4EQ5 A;  5IWA L;  4WJ3 M;  2ZM6 Q;  1JJG A;  2MFI A;  4LF5 Q;  3PF5 A;  3VDY A;  3CMA A;  4DR2 Q;  4DV1 L;  4P72 A;  2OTL A;  3FP9 A;  2JA6 H;  1J6Q A;  2ZTC A;  1HZA A;  3F1Z A;  1KQS A;  1Q46 A;  3JAM i;  1QUQ A;  4QIW E;  1OXX K;  1X65 A;  4A76 A;  3S1R H;  1A8V A;  4A3D H;  2JEB I;  3B6Y A;  5FJ8 H;  2I0Q A;  4IFD I;  3PCO B;  1VQ5 A;  3E0E A;  4R1J A;  1I6H H;  1N32 L;  4JI7 L;  2L15 A;  3J7A 5;  1UE6 A;  4B3T Q;  1EUJ A;  3BZC A;  3TS0 A;  3W1G A;  1KRT A;  2Z6K A;  1XMQ Q;  3CD6 A;  4A3L H;  2E2H H;  1XTD A;  1VCI A;  4B3R L;  2E2J H;  2UUC Q;  2XGT A;  2WB1 G;  4A3B G;  2MQH A;  3M4Q A;  4LUZ A;  1N34 Q;  2PQA B;  2BH8 A;  4AIM A;  2CCZ A;  4DV0 Q;  2N49 A;  3L0O A;  1X6O A;  1J5E Q;  1E24 A;  1N36 L;  1IBM L;  3CP0 A;  3S2D H;  2PNH A;  2OCE A;  2K5V A;  5M3F H;  1NTG A;  1IBK Q;  2Q2I A;  5C4X H;  1PH6 A;  1BBU A;  2VS1 A;  3MEF A;  2IX1 A;  2MNA A;  2KEN A;  1QVC A;  3GTQ H;  2NN6 I;  2HQL A;  2ZM6 L;  2R93 H;  4LF5 L;  1CKN B;  4L5S A;  2K5N A;  4A93 H;  2NZH A;  1Y1V H;  4DR2 L;  4GN5 A;  1PFS A;  3H0G G;  3H15 A;  3TS2 A;  1SRO A;  2OWO A;  3KDF A;  1Q8K A;  1KHI A;  2WP8 J;  5FLX c;  3KLW A;  1VQA A;  3HKZ E;  1KD1 C;  1L2F A;  2NVX H;  2JA5 G;  2UUA Q;  4DUZ Q;  3OYY A;  4B3T L;  3ZJY C;  2Z0S A;  1XJV A;  4QQB X;  4KHP Q;  1XMQ L;  1G29 1;  1A62 A;  3D31 A;  1ASZ A;  4AH6 A;  2UUC L;  3HOY G;  4LF6 Q;  1TWA H;  2KCT A;  1N34 L;  2R92 H;  4AYB E;  1IXR A;  5IY0 A;  5M5W H;  5C3E G;  4LFB Q;  2JA9 A;  4XIG S;  5IYC H;  4DV0 L;  3A5Z B;  1J5E L;  2IT1 A;  4C3H H;  4A3J G;  3H3V I;  1YHB A;  5GAD C;  4YWL A;  5LMN Q;  4DV4 Q;  4A3K G;  1YJW A;  3PO2 G;  4A3C H;  1MJE A;  1IBK L;  3PO3 G;  3HOZ G;  3RZO H;  4GS3 A;  4NB3 A;  4BXX G;  4YY3 Q;  4HJ5 A;  4OO1 I;  4GKJ Q;  3NEL A;  1EIY B;  1XPR A;  2CWP A;  4C3J H;  5DLQ E;  4A3G G;  4MNO A;  5LMU Q;  1WI5 A;  1FGU A;  1V1Q A;  4PMW A;  3T1Y Q;  2UXC Q;  4LUV A;  1K9M C;  3S2H H;  1YHQ A;  2ALY B;  4LFA Q;  4RMF A;  3DLL A;  3M3Y H;  1SE8 A;  2YU9 H;  4X62 Q;  1E1O A;  1CKN A;  1DGS A;  3I56 A;  2Y0S E;  3U4Z A;  2UUA L;  4DUZ L;  3CC7 A;  3NEM A;  3ICE A;  2V1C C;  4KHP L;  1RIP A;  3ULP A;  3HOU G;  1HH2 P;  1GKH A;  1UWV A;  2GVB A;  1VQK A;  3JAM c;  4LF6 L;  3S17 H;  4BA1 I;  1OXT A;  3PUZ A;  1W2B A;  4LFB L;  3J81 j;  1NE3 A;  4IO9 A;  1EOV A;  2OQK A;  3GD7 A;  4TQU S;  5LMN L;  4DV4 L;  1OTC A;  4B3S Q;  4UP7 A;  3CCJ A;  4UP9 A;  1B8A A;  3UE1 A;  4YY3 L;  3KJP A;  1GO3 E;  4GKJ L;  1WCM G;  2N3S A;  1P8L A;  2XTI A;  5IYB H;  3AYH B;  4YCW A;  1Q1B A;  4OWW B;  2LXJ A;  3AFP A;  4H02 A;  4TVA B;  2B63 H;  1X9N A;  1K0R A;  4FDB A;  5LMU L;  3I4N H;  3T1Y L;  3EBE A;  2KBN A;  4DAM A;  5HGQ A;  5IE8 A;  5JEA G;  2UXC L;  3SGI A;  2F3I A;  4PG3 A;  5C4J H;  2BH2 A;  1VQE A;  3HKZ G;  1NJI C;  4LFA L;  2EXD A;  1JMC A;  4NPS A;  3H0G H;  1I3Q H;  4X62 L;  3BJU A;  1V9P A;  3HOX G;  3GTP H;  4R4O A;  4OWX B;  1VQH A;  1HR0 W;  1SN8 A;  4OX9 Q;  4RG1 A;  4BY1 G;  1NY4 A;  1JT8 A;  1HNW L;  1PA6 A;  2RF4 A;  3GO5 A;  3FHW A;  5C44 G;  4AYB G;  1Q86 C;  1H95 A;  2YTV A;  2CQO A;  2YTY A;  1OXV A;  4P75 A;  4JI0 Q;  2VZA A;  4LF9 Q;  1MIU A;  3U58 A;  4A3I H;  3G48 A;  5GAE C;  1VQB A;  3AEV A;  4X6A H;  5IP9 H;  3HOY H;  4B3M Q;  5C3E H;  4B3S L;  4JI8 Q;  1IZ6 A;  2D62 A;  2N8N A;  2Q2U A;  1G6P A;  4L5T A;  4GNX C;  4OON A;  4A3K H;  4DR4 Q;  2JE6 I;  2R6G A;  3PO2 H;  2A8V A;  1SMX A;  3CCQ A;  2AMC B;  3CCM A;  3HOZ H;  3K7A H;  1TXY A;  1UE5 A;  4BBR G;  3PO3 H;  1CKM A;  4EX5 A;  3EN2 A;  4P73 A;  2C35 B;  4LW1 A;  4DK6 C;  3CXC A;  1PH8 A;  1JB7 A;  1YI2 A;  3BZK A;  1K83 H;  4A3G H;  3K0X A;  1PH7 A;  3KOJ A;  3T1H Q;  2Y0S G;  2N78 A;  3CQZ H;  4GKK Q;  2E2I H;  4OX9 L;  1UE7 A;  1SRU A;  4DK3 C;  1U0L A;  4DR3 Q;  3CC2 A;  4JI4 Q;  2JJQ A;  4HJA A;  1KIX A;  2VY3 A;  3J7Z C;  2BA0 A;  4GNX B;  2NVQ H;  4GLA C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...