1IBML

Structure of the thermus thermophilus 30s ribosomal subunit in complex with a messenger rna fragment and cognate transfer rna anticodon stem-loop bound at the a site
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
124
structure length
124
Chain Sequence
b'PTINQLVRKGREKVRKKSKVPALKGAPFRRGVCTVVRTVTPKKPNSALRKVAKVRLTSGYEVTAYIPGEGHNLQEHSVVLIRGGRVKDLPGVRYHIVRGVYDAAGVKDRKKSRSKYGTKKPKEA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S RIBOSOMAL RNA
publication title Recognition of cognate transfer RNA by the 30S ribosomal subunit.
pubmed doi rcsb
molecule tags Ribosome
total genus 14
structure length 124
sequence length 124
ec nomenclature
pdb deposition date 2001-03-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
L PF00164 Ribosom_S12_S23 Ribosomal protein S12/S23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 1ibmL00
1X3EA 1C0AA 4LF7Q 3PCOB 4P71A 5DLQE 3CC7A 2RF4A 1R9TH 2HT1A 3HOVH 3M7NA 5FLMG 1LTLA 1IXRA 4A93H 3T1YL 4DR1L 1JT8A 4DV6Q 3CCMA 3J81c 2ID0A 4LF9Q 1L2FA 3GTJH 1YJ9A 3I56A 4LF6L 3RN5A 2HIXA 1N32Q 4DV0L 1KRSA 4YCWA 1C9OA 2BH2A 1B8AA 1E22A 4IJHA 1XMQQ 5M3FH 5BR8Q 4DKAC 4LF5Q 1N36L 2UUBQ 2R93G 4JBMA 2A1AA 4O0AA 2D0PA 3A5ZB 5GAEC 3HKZG 1MKHA 1KD1C 2Z6KA 2EQSA 1X6OA 5M3MG 4C2MH 3DLLA 3KF6A 2JA7G 3EIVA 3M4PA 2CCZA 4JI8Q 3H0GG 3CCEA 3ZJYC 4HJ8A 4C3JH 3M3YH 4GNXB 2WAQE 1SLJA 2E2HH 1U0LA 1YZ6A 2RHSB 4JBJA 4KI0A 4BBSG 1K9MC 1HR0W 3RZOH 2VW9A 1UE7A 3L0OA 1XNQL 2IX1A 4KLKA 1UEBA 3PUVA 2B29A 3S15H 5C0XG 1KXLA 2N49A 5IYCH 3TS0A 1WCMG 1Q12A 4YHHQ 4DR3L 2Q2UA 2ES2A 1PH9A 4IPHA 1L1OA 2CFMA 3K8AA 5IP7G 4R4TA 4HJ7A 3KOJA 4BA2I 4DR6L 1CSPA 1PH7A 1QUQB 1CKNB 1OXTA 3ERSX 4A3KH 3GTOH 4LFCQ 1VCIA 1HR0L 4TQUS 4LFBL 3OTOL 1A0IA 1RL2A 5GADC 1HNXL 1EFWA 1YIJA 3K80C 4BY7H 3M85A 4B3SL 1EQRA 1TWCH 4DV4L 1PH1A 1JMCA 1Q8KA 1SMXA 1CKOA 1VQ7A 2WFWA 3I4OA 3PV0A 2R92H 3M9BA 3GTMH 3T1YQ 1VS0A 2XGTA 3RLFA 3HFZB 1VQOA 1H95A 3G71A 4GN5A 4GNXC 2E2IH 3TEHB 3S24A 4A3FH 4DV3Q 4LF6Q 3I4NH 1OXUA 4DV0Q 4OXPA 3WWVA 2ZTCA 3NENA 1GM5A 2JA5G 3I7FA 4MTNA 3ULJA 3F1ZA 4C3HH 4QQBX 4QIWE 3HOUG 1N36Q 4L5TA 3CP0A 1WOCA 1Q1EA 3I2ZA 5LMNW 3G48A 2ZTDA 3PO3H 3TREA 1YI2A 2BA1A 4JBWA 1DGSA 4P73A 2JA6G 1PH6A 2VL6A 1S3OA 1VQPA 1SFOH 1HNWQ 2R6GA 4R4QA 2B63H 4LUOA 3HOYG 3IRBA 4ME3A 4BY1G 1NMFA 3UDFA 4DR4L 4WJ4A 4LWCA 1KQSA 4JI5Q 1E3PA 4DK3C 1CKMA 4UP9A 1VQCA 3FHWA 4PZ6A 4A76A 1XNQQ 2R7ZH 1Q1BA 3W1GA 4A3BG 1KAWA 2R7FA 5LMNL 2I5HA 2YTYA 2F3IA 4UP7A 3I55A 5FLMH 4DR3Q 3CQZH 3KDFB 2NZHA 4YWKA 4DR6Q 4DR5Q 3AEVA 3ULLA 2AWOA 2E5LL 1ASYA 2H5XA 3G4SA 1HR0Q 3OTOQ 4JBKA 1PFSA 1HNXQ 3UDIA 1KC8C 4DV4Q 4DV5L 1WYDA 2I5LX 4EX5A 2R93H 1AE3A 3PIOA 4OO1I 2AMCB 1JJ2A 1O7IA 5M3MH 3CAMA 2JA7H 4BXXH 3EBEA 3ULPA 3UE0A 3BU2A 1I3QH 3H0GH 1L1OB 1QZGA 4GN3B 3JC66 5J3BA 3ER0A 1HNZQ 5JEAJ 4RG1A 1FVIA 4JYAL 4JI7Q 2GVAA 4AH6A 4BBSH 2ZJRA 3M4OH 1Y1WG 1L0WA 1PYSB 1W2BA 3BJUA 3MXNB 3A74A 1YHQA 2C35B 3GDEA 4LF4L 2Z6KC 4J15A 3U4ZA 4H02A 1ASZA 2N8NA 3CPWA 4IO9A 1WCMH 5IE8A 5IWAL 1HH2P 1LM0A 2NN6G 3OW2A 2GVBA 2K4KA 4JI1L 5IP7H 4IPDA 1HZ9A 4OX9L 4A3GG 2E8GA 4A3MG 5HGQA 2F4VL 4DV1L 3HKZE 2N78A 3D31A 4GOPA 3GTQH 5HY6A 1YJNA 3J81j 4B3TQ 1MJEA 2KCTA 5LMNQ 1V1QA 1BVSA 1J6QA 5C3EG 1AH9A 1N8RC 2V1CC 4XTCS 1X55A 2K75A 3NEMA 4MZ9A 4BXXG 3D0FA 4OO1G 1L1OC 3KFUA 2NVXH 1X56A 1VQ9A 3PUZA 2E5LQ 3HOWG 4P74A 4UY8C 1OTCA 2PI2E 4DPGA 3B6YA 2JA5H 1TXYA 2D0OA 4HIOA 1Q7YC 1UE5A 2UUCQ 2HIVA 2JA8G 3HOUH 4DV2L 1M90C 1IBLQ 3GD7A 3RR5A 4YY3L 2IHEA 4P72A 1VQDA 1I94L 1IBML 1D7QA 1MJCA 2WB1G 3KF8B 3GTPH 1CUKA 2ZTEA 2JA6H 3PUXA 4YCVA 4OWTB 4A3IG 3PIPA 3GO5A 3HOYH 2Q2IA 5FLXc 2HQLA 2Z0SA 1SRUA 4BY1H 4IFDJ 4JYAQ 2OCEA 3CF5A 3AFQA 2UXBL 3RN2A 3AYHB 1E1TA 2ZJQA 4X62L 4DUYL 3K7AH 5IP9G 3UE1A 3JAMi 5C4JH 2VUMG 4A3BH 4LF4Q 2UXDL 3FKIG 5H1SE 3CC4A 2B3GA 1K8AC 5IWAQ 3MEFA 2JJQA 3PUYA 4JOIA 2QA4A 4JI1Q 4OX9Q 5E7NA 2F4VQ 4UPAA 3I4MG 3S16H 4DV1Q 3K0XA 3J7A5 5C4XG 4FDBA 2CQOA 4X64L 4X65L 1JB7A 2YYZA 2PNHA 5C0XJ 1NE3A 4B3ML 2VS1A 4DR1Q 1N9WA 4HIDA 1E24A 1W3SA 1SROA 4GKJL 1LYLA 1NY4A 1SE8A 4TVAB 4UP8A 4A3EG 4DUZL 3UDXA 2UUAL 1VQJA 3FP9A 2ALYB 2JE6I 4NXNL 4APVA 1M1KC 4A3LG 3TQYA 3E9IA 4JI6L 5ELNA 2NVQH 4GOPB 2NZOA 1N33L 4KHZA 1GKHA 3PSIA 1P8LA 1T9HA 1IYJB 1FGUA 2MFIA 2RCNA 4DR2L 3F2DA 3UDGA 1Y1WH 1I94Q 2AKWB 4IPGA 3CMAA 1IBMQ 4NXML 1XPUA 4LW1A 4A3DG 2ASBA 1XPRA 2OTLA 1BBWA 2DUDA 1EUJA 1VQMA 5M5XH 3CCSA 4GN4B 1B70B 5GAHC 1I5FA 2A8VA 4HIMA 4A3GH 2UXBQ 4A3MH 4YWLA 5LMUL 1A8VA 1Q82C 2YU9H 3S1NH 4WJ3M 4DUYQ 4AYBE 1VQAA 3L2PA 4LFAL 2I0QA 3U50C 2VY3A 4X66L 2UXDQ 1YEZA 1Z9FA 4DAYB 5C3EH 3KF6B 5M5YH 3A0JA 1FJGL 1CSQA 3NBHB 1VQEA 4Y52H 4LFBQ 5JJIA 3HOWH 4A3JG 4R1JA 4JI0L 1X65A 3PGZA 4X64Q 4GOPC 5GAGC 3EN2A 1NMGA 4B3SQ 2EIFA 3JAMc 1VQKA 1XMOL 2JA8H 4OONA 4B3MQ 3H15A 2CWAA 1GD7A 4JI3L 3H3VH 4IJLA 2NVTH 1EOVA 4AYBG 4GKJQ 3PF5A 1WJJA 4JC0A 3E0EA 3S17H 2UUAQ 1V9PA 4POFA 3CCVA 4NXNQ 4A3IH 2K5HA 5JJLA 3DM3A 5AJ3L 4R4OA 1N33Q 1K83H 4YWMA 1OXXK 3HOXG 4DR2Q 1GO3E 1TWHH 4PMWA 4ALPA 1G291 2I5MX 3RZDH 4NXMQ 4OWWB 1X3FA 2IX0A 4GLVB 5IP9H 2PMZE 1PYBA 1VQNA 2VUMH 3GTGH 1S72A 3S1MH 3FKIH 4DV7L 2KCMA 2VZAA 3J80c 2YTXA 2VQEL 4DR4Q 2OQ0A 4QJFA 2IHFA 1QUQA 1X3GA 4BBRG 3VDYA 4IFDI 2GN5A 1JJGA 3I4MH 1NBWA 1J5EL 3U4VA 2WB1E 5C4XH 3CMEA 1EIYB 2F52A 4Y7NH 2R7DA 4LFAQ 2PQAA 3HOZG 2AHOB 3A5UA 3KJPA 4HIKA 2HHHL 2CKZB 1PH8A 2OTJA 1KHIA 4K0KL 2JA9A 2Q2TA 4YHHL 2IY5B 4DR7L 4KHPL 3KJOA 1MIUA 4JOIC 2KHIA 1C7YA 3GTLH 4AQYL 4A3EH 5IYDG 4L5RC 4JI0Q 2NVYH 4L5SA 2JEAI 1VQBA 3PF4A 1N34L 5M5WH 3CCJA 4DV5Q 4A3LH 1FL0A 1JE5A 1XMOQ 1PHJA 1Q86C 5C0XI 3Q8DA 1X9NA 1KRTA 4JI3Q 1VQ4A 1EWIA 4IPCA 1PA6A 1QVCA 1KL9A 3CCLA 4A3DH 1A62A 4HJAA 3CD6A 1VQ8A 2CWPA 4IOCA 5IYBG 4DV3L 1PH4A 2QGQA 3SGIA 1D8LA 3TRZA 4DK6C 4IFDG 2MO0A 4R4IA 5AJ3Q 1QVGA 2KHJA 2KBNA 1E1OA 1X54A 4GKKL 2QEXA 1BKBA 3S2HH 4YCUA 1HZAA 4NB3A 3S1QH 2UU9L 3L7ZC 1UE6A 3KDFA 4DV7Q 5GQOA 2VQEQ 2LSSA 4DNIA 1HNWL 5FJ8G 1HZBA 3AFPA 1B7YB 4JV5L 4JI4L 3NELA 1J5EQ 5IY0A 4JI5L 2MO1A 4A3CG 4A3JH 1VQHA 3OYYA 2D62A 1IL2A 3KLWA 3U58A 1SR3A 1Y1VG 2YTVA 3PUWA 1VQLA 2UXCL 2HHHQ 2K5VA 1WFQA 4C3IH 1GVPA 1YNXA 2K14A 4K0KQ 5C44G 1EIFA 4QL5A 4XIGS 3PO2G 2Y0SE 4DR7Q 4KHPQ 1YVCA 1Z47A 3E9HA 4GS3A 2YV5A 3J80i 4AQYQ 1IBKL 4JI2L 1YHBA 1TWFH 2XTIA 3W5OA 4DR5L 1QZHA 4AIMA 1G6PA 1N34Q 1U5KA 2FXQA 3CPFA 3F8TA 3W1BA 1Q81C 4DV2Q 4YY3Q 3HOVG 1WI5A 4QGUA 2WAQG 1XNRL 1RIPA 1I6HH 1VQ5A 4LNQA 4HJ9A 3HOXH 2PQAB 4GLAC 1LUZA 4A93G 3S14H 3F2BA 2ZM6L 2K50A 1G51A 1K0RA 3ICEA 4JCVE 3STBC 4B3RL 2AWNA 1YHAA 1HJPA 3AQQA 3CCQA 1NJIC 5M3FG 3KYHC 2Y0SG 2OWOA 3S2DH 4BBRH 1PV4A 1TWAH 2OQKA 4X62Q 1HNZL 1PH2A 5IT9c 5GROA 4GKKQ 4X6AH 4NPSA 4JI7L 3RNUA 1EQQA 4P75A 2WP8J 3T1HL 3G6EA 2IT1A 2BH8A 3HOZH 2UU9Q 4L5QA 3CXCA 1KIXA 4HJ5A 3TS2A 1UE1A 3GTKH 4OWXB 2ATWA 2VQFL 3S1RH 4PG3A 3J81i 4PZ7A 4EQ5A 3K7UC 4JV5Q 2PI2A 4RMFA 4X65Q 4JI4Q 4DAMA 4LF8L 5IYDH 2ZJPA 5K36G 1PVOA 4POGA 3LGJA 1E7ZA 1VQIA 3RLOA 1HZCA 4R4CA 5IYCG 1PH5A 4B3TL 4LF7L 2UXCQ 2K52A 1EYGA 1VQ6A 2MQHA 4MNOA 2E2JH 4DUZQ 2VNUD 4DV6L 4GNXA 3M4QA 2NN6I 1IBKQ 4JI2Q 4LF9L 4O2DA 4A3KG 2JK8A 1N32L 4JI6Q 1BBUA 3CW2C 5IYBH 1JJCB 5JEAG 4GLXA 1XMQL 4BY7G 1XPOA 5BR8L 5JJKA 1K73C 2BA0A 3BZKA 1PH3A 4LF5L 1XNRQ 2KENA 2UUBL 2UUCL 2R92G 2A19A 2N3SA 2MNAA 3CCUA 1IBLL 1XTDA 5EAYA 1QVFA 2ZM6Q 2JQOA 1XJVA 4A3FG 1K8GA 3I4NG 4B3RQ 4JI8L 1NTGA 2RHQB 1CKNA 1UWVA 1OXVA 3CCRA 1TWGH 2DGYA 1AE2A 3STBD 4BA1I 5FJ8H 1YJWA 1S40A 4QY7A 5LMUQ 4IOAA 1Y14B 2K5NA 3BZCA 4PZ8A 2Q2HA 1A63A 4A3CH 4X66Q 3PO3G 1K3RA 3K81C 3T1HQ 3J7ZC 3RLNA 3H3VI 1SN8A 1Y1VH 4LUVA 4JG2A 3HKSA 2LXJA 1FJGQ 2B63G 3CC2A 1YBYA 1Q46A 5C44H 1IZ6A 1OXSC 3F2CA 2VQFQ 4A75A 3PO2H 1VQFA 2JEBI 1YITA 1VQGA 5ELOA 1I50H 1V43A 2LXKA 4LF8Q 2R7ZG 2L15A 4LUZA 4LFCL 2EXDA 4A4IA 1P16A
chains in the Genus database with same CATH superfamily
1X3EA 3H0GB 1FD7D 2I07B 4RKLA 1R9TH 3HOVH 5FLMG 1AP0A 1IXRA 1PZKD 3T1YL 3CCMA 5LL6X 1L2FA 1PFNA 2HIXA 3P7JA 4DV0L 1KRSA 2BH2A 1E22A 2F0VA 1TY0A 5BR8Q 2Z8LA 2LY7A 4JBMA 1AEXA 4IUPA 1MKHA 1B3AA 2Z6KA 2EQSA 1X6OA 3EIVA 3CCEA 4HJ8A 1DM0B 3NBHA 3T13A 2WAQE 1SLJA 2E2HH 1WTHA 2DNCA 4G7OC 2L55A 4F7XA 1K9MC 4KLKA 4CDFC 1SBBB 3PUVA 4YHHQ 3L9AX 4DR3L 3MXPA 2Q2UA 5KYIA 2ES2A 4IPHA 1HQRD 1L1OA 2Q8TA 1GHKA 2EYFA 1CKNB 1OXTA 1DXMA 1VCIA 1A0IA 5JEAH 3K80C 4BY7H 3M85A 3A54A 3MFGA 1Q8KA 3LNNA 4XQNA 1Y8NB 1NR4A 2CVRA 2F0GA 4GNXC 4A3FH 1ZYRD 1CFMA 4DV3Q 3D6WA 3I4NH 1I4XA 4OXPA 1RDPD 3DWPA 3HOUG 1ENCA 4UDUC 2E74C 2SEBD 3C1EA 5LMNW 3PO3H 3TREA 2B2WC 2JA6G 2VL6A 1VQPA 1HNWQ 4J8QA 2R6GA 1IW7D 4R4QA 4BY1G 1H9MA 4OIKA 1EU4A 4JI5Q 1EZ6A 2NYZD 4DK3C 1STYA 1CK1A 1CKMA 1VQCA 4UP9A 2Z4IA 4PZ6A 4C1NI 2QDLA 3J81E 4A76A 1XNQQ 2I5HA 4C3HB 2F3IA 2QW7A 3I55A 1JR0D 1HXYD 3CQZH 2NZHA 4DR5Q 3NBIA 2AWOA 1J8IA 1GJXA 2H4OA 3K5OA 4KTAA 3LWUA 2HDLA 1PRTC 5T1GA 4DV5L 4K2KA 4EX5A 2F0LA 2R93H 1AE3A 2R7ZB 4QF4A 3PIOA 3OSOA 1JJ2A 2Z6BA 3CAMA 3NTHA 4BXXH 1I3QH 3ND8A 5I4DA 2JXMB 1QZGA 3P20A 1R4QB 5J3BA 3ER0A 1HNZQ 4QMGA 1EWCA 2SNSA 3SE0A 1H9SA 3C2PA 1W2BA 1NSNS 3HOWB 2C35B 5EKKA 2Z6KC 4HTHA 4J15A 1ASZA 1B4OA 2N8NA 1STAA 1WCMH 5IE8A 1HH2P 1ZXTA 1O78A 2NN6G 1F2LA 2B2YA 4IPDA 2PZWA 4A3MG 3HKZE 5HY6A 1YJNA 1PZID 1K8OA 2KCTA 3A8JE 1SEBD 3E0JA 2V1CC 1X55A 2K75A 4MZ9A 5AFWA 3D0FA 5EBDA 5LHY1 1B2TA 1L1OC 1F9RA 2NVXH 1X56A 3TN2A 1CI3M 2E5LQ 4QUFA 3R93A 1GXDC 2PI2E 1A3VA 2D0OA 1UE5A 2HIVA 3A8IE 4DV2L 1IBLQ 4R9WA 4YY3L 1I94L 1MJCA 3KF8B 1SE2A 4OWTB 2NB0A 4IFDJ 2HQLA 2Z0SA 5IGCA 4OELB 1JORA 5NUCA 4JYAQ 2UXBL 3RN2A 3AYHB 4X62L 4PMCA 4A3EB 1MBYA 5IP9G 1CT1D 5C4JH 4RGMA 4LF4Q 2RA4A 3FKIG 3CC4A 2QEJC 5M5WB 1QB5D 4CGYB 1K8AC 5IWAQ 3MEFA 3PUYA 3K6OA 4OX9Q 3S16H 1BOSA 2PYKA 2JA6B 3J7A5 3CKIB 4A3DB 2YYZA 1B1ZA 5C0XJ 2P5ZX 1SROA 1NY4A 2VB2X 4TVAB 3S2HB 1JE4A 4NXNL 4APVA 1M1KC 3TQYA 4DF7A 2WINB 2A5HA 5ELNA 4JI6L 1B9NA 1N33L 3PSIA 1VQKA 1JWSD 3F2DA 3UDGA 1Y1WH 2AKWB 4IPGA 4YIJA 2ASBA 2FMMA 1BBWA 2EOTA 1VQMA 3D8GA 2A8VA 4A3GH 1Q82C 4AYBE 1TWFB 1V8QA 2BDNA 2UXDQ 3MFYA 4DNRB 1TS5A 1YEZA 1PTOB 5M5YH 1FJGL 1CSQA 2JSOA 2B2YC 1EY9A 1PDQA 1U4MA 2DY8A 4KY5A 3HOXB 3S14B 4JI0L 1X65A 1IHZA 1NMGA 4MTKA 3JAMc 2KUMA 2EPBA 1XMOL 2JA8H 4OONA 2IWHA 1GUGA 2RDGA 4BBRB 2WIIB 2IW3A 4IJLA 2NVTH 4CDEC 1WJJA 4JC0A 3S17H 1F2ZA 1H9KA 4A3IH 3DM3A 2Z9HA 5AJ3L 4R4OA 5LL6S 1OXXK 1GO3E 1QILA 5ELEA 4NXMQ 5CV7A 1GUOA 2PMZB 4GLVB 1VQNA 2VUMH 3HZXA 4DR4Q 2VQEL 4CKEA 1WVLA 5C6AA 2D5DA 1NBWA 3U4VA 2WB1E 5C4XH 3HOZG 3KJPA 4HIKA 1EU3A 2D2CC 2M9VA 3K0YA 3RZDB 2IY5B 3KJOA 1MIUA 2KHIA 1WTVA 3GTLH 3MTSA 2C5CA 2NVYH 2F0HA 2X69A 3FKIB 4L5SA 1VQBA 1FGBD 4XXEA 4K2LA 1TWGB 2RDHA 1Q86C 3R2IA 4IPCA 4N8X1 3CCLA 4KKSA 2EE1A 2AUKA 2CWPA 3HGBA 4S3SA 1A3TA 2B2VA 5L37A 2KBNA 5EJWA 1E2VA 1HZAA 2UU9L 2B2UA 4DNIA 1R9TB 3HOVB 2CH4A 3CRKC 4JI4L 5IY0A 3OW7A 3DEOA 4A3JH 5CBAE 2UXCL 2HHHQ 2K5VA 1WFQA 1GVPA 4RWSC 2K14A 5C44G 2Y0SB 4ZLTF 5E4XA 2KCNA 1Z47A 3E9HA 4AQYQ 1YHBA 1U4PA 1AZPA 2K04A 1N34Q 1U5KA 2HQEA 3F8TA 4XQQA 2F0JA 3D4DA 3SDZA 2O4XA 2E2HB 1RIPA 4H13C 4HJ9A 4DU9A 2PQAB 4A93G 1LUZA 1GHJA 1U9RA 1S5DD 1UNSA 1K0RA 1LTGD 4JCVE 1S5CD 4X3KA 4Q5VA 1YHAA 3AQQA 3CCQA 1EYAA 3TDQA 3OWEB 3KYHC 3W3AA 3OIPA 2OWOA 4K5WA 5EKIA 4GKKQ 3V96A 1I4GA 2IT1A 1DOLA 3QJYA 4HJ5A 3NE5B 3GTKH 1EOTA 1HCZA 4OWXB 2ATWA 4EQ5A 2SNMA 1MSGA 2A74C 4IZ8A 5IYDH 5K36G 4P2CB 1PVOA 4A3FB 3RLOA 3I4NB 4KMUC 1HZCA 4R4CA 4KJOA 1PH5A 4LF7L 3T51B 5FO7B 1TWAB 3G7LA 2E2JH 3Q24A 1R4PB 2KQ3A 4DV6L 3M4QA 2NN6I 4LF9L 1BBUA 5KEEA 2AUJD 5IYBH 1XMQL 2BA0A 1DD2A 3FVQA 4LF5L 2UUCL 2XWBB 2A19A 2K5QA 2MNAA 3BDCA 5CV6A 3SK8A 2ZM6Q 5D3DA 5JPNC 4B3RQ 1LTBD 4BA1I 1GUWA 4QY7A 1BNZA 3CQZB 1FNVA 3BZCA 2N55A 1A63A 1K3RA 3K81C 3T1HQ 2K28A 1JQYD 1Y1VH 4LUVA 4JG2A 1SYBA 4RFBA 1SNMA 2MJ8A 4IUUA 3F2CA 2VQFQ 1RF2D 1VQFA 2B2UC 1YITA 1KNAA 1VQGA 5ELOA 2R93B 5G3LD 1I50H 1V43A 2LXKA 4NDXA 3HKZB 3BVZA 3K5LA 5IGFA 1P16A 1KHIA 1I3QB 5DLQE 3QR8A 1LTLA 1GOZA 1TS3A 1ET6A 4EGVA 3DHQA 4DR1L 1C48A 3J81c 4K8IA 2RKSA 4LF6L 1QE6A 2KA7A 4ULLA 3T53B 1N32Q 1G2SA 1TS4A 5C44B 1NCVA 1WCMB 3X3MA 4TKOB 5K5PA 1N36L 2A68D 1PTOF 1RODA 4TRDA 4J6HA 1KD1C 1F9QA 1KLUD 2PNRC 4C2MH 3DLLA 4IUTA 2CCZA 4JI8Q 3H0GG 2A6EC 3ZJYC 5BN3A 4C3JH 1QNUA 1UEAB 2F0KA 1EIGA 1YZ6A 2RHSB 4K14A 4JBJA 4KI0A 1WD0A 5DNFA 5KNCA 1HR0W 2EVBA 2VW9A 1UE7A 2NVXB 1NUCA 2B29A 5C0XG 5IT9L 2KCCA 1JOOA 1PH9A 4DR6L 5IP7G 3K8AA 4HJ7A 4BA2I 1CSPA 1PH7A 2O2LD 1QUQB 1ILPA 4TQUS 1EFWA 4FO2A 3BVMA 1YIJA 1RKNA 2RSOA 3MXNA 1JMCA 4B3SL 4NW2A 1SMXA 3EFXD 4FVMA 4CDDC 3T1YQ 3KBXA 1VS0A 3HFZB 1H95A 4GN5A 3S24A 4UHVA 1OXUA 3P1HA 3SK5A 4DV0Q 1SYDA 1EYCA 4RCOA 4QQBX 3K57A 3NK9A 3HRZC 2MP1A 1Q1EA 3I2ZA 3S16B 2BA1A 4JBWA 4P73A 4F88A 2XN9C 1SFOH 1LLRD 4ME3A 1X3PA 3UDFA 4LWCA 3FHWA 3ZYYX 1TIID 1Q1BA 2L0CA 5LMNL 5KNDA 2ZT9C 4K8JA 3KLSA 2DY7A 4DR3Q 1Y1WB 1ASYA 3SK4A 3J7AF 3LWEA 1PFSA 3FDTA 1EY6A 4PMBA 5FOBB 2I5LX 2B2WA 4A3GB 3U9SA 1BCPF 4ZYSA 5M3MH 2JA7H 3UE0A 1EYDA 4GN3B 4IUNA 5JEAJ 1B50A 4JI7Q 1JCKB 3SVMA 1EZ8A 4BBSH 1SNDA 3M4OH 1L0WA 1ENAA 3NXWA 3EVQA 3BJUA 4M8AA 3A74A 1YHQA 3EA6A 3GDEA 1BO0A 1KABA 3CPWA 2JA8B 2GVBA 1E2ZA 3NTKA 4ZCKA 2E8GA 2F4VL 4DV1L 2NVTB 1B44D 4WORA 3D31A 2WB1B 3S17B 4JVZA 1V1QA 2L11A 4A3IB 1CA5A 3DXJC 4KKUA 4OL7A 4HN7A 1AH9A 2ZXRA 1CQFA 4X3SA 1K0SA 1EQTA 4OO1G 3NP8A 1DOMA 3HOWG 4DXFA 4P74A 1LTTD 4UY8C 3B6YA 2JA5H 1TT2A 1LT5D 1PRTD 3GD7A 4P72A 1SYFA 2MGSA 5ELCA 1IBML 4RKBA 3GTPH 2RBMA 2ZTEA 2M00A 3PIPA 1M4VA 3HOYH 4IUVA 4DAVA 2OCEA 3AFQA 3GTLB 3K7AH 2NVYB 2FJ2A 4A3BH 2F0PA 1FNWA 2B3GA 3OIQA 1KLGD 4XDXA 5E7NA 5C4ZA 3K0XA 4FDBA 2CQOA 4ZKCB 1JB7A 5T1IA 2EYHA 2J7ZA 4MIUA 2L9HA 2DN8A 1GUTA 4GKJL 2IJ0A 3C3LA 4A3EG 4DUZL 3FP9A 4HSPA 2JE6I 3LX0A 4A3LG 3E9IA 3ND9A 1ET9A 4GOPB 1GKHA 3MAQA 1P8LA 4L63B 1T9HA 4DR2L 4FF2A 1D5MC 2MFIA 1I94Q 1CZWA 2F0DA 4LW1A 4A3JB 4A3DG 5CC4A 1M8AA 2JP1A 2HCIA 1XPRA 2OTLA 5M5XH 2MUYA 3IAYA 5GAHC 2B2TA 2UXBQ 1SNPA 4O42A 1LTAD 1A8VA 5LMUL 3S1NH 4WJ3M 3L2PA 2I0QA 4X66L 2GA4B 4XYQA 3K58A 1IL8A 3H91A 1Z9FA 4DAYB 3NHHA 5C3EH 2LKVA 2E76C 3KK7A 2F0WA 4HMJA 4ME5A 4LFBQ 4Q0FA 4FF3A 1YNNC 4G4KA 3PGZA 4CKCA 1WTPA 1IYUA 3RD4A 4C3IG 4L6TB 3H15A 1ESRA 3H3VH 2BOSA 3PF5A 2CH4W 1CHPD 4N9TA 5D14A 3CCVA 4NXNQ 2A69C 3K5MA 3ERQA 4IQZA 3GTKB 4ABNA 1N33Q 1K83H 4IALA 3HOXG 4NMZA 1G291 2I5MX 2KECA 1X3FA 3A8KE 1SYGA 4X3UA 1S72A 2KCMA 3NUCA 2YTXA 2OQ0A 2FHTA 2IHFA 1QUQA 4BBRG 3H94A 4IFDI 1WTRA 3I4MH 1J5EL 2F52A 3SXHA 5D3IB 2AHOB 1VMCA 4ZAIA 3A5UA 2F0QA 4K0KL 1D6EC 2KJXA 4YHHL 4DR7L 2HD3A 2PO4A 4JI0Q 4GZYC 3CCJA 1FL0A 1JE5A 1S5ED 3ONAB 5J39A 1Q8IA 1XMOQ 1PHJA 5C0XI 1G8ZD 4Y7NB 2JYOA 2KEEA 4U673 4C1NK 1SDFA 1Y1VB 4DV3L 1PH4A 2QGQA 3D6CA 1D8LA 5IGEA 4DK0A 5AJ3Q 2XVSA 1WD1A 2K05A 3I3CA 3I91A 1C4QA 1BKBA 1I6VC 5BN4A 4NB3A 3CHBD 5IOCA 2VQEQ 2LSSA 4HEDA 5I2XA 1HNWL 1HZBA 3D4RA 1B7YB 4JV5L 3E6ZX 2EJGC 3NELA 2B2TC 2EY2A 4XT3B 4JI5L 3OYYA 3KLWA 3WDNA 4JK1C 1SE4A 4XIGS 3WOFA 2YV5A 1X32A 2CHBD 3W5OA 4DR5L 4ZKBB 4C2MB 1O80A 3W1BA 4K5VA 1Q81C 4C3JB 3X3NA 3HOVG 1WI5A 4QGUA 2WAQG 1XNRL 1I6HH 3VR6A 2EY6A 1TVXA 3STBC 2AWNA 4C3IB 4DGZA 2Y0SG 2EYMA 2KVMA 1QOHA 1ILQA 2OQKA 1HNZL 1PH2A 1NAPA 3RNUA 1D1KA 3G6EA 1EIHA 2BH8A 2UU9Q 3TS2A 1QJOA 3S1RH 2BCOA 2F0NA 4X65Q 4JI4Q 1CTMA 2X6LA 4POGA 3EJIA 3MA2B 1E7ZA 1VQIA 1L0XB 5KIXA 2UXCQ 1K28A 1W6JA 5CV4A 1NNXA 2MQHA 2RDFA 4MNOA 4NKLA 2AQ3B 5CV8A 1LACA 2EYJA 3EQLC 3RMHA 3CW2C 3NPPA 1BR9A 5JOBA 4GLXA 1JJCB 5JEAG 3NQIA 1SFOB 4BY7G 1XPOA 5JJKA 4FNFA 5EPKA 1Y8PB 1PH3A 1T5EA 2UUBL 3NWTA 2J4XA 1IBLL 5EAYA 1IKLA 2JQOA 4DA2A 4A3FG 1K8GA 3I4NG 5I6WA 1CKNA 1UWVA 5HURA 3MEHA 1OXVA 1WTWA 5FJ8H 1CQVA 2Q2HA 4A3CH 3QIAA 3PO3G 3RLNA 5IGDA 3HKSA 2LXJA 2PCFB 1KTKA 2PPBC 1RJTA 3PO2H 2JEBI 2K7VA 4PQXA 4WJWA 5E3FA 1LO5D 5CORA 2O5JC 2L15A 2OXPA 2VXWA 3IL8A 4LFCL 1HRJA 2WKDA 5M3MB 2EXDA 2JA7B 4RH6A 3E3XA 2NBFA 4LF7Q 1JOKA 3PCOB 4P71A 4RHSA 1DJRD 1AW7A 1PZJD 3M7NA 5JAVA 1HFNA 3UI2A 3H6MA 2G9HD 5IT9E 4BBSB 1JT8A 4DV6Q 2ID0A 4LF9Q 3PIP3 3GTJH 3RN5A 3TBIB 5EGTA 2QCPX 1C9OA 1B8AA 1XMQQ 3WOEA 5I9PA 4DKAC 5IGBA 5M3FH 4LF5Q 2EY5A 2R93G 4RA8A 4O0AA 3A5ZB 5GAEC 3HKZG 1QG7A 1FR3A 4DAYA 4BXXG 5JVH3 1JB3A 2WAQB 3M3YH 4GNXB 1BCPB 1U0LA 4HR7B 3R8BA 4XYOA 1HUMA 3RZOH 3L0OA 2XNAC 1UEBA 2RCFA 1I4PA 1SXTA 4RHRA 1KXLA 2N49A 4BWGB 5IYCH 1JOQA 1WCMG 1Q12A 2CFMA 4R4TA 3BYYB 2CW0C 2F0SA 4B9WA 3ERSX 4A3KH 1HR0L 3HP3A 3V05A 5IIFA 4JPBW 3OTOL 1RL2A 3GTPB 1HNXL 2K33A 1QNKA 1E2WA 4KN4C 3HOYB 1EQRA 1TWCH 2PZUA 4DV4L 1PH1A 1CKOA 1VQ7A 2WFWA 3I4OA 3L3OC 1YNJC 2B39A 3PV0A 2R92H 3RLFA 2QF7A 2AQ2B 3K7AB 4LF6Q 4A3BB 1CM9A 1D5ZC 1GM5A 5KGUA 3I7FA 4M1UB 4MTNA 4C3HH 5E4WC 4QIWE 1N36Q 2HCCA 4RGOS 3I8ZA 3CP0A 1PRTB 4EQOA 3G48A 3QOLA 3TSSA 3G6JB 4FP5D 4BY7B 1EY4A 1O7YA 1XYIA 1S3OA 1CA6A 2F0FA 2B63H 4LUOA 3IFTA 2A6ED 4DR4L 2SOBA 5HGTA 1E3PA 1SMYC 4N8FA 2R7ZH 4JW0A 1KAWA 3GP7A 4RGTA 3BYTB 3PIO3 1BF4A 4UP7A 3KF8A 5FLMH 3R2TA 4DR6Q 3PO3B 5J22A 3AEVA 5CMDA 3H09A 3A56A 1S5FD 2H5XA 1F77A 3G4SA 1F9PA 1STGA 1V1OA 1UUPA 3SK6A 2NTSA 1KC8C 5M5XB 1RHPA 5F2DA 1WYDA 3QWNA 3DMUA 1F9SA 3SEBA 5ISRA 4CDCC 4KD4A 1O7IA 1MGSA 3ULPA 1L1OB 1XXGA 3JC66 2WV6D 5C3EB 4RG1A 4KY7A 4AH6A 2FINB 4DNTB 2ZJRA 1Y1WG 1PYSB 3KLRA 5EKLA 5G3LF 1BUVT 3U4ZA 4H02A 5C4HA 4IO9A 3OW2A 2K4KA 4JI1L 4A3GG 1HZ9A 4B9XA 3Q0AA 1JWMD 5HGQA 1TS2A 4U68A 2N78A 3TP8A 1KDAA 3GTQH 2J0TD 2CQAA 2E75C 3MWYW 4B3TQ 1MJEA 5LMNQ 1HTLD 2PW5A 2R61A 1J6QA 2PZTA 3MHBA 1DONA 4F87A 1N8RC 4XTCS 1S5BD 1K83B 1ONLA 3KFUA 1VQ9A 3PUZA 1OTCA 2Q8IB 4MHEA 1SJHD 1TXYA 4HIOA 2JA8G 3HOUH 3RR5A 5IODA 3I4MB 3VYUA 1K8MA 5JJZA 1D7QA 2WB1G 1XX8A 2EZVA 3FMCA 3HEJA 2JA6H 2M2LA 4YCVA 4A3IG 3R3OA 2VB3X 2Z1CA 4V190 3AU7A 4BY1H 1SRUA 5CV9A 3TP6A 1AN8A 3CF5A 1Q90A 3TZUA 2ZJQA 4DUYL 1Z6HA 1WTOA 3UE1A 3JAMi 2VUMG 3CU7A 5H1SE 2ICIA 4EVOA 1PFMA 1I4QA 1U4RA 4L8JA 3S9WA 2A6HC 2F4VQ 5DEHA 4DV1Q 1RCVD 5C4XG 1STHA 5TSSA 4X64L 5A2QL 1STEA 1A2TA 1H9SB 1NE3A 2G5DA 2JN4A 4B3ML 5M9OA 1N9WA 4HIDA 1LYLA 1SE8A 1BQQT 5C4JB 3UDXA 1LV9A 3QG1A 1VQJA 1Y8OB 2UUAL 1X3QA 2ALYB 5IGGA 2NVQH 1A2UA 1EL0A 2N88A 1IYJB 1FGUA 2RCNA 5DAUA 1XPUA 1IBMQ 3CMAA 1TQOA 5DM73 3M4YA 3CCSA 4O1NA 2NN6H 1I5FA 1CZGA 4I65A 1NR2A 5C3WA 4A3MH 4YWLA 4AYBB 2YU9H 1VQAA 1B9MA 4LFAL 4FF1A 1WTQA 1ENFA 3KF6B 3AB9A 1I6HB 4CJ1B 4Y52H 5JVG3 4A3JG 4R1JA 1VF7A 3NWSA 3Q23A 3EN2A 2EIFA 1F2YA 1GUSA 2L4NA 5FLXE 3QO2A 3AMUA 2B8GA 4HSVA 4JI3L 4GKJQ 4OGQC 3NTIA 3E0EA 3GQBA 4POFA 5M5YB 5JJLA 2LMCB 4DXGA 1HUNA 2V4DA 3S1RB 4YWMA 4DR2Q 1TWHH 3RZDH 4OWWB 3GTGH 3S1MH 4XT1B 1PTOC 2PMZE 5IP9H 1TU2B 4RAUC 3FKIH 4DV7L 3I72A 1ML0D 4K5XA 5KYLA 2QKIC 1X3GA 4F8MA 2OEOA 3VDYA 3KLSX 3CMEA 1D1IA 1GUNA 1PMRA 2KEDA 2R7DA 2PQAA 1LTSD 2FMCA 4E6IA 2OTJA 5C5MA 1A6XA 3TZDA 3QOJA 2EYOA 2JA9A 2AQ1B 3A7LA 4KHPL 3OOCA 4OEMB 2EXZA 4G7ZC 2VUMB 5IYDG 4L5RC 1J9OA 1OO9B 1PRTF 2JEAI 3PF4A 4DV5Q 1YNND 2OF1A 3Q8DA 5C4XB 4FXDA 1U4LA 1EWIA 1WTXA 1QVCA 1KL9A 4CHTB 4HJAA 2G9DA 4IOCA 5IYBG 3SGIA 3TRZA 2A69D 2MO0A 1QVGA 2DJGC 5DM63 3PO2B 1E1OA 1MD2D 1Q3LA 2ZXOA 2QEXA 3DUZA 4TSSA 3S1QH 1K3BC 2Q8RE 1UE6A 1ESFA 3L7ZC 5GQOA 1A3UA 3QB3A 2BE5C 2F3VA 1LTID 1QCBD 1J5EQ 1HTPA 1VQHA 1XTCD 2D62A 3GTJB 3U58A 1SR3A 1H9RA 1Y1VG 2YTVA 2F03A 1YNXA 4K0KQ 2KOLA 5M3FB 4QL5A 2Y0SE 4DR7Q 3J80i 5CGKA 1IBKL 4JI2L 2XTIA 4ZRZA 4AIMA 2F1MA 4DK1A 1RD9D 2FXQA 3CPFA 3J80E 2LFNA 4DV2Q 3M3YB 4YY3Q 4DN4M 3JAML 3RZOB 1Z7TA 2K50A 1B53A 3A55A 4FF4A 2K03A 1BCPC 4WRDA 3S2DH 5CV5A 1TWAH 4QIWB 4X62Q 1PV4A 5IT9c 4X6AH 4NPSA 4JI7L 4P75A 4A3KB 2F4IA 2K1BA 4LJZC 3HOZH 4L5QA 3CXCA 1KIXA 4C3JG 3DWQA 3VR3A 1DYQA 2F0OA 1TWCB 2EY1A 4PG3A 3J81i 4PZ7A 4JV5Q 3K7UC 2R92B 2PI2A 4DAMA 4LF8L 2ZJPA 3MXGA 1ICFB 4ILWA 1SE3A 3OPOA 2K52A 4BS9A 3NSWA 1XWEA 5E1FA 1JICA 2JK8A 4V0BA 5KRUA 4JI6Q 2I46A 2B63B 5BR8L 1EQVA 3BZKA 3VYTA 1XNRQ 4G7HC 2KENA 2K5DA 2N3SA 1QVFA 1XTDA 1XJVA 2F0MA 1NTGA 1H9JA 2WKCA 3TP5A 3STBD 1YJWA 1AE2A 2E2JB 4IOAA 3TMEA 5COYA 1Y14B 5FLXL 3OWFA 2K5NA 4QB4A 1KDCA 4WFN3 2B8FA 1I4HA 2RVLA 1FJGQ 4K6DA 1YBYA 4H0LC 1Q46A 5C44H 1TY2A 4NP5A 4A75A 1LABA 1HHVA 3GV6A 5BN5A 5I2YA 2RSNA 3VYSA 5FKAC 4DAPA 4ZK9B 4LUZA 4J1MA 4ZQ3A 5J1ZA 4A4IA 1C0AA 1JWUD 2BDOA 3CC7A 2L5TA 3O13A 2RF4A 1IYVA 2HT1A 4A93H 1ZYRC 5JPMC 1D2BA 1SJED 1YJ9A 3I56A 4YCWA 1HPCA 3F2UA 4IJHA 3I73A 1I50B 2UUBQ 2OT2A 2A1AA 1PFBA 2D0PA 4DFAA 5EBCA 1IW7C 3RUZA 5M3MG 3FEWX 3VR5A 3KF6A 2JA7G 3GTQB 3M4PA 4KJNA 3H3VC 1G6ZA 4BBSG 2R3ZA 5K36H 1XNQL 2EJFC 2IX1A 1PLFA 1MSHA 1EFID 3S15H 3TS0A 2KHSA 3K59A 4H7BA 1FNUA 3HOUB 3KOJA 2NTTA 3V2TA 3I90A 4LFCQ 3GTOH 3IFDA 4LFBL 3EROA 3U9OA 5GADC 1KDBA 3M7GA 2ICEC 4BY1B 2E2DC 1D5XC 3I4LA 4H44C 3GTMH 3M9BA 2XGTA 1VQOA 2DNEA 4N9PA 3G71A 1V1PB 2E2IH 4KV6A 3TEHB 1B3QA 4HMIA 3WWVA 2ZTCA 3NENA 2JA5G 3ULJA 3F1ZA 1HA5A 4PNYA 4L5TA 1PYWD 1WOCA 1T5XD 2ZTDA 3C46A 1YI2A 1DGSA 2O5IC 1PH6A 2TSSA 3HOYG 3IRBA 4QCLA 1SYEA 1NMFA 3J80L 4WJ4A 1KQSA 4IURA 1O7ZA 3W1GA 4A3BG 2R7FA 2YTYA 4ZUIA 3FRPB 3PMFA 1MI2A 2NVQB 3KDFB 4YWKA 1FYCA 4FYDA 3ULLA 2E5LL 4EQNA 1HR0Q 3OHXC 3OTOQ 2CW0D 3E5SA 3IKJA 1HNXQ 4JBKA 4IFDH 4KY6A 1LT4D 3UDIA 3T16A 2IPKD 4OIJA 4DV4Q 3OMCA 1TKWB 3BVGA 4A3MB 4OO1I 2YU9B 2AMCB 1YNJD 3EBEA 3BU2A 3H0GH 3J81L 4R8NA 4B08A 1FVIA 1ZKOA 4JYAL 2GVAA 2F3WA 1G2TA 2L12A 2K5WA 1SYCA 3CRLC 3MXNB 4LF4L 5C0XH 3OMGA 1BBXC 1LTRD 2Z4HA 3N6RA 5IWAL 1LM0A 5IP7H 4OX9L 4GOPA 1SMYD 3J81j 1A15A 4ZUJA 1BVSA 5C5LA 5C3EG 3M4OB 3NEMA 3SHLA 1TWHB 4KKTA 1UAPA 4Z9CB 3GTGB 3S1MB 2IX3A 3FPPA 4DPGA 3N52A 2QILA 2UUCQ 1Q7YC 2IL8A 1CHQD 2NWGA 2XIWA 2SDFA 5A2QE 1M90C 3VR2A 2IHEA 1VQDA 2NUCA 5C3XA 5ELBA 2XWJB 1CUKA 2LS01 3PUXA 3BS1A 3GO5A 1MHWC 2Q2IA 5FLXc 3K5NA 3SR1A 5A35A 1E1TA 1EY5A 4XQJA 4FXGC 2UXDL 1W6KA 2JA5B 3NQTA 2JJQA 2PQEA 4JOIA 1VMPA 4JI1Q 2QA4A 3MXUA 4HAEA 3A7AB 4UPAA 3I4MG 4X65L 4IUQA 1I4RA 4CJ0B 3VA7A 2PNHA 2DJFC 2VS1A 4DR1Q 4LMQD 1E24A 1W3SA 4UP8A 1Y69U 1SNQA 4G57A 2EJMA 5KNBA 4LAAA 4IN3A 3S1QB 3BZDB 3URYA 1VDZA 5I6YA 2NZOA 4KHZA 5ELFA 3FPUB 2L1BA 4NXML 4KD3A 1E0BA 2WACA 4CBVA 4I7AA 2DUDA 1EUJA 1TR5A 4GN4B 1B70B 3BDLA 4HIMA 3DM1A 5CYUA 2HDMA 4ODGA 2EYLA 4LK1C 4DUYQ 2NZ1D 5CR3A 3U50C 2VY3A 2PW7A 4OHJA 1KAAA 3A0JA 1AFPA 3NBHB 3VA5A 1VQEA 4OO1H 5JJIA 3HOWH 3J7AV 2A6HD 4X64Q 4GOPC 5FO8B 1HA6A 1ICWA 5GAGC 4B3SQ 4EQPA 1ZEQX 4B3MQ 5EQ0A 2CWAA 3S2DB 4RGNA 1GD7A 3S1NB 1EOVA 4K6LA 4AYBG 1O7LA 1STNA 2UUAQ 1BXTA 1V9PA 3D3RA 4PV1C 3HG9A 3HOZB 2K5HA 2F0TA 4PMWA 4ALPA 3Q6SA 2ZXPA 3P75A 2IX0A 3MZ5A 1PYBA 4KHVA 2VZAA 3J80c 3DWAA 4QJFA 2D9UA 2GN5A 1JJGA 4MN3A 3GV3A 3C1FA 2B2VC 4Y7NH 1EIYB 4LFAQ 4ID6A 4HCEA 1EY8A 2HHHL 2CKZB 1PH8A 1EWHA 1C8CA 1DCZA 1EEID 2EDGA 2Q2TA 1V1PA 4JOIC 1C7YA 4AQYL 4A3EH 1DOKA 5I9OA 3BDOA 5ELDA 1N34L 5M5WH 4A3LH 1EY0A 2XRQD 5CBEE 1X9NA 1KRTA 4JI3Q 1VQ4A 1PA6A 4A3DH 1A62A 3CD6A 1VQ8A 4HCSA 4CKBA 2MHVA 1PXUA 4DK6C 4IFDG 4R4IA 3VYRA 2KHJA 2QDBA 3KUPA 1X54A 4UAIA 4GKKL 2MPMA 1II3A 1SAPA 3MC0B 3S2HH 4YCUA 2RQXA 2ENBA 2XSCA 4DV7Q 3KDFA 1PTOD 3JAME 5FJ8G 3AFPA 1KNEA 1HFGA 4KK7A 2K32A 4A93B 4R8IA 2MO1A 4A3CG 2FFKB 1SNCA 3DEPA 1IL2A 3PUWA 3W2DA 1VQLA 4X3TA 4C3IH 3VR4A 1EIFA 3PO2G 1DZ1A 3HS0C 4QUCA 1YVCA 4GS3A 4KHPQ 2C9OA 2F0EA 1TWFH 5EPJA 1STBA 1QZHA 1G6PA 1PTOH 1SNOA 1IKMA 1VQ5A 4LNQA 1EEFD 3HOXH 2HUGA 4GLAC 1G91A 3T4AC 3F2BA 3S14H 2ZM6L 3ICEA 1G51A 2F0IA 1AZQA 1S4ZA 4I7ZC 4B3RL 5FK9C 1HJPA 2TMPA 3S15B 1RTOA 1NJIC 5M3FG 1RTNA 1HQMC 4BBRH 1QWYA 5D65A 3MVVA 3I70A 3PQIA 5GROA 1EQQA 2WP8J 3T1HL 3TP7A 3GTOB 1UE1A 2VQFL 4CJ2C 2BE5D 4RMFA 1F2MA 4FXKC 3GTMB 3KBGA 2E2IB 3LGJA 2A73B 5IYCG 4B3TL 2EYPA 1EYGA 1VQ6A 2H1EA 4DUZQ 2VNUD 5FO9B 1LT6D 4GNXA 1IBKQ 4JI2Q 4O2DA 4A3KG 1JC7A 1N32L 4KN7C 1EY7A 3Q22A 2A68C 1K73C 2XRSD 3BG3A 2R92G 3CCUA 4RCNA 1BDOA 1L0YB 4JI8L 1LT3D 2RHQB 2K6AA 3CCRA 4C3HG 1TWGH 2DGYA 3J7YW 1S40A 1BCPD 5LMUQ 2K01A 3D4WA 4PZ8A 4X66Q 3J7ZC 2F0UA 3H3VI 1SN8A 2X6GA 2B63G 3CC2A 1OXSC 1IZ6A 3ITPA 1SSOA 5EPLA 4LF8Q 2R7ZG 1VF5C 4C56C 3T56B
chains in the Genus database with same CATH topology
1X3EA 1C0AA 4LF7Q 3PCOB 4P71A 5DLQE 3CC7A 2RF4A 1R9TH 2HT1A 3HOVH 3M7NA 5FLMG 1LTLA 1IXRA 4A93H 3T1YL 4DR1L 1JT8A 4DV6Q 3CCMA 3J81c 2ID0A 4LF9Q 1L2FA 3GTJH 1YJ9A 3I56A 4LF6L 3RN5A 2HIXA 1N32Q 4DV0L 1KRSA 4YCWA 1C9OA 2BH2A 1B8AA 1E22A 4IJHA 1XMQQ 5M3FH 5BR8Q 4DKAC 4LF5Q 1N36L 2UUBQ 2R93G 4JBMA 2A1AA 4O0AA 2D0PA 3A5ZB 5GAEC 3HKZG 1MKHA 1KD1C 2Z6KA 2EQSA 1X6OA 5M3MG 4C2MH 3DLLA 3KF6A 2JA7G 3EIVA 3M4PA 2CCZA 4JI8Q 3H0GG 3CCEA 3ZJYC 4HJ8A 4C3JH 3M3YH 4GNXB 2WAQE 1SLJA 2E2HH 1U0LA 1YZ6A 2RHSB 4JBJA 4KI0A 4BBSG 1K9MC 1HR0W 3RZOH 2VW9A 1UE7A 3L0OA 1XNQL 2IX1A 4KLKA 1UEBA 3PUVA 2B29A 3S15H 5C0XG 1KXLA 2N49A 5IYCH 3TS0A 1WCMG 1Q12A 4YHHQ 4DR3L 2Q2UA 2ES2A 1PH9A 4IPHA 1L1OA 2CFMA 3K8AA 5IP7G 4R4TA 4HJ7A 3KOJA 4BA2I 4DR6L 1CSPA 1PH7A 1QUQB 1CKNB 1OXTA 3ERSX 4A3KH 3GTOH 4LFCQ 1VCIA 1HR0L 4TQUS 4LFBL 3OTOL 1A0IA 1RL2A 5GADC 1HNXL 1EFWA 1YIJA 3K80C 4BY7H 3M85A 4B3SL 1EQRA 1TWCH 4DV4L 1PH1A 1JMCA 1Q8KA 1SMXA 1CKOA 1VQ7A 2WFWA 3I4OA 3PV0A 2R92H 3M9BA 3GTMH 3T1YQ 1VS0A 2XGTA 3RLFA 3HFZB 1VQOA 1H95A 3G71A 4GN5A 4GNXC 2E2IH 3TEHB 3S24A 4A3FH 4DV3Q 4LF6Q 3I4NH 1OXUA 4DV0Q 4OXPA 3WWVA 2ZTCA 3NENA 1GM5A 2JA5G 3I7FA 4MTNA 3ULJA 3F1ZA 4C3HH 4QQBX 4QIWE 3HOUG 1N36Q 4L5TA 3CP0A 1WOCA 1Q1EA 3I2ZA 5LMNW 3G48A 2ZTDA 3PO3H 3TREA 1YI2A 2BA1A 4JBWA 1DGSA 4P73A 2JA6G 1PH6A 2VL6A 1S3OA 1VQPA 1SFOH 1HNWQ 2R6GA 4R4QA 2B63H 4LUOA 3HOYG 3IRBA 4ME3A 4BY1G 1NMFA 3UDFA 4DR4L 4WJ4A 4LWCA 1KQSA 4JI5Q 1E3PA 4DK3C 1CKMA 4UP9A 1VQCA 3FHWA 4PZ6A 4A76A 1XNQQ 2R7ZH 1Q1BA 3W1GA 4A3BG 1KAWA 2R7FA 5LMNL 2I5HA 2YTYA 2F3IA 4UP7A 3I55A 5FLMH 4DR3Q 3CQZH 3KDFB 2NZHA 4YWKA 4DR6Q 4DR5Q 3AEVA 3ULLA 2AWOA 2E5LL 1ASYA 2H5XA 3G4SA 1HR0Q 3OTOQ 4JBKA 1PFSA 1HNXQ 3UDIA 1KC8C 4DV4Q 4DV5L 1WYDA 2I5LX 4EX5A 2R93H 1AE3A 3PIOA 4OO1I 2AMCB 1JJ2A 1O7IA 5M3MH 3CAMA 2JA7H 4BXXH 3EBEA 3ULPA 3UE0A 3BU2A 1I3QH 3H0GH 1L1OB 1QZGA 4GN3B 3JC66 5J3BA 3ER0A 1HNZQ 5JEAJ 4RG1A 1FVIA 4JYAL 4JI7Q 2GVAA 4AH6A 4BBSH 2ZJRA 3M4OH 1Y1WG 1L0WA 1PYSB 1W2BA 3BJUA 3MXNB 3A74A 1YHQA 2C35B 3GDEA 4LF4L 2Z6KC 4J15A 3U4ZA 4H02A 1ASZA 2N8NA 3CPWA 4IO9A 1WCMH 5IE8A 5IWAL 1HH2P 1LM0A 2NN6G 3OW2A 2GVBA 2K4KA 4JI1L 5IP7H 4IPDA 1HZ9A 4OX9L 4A3GG 2E8GA 4A3MG 5HGQA 2F4VL 4DV1L 3HKZE 2N78A 3D31A 4GOPA 3GTQH 5HY6A 1YJNA 3J81j 4B3TQ 1MJEA 2KCTA 5LMNQ 1V1QA 1BVSA 1J6QA 5C3EG 1AH9A 1N8RC 2V1CC 4XTCS 1X55A 2K75A 3NEMA 4MZ9A 4BXXG 3D0FA 4OO1G 1L1OC 3KFUA 2NVXH 1X56A 1VQ9A 3PUZA 2E5LQ 3HOWG 4P74A 4UY8C 1OTCA 2PI2E 4DPGA 3B6YA 2JA5H 1TXYA 2D0OA 4HIOA 1Q7YC 1UE5A 2UUCQ 2HIVA 2JA8G 3HOUH 4DV2L 1M90C 1IBLQ 3GD7A 3RR5A 4YY3L 2IHEA 4P72A 1VQDA 1I94L 1IBML 1D7QA 1MJCA 2WB1G 3KF8B 3GTPH 1CUKA 2ZTEA 2JA6H 3PUXA 4YCVA 4OWTB 4A3IG 3PIPA 3GO5A 3HOYH 2Q2IA 5FLXc 2HQLA 2Z0SA 1SRUA 4BY1H 4IFDJ 4JYAQ 2OCEA 3CF5A 3AFQA 2UXBL 3RN2A 3AYHB 1E1TA 2ZJQA 4X62L 4DUYL 3K7AH 5IP9G 3UE1A 3JAMi 5C4JH 2VUMG 4A3BH 4LF4Q 2UXDL 3FKIG 5H1SE 3CC4A 2B3GA 1K8AC 5IWAQ 3MEFA 2JJQA 3PUYA 4JOIA 2QA4A 4JI1Q 4OX9Q 5E7NA 2F4VQ 4UPAA 3I4MG 3S16H 4DV1Q 3K0XA 3J7A5 5C4XG 4FDBA 2CQOA 4X64L 4X65L 1JB7A 2YYZA 2PNHA 5C0XJ 1NE3A 4B3ML 2VS1A 4DR1Q 1N9WA 4HIDA 1E24A 1W3SA 1SROA 4GKJL 1LYLA 1NY4A 1SE8A 4TVAB 4UP8A 4A3EG 4DUZL 3UDXA 2UUAL 1VQJA 3FP9A 2ALYB 2JE6I 4NXNL 4APVA 1M1KC 4A3LG 3TQYA 3E9IA 4JI6L 5ELNA 2NVQH 4GOPB 2NZOA 1N33L 4KHZA 1GKHA 3PSIA 1P8LA 1T9HA 1IYJB 1FGUA 2MFIA 2RCNA 4DR2L 3F2DA 3UDGA 1Y1WH 1I94Q 2AKWB 4IPGA 3CMAA 1IBMQ 4NXML 1XPUA 4LW1A 4A3DG 2ASBA 1XPRA 2OTLA 1BBWA 2DUDA 1EUJA 1VQMA 5M5XH 3CCSA 4GN4B 1B70B 5GAHC 1I5FA 2A8VA 4HIMA 4A3GH 2UXBQ 4A3MH 4YWLA 5LMUL 1A8VA 1Q82C 2YU9H 3S1NH 4WJ3M 4DUYQ 4AYBE 1VQAA 3L2PA 4LFAL 2I0QA 3U50C 2VY3A 4X66L 2UXDQ 1YEZA 1Z9FA 4DAYB 5C3EH 3KF6B 5M5YH 3A0JA 1FJGL 1CSQA 3NBHB 1VQEA 4Y52H 4LFBQ 5JJIA 3HOWH 4A3JG 4R1JA 4JI0L 1X65A 3PGZA 4X64Q 4GOPC 5GAGC 3EN2A 1NMGA 4B3SQ 2EIFA 3JAMc 1VQKA 1XMOL 2JA8H 4OONA 4B3MQ 3H15A 2CWAA 1GD7A 4JI3L 3H3VH 4IJLA 2NVTH 1EOVA 4AYBG 4GKJQ 3PF5A 1WJJA 4JC0A 3E0EA 3S17H 2UUAQ 1V9PA 4POFA 3CCVA 4NXNQ 4A3IH 2K5HA 5JJLA 3DM3A 5AJ3L 4R4OA 1N33Q 1K83H 4YWMA 1OXXK 3HOXG 4DR2Q 1GO3E 1TWHH 4PMWA 4ALPA 1G291 2I5MX 3RZDH 4NXMQ 4OWWB 1X3FA 2IX0A 4GLVB 5IP9H 2PMZE 1PYBA 1VQNA 2VUMH 3GTGH 1S72A 3S1MH 3FKIH 4DV7L 2KCMA 2VZAA 3J80c 2YTXA 2VQEL 4DR4Q 2OQ0A 4QJFA 2IHFA 1QUQA 1X3GA 4BBRG 3VDYA 4IFDI 2GN5A 1JJGA 3I4MH 1NBWA 1J5EL 3U4VA 2WB1E 5C4XH 3CMEA 1EIYB 2F52A 4Y7NH 2R7DA 4LFAQ 2PQAA 3HOZG 2AHOB 3A5UA 3KJPA 4HIKA 2HHHL 2CKZB 1PH8A 2OTJA 1KHIA 4K0KL 2JA9A 2Q2TA 4YHHL 2IY5B 4DR7L 4KHPL 3KJOA 1MIUA 4JOIC 2KHIA 1C7YA 3GTLH 4AQYL 4A3EH 5IYDG 4L5RC 4JI0Q 2NVYH 4L5SA 2JEAI 1VQBA 3PF4A 1N34L 5M5WH 3CCJA 4DV5Q 4A3LH 1FL0A 1JE5A 1XMOQ 1PHJA 1Q86C 5C0XI 3Q8DA 1X9NA 1KRTA 4JI3Q 1VQ4A 1EWIA 4IPCA 1PA6A 1QVCA 1KL9A 3CCLA 4A3DH 1A62A 4HJAA 3CD6A 1VQ8A 2CWPA 4IOCA 5IYBG 4DV3L 1PH4A 2QGQA 3SGIA 1D8LA 3TRZA 4DK6C 4IFDG 2MO0A 4R4IA 5AJ3Q 1QVGA 2KHJA 2KBNA 1E1OA 1X54A 4GKKL 2QEXA 1BKBA 3S2HH 4YCUA 1HZAA 4NB3A 3S1QH 2UU9L 3L7ZC 1UE6A 3KDFA 4DV7Q 5GQOA 2VQEQ 2LSSA 4DNIA 1HNWL 5FJ8G 1HZBA 3AFPA 1B7YB 4JV5L 4JI4L 3NELA 1J5EQ 5IY0A 4JI5L 2MO1A 4A3CG 4A3JH 1VQHA 3OYYA 2D62A 1IL2A 3KLWA 3U58A 1SR3A 1Y1VG 2YTVA 3PUWA 1VQLA 2UXCL 2HHHQ 2K5VA 1WFQA 4C3IH 1GVPA 1YNXA 2K14A 4K0KQ 5C44G 1EIFA 4QL5A 4XIGS 3PO2G 2Y0SE 4DR7Q 4KHPQ 1YVCA 1Z47A 3E9HA 4GS3A 2YV5A 3J80i 4AQYQ 1IBKL 4JI2L 1YHBA 1TWFH 2XTIA 3W5OA 4DR5L 1QZHA 4AIMA 1G6PA 1N34Q 1U5KA 2FXQA 3CPFA 3F8TA 3W1BA 1Q81C 4DV2Q 4YY3Q 3HOVG 1WI5A 4QGUA 2WAQG 1XNRL 1RIPA 1I6HH 1VQ5A 4LNQA 4HJ9A 3HOXH 2PQAB 4GLAC 1LUZA 4A93G 3S14H 3F2BA 2ZM6L 2K50A 1G51A 1K0RA 3ICEA 4JCVE 3STBC 4B3RL 2AWNA 1YHAA 1HJPA 3AQQA 3CCQA 1NJIC 5M3FG 3KYHC 2Y0SG 2OWOA 3S2DH 4BBRH 1PV4A 1TWAH 2OQKA 4X62Q 1HNZL 1PH2A 5IT9c 5GROA 4GKKQ 4X6AH 4NPSA 4JI7L 3RNUA 1EQQA 4P75A 2WP8J 3T1HL 3G6EA 2IT1A 2BH8A 3HOZH 2UU9Q 4L5QA 3CXCA 1KIXA 4HJ5A 3TS2A 1UE1A 3GTKH 4OWXB 2ATWA 2VQFL 3S1RH 4PG3A 3J81i 4PZ7A 4EQ5A 3K7UC 4JV5Q 2PI2A 4RMFA 4X65Q 4JI4Q 4DAMA 4LF8L 5IYDH 2ZJPA 5K36G 1PVOA 4POGA 3LGJA 1E7ZA 1VQIA 3RLOA 1HZCA 4R4CA 5IYCG 1PH5A 4B3TL 4LF7L 2UXCQ 2K52A 1EYGA 1VQ6A 2MQHA 4MNOA 2E2JH 4DUZQ 2VNUD 4DV6L 4GNXA 3M4QA 2NN6I 1IBKQ 4JI2Q 4LF9L 4O2DA 4A3KG 2JK8A 1N32L 4JI6Q 1BBUA 3CW2C 5IYBH 1JJCB 5JEAG 4GLXA 1XMQL 4BY7G 1XPOA 5BR8L 5JJKA 1K73C 2BA0A 3BZKA 1PH3A 4LF5L 1XNRQ 2KENA 2UUBL 2UUCL 2R92G 2A19A 2N3SA 2MNAA 3CCUA 1IBLL 1XTDA 5EAYA 1QVFA 2ZM6Q 2JQOA 1XJVA 4A3FG 1K8GA 3I4NG 4B3RQ 4JI8L 1NTGA 2RHQB 1CKNA 1UWVA 1OXVA 3CCRA 1TWGH 2DGYA 1AE2A 3STBD 4BA1I 5FJ8H 1YJWA 1S40A 4QY7A 5LMUQ 4IOAA 1Y14B 2K5NA 3BZCA 4PZ8A 2Q2HA 1A63A 4A3CH 4X66Q 3PO3G 1K3RA 3K81C 3T1HQ 3J7ZC 3RLNA 3H3VI 1SN8A 1Y1VH 4LUVA 4JG2A 3HKSA 2LXJA 1FJGQ 2B63G 3CC2A 1YBYA 1Q46A 5C44H 1IZ6A 1OXSC 3F2CA 2VQFQ 4A75A 3PO2H 1VQFA 2JEBI 1YITA 1VQGA 5ELOA 1I50H 1V43A 2LXKA 4LF8Q 2R7ZG 2L15A 4LUZA 4LFCL 2EXDA 4A4IA 1P16A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1X3E A;  1C0A A;  4LF7 Q;  3PCO B;  4P71 A;  5DLQ E;  3CC7 A;  2RF4 A;  1R9T H;  2HT1 A;  3HOV H;  3M7N A;  5FLM G;  1LTL A;  1IXR A;  4A93 H;  3T1Y L;  4DR1 L;  1JT8 A;  4DV6 Q;  3CCM A;  3J81 c;  2ID0 A;  4LF9 Q;  1L2F A;  3GTJ H;  1YJ9 A;  3I56 A;  4LF6 L;  3RN5 A;  2HIX A;  1N32 Q;  4DV0 L;  1KRS A;  4YCW A;  1C9O A;  2BH2 A;  1B8A A;  1E22 A;  4IJH A;  1XMQ Q;  5M3F H;  5BR8 Q;  4DKA C;  4LF5 Q;  1N36 L;  2UUB Q;  2R93 G;  4JBM A;  2A1A A;  4O0A A;  2D0P A;  3A5Z B;  5GAE C;  3HKZ G;  1MKH A;  1KD1 C;  2Z6K A;  2EQS A;  1X6O A;  5M3M G;  4C2M H;  3DLL A;  3KF6 A;  2JA7 G;  3EIV A;  3M4P A;  2CCZ A;  4JI8 Q;  3H0G G;  3CCE A;  3ZJY C;  4HJ8 A;  4C3J H;  3M3Y H;  4GNX B;  2WAQ E;  1SLJ A;  2E2H H;  1U0L A;  1YZ6 A;  2RHS B;  4JBJ A;  4KI0 A;  4BBS G;  1K9M C;  1HR0 W;  3RZO H;  2VW9 A;  1UE7 A;  3L0O A;  1XNQ L;  2IX1 A;  4KLK A;  1UEB A;  3PUV A;  2B29 A;  3S15 H;  5C0X G;  1KXL A;  2N49 A;  5IYC H;  3TS0 A;  1WCM G;  1Q12 A;  4YHH Q;  4DR3 L;  2Q2U A;  2ES2 A;  1PH9 A;  4IPH A;  1L1O A;  2CFM A;  3K8A A;  5IP7 G;  4R4T A;  4HJ7 A;  3KOJ A;  4BA2 I;  4DR6 L;  1CSP A;  1PH7 A;  1QUQ B;  1CKN B;  1OXT A;  3ERS X;  4A3K H;  3GTO H;  4LFC Q;  1VCI A;  1HR0 L;  4TQU S;  4LFB L;  3OTO L;  1A0I A;  1RL2 A;  5GAD C;  1HNX L;  1EFW A;  1YIJ A;  3K80 C;  4BY7 H;  3M85 A;  4B3S L;  1EQR A;  1TWC H;  4DV4 L;  1PH1 A;  1JMC A;  1Q8K A;  1SMX A;  1CKO A;  1VQ7 A;  2WFW A;  3I4O A;  3PV0 A;  2R92 H;  3M9B A;  3GTM H;  3T1Y Q;  1VS0 A;  2XGT A;  3RLF A;  3HFZ B;  1VQO A;  1H95 A;  3G71 A;  4GN5 A;  4GNX C;  2E2I H;  3TEH B;  3S24 A;  4A3F H;  4DV3 Q;  4LF6 Q;  3I4N H;  1OXU A;  4DV0 Q;  4OXP A;  3WWV A;  2ZTC A;  3NEN A;  1GM5 A;  2JA5 G;  3I7F A;  4MTN A;  3ULJ A;  3F1Z A;  4C3H H;  4QQB X;  4QIW E;  3HOU G;  1N36 Q;  4L5T A;  3CP0 A;  1WOC A;  1Q1E A;  3I2Z A;  5LMN W;  3G48 A;  2ZTD A;  3PO3 H;  3TRE A;  1YI2 A;  2BA1 A;  4JBW A;  1DGS A;  4P73 A;  2JA6 G;  1PH6 A;  2VL6 A;  1S3O A;  1VQP A;  1SFO H;  1HNW Q;  2R6G A;  4R4Q A;  2B63 H;  4LUO A;  3HOY G;  3IRB A;  4ME3 A;  4BY1 G;  1NMF A;  3UDF A;  4DR4 L;  4WJ4 A;  4LWC A;  1KQS A;  4JI5 Q;  1E3P A;  4DK3 C;  1CKM A;  4UP9 A;  1VQC A;  3FHW A;  4PZ6 A;  4A76 A;  1XNQ Q;  2R7Z H;  1Q1B A;  3W1G A;  4A3B G;  1KAW A;  2R7F A;  5LMN L;  2I5H A;  2YTY A;  2F3I A;  4UP7 A;  3I55 A;  5FLM H;  4DR3 Q;  3CQZ H;  3KDF B;  2NZH A;  4YWK A;  4DR6 Q;  4DR5 Q;  3AEV A;  3ULL A;  2AWO A;  2E5L L;  1ASY A;  2H5X A;  3G4S A;  1HR0 Q;  3OTO Q;  4JBK A;  1PFS A;  1HNX Q;  3UDI A;  1KC8 C;  4DV4 Q;  4DV5 L;  1WYD A;  2I5L X;  4EX5 A;  2R93 H;  1AE3 A;  3PIO A;  4OO1 I;  2AMC B;  1JJ2 A;  1O7I A;  5M3M H;  3CAM A;  2JA7 H;  4BXX H;  3EBE A;  3ULP A;  3UE0 A;  3BU2 A;  1I3Q H;  3H0G H;  1L1O B;  1QZG A;  4GN3 B;  3JC6 6;  5J3B A;  3ER0 A;  1HNZ Q;  5JEA J;  4RG1 A;  1FVI A;  4JYA L;  4JI7 Q;  2GVA A;  4AH6 A;  4BBS H;  2ZJR A;  3M4O H;  1Y1W G;  1L0W A;  1PYS B;  1W2B A;  3BJU A;  3MXN B;  3A74 A;  1YHQ A;  2C35 B;  3GDE A;  4LF4 L;  2Z6K C;  4J15 A;  3U4Z A;  4H02 A;  1ASZ A;  2N8N A;  3CPW A;  4IO9 A;  1WCM H;  5IE8 A;  5IWA L;  1HH2 P;  1LM0 A;  2NN6 G;  3OW2 A;  2GVB A;  2K4K A;  4JI1 L;  5IP7 H;  4IPD A;  1HZ9 A;  4OX9 L;  4A3G G;  2E8G A;  4A3M G;  5HGQ A;  2F4V L;  4DV1 L;  3HKZ E;  2N78 A;  3D31 A;  4GOP A;  3GTQ H;  5HY6 A;  1YJN A;  3J81 j;  4B3T Q;  1MJE A;  2KCT A;  5LMN Q;  1V1Q A;  1BVS A;  1J6Q A;  5C3E G;  1AH9 A;  1N8R C;  2V1C C;  4XTC S;  1X55 A;  2K75 A;  3NEM A;  4MZ9 A;  4BXX G;  3D0F A;  4OO1 G;  1L1O C;  3KFU A;  2NVX H;  1X56 A;  1VQ9 A;  3PUZ A;  2E5L Q;  3HOW G;  4P74 A;  4UY8 C;  1OTC A;  2PI2 E;  4DPG A;  3B6Y A;  2JA5 H;  1TXY A;  2D0O A;  4HIO A;  1Q7Y C;  1UE5 A;  2UUC Q;  2HIV A;  2JA8 G;  3HOU H;  4DV2 L;  1M90 C;  1IBL Q;  3GD7 A;  3RR5 A;  4YY3 L;  2IHE A;  4P72 A;  1VQD A;  1I94 L;  1IBM L;  1D7Q A;  1MJC A;  2WB1 G;  3KF8 B;  3GTP H;  1CUK A;  2ZTE A;  2JA6 H;  3PUX A;  4YCV A;  4OWT B;  4A3I G;  3PIP A;  3GO5 A;  3HOY H;  2Q2I A;  5FLX c;  2HQL A;  2Z0S A;  1SRU A;  4BY1 H;  4IFD J;  4JYA Q;  2OCE A;  3CF5 A;  3AFQ A;  2UXB L;  3RN2 A;  3AYH B;  1E1T A;  2ZJQ A;  4X62 L;  4DUY L;  3K7A H;  5IP9 G;  3UE1 A;  3JAM i;  5C4J H;  2VUM G;  4A3B H;  4LF4 Q;  2UXD L;  3FKI G;  5H1S E;  3CC4 A;  2B3G A;  1K8A C;  5IWA Q;  3MEF A;  2JJQ A;  3PUY A;  4JOI A;  2QA4 A;  4JI1 Q;  4OX9 Q;  5E7N A;  2F4V Q;  4UPA A;  3I4M G;  3S16 H;  4DV1 Q;  3K0X A;  3J7A 5;  5C4X G;  4FDB A;  2CQO A;  4X64 L;  4X65 L;  1JB7 A;  2YYZ A;  2PNH A;  5C0X J;  1NE3 A;  4B3M L;  2VS1 A;  4DR1 Q;  1N9W A;  4HID A;  1E24 A;  1W3S A;  1SRO A;  4GKJ L;  1LYL A;  1NY4 A;  1SE8 A;  4TVA B;  4UP8 A;  4A3E G;  4DUZ L;  3UDX A;  2UUA L;  1VQJ A;  3FP9 A;  2ALY B;  2JE6 I;  4NXN L;  4APV A;  1M1K C;  4A3L G;  3TQY A;  3E9I A;  4JI6 L;  5ELN A;  2NVQ H;  4GOP B;  2NZO A;  1N33 L;  4KHZ A;  1GKH A;  3PSI A;  1P8L A;  1T9H A;  1IYJ B;  1FGU A;  2MFI A;  2RCN A;  4DR2 L;  3F2D A;  3UDG A;  1Y1W H;  1I94 Q;  2AKW B;  4IPG A;  3CMA A;  1IBM Q;  4NXM L;  1XPU A;  4LW1 A;  4A3D G;  2ASB A;  1XPR A;  2OTL A;  1BBW A;  2DUD A;  1EUJ A;  1VQM A;  5M5X H;  3CCS A;  4GN4 B;  1B70 B;  5GAH C;  1I5F A;  2A8V A;  4HIM A;  4A3G H;  2UXB Q;  4A3M H;  4YWL A;  5LMU L;  1A8V A;  1Q82 C;  2YU9 H;  3S1N H;  4WJ3 M;  4DUY Q;  4AYB E;  1VQA A;  3L2P A;  4LFA L;  2I0Q A;  3U50 C;  2VY3 A;  4X66 L;  2UXD Q;  1YEZ A;  1Z9F A;  4DAY B;  5C3E H;  3KF6 B;  5M5Y H;  3A0J A;  1FJG L;  1CSQ A;  3NBH B;  1VQE A;  4Y52 H;  4LFB Q;  5JJI A;  3HOW H;  4A3J G;  4R1J A;  4JI0 L;  1X65 A;  3PGZ A;  4X64 Q;  4GOP C;  5GAG C;  3EN2 A;  1NMG A;  4B3S Q;  2EIF A;  3JAM c;  1VQK A;  1XMO L;  2JA8 H;  4OON A;  4B3M Q;  3H15 A;  2CWA A;  1GD7 A;  4JI3 L;  3H3V H;  4IJL A;  2NVT H;  1EOV A;  4AYB G;  4GKJ Q;  3PF5 A;  1WJJ A;  4JC0 A;  3E0E A;  3S17 H;  2UUA Q;  1V9P A;  4POF A;  3CCV A;  4NXN Q;  4A3I H;  2K5H A;  5JJL A;  3DM3 A;  5AJ3 L;  4R4O A;  1N33 Q;  1K83 H;  4YWM A;  1OXX K;  3HOX G;  4DR2 Q;  1GO3 E;  1TWH H;  4PMW A;  4ALP A;  1G29 1;  2I5M X;  3RZD H;  4NXM Q;  4OWW B;  1X3F A;  2IX0 A;  4GLV B;  5IP9 H;  2PMZ E;  1PYB A;  1VQN A;  2VUM H;  3GTG H;  1S72 A;  3S1M H;  3FKI H;  4DV7 L;  2KCM A;  2VZA A;  3J80 c;  2YTX A;  2VQE L;  4DR4 Q;  2OQ0 A;  4QJF A;  2IHF A;  1QUQ A;  1X3G A;  4BBR G;  3VDY A;  4IFD I;  2GN5 A;  1JJG A;  3I4M H;  1NBW A;  1J5E L;  3U4V A;  2WB1 E;  5C4X H;  3CME A;  1EIY B;  2F52 A;  4Y7N H;  2R7D A;  4LFA Q;  2PQA A;  3HOZ G;  2AHO B;  3A5U A;  3KJP A;  4HIK A;  2HHH L;  2CKZ B;  1PH8 A;  2OTJ A;  1KHI A;  4K0K L;  2JA9 A;  2Q2T A;  4YHH L;  2IY5 B;  4DR7 L;  4KHP L;  3KJO A;  1MIU A;  4JOI C;  2KHI A;  1C7Y A;  3GTL H;  4AQY L;  4A3E H;  5IYD G;  4L5R C;  4JI0 Q;  2NVY H;  4L5S A;  2JEA I;  1VQB A;  3PF4 A;  1N34 L;  5M5W H;  3CCJ A;  4DV5 Q;  4A3L H;  1FL0 A;  1JE5 A;  1XMO Q;  1PHJ A;  1Q86 C;  5C0X I;  3Q8D A;  1X9N A;  1KRT A;  4JI3 Q;  1VQ4 A;  1EWI A;  4IPC A;  1PA6 A;  1QVC A;  1KL9 A;  3CCL A;  4A3D H;  1A62 A;  4HJA A;  3CD6 A;  1VQ8 A;  2CWP A;  4IOC A;  5IYB G;  4DV3 L;  1PH4 A;  2QGQ A;  3SGI A;  1D8L A;  3TRZ A;  4DK6 C;  4IFD G;  2MO0 A;  4R4I A;  5AJ3 Q;  1QVG A;  2KHJ A;  2KBN A;  1E1O A;  1X54 A;  4GKK L;  2QEX A;  1BKB A;  3S2H H;  4YCU A;  1HZA A;  4NB3 A;  3S1Q H;  2UU9 L;  3L7Z C;  1UE6 A;  3KDF A;  4DV7 Q;  5GQO A;  2VQE Q;  2LSS A;  4DNI A;  1HNW L;  5FJ8 G;  1HZB A;  3AFP A;  1B7Y B;  4JV5 L;  4JI4 L;  3NEL A;  1J5E Q;  5IY0 A;  4JI5 L;  2MO1 A;  4A3C G;  4A3J H;  1VQH A;  3OYY A;  2D62 A;  1IL2 A;  3KLW A;  3U58 A;  1SR3 A;  1Y1V G;  2YTV A;  3PUW A;  1VQL A;  2UXC L;  2HHH Q;  2K5V A;  1WFQ A;  4C3I H;  1GVP A;  1YNX A;  2K14 A;  4K0K Q;  5C44 G;  1EIF A;  4QL5 A;  4XIG S;  3PO2 G;  2Y0S E;  4DR7 Q;  4KHP Q;  1YVC A;  1Z47 A;  3E9H A;  4GS3 A;  2YV5 A;  3J80 i;  4AQY Q;  1IBK L;  4JI2 L;  1YHB A;  1TWF H;  2XTI A;  3W5O A;  4DR5 L;  1QZH A;  4AIM A;  1G6P A;  1N34 Q;  1U5K A;  2FXQ A;  3CPF A;  3F8T A;  3W1B A;  1Q81 C;  4DV2 Q;  4YY3 Q;  3HOV G;  1WI5 A;  4QGU A;  2WAQ G;  1XNR L;  1RIP A;  1I6H H;  1VQ5 A;  4LNQ A;  4HJ9 A;  3HOX H;  2PQA B;  4GLA C;  1LUZ A;  4A93 G;  3S14 H;  3F2B A;  2ZM6 L;  2K50 A;  1G51 A;  1K0R A;  3ICE A;  4JCV E;  3STB C;  4B3R L;  2AWN A;  1YHA A;  1HJP A;  3AQQ A;  3CCQ A;  1NJI C;  5M3F G;  3KYH C;  2Y0S G;  2OWO A;  3S2D H;  4BBR H;  1PV4 A;  1TWA H;  2OQK A;  4X62 Q;  1HNZ L;  1PH2 A;  5IT9 c;  5GRO A;  4GKK Q;  4X6A H;  4NPS A;  4JI7 L;  3RNU A;  1EQQ A;  4P75 A;  2WP8 J;  3T1H L;  3G6E A;  2IT1 A;  2BH8 A;  3HOZ H;  2UU9 Q;  4L5Q A;  3CXC A;  1KIX A;  4HJ5 A;  3TS2 A;  1UE1 A;  3GTK H;  4OWX B;  2ATW A;  2VQF L;  3S1R H;  4PG3 A;  3J81 i;  4PZ7 A;  4EQ5 A;  3K7U C;  4JV5 Q;  2PI2 A;  4RMF A;  4X65 Q;  4JI4 Q;  4DAM A;  4LF8 L;  5IYD H;  2ZJP A;  5K36 G;  1PVO A;  4POG A;  3LGJ A;  1E7Z A;  1VQI A;  3RLO A;  1HZC A;  4R4C A;  5IYC G;  1PH5 A;  4B3T L;  4LF7 L;  2UXC Q;  2K52 A;  1EYG A;  1VQ6 A;  2MQH A;  4MNO A;  2E2J H;  4DUZ Q;  2VNU D;  4DV6 L;  4GNX A;  3M4Q A;  2NN6 I;  1IBK Q;  4JI2 Q;  4LF9 L;  4O2D A;  4A3K G;  2JK8 A;  1N32 L;  4JI6 Q;  1BBU A;  3CW2 C;  5IYB H;  1JJC B;  5JEA G;  4GLX A;  1XMQ L;  4BY7 G;  1XPO A;  5BR8 L;  5JJK A;  1K73 C;  2BA0 A;  3BZK A;  1PH3 A;  4LF5 L;  1XNR Q;  2KEN A;  2UUB L;  2UUC L;  2R92 G;  2A19 A;  2N3S A;  2MNA A;  3CCU A;  1IBL L;  1XTD A;  5EAY A;  1QVF A;  2ZM6 Q;  2JQO A;  1XJV A;  4A3F G;  1K8G A;  3I4N G;  4B3R Q;  4JI8 L;  1NTG A;  2RHQ B;  1CKN A;  1UWV A;  1OXV A;  3CCR A;  1TWG H;  2DGY A;  1AE2 A;  3STB D;  4BA1 I;  5FJ8 H;  1YJW A;  1S40 A;  4QY7 A;  5LMU Q;  4IOA A;  1Y14 B;  2K5N A;  3BZC A;  4PZ8 A;  2Q2H A;  1A63 A;  4A3C H;  4X66 Q;  3PO3 G;  1K3R A;  3K81 C;  3T1H Q;  3J7Z C;  3RLN A;  3H3V I;  1SN8 A;  1Y1V H;  4LUV A;  4JG2 A;  3HKS A;  2LXJ A;  1FJG Q;  2B63 G;  3CC2 A;  1YBY A;  1Q46 A;  5C44 H;  1IZ6 A;  1OXS C;  3F2C A;  2VQF Q;  4A75 A;  3PO2 H;  1VQF A;  2JEB I;  1YIT A;  1VQG A;  5ELO A;  1I50 H;  1V43 A;  2LXK A;  4LF8 Q;  2R7Z G;  2L15 A;  4LUZ A;  4LFC L;  2EXD A;  4A4I A;  1P16 A; 
#chains in the Genus database with same CATH topology
 1X3E A;  3H0G B;  1FD7 D;  2I07 B;  4RKL A;  1R9T H;  3HOV H;  5FLM G;  1AP0 A;  1IXR A;  1PZK D;  3T1Y L;  3CCM A;  5LL6 X;  1L2F A;  1PFN A;  2HIX A;  3P7J A;  4DV0 L;  1KRS A;  2BH2 A;  1E22 A;  2F0V A;  1TY0 A;  5BR8 Q;  2Z8L A;  2LY7 A;  4JBM A;  1AEX A;  4IUP A;  1MKH A;  1B3A A;  2Z6K A;  2EQS A;  1X6O A;  3EIV A;  3CCE A;  4HJ8 A;  1DM0 B;  3NBH A;  3T13 A;  2WAQ E;  1SLJ A;  2E2H H;  1WTH A;  2DNC A;  4G7O C;  2L55 A;  4F7X A;  1K9M C;  4KLK A;  4CDF C;  1SBB B;  3PUV A;  4YHH Q;  3L9A X;  4DR3 L;  3MXP A;  2Q2U A;  5KYI A;  2ES2 A;  4IPH A;  1HQR D;  1L1O A;  2Q8T A;  1GHK A;  2EYF A;  1CKN B;  1OXT A;  1DXM A;  1VCI A;  1A0I A;  5JEA H;  3K80 C;  4BY7 H;  3M85 A;  3A54 A;  3MFG A;  1Q8K A;  3LNN A;  4XQN A;  1Y8N B;  1NR4 A;  2CVR A;  2F0G A;  4GNX C;  4A3F H;  1ZYR D;  1CFM A;  4DV3 Q;  3D6W A;  3I4N H;  1I4X A;  4OXP A;  1RDP D;  3DWP A;  3HOU G;  1ENC A;  4UDU C;  2E74 C;  2SEB D;  3C1E A;  5LMN W;  3PO3 H;  3TRE A;  2B2W C;  2JA6 G;  2VL6 A;  1VQP A;  1HNW Q;  4J8Q A;  2R6G A;  1IW7 D;  4R4Q A;  4BY1 G;  1H9M A;  4OIK A;  1EU4 A;  4JI5 Q;  1EZ6 A;  2NYZ D;  4DK3 C;  1STY A;  1CK1 A;  1CKM A;  1VQC A;  4UP9 A;  2Z4I A;  4PZ6 A;  4C1N I;  2QDL A;  3J81 E;  4A76 A;  1XNQ Q;  2I5H A;  4C3H B;  2F3I A;  2QW7 A;  3I55 A;  1JR0 D;  1HXY D;  3CQZ H;  2NZH A;  4DR5 Q;  3NBI A;  2AWO A;  1J8I A;  1GJX A;  2H4O A;  3K5O A;  4KTA A;  3LWU A;  2HDL A;  1PRT C;  5T1G A;  4DV5 L;  4K2K A;  4EX5 A;  2F0L A;  2R93 H;  1AE3 A;  2R7Z B;  4QF4 A;  3PIO A;  3OSO A;  1JJ2 A;  2Z6B A;  3CAM A;  3NTH A;  4BXX H;  1I3Q H;  3ND8 A;  5I4D A;  2JXM B;  1QZG A;  3P20 A;  1R4Q B;  5J3B A;  3ER0 A;  1HNZ Q;  4QMG A;  1EWC A;  2SNS A;  3SE0 A;  1H9S A;  3C2P A;  1W2B A;  1NSN S;  3HOW B;  2C35 B;  5EKK A;  2Z6K C;  4HTH A;  4J15 A;  1ASZ A;  1B4O A;  2N8N A;  1STA A;  1WCM H;  5IE8 A;  1HH2 P;  1ZXT A;  1O78 A;  2NN6 G;  1F2L A;  2B2Y A;  4IPD A;  2PZW A;  4A3M G;  3HKZ E;  5HY6 A;  1YJN A;  1PZI D;  1K8O A;  2KCT A;  3A8J E;  1SEB D;  3E0J A;  2V1C C;  1X55 A;  2K75 A;  4MZ9 A;  5AFW A;  3D0F A;  5EBD A;  5LHY 1;  1B2T A;  1L1O C;  1F9R A;  2NVX H;  1X56 A;  3TN2 A;  1CI3 M;  2E5L Q;  4QUF A;  3R93 A;  1GXD C;  2PI2 E;  1A3V A;  2D0O A;  1UE5 A;  2HIV A;  3A8I E;  4DV2 L;  1IBL Q;  4R9W A;  4YY3 L;  1I94 L;  1MJC A;  3KF8 B;  1SE2 A;  4OWT B;  2NB0 A;  4IFD J;  2HQL A;  2Z0S A;  5IGC A;  4OEL B;  1JOR A;  5NUC A;  4JYA Q;  2UXB L;  3RN2 A;  3AYH B;  4X62 L;  4PMC A;  4A3E B;  1MBY A;  5IP9 G;  1CT1 D;  5C4J H;  4RGM A;  4LF4 Q;  2RA4 A;  3FKI G;  3CC4 A;  2QEJ C;  5M5W B;  1QB5 D;  4CGY B;  1K8A C;  5IWA Q;  3MEF A;  3PUY A;  3K6O A;  4OX9 Q;  3S16 H;  1BOS A;  2PYK A;  2JA6 B;  3J7A 5;  3CKI B;  4A3D B;  2YYZ A;  1B1Z A;  5C0X J;  2P5Z X;  1SRO A;  1NY4 A;  2VB2 X;  4TVA B;  3S2H B;  1JE4 A;  4NXN L;  4APV A;  1M1K C;  3TQY A;  4DF7 A;  2WIN B;  2A5H A;  5ELN A;  4JI6 L;  1B9N A;  1N33 L;  3PSI A;  1VQK A;  1JWS D;  3F2D A;  3UDG A;  1Y1W H;  2AKW B;  4IPG A;  4YIJ A;  2ASB A;  2FMM A;  1BBW A;  2EOT A;  1VQM A;  3D8G A;  2A8V A;  4A3G H;  1Q82 C;  4AYB E;  1TWF B;  1V8Q A;  2BDN A;  2UXD Q;  3MFY A;  4DNR B;  1TS5 A;  1YEZ A;  1PTO B;  5M5Y H;  1FJG L;  1CSQ A;  2JSO A;  2B2Y C;  1EY9 A;  1PDQ A;  1U4M A;  2DY8 A;  4KY5 A;  3HOX B;  3S14 B;  4JI0 L;  1X65 A;  1IHZ A;  1NMG A;  4MTK A;  3JAM c;  2KUM A;  2EPB A;  1XMO L;  2JA8 H;  4OON A;  2IWH A;  1GUG A;  2RDG A;  4BBR B;  2WII B;  2IW3 A;  4IJL A;  2NVT H;  4CDE C;  1WJJ A;  4JC0 A;  3S17 H;  1F2Z A;  1H9K A;  4A3I H;  3DM3 A;  2Z9H A;  5AJ3 L;  4R4O A;  5LL6 S;  1OXX K;  1GO3 E;  1QIL A;  5ELE A;  4NXM Q;  5CV7 A;  1GUO A;  2PMZ B;  4GLV B;  1VQN A;  2VUM H;  3HZX A;  4DR4 Q;  2VQE L;  4CKE A;  1WVL A;  5C6A A;  2D5D A;  1NBW A;  3U4V A;  2WB1 E;  5C4X H;  3HOZ G;  3KJP A;  4HIK A;  1EU3 A;  2D2C C;  2M9V A;  3K0Y A;  3RZD B;  2IY5 B;  3KJO A;  1MIU A;  2KHI A;  1WTV A;  3GTL H;  3MTS A;  2C5C A;  2NVY H;  2F0H A;  2X69 A;  3FKI B;  4L5S A;  1VQB A;  1FGB D;  4XXE A;  4K2L A;  1TWG B;  2RDH A;  1Q86 C;  3R2I A;  4IPC A;  4N8X 1;  3CCL A;  4KKS A;  2EE1 A;  2AUK A;  2CWP A;  3HGB A;  4S3S A;  1A3T A;  2B2V A;  5L37 A;  2KBN A;  5EJW A;  1E2V A;  1HZA A;  2UU9 L;  2B2U A;  4DNI A;  1R9T B;  3HOV B;  2CH4 A;  3CRK C;  4JI4 L;  5IY0 A;  3OW7 A;  3DEO A;  4A3J H;  5CBA E;  2UXC L;  2HHH Q;  2K5V A;  1WFQ A;  1GVP A;  4RWS C;  2K14 A;  5C44 G;  2Y0S B;  4ZLT F;  5E4X A;  2KCN A;  1Z47 A;  3E9H A;  4AQY Q;  1YHB A;  1U4P A;  1AZP A;  2K04 A;  1N34 Q;  1U5K A;  2HQE A;  3F8T A;  4XQQ A;  2F0J A;  3D4D A;  3SDZ A;  2O4X A;  2E2H B;  1RIP A;  4H13 C;  4HJ9 A;  4DU9 A;  2PQA B;  4A93 G;  1LUZ A;  1GHJ A;  1U9R A;  1S5D D;  1UNS A;  1K0R A;  1LTG D;  4JCV E;  1S5C D;  4X3K A;  4Q5V A;  1YHA A;  3AQQ A;  3CCQ A;  1EYA A;  3TDQ A;  3OWE B;  3KYH C;  3W3A A;  3OIP A;  2OWO A;  4K5W A;  5EKI A;  4GKK Q;  3V96 A;  1I4G A;  2IT1 A;  1DOL A;  3QJY A;  4HJ5 A;  3NE5 B;  3GTK H;  1EOT A;  1HCZ A;  4OWX B;  2ATW A;  4EQ5 A;  2SNM A;  1MSG A;  2A74 C;  4IZ8 A;  5IYD H;  5K36 G;  4P2C B;  1PVO A;  4A3F B;  3RLO A;  3I4N B;  4KMU C;  1HZC A;  4R4C A;  4KJO A;  1PH5 A;  4LF7 L;  3T51 B;  5FO7 B;  1TWA B;  3G7L A;  2E2J H;  3Q24 A;  1R4P B;  2KQ3 A;  4DV6 L;  3M4Q A;  2NN6 I;  4LF9 L;  1BBU A;  5KEE A;  2AUJ D;  5IYB H;  1XMQ L;  2BA0 A;  1DD2 A;  3FVQ A;  4LF5 L;  2UUC L;  2XWB B;  2A19 A;  2K5Q A;  2MNA A;  3BDC A;  5CV6 A;  3SK8 A;  2ZM6 Q;  5D3D A;  5JPN C;  4B3R Q;  1LTB D;  4BA1 I;  1GUW A;  4QY7 A;  1BNZ A;  3CQZ B;  1FNV A;  3BZC A;  2N55 A;  1A63 A;  1K3R A;  3K81 C;  3T1H Q;  2K28 A;  1JQY D;  1Y1V H;  4LUV A;  4JG2 A;  1SYB A;  4RFB A;  1SNM A;  2MJ8 A;  4IUU A;  3F2C A;  2VQF Q;  1RF2 D;  1VQF A;  2B2U C;  1YIT A;  1KNA A;  1VQG A;  5ELO A;  2R93 B;  5G3L D;  1I50 H;  1V43 A;  2LXK A;  4NDX A;  3HKZ B;  3BVZ A;  3K5L A;  5IGF A;  1P16 A;  1KHI A;  1I3Q B;  5DLQ E;  3QR8 A;  1LTL A;  1GOZ A;  1TS3 A;  1ET6 A;  4EGV A;  3DHQ A;  4DR1 L;  1C48 A;  3J81 c;  4K8I A;  2RKS A;  4LF6 L;  1QE6 A;  2KA7 A;  4ULL A;  3T53 B;  1N32 Q;  1G2S A;  1TS4 A;  5C44 B;  1NCV A;  1WCM B;  3X3M A;  4TKO B;  5K5P A;  1N36 L;  2A68 D;  1PTO F;  1ROD A;  4TRD A;  4J6H A;  1KD1 C;  1F9Q A;  1KLU D;  2PNR C;  4C2M H;  3DLL A;  4IUT A;  2CCZ A;  4JI8 Q;  3H0G G;  2A6E C;  3ZJY C;  5BN3 A;  4C3J H;  1QNU A;  1UEA B;  2F0K A;  1EIG A;  1YZ6 A;  2RHS B;  4K14 A;  4JBJ A;  4KI0 A;  1WD0 A;  5DNF A;  5KNC A;  1HR0 W;  2EVB A;  2VW9 A;  1UE7 A;  2NVX B;  1NUC A;  2B29 A;  5C0X G;  5IT9 L;  2KCC A;  1JOO A;  1PH9 A;  4DR6 L;  5IP7 G;  3K8A A;  4HJ7 A;  4BA2 I;  1CSP A;  1PH7 A;  2O2L D;  1QUQ B;  1ILP A;  4TQU S;  1EFW A;  4FO2 A;  3BVM A;  1YIJ A;  1RKN A;  2RSO A;  3MXN A;  1JMC A;  4B3S L;  4NW2 A;  1SMX A;  3EFX D;  4FVM A;  4CDD C;  3T1Y Q;  3KBX A;  1VS0 A;  3HFZ B;  1H95 A;  4GN5 A;  3S24 A;  4UHV A;  1OXU A;  3P1H A;  3SK5 A;  4DV0 Q;  1SYD A;  1EYC A;  4RCO A;  4QQB X;  3K57 A;  3NK9 A;  3HRZ C;  2MP1 A;  1Q1E A;  3I2Z A;  3S16 B;  2BA1 A;  4JBW A;  4P73 A;  4F88 A;  2XN9 C;  1SFO H;  1LLR D;  4ME3 A;  1X3P A;  3UDF A;  4LWC A;  3FHW A;  3ZYY X;  1TII D;  1Q1B A;  2L0C A;  5LMN L;  5KND A;  2ZT9 C;  4K8J A;  3KLS A;  2DY7 A;  4DR3 Q;  1Y1W B;  1ASY A;  3SK4 A;  3J7A F;  3LWE A;  1PFS A;  3FDT A;  1EY6 A;  4PMB A;  5FOB B;  2I5L X;  2B2W A;  4A3G B;  3U9S A;  1BCP F;  4ZYS A;  5M3M H;  2JA7 H;  3UE0 A;  1EYD A;  4GN3 B;  4IUN A;  5JEA J;  1B50 A;  4JI7 Q;  1JCK B;  3SVM A;  1EZ8 A;  4BBS H;  1SND A;  3M4O H;  1L0W A;  1ENA A;  3NXW A;  3EVQ A;  3BJU A;  4M8A A;  3A74 A;  1YHQ A;  3EA6 A;  3GDE A;  1BO0 A;  1KAB A;  3CPW A;  2JA8 B;  2GVB A;  1E2Z A;  3NTK A;  4ZCK A;  2E8G A;  2F4V L;  4DV1 L;  2NVT B;  1B44 D;  4WOR A;  3D31 A;  2WB1 B;  3S17 B;  4JVZ A;  1V1Q A;  2L11 A;  4A3I B;  1CA5 A;  3DXJ C;  4KKU A;  4OL7 A;  4HN7 A;  1AH9 A;  2ZXR A;  1CQF A;  4X3S A;  1K0S A;  1EQT A;  4OO1 G;  3NP8 A;  1DOM A;  3HOW G;  4DXF A;  4P74 A;  1LTT D;  4UY8 C;  3B6Y A;  2JA5 H;  1TT2 A;  1LT5 D;  1PRT D;  3GD7 A;  4P72 A;  1SYF A;  2MGS A;  5ELC A;  1IBM L;  4RKB A;  3GTP H;  2RBM A;  2ZTE A;  2M00 A;  3PIP A;  1M4V A;  3HOY H;  4IUV A;  4DAV A;  2OCE A;  3AFQ A;  3GTL B;  3K7A H;  2NVY B;  2FJ2 A;  4A3B H;  2F0P A;  1FNW A;  2B3G A;  3OIQ A;  1KLG D;  4XDX A;  5E7N A;  5C4Z A;  3K0X A;  4FDB A;  2CQO A;  4ZKC B;  1JB7 A;  5T1I A;  2EYH A;  2J7Z A;  4MIU A;  2L9H A;  2DN8 A;  1GUT A;  4GKJ L;  2IJ0 A;  3C3L A;  4A3E G;  4DUZ L;  3FP9 A;  4HSP A;  2JE6 I;  3LX0 A;  4A3L G;  3E9I A;  3ND9 A;  1ET9 A;  4GOP B;  1GKH A;  3MAQ A;  1P8L A;  4L63 B;  1T9H A;  4DR2 L;  4FF2 A;  1D5M C;  2MFI A;  1I94 Q;  1CZW A;  2F0D A;  4LW1 A;  4A3J B;  4A3D G;  5CC4 A;  1M8A A;  2JP1 A;  2HCI A;  1XPR A;  2OTL A;  5M5X H;  2MUY A;  3IAY A;  5GAH C;  2B2T A;  2UXB Q;  1SNP A;  4O42 A;  1LTA D;  1A8V A;  5LMU L;  3S1N H;  4WJ3 M;  3L2P A;  2I0Q A;  4X66 L;  2GA4 B;  4XYQ A;  3K58 A;  1IL8 A;  3H91 A;  1Z9F A;  4DAY B;  3NHH A;  5C3E H;  2LKV A;  2E76 C;  3KK7 A;  2F0W A;  4HMJ A;  4ME5 A;  4LFB Q;  4Q0F A;  4FF3 A;  1YNN C;  4G4K A;  3PGZ A;  4CKC A;  1WTP A;  1IYU A;  3RD4 A;  4C3I G;  4L6T B;  3H15 A;  1ESR A;  3H3V H;  2BOS A;  3PF5 A;  2CH4 W;  1CHP D;  4N9T A;  5D14 A;  3CCV A;  4NXN Q;  2A69 C;  3K5M A;  3ERQ A;  4IQZ A;  3GTK B;  4ABN A;  1N33 Q;  1K83 H;  4IAL A;  3HOX G;  4NMZ A;  1G29 1;  2I5M X;  2KEC A;  1X3F A;  3A8K E;  1SYG A;  4X3U A;  1S72 A;  2KCM A;  3NUC A;  2YTX A;  2OQ0 A;  2FHT A;  2IHF A;  1QUQ A;  4BBR G;  3H94 A;  4IFD I;  1WTR A;  3I4M H;  1J5E L;  2F52 A;  3SXH A;  5D3I B;  2AHO B;  1VMC A;  4ZAI A;  3A5U A;  2F0Q A;  4K0K L;  1D6E C;  2KJX A;  4YHH L;  4DR7 L;  2HD3 A;  2PO4 A;  4JI0 Q;  4GZY C;  3CCJ A;  1FL0 A;  1JE5 A;  1S5E D;  3ONA B;  5J39 A;  1Q8I A;  1XMO Q;  1PHJ A;  5C0X I;  1G8Z D;  4Y7N B;  2JYO A;  2KEE A;  4U67 3;  4C1N K;  1SDF A;  1Y1V B;  4DV3 L;  1PH4 A;  2QGQ A;  3D6C A;  1D8L A;  5IGE A;  4DK0 A;  5AJ3 Q;  2XVS A;  1WD1 A;  2K05 A;  3I3C A;  3I91 A;  1C4Q A;  1BKB A;  1I6V C;  5BN4 A;  4NB3 A;  3CHB D;  5IOC A;  2VQE Q;  2LSS A;  4HED A;  5I2X A;  1HNW L;  1HZB A;  3D4R A;  1B7Y B;  4JV5 L;  3E6Z X;  2EJG C;  3NEL A;  2B2T C;  2EY2 A;  4XT3 B;  4JI5 L;  3OYY A;  3KLW A;  3WDN A;  4JK1 C;  1SE4 A;  4XIG S;  3WOF A;  2YV5 A;  1X32 A;  2CHB D;  3W5O A;  4DR5 L;  4ZKB B;  4C2M B;  1O80 A;  3W1B A;  4K5V A;  1Q81 C;  4C3J B;  3X3N A;  3HOV G;  1WI5 A;  4QGU A;  2WAQ G;  1XNR L;  1I6H H;  3VR6 A;  2EY6 A;  1TVX A;  3STB C;  2AWN A;  4C3I B;  4DGZ A;  2Y0S G;  2EYM A;  2KVM A;  1QOH A;  1ILQ A;  2OQK A;  1HNZ L;  1PH2 A;  1NAP A;  3RNU A;  1D1K A;  3G6E A;  1EIH A;  2BH8 A;  2UU9 Q;  3TS2 A;  1QJO A;  3S1R H;  2BCO A;  2F0N A;  4X65 Q;  4JI4 Q;  1CTM A;  2X6L A;  4POG A;  3EJI A;  3MA2 B;  1E7Z A;  1VQI A;  1L0X B;  5KIX A;  2UXC Q;  1K28 A;  1W6J A;  5CV4 A;  1NNX A;  2MQH A;  2RDF A;  4MNO A;  4NKL A;  2AQ3 B;  5CV8 A;  1LAC A;  2EYJ A;  3EQL C;  3RMH A;  3CW2 C;  3NPP A;  1BR9 A;  5JOB A;  4GLX A;  1JJC B;  5JEA G;  3NQI A;  1SFO B;  4BY7 G;  1XPO A;  5JJK A;  4FNF A;  5EPK A;  1Y8P B;  1PH3 A;  1T5E A;  2UUB L;  3NWT A;  2J4X A;  1IBL L;  5EAY A;  1IKL A;  2JQO A;  4DA2 A;  4A3F G;  1K8G A;  3I4N G;  5I6W A;  1CKN A;  1UWV A;  5HUR A;  3MEH A;  1OXV A;  1WTW A;  5FJ8 H;  1CQV A;  2Q2H A;  4A3C H;  3QIA A;  3PO3 G;  3RLN A;  5IGD A;  3HKS A;  2LXJ A;  2PCF B;  1KTK A;  2PPB C;  1RJT A;  3PO2 H;  2JEB I;  2K7V A;  4PQX A;  4WJW A;  5E3F A;  1LO5 D;  5COR A;  2O5J C;  2L15 A;  2OXP A;  2VXW A;  3IL8 A;  4LFC L;  1HRJ A;  2WKD A;  5M3M B;  2EXD A;  2JA7 B;  4RH6 A;  3E3X A;  2NBF A;  4LF7 Q;  1JOK A;  3PCO B;  4P71 A;  4RHS A;  1DJR D;  1AW7 A;  1PZJ D;  3M7N A;  5JAV A;  1HFN A;  3UI2 A;  3H6M A;  2G9H D;  5IT9 E;  4BBS B;  1JT8 A;  4DV6 Q;  2ID0 A;  4LF9 Q;  3PIP 3;  3GTJ H;  3RN5 A;  3TBI B;  5EGT A;  2QCP X;  1C9O A;  1B8A A;  1XMQ Q;  3WOE A;  5I9P A;  4DKA C;  5IGB A;  5M3F H;  4LF5 Q;  2EY5 A;  2R93 G;  4RA8 A;  4O0A A;  3A5Z B;  5GAE C;  3HKZ G;  1QG7 A;  1FR3 A;  4DAY A;  4BXX G;  5JVH 3;  1JB3 A;  2WAQ B;  3M3Y H;  4GNX B;  1BCP B;  1U0L A;  4HR7 B;  3R8B A;  4XYO A;  1HUM A;  3RZO H;  3L0O A;  2XNA C;  1UEB A;  2RCF A;  1I4P A;  1SXT A;  4RHR A;  1KXL A;  2N49 A;  4BWG B;  5IYC H;  1JOQ A;  1WCM G;  1Q12 A;  2CFM A;  4R4T A;  3BYY B;  2CW0 C;  2F0S A;  4B9W A;  3ERS X;  4A3K H;  1HR0 L;  3HP3 A;  3V05 A;  5IIF A;  4JPB W;  3OTO L;  1RL2 A;  3GTP B;  1HNX L;  2K33 A;  1QNK A;  1E2W A;  4KN4 C;  3HOY B;  1EQR A;  1TWC H;  2PZU A;  4DV4 L;  1PH1 A;  1CKO A;  1VQ7 A;  2WFW A;  3I4O A;  3L3O C;  1YNJ C;  2B39 A;  3PV0 A;  2R92 H;  3RLF A;  2QF7 A;  2AQ2 B;  3K7A B;  4LF6 Q;  4A3B B;  1CM9 A;  1D5Z C;  1GM5 A;  5KGU A;  3I7F A;  4M1U B;  4MTN A;  4C3H H;  5E4W C;  4QIW E;  1N36 Q;  2HCC A;  4RGO S;  3I8Z A;  3CP0 A;  1PRT B;  4EQO A;  3G48 A;  3QOL A;  3TSS A;  3G6J B;  4FP5 D;  4BY7 B;  1EY4 A;  1O7Y A;  1XYI A;  1S3O A;  1CA6 A;  2F0F A;  2B63 H;  4LUO A;  3IFT A;  2A6E D;  4DR4 L;  2SOB A;  5HGT A;  1E3P A;  1SMY C;  4N8F A;  2R7Z H;  4JW0 A;  1KAW A;  3GP7 A;  4RGT A;  3BYT B;  3PIO 3;  1BF4 A;  4UP7 A;  3KF8 A;  5FLM H;  3R2T A;  4DR6 Q;  3PO3 B;  5J22 A;  3AEV A;  5CMD A;  3H09 A;  3A56 A;  1S5F D;  2H5X A;  1F77 A;  3G4S A;  1F9P A;  1STG A;  1V1O A;  1UUP A;  3SK6 A;  2NTS A;  1KC8 C;  5M5X B;  1RHP A;  5F2D A;  1WYD A;  3QWN A;  3DMU A;  1F9S A;  3SEB A;  5ISR A;  4CDC C;  4KD4 A;  1O7I A;  1MGS A;  3ULP A;  1L1O B;  1XXG A;  3JC6 6;  2WV6 D;  5C3E B;  4RG1 A;  4KY7 A;  4AH6 A;  2FIN B;  4DNT B;  2ZJR A;  1Y1W G;  1PYS B;  3KLR A;  5EKL A;  5G3L F;  1BUV T;  3U4Z A;  4H02 A;  5C4H A;  4IO9 A;  3OW2 A;  2K4K A;  4JI1 L;  4A3G G;  1HZ9 A;  4B9X A;  3Q0A A;  1JWM D;  5HGQ A;  1TS2 A;  4U68 A;  2N78 A;  3TP8 A;  1KDA A;  3GTQ H;  2J0T D;  2CQA A;  2E75 C;  3MWY W;  4B3T Q;  1MJE A;  5LMN Q;  1HTL D;  2PW5 A;  2R61 A;  1J6Q A;  2PZT A;  3MHB A;  1DON A;  4F87 A;  1N8R C;  4XTC S;  1S5B D;  1K83 B;  1ONL A;  3KFU A;  1VQ9 A;  3PUZ A;  1OTC A;  2Q8I B;  4MHE A;  1SJH D;  1TXY A;  4HIO A;  2JA8 G;  3HOU H;  3RR5 A;  5IOD A;  3I4M B;  3VYU A;  1K8M A;  5JJZ A;  1D7Q A;  2WB1 G;  1XX8 A;  2EZV A;  3FMC A;  3HEJ A;  2JA6 H;  2M2L A;  4YCV A;  4A3I G;  3R3O A;  2VB3 X;  2Z1C A;  4V19 0;  3AU7 A;  4BY1 H;  1SRU A;  5CV9 A;  3TP6 A;  1AN8 A;  3CF5 A;  1Q90 A;  3TZU A;  2ZJQ A;  4DUY L;  1Z6H A;  1WTO A;  3UE1 A;  3JAM i;  2VUM G;  3CU7 A;  5H1S E;  2ICI A;  4EVO A;  1PFM A;  1I4Q A;  1U4R A;  4L8J A;  3S9W A;  2A6H C;  2F4V Q;  5DEH A;  4DV1 Q;  1RCV D;  5C4X G;  1STH A;  5TSS A;  4X64 L;  5A2Q L;  1STE A;  1A2T A;  1H9S B;  1NE3 A;  2G5D A;  2JN4 A;  4B3M L;  5M9O A;  1N9W A;  4HID A;  1LYL A;  1SE8 A;  1BQQ T;  5C4J B;  3UDX A;  1LV9 A;  3QG1 A;  1VQJ A;  1Y8O B;  2UUA L;  1X3Q A;  2ALY B;  5IGG A;  2NVQ H;  1A2U A;  1EL0 A;  2N88 A;  1IYJ B;  1FGU A;  2RCN A;  5DAU A;  1XPU A;  1IBM Q;  3CMA A;  1TQO A;  5DM7 3;  3M4Y A;  3CCS A;  4O1N A;  2NN6 H;  1I5F A;  1CZG A;  4I65 A;  1NR2 A;  5C3W A;  4A3M H;  4YWL A;  4AYB B;  2YU9 H;  1VQA A;  1B9M A;  4LFA L;  4FF1 A;  1WTQ A;  1ENF A;  3KF6 B;  3AB9 A;  1I6H B;  4CJ1 B;  4Y52 H;  5JVG 3;  4A3J G;  4R1J A;  1VF7 A;  3NWS A;  3Q23 A;  3EN2 A;  2EIF A;  1F2Y A;  1GUS A;  2L4N A;  5FLX E;  3QO2 A;  3AMU A;  2B8G A;  4HSV A;  4JI3 L;  4GKJ Q;  4OGQ C;  3NTI A;  3E0E A;  3GQB A;  4POF A;  5M5Y B;  5JJL A;  2LMC B;  4DXG A;  1HUN A;  2V4D A;  3S1R B;  4YWM A;  4DR2 Q;  1TWH H;  3RZD H;  4OWW B;  3GTG H;  3S1M H;  4XT1 B;  1PTO C;  2PMZ E;  5IP9 H;  1TU2 B;  4RAU C;  3FKI H;  4DV7 L;  3I72 A;  1ML0 D;  4K5X A;  5KYL A;  2QKI C;  1X3G A;  4F8M A;  2OEO A;  3VDY A;  3KLS X;  3CME A;  1D1I A;  1GUN A;  1PMR A;  2KED A;  2R7D A;  2PQA A;  1LTS D;  2FMC A;  4E6I A;  2OTJ A;  5C5M A;  1A6X A;  3TZD A;  3QOJ A;  2EYO A;  2JA9 A;  2AQ1 B;  3A7L A;  4KHP L;  3OOC A;  4OEM B;  2EXZ A;  4G7Z C;  2VUM B;  5IYD G;  4L5R C;  1J9O A;  1OO9 B;  1PRT F;  2JEA I;  3PF4 A;  4DV5 Q;  1YNN D;  2OF1 A;  3Q8D A;  5C4X B;  4FXD A;  1U4L A;  1EWI A;  1WTX A;  1QVC A;  1KL9 A;  4CHT B;  4HJA A;  2G9D A;  4IOC A;  5IYB G;  3SGI A;  3TRZ A;  2A69 D;  2MO0 A;  1QVG A;  2DJG C;  5DM6 3;  3PO2 B;  1E1O A;  1MD2 D;  1Q3L A;  2ZXO A;  2QEX A;  3DUZ A;  4TSS A;  3S1Q H;  1K3B C;  2Q8R E;  1UE6 A;  1ESF A;  3L7Z C;  5GQO A;  1A3U A;  3QB3 A;  2BE5 C;  2F3V A;  1LTI D;  1QCB D;  1J5E Q;  1HTP A;  1VQH A;  1XTC D;  2D62 A;  3GTJ B;  3U58 A;  1SR3 A;  1H9R A;  1Y1V G;  2YTV A;  2F03 A;  1YNX A;  4K0K Q;  2KOL A;  5M3F B;  4QL5 A;  2Y0S E;  4DR7 Q;  3J80 i;  5CGK A;  1IBK L;  4JI2 L;  2XTI A;  4ZRZ A;  4AIM A;  2F1M A;  4DK1 A;  1RD9 D;  2FXQ A;  3CPF A;  3J80 E;  2LFN A;  4DV2 Q;  3M3Y B;  4YY3 Q;  4DN4 M;  3JAM L;  3RZO B;  1Z7T A;  2K50 A;  1B53 A;  3A55 A;  4FF4 A;  2K03 A;  1BCP C;  4WRD A;  3S2D H;  5CV5 A;  1TWA H;  4QIW B;  4X62 Q;  1PV4 A;  5IT9 c;  4X6A H;  4NPS A;  4JI7 L;  4P75 A;  4A3K B;  2F4I A;  2K1B A;  4LJZ C;  3HOZ H;  4L5Q A;  3CXC A;  1KIX A;  4C3J G;  3DWQ A;  3VR3 A;  1DYQ A;  2F0O A;  1TWC B;  2EY1 A;  4PG3 A;  3J81 i;  4PZ7 A;  4JV5 Q;  3K7U C;  2R92 B;  2PI2 A;  4DAM A;  4LF8 L;  2ZJP A;  3MXG A;  1ICF B;  4ILW A;  1SE3 A;  3OPO A;  2K52 A;  4BS9 A;  3NSW A;  1XWE A;  5E1F A;  1JIC A;  2JK8 A;  4V0B A;  5KRU A;  4JI6 Q;  2I46 A;  2B63 B;  5BR8 L;  1EQV A;  3BZK A;  3VYT A;  1XNR Q;  4G7H C;  2KEN A;  2K5D A;  2N3S A;  1QVF A;  1XTD A;  1XJV A;  2F0M A;  1NTG A;  1H9J A;  2WKC A;  3TP5 A;  3STB D;  1YJW A;  1AE2 A;  2E2J B;  4IOA A;  3TME A;  5COY A;  1Y14 B;  5FLX L;  3OWF A;  2K5N A;  4QB4 A;  1KDC A;  4WFN 3;  2B8F A;  1I4H A;  2RVL A;  1FJG Q;  4K6D A;  1YBY A;  4H0L C;  1Q46 A;  5C44 H;  1TY2 A;  4NP5 A;  4A75 A;  1LAB A;  1HHV A;  3GV6 A;  5BN5 A;  5I2Y A;  2RSN A;  3VYS A;  5FKA C;  4DAP A;  4ZK9 B;  4LUZ A;  4J1M A;  4ZQ3 A;  5J1Z A;  4A4I A;  1C0A A;  1JWU D;  2BDO A;  3CC7 A;  2L5T A;  3O13 A;  2RF4 A;  1IYV A;  2HT1 A;  4A93 H;  1ZYR C;  5JPM C;  1D2B A;  1SJE D;  1YJ9 A;  3I56 A;  4YCW A;  1HPC A;  3F2U A;  4IJH A;  3I73 A;  1I50 B;  2UUB Q;  2OT2 A;  2A1A A;  1PFB A;  2D0P A;  4DFA A;  5EBC A;  1IW7 C;  3RUZ A;  5M3M G;  3FEW X;  3VR5 A;  3KF6 A;  2JA7 G;  3GTQ B;  3M4P A;  4KJN A;  3H3V C;  1G6Z A;  4BBS G;  2R3Z A;  5K36 H;  1XNQ L;  2EJF C;  2IX1 A;  1PLF A;  1MSH A;  1EFI D;  3S15 H;  3TS0 A;  2KHS A;  3K59 A;  4H7B A;  1FNU A;  3HOU B;  3KOJ A;  2NTT A;  3V2T A;  3I90 A;  4LFC Q;  3GTO H;  3IFD A;  4LFB L;  3ERO A;  3U9O A;  5GAD C;  1KDB A;  3M7G A;  2ICE C;  4BY1 B;  2E2D C;  1D5X C;  3I4L A;  4H44 C;  3GTM H;  3M9B A;  2XGT A;  1VQO A;  2DNE A;  4N9P A;  3G71 A;  1V1P B;  2E2I H;  4KV6 A;  3TEH B;  1B3Q A;  4HMI A;  3WWV A;  2ZTC A;  3NEN A;  2JA5 G;  3ULJ A;  3F1Z A;  1HA5 A;  4PNY A;  4L5T A;  1PYW D;  1WOC A;  1T5X D;  2ZTD A;  3C46 A;  1YI2 A;  1DGS A;  2O5I C;  1PH6 A;  2TSS A;  3HOY G;  3IRB A;  4QCL A;  1SYE A;  1NMF A;  3J80 L;  4WJ4 A;  1KQS A;  4IUR A;  1O7Z A;  3W1G A;  4A3B G;  2R7F A;  2YTY A;  4ZUI A;  3FRP B;  3PMF A;  1MI2 A;  2NVQ B;  3KDF B;  4YWK A;  1FYC A;  4FYD A;  3ULL A;  2E5L L;  4EQN A;  1HR0 Q;  3OHX C;  3OTO Q;  2CW0 D;  3E5S A;  3IKJ A;  1HNX Q;  4JBK A;  4IFD H;  4KY6 A;  1LT4 D;  3UDI A;  3T16 A;  2IPK D;  4OIJ A;  4DV4 Q;  3OMC A;  1TKW B;  3BVG A;  4A3M B;  4OO1 I;  2YU9 B;  2AMC B;  1YNJ D;  3EBE A;  3BU2 A;  3H0G H;  3J81 L;  4R8N A;  4B08 A;  1FVI A;  1ZKO A;  4JYA L;  2GVA A;  2F3W A;  1G2T A;  2L12 A;  2K5W A;  1SYC A;  3CRL C;  3MXN B;  4LF4 L;  5C0X H;  3OMG A;  1BBX C;  1LTR D;  2Z4H A;  3N6R A;  5IWA L;  1LM0 A;  5IP7 H;  4OX9 L;  4GOP A;  1SMY D;  3J81 j;  1A15 A;  4ZUJ A;  1BVS A;  5C5L A;  5C3E G;  3M4O B;  3NEM A;  3SHL A;  1TWH B;  4KKT A;  1UAP A;  4Z9C B;  3GTG B;  3S1M B;  2IX3 A;  3FPP A;  4DPG A;  3N52 A;  2QIL A;  2UUC Q;  1Q7Y C;  2IL8 A;  1CHQ D;  2NWG A;  2XIW A;  2SDF A;  5A2Q E;  1M90 C;  3VR2 A;  2IHE A;  1VQD A;  2NUC A;  5C3X A;  5ELB A;  2XWJ B;  1CUK A;  2LS0 1;  3PUX A;  3BS1 A;  3GO5 A;  1MHW C;  2Q2I A;  5FLX c;  3K5N A;  3SR1 A;  5A35 A;  1E1T A;  1EY5 A;  4XQJ A;  4FXG C;  2UXD L;  1W6K A;  2JA5 B;  3NQT A;  2JJQ A;  2PQE A;  4JOI A;  1VMP A;  4JI1 Q;  2QA4 A;  3MXU A;  4HAE A;  3A7A B;  4UPA A;  3I4M G;  4X65 L;  4IUQ A;  1I4R A;  4CJ0 B;  3VA7 A;  2PNH A;  2DJF C;  2VS1 A;  4DR1 Q;  4LMQ D;  1E24 A;  1W3S A;  4UP8 A;  1Y69 U;  1SNQ A;  4G57 A;  2EJM A;  5KNB A;  4LAA A;  4IN3 A;  3S1Q B;  3BZD B;  3URY A;  1VDZ A;  5I6Y A;  2NZO A;  4KHZ A;  5ELF A;  3FPU B;  2L1B A;  4NXM L;  4KD3 A;  1E0B A;  2WAC A;  4CBV A;  4I7A A;  2DUD A;  1EUJ A;  1TR5 A;  4GN4 B;  1B70 B;  3BDL A;  4HIM A;  3DM1 A;  5CYU A;  2HDM A;  4ODG A;  2EYL A;  4LK1 C;  4DUY Q;  2NZ1 D;  5CR3 A;  3U50 C;  2VY3 A;  2PW7 A;  4OHJ A;  1KAA A;  3A0J A;  1AFP A;  3NBH B;  3VA5 A;  1VQE A;  4OO1 H;  5JJI A;  3HOW H;  3J7A V;  2A6H D;  4X64 Q;  4GOP C;  5FO8 B;  1HA6 A;  1ICW A;  5GAG C;  4B3S Q;  4EQP A;  1ZEQ X;  4B3M Q;  5EQ0 A;  2CWA A;  3S2D B;  4RGN A;  1GD7 A;  3S1N B;  1EOV A;  4K6L A;  4AYB G;  1O7L A;  1STN A;  2UUA Q;  1BXT A;  1V9P A;  3D3R A;  4PV1 C;  3HG9 A;  3HOZ B;  2K5H A;  2F0T A;  4PMW A;  4ALP A;  3Q6S A;  2ZXP A;  3P75 A;  2IX0 A;  3MZ5 A;  1PYB A;  4KHV A;  2VZA A;  3J80 c;  3DWA A;  4QJF A;  2D9U A;  2GN5 A;  1JJG A;  4MN3 A;  3GV3 A;  3C1F A;  2B2V C;  4Y7N H;  1EIY B;  4LFA Q;  4ID6 A;  4HCE A;  1EY8 A;  2HHH L;  2CKZ B;  1PH8 A;  1EWH A;  1C8C A;  1DCZ A;  1EEI D;  2EDG A;  2Q2T A;  1V1P A;  4JOI C;  1C7Y A;  4AQY L;  4A3E H;  1DOK A;  5I9O A;  3BDO A;  5ELD A;  1N34 L;  5M5W H;  4A3L H;  1EY0 A;  2XRQ D;  5CBE E;  1X9N A;  1KRT A;  4JI3 Q;  1VQ4 A;  1PA6 A;  4A3D H;  1A62 A;  3CD6 A;  1VQ8 A;  4HCS A;  4CKB A;  2MHV A;  1PXU A;  4DK6 C;  4IFD G;  4R4I A;  3VYR A;  2KHJ A;  2QDB A;  3KUP A;  1X54 A;  4UAI A;  4GKK L;  2MPM A;  1II3 A;  1SAP A;  3MC0 B;  3S2H H;  4YCU A;  2RQX A;  2ENB A;  2XSC A;  4DV7 Q;  3KDF A;  1PTO D;  3JAM E;  5FJ8 G;  3AFP A;  1KNE A;  1HFG A;  4KK7 A;  2K32 A;  4A93 B;  4R8I A;  2MO1 A;  4A3C G;  2FFK B;  1SNC A;  3DEP A;  1IL2 A;  3PUW A;  3W2D A;  1VQL A;  4X3T A;  4C3I H;  3VR4 A;  1EIF A;  3PO2 G;  1DZ1 A;  3HS0 C;  4QUC A;  1YVC A;  4GS3 A;  4KHP Q;  2C9O A;  2F0E A;  1TWF H;  5EPJ A;  1STB A;  1QZH A;  1G6P A;  1PTO H;  1SNO A;  1IKM A;  1VQ5 A;  4LNQ A;  1EEF D;  3HOX H;  2HUG A;  4GLA C;  1G91 A;  3T4A C;  3F2B A;  3S14 H;  2ZM6 L;  3ICE A;  1G51 A;  2F0I A;  1AZQ A;  1S4Z A;  4I7Z C;  4B3R L;  5FK9 C;  1HJP A;  2TMP A;  3S15 B;  1RTO A;  1NJI C;  5M3F G;  1RTN A;  1HQM C;  4BBR H;  1QWY A;  5D65 A;  3MVV A;  3I70 A;  3PQI A;  5GRO A;  1EQQ A;  2WP8 J;  3T1H L;  3TP7 A;  3GTO B;  1UE1 A;  2VQF L;  4CJ2 C;  2BE5 D;  4RMF A;  1F2M A;  4FXK C;  3GTM B;  3KBG A;  2E2I B;  3LGJ A;  2A73 B;  5IYC G;  4B3T L;  2EYP A;  1EYG A;  1VQ6 A;  2H1E A;  4DUZ Q;  2VNU D;  5FO9 B;  1LT6 D;  4GNX A;  1IBK Q;  4JI2 Q;  4O2D A;  4A3K G;  1JC7 A;  1N32 L;  4KN7 C;  1EY7 A;  3Q22 A;  2A68 C;  1K73 C;  2XRS D;  3BG3 A;  2R92 G;  3CCU A;  4RCN A;  1BDO A;  1L0Y B;  4JI8 L;  1LT3 D;  2RHQ B;  2K6A A;  3CCR A;  4C3H G;  1TWG H;  2DGY A;  3J7Y W;  1S40 A;  1BCP D;  5LMU Q;  2K01 A;  3D4W A;  4PZ8 A;  4X66 Q;  3J7Z C;  2F0U A;  3H3V I;  1SN8 A;  2X6G A;  2B63 G;  3CC2 A;  1OXS C;  1IZ6 A;  3ITP A;  1SSO A;  5EPL A;  4LF8 Q;  2R7Z G;  1VF5 C;  4C56 C;  3T56 B; 
#chains in the Genus database with same CATH homology
 1X3E A;  1C0A A;  4LF7 Q;  3PCO B;  4P71 A;  5DLQ E;  3CC7 A;  2RF4 A;  1R9T H;  2HT1 A;  3HOV H;  3M7N A;  5FLM G;  1LTL A;  1IXR A;  4A93 H;  3T1Y L;  4DR1 L;  1JT8 A;  4DV6 Q;  3CCM A;  3J81 c;  2ID0 A;  4LF9 Q;  1L2F A;  3GTJ H;  1YJ9 A;  3I56 A;  4LF6 L;  3RN5 A;  2HIX A;  1N32 Q;  4DV0 L;  1KRS A;  4YCW A;  1C9O A;  2BH2 A;  1B8A A;  1E22 A;  4IJH A;  1XMQ Q;  5M3F H;  5BR8 Q;  4DKA C;  4LF5 Q;  1N36 L;  2UUB Q;  2R93 G;  4JBM A;  2A1A A;  4O0A A;  2D0P A;  3A5Z B;  5GAE C;  3HKZ G;  1MKH A;  1KD1 C;  2Z6K A;  2EQS A;  1X6O A;  5M3M G;  4C2M H;  3DLL A;  3KF6 A;  2JA7 G;  3EIV A;  3M4P A;  2CCZ A;  4JI8 Q;  3H0G G;  3CCE A;  3ZJY C;  4HJ8 A;  4C3J H;  3M3Y H;  4GNX B;  2WAQ E;  1SLJ A;  2E2H H;  1U0L A;  1YZ6 A;  2RHS B;  4JBJ A;  4KI0 A;  4BBS G;  1K9M C;  1HR0 W;  3RZO H;  2VW9 A;  1UE7 A;  3L0O A;  1XNQ L;  2IX1 A;  4KLK A;  1UEB A;  3PUV A;  2B29 A;  3S15 H;  5C0X G;  1KXL A;  2N49 A;  5IYC H;  3TS0 A;  1WCM G;  1Q12 A;  4YHH Q;  4DR3 L;  2Q2U A;  2ES2 A;  1PH9 A;  4IPH A;  1L1O A;  2CFM A;  3K8A A;  5IP7 G;  4R4T A;  4HJ7 A;  3KOJ A;  4BA2 I;  4DR6 L;  1CSP A;  1PH7 A;  1QUQ B;  1CKN B;  1OXT A;  3ERS X;  4A3K H;  3GTO H;  4LFC Q;  1VCI A;  1HR0 L;  4TQU S;  4LFB L;  3OTO L;  1A0I A;  1RL2 A;  5GAD C;  1HNX L;  1EFW A;  1YIJ A;  3K80 C;  4BY7 H;  3M85 A;  4B3S L;  1EQR A;  1TWC H;  4DV4 L;  1PH1 A;  1JMC A;  1Q8K A;  1SMX A;  1CKO A;  1VQ7 A;  2WFW A;  3I4O A;  3PV0 A;  2R92 H;  3M9B A;  3GTM H;  3T1Y Q;  1VS0 A;  2XGT A;  3RLF A;  3HFZ B;  1VQO A;  1H95 A;  3G71 A;  4GN5 A;  4GNX C;  2E2I H;  3TEH B;  3S24 A;  4A3F H;  4DV3 Q;  4LF6 Q;  3I4N H;  1OXU A;  4DV0 Q;  4OXP A;  3WWV A;  2ZTC A;  3NEN A;  1GM5 A;  2JA5 G;  3I7F A;  4MTN A;  3ULJ A;  3F1Z A;  4C3H H;  4QQB X;  4QIW E;  3HOU G;  1N36 Q;  4L5T A;  3CP0 A;  1WOC A;  1Q1E A;  3I2Z A;  5LMN W;  3G48 A;  2ZTD A;  3PO3 H;  3TRE A;  1YI2 A;  2BA1 A;  4JBW A;  1DGS A;  4P73 A;  2JA6 G;  1PH6 A;  2VL6 A;  1S3O A;  1VQP A;  1SFO H;  1HNW Q;  2R6G A;  4R4Q A;  2B63 H;  4LUO A;  3HOY G;  3IRB A;  4ME3 A;  4BY1 G;  1NMF A;  3UDF A;  4DR4 L;  4WJ4 A;  4LWC A;  1KQS A;  4JI5 Q;  1E3P A;  4DK3 C;  1CKM A;  4UP9 A;  1VQC A;  3FHW A;  4PZ6 A;  4A76 A;  1XNQ Q;  2R7Z H;  1Q1B A;  3W1G A;  4A3B G;  1KAW A;  2R7F A;  5LMN L;  2I5H A;  2YTY A;  2F3I A;  4UP7 A;  3I55 A;  5FLM H;  4DR3 Q;  3CQZ H;  3KDF B;  2NZH A;  4YWK A;  4DR6 Q;  4DR5 Q;  3AEV A;  3ULL A;  2AWO A;  2E5L L;  1ASY A;  2H5X A;  3G4S A;  1HR0 Q;  3OTO Q;  4JBK A;  1PFS A;  1HNX Q;  3UDI A;  1KC8 C;  4DV4 Q;  4DV5 L;  1WYD A;  2I5L X;  4EX5 A;  2R93 H;  1AE3 A;  3PIO A;  4OO1 I;  2AMC B;  1JJ2 A;  1O7I A;  5M3M H;  3CAM A;  2JA7 H;  4BXX H;  3EBE A;  3ULP A;  3UE0 A;  3BU2 A;  1I3Q H;  3H0G H;  1L1O B;  1QZG A;  4GN3 B;  3JC6 6;  5J3B A;  3ER0 A;  1HNZ Q;  5JEA J;  4RG1 A;  1FVI A;  4JYA L;  4JI7 Q;  2GVA A;  4AH6 A;  4BBS H;  2ZJR A;  3M4O H;  1Y1W G;  1L0W A;  1PYS B;  1W2B A;  3BJU A;  3MXN B;  3A74 A;  1YHQ A;  2C35 B;  3GDE A;  4LF4 L;  2Z6K C;  4J15 A;  3U4Z A;  4H02 A;  1ASZ A;  2N8N A;  3CPW A;  4IO9 A;  1WCM H;  5IE8 A;  5IWA L;  1HH2 P;  1LM0 A;  2NN6 G;  3OW2 A;  2GVB A;  2K4K A;  4JI1 L;  5IP7 H;  4IPD A;  1HZ9 A;  4OX9 L;  4A3G G;  2E8G A;  4A3M G;  5HGQ A;  2F4V L;  4DV1 L;  3HKZ E;  2N78 A;  3D31 A;  4GOP A;  3GTQ H;  5HY6 A;  1YJN A;  3J81 j;  4B3T Q;  1MJE A;  2KCT A;  5LMN Q;  1V1Q A;  1BVS A;  1J6Q A;  5C3E G;  1AH9 A;  1N8R C;  2V1C C;  4XTC S;  1X55 A;  2K75 A;  3NEM A;  4MZ9 A;  4BXX G;  3D0F A;  4OO1 G;  1L1O C;  3KFU A;  2NVX H;  1X56 A;  1VQ9 A;  3PUZ A;  2E5L Q;  3HOW G;  4P74 A;  4UY8 C;  1OTC A;  2PI2 E;  4DPG A;  3B6Y A;  2JA5 H;  1TXY A;  2D0O A;  4HIO A;  1Q7Y C;  1UE5 A;  2UUC Q;  2HIV A;  2JA8 G;  3HOU H;  4DV2 L;  1M90 C;  1IBL Q;  3GD7 A;  3RR5 A;  4YY3 L;  2IHE A;  4P72 A;  1VQD A;  1I94 L;  1IBM L;  1D7Q A;  1MJC A;  2WB1 G;  3KF8 B;  3GTP H;  1CUK A;  2ZTE A;  2JA6 H;  3PUX A;  4YCV A;  4OWT B;  4A3I G;  3PIP A;  3GO5 A;  3HOY H;  2Q2I A;  5FLX c;  2HQL A;  2Z0S A;  1SRU A;  4BY1 H;  4IFD J;  4JYA Q;  2OCE A;  3CF5 A;  3AFQ A;  2UXB L;  3RN2 A;  3AYH B;  1E1T A;  2ZJQ A;  4X62 L;  4DUY L;  3K7A H;  5IP9 G;  3UE1 A;  3JAM i;  5C4J H;  2VUM G;  4A3B H;  4LF4 Q;  2UXD L;  3FKI G;  5H1S E;  3CC4 A;  2B3G A;  1K8A C;  5IWA Q;  3MEF A;  2JJQ A;  3PUY A;  4JOI A;  2QA4 A;  4JI1 Q;  4OX9 Q;  5E7N A;  2F4V Q;  4UPA A;  3I4M G;  3S16 H;  4DV1 Q;  3K0X A;  3J7A 5;  5C4X G;  4FDB A;  2CQO A;  4X64 L;  4X65 L;  1JB7 A;  2YYZ A;  2PNH A;  5C0X J;  1NE3 A;  4B3M L;  2VS1 A;  4DR1 Q;  1N9W A;  4HID A;  1E24 A;  1W3S A;  1SRO A;  4GKJ L;  1LYL A;  1NY4 A;  1SE8 A;  4TVA B;  4UP8 A;  4A3E G;  4DUZ L;  3UDX A;  2UUA L;  1VQJ A;  3FP9 A;  2ALY B;  2JE6 I;  4NXN L;  4APV A;  1M1K C;  4A3L G;  3TQY A;  3E9I A;  4JI6 L;  5ELN A;  2NVQ H;  4GOP B;  2NZO A;  1N33 L;  4KHZ A;  1GKH A;  3PSI A;  1P8L A;  1T9H A;  1IYJ B;  1FGU A;  2MFI A;  2RCN A;  4DR2 L;  3F2D A;  3UDG A;  1Y1W H;  1I94 Q;  2AKW B;  4IPG A;  3CMA A;  1IBM Q;  4NXM L;  1XPU A;  4LW1 A;  4A3D G;  2ASB A;  1XPR A;  2OTL A;  1BBW A;  2DUD A;  1EUJ A;  1VQM A;  5M5X H;  3CCS A;  4GN4 B;  1B70 B;  5GAH C;  1I5F A;  2A8V A;  4HIM A;  4A3G H;  2UXB Q;  4A3M H;  4YWL A;  5LMU L;  1A8V A;  1Q82 C;  2YU9 H;  3S1N H;  4WJ3 M;  4DUY Q;  4AYB E;  1VQA A;  3L2P A;  4LFA L;  2I0Q A;  3U50 C;  2VY3 A;  4X66 L;  2UXD Q;  1YEZ A;  1Z9F A;  4DAY B;  5C3E H;  3KF6 B;  5M5Y H;  3A0J A;  1FJG L;  1CSQ A;  3NBH B;  1VQE A;  4Y52 H;  4LFB Q;  5JJI A;  3HOW H;  4A3J G;  4R1J A;  4JI0 L;  1X65 A;  3PGZ A;  4X64 Q;  4GOP C;  5GAG C;  3EN2 A;  1NMG A;  4B3S Q;  2EIF A;  3JAM c;  1VQK A;  1XMO L;  2JA8 H;  4OON A;  4B3M Q;  3H15 A;  2CWA A;  1GD7 A;  4JI3 L;  3H3V H;  4IJL A;  2NVT H;  1EOV A;  4AYB G;  4GKJ Q;  3PF5 A;  1WJJ A;  4JC0 A;  3E0E A;  3S17 H;  2UUA Q;  1V9P A;  4POF A;  3CCV A;  4NXN Q;  4A3I H;  2K5H A;  5JJL A;  3DM3 A;  5AJ3 L;  4R4O A;  1N33 Q;  1K83 H;  4YWM A;  1OXX K;  3HOX G;  4DR2 Q;  1GO3 E;  1TWH H;  4PMW A;  4ALP A;  1G29 1;  2I5M X;  3RZD H;  4NXM Q;  4OWW B;  1X3F A;  2IX0 A;  4GLV B;  5IP9 H;  2PMZ E;  1PYB A;  1VQN A;  2VUM H;  3GTG H;  1S72 A;  3S1M H;  3FKI H;  4DV7 L;  2KCM A;  2VZA A;  3J80 c;  2YTX A;  2VQE L;  4DR4 Q;  2OQ0 A;  4QJF A;  2IHF A;  1QUQ A;  1X3G A;  4BBR G;  3VDY A;  4IFD I;  2GN5 A;  1JJG A;  3I4M H;  1NBW A;  1J5E L;  3U4V A;  2WB1 E;  5C4X H;  3CME A;  1EIY B;  2F52 A;  4Y7N H;  2R7D A;  4LFA Q;  2PQA A;  3HOZ G;  2AHO B;  3A5U A;  3KJP A;  4HIK A;  2HHH L;  2CKZ B;  1PH8 A;  2OTJ A;  1KHI A;  4K0K L;  2JA9 A;  2Q2T A;  4YHH L;  2IY5 B;  4DR7 L;  4KHP L;  3KJO A;  1MIU A;  4JOI C;  2KHI A;  1C7Y A;  3GTL H;  4AQY L;  4A3E H;  5IYD G;  4L5R C;  4JI0 Q;  2NVY H;  4L5S A;  2JEA I;  1VQB A;  3PF4 A;  1N34 L;  5M5W H;  3CCJ A;  4DV5 Q;  4A3L H;  1FL0 A;  1JE5 A;  1XMO Q;  1PHJ A;  1Q86 C;  5C0X I;  3Q8D A;  1X9N A;  1KRT A;  4JI3 Q;  1VQ4 A;  1EWI A;  4IPC A;  1PA6 A;  1QVC A;  1KL9 A;  3CCL A;  4A3D H;  1A62 A;  4HJA A;  3CD6 A;  1VQ8 A;  2CWP A;  4IOC A;  5IYB G;  4DV3 L;  1PH4 A;  2QGQ A;  3SGI A;  1D8L A;  3TRZ A;  4DK6 C;  4IFD G;  2MO0 A;  4R4I A;  5AJ3 Q;  1QVG A;  2KHJ A;  2KBN A;  1E1O A;  1X54 A;  4GKK L;  2QEX A;  1BKB A;  3S2H H;  4YCU A;  1HZA A;  4NB3 A;  3S1Q H;  2UU9 L;  3L7Z C;  1UE6 A;  3KDF A;  4DV7 Q;  5GQO A;  2VQE Q;  2LSS A;  4DNI A;  1HNW L;  5FJ8 G;  1HZB A;  3AFP A;  1B7Y B;  4JV5 L;  4JI4 L;  3NEL A;  1J5E Q;  5IY0 A;  4JI5 L;  2MO1 A;  4A3C G;  4A3J H;  1VQH A;  3OYY A;  2D62 A;  1IL2 A;  3KLW A;  3U58 A;  1SR3 A;  1Y1V G;  2YTV A;  3PUW A;  1VQL A;  2UXC L;  2HHH Q;  2K5V A;  1WFQ A;  4C3I H;  1GVP A;  1YNX A;  2K14 A;  4K0K Q;  5C44 G;  1EIF A;  4QL5 A;  4XIG S;  3PO2 G;  2Y0S E;  4DR7 Q;  4KHP Q;  1YVC A;  1Z47 A;  3E9H A;  4GS3 A;  2YV5 A;  3J80 i;  4AQY Q;  1IBK L;  4JI2 L;  1YHB A;  1TWF H;  2XTI A;  3W5O A;  4DR5 L;  1QZH A;  4AIM A;  1G6P A;  1N34 Q;  1U5K A;  2FXQ A;  3CPF A;  3F8T A;  3W1B A;  1Q81 C;  4DV2 Q;  4YY3 Q;  3HOV G;  1WI5 A;  4QGU A;  2WAQ G;  1XNR L;  1RIP A;  1I6H H;  1VQ5 A;  4LNQ A;  4HJ9 A;  3HOX H;  2PQA B;  4GLA C;  1LUZ A;  4A93 G;  3S14 H;  3F2B A;  2ZM6 L;  2K50 A;  1G51 A;  1K0R A;  3ICE A;  4JCV E;  3STB C;  4B3R L;  2AWN A;  1YHA A;  1HJP A;  3AQQ A;  3CCQ A;  1NJI C;  5M3F G;  3KYH C;  2Y0S G;  2OWO A;  3S2D H;  4BBR H;  1PV4 A;  1TWA H;  2OQK A;  4X62 Q;  1HNZ L;  1PH2 A;  5IT9 c;  5GRO A;  4GKK Q;  4X6A H;  4NPS A;  4JI7 L;  3RNU A;  1EQQ A;  4P75 A;  2WP8 J;  3T1H L;  3G6E A;  2IT1 A;  2BH8 A;  3HOZ H;  2UU9 Q;  4L5Q A;  3CXC A;  1KIX A;  4HJ5 A;  3TS2 A;  1UE1 A;  3GTK H;  4OWX B;  2ATW A;  2VQF L;  3S1R H;  4PG3 A;  3J81 i;  4PZ7 A;  4EQ5 A;  3K7U C;  4JV5 Q;  2PI2 A;  4RMF A;  4X65 Q;  4JI4 Q;  4DAM A;  4LF8 L;  5IYD H;  2ZJP A;  5K36 G;  1PVO A;  4POG A;  3LGJ A;  1E7Z A;  1VQI A;  3RLO A;  1HZC A;  4R4C A;  5IYC G;  1PH5 A;  4B3T L;  4LF7 L;  2UXC Q;  2K52 A;  1EYG A;  1VQ6 A;  2MQH A;  4MNO A;  2E2J H;  4DUZ Q;  2VNU D;  4DV6 L;  4GNX A;  3M4Q A;  2NN6 I;  1IBK Q;  4JI2 Q;  4LF9 L;  4O2D A;  4A3K G;  2JK8 A;  1N32 L;  4JI6 Q;  1BBU A;  3CW2 C;  5IYB H;  1JJC B;  5JEA G;  4GLX A;  1XMQ L;  4BY7 G;  1XPO A;  5BR8 L;  5JJK A;  1K73 C;  2BA0 A;  3BZK A;  1PH3 A;  4LF5 L;  1XNR Q;  2KEN A;  2UUB L;  2UUC L;  2R92 G;  2A19 A;  2N3S A;  2MNA A;  3CCU A;  1IBL L;  1XTD A;  5EAY A;  1QVF A;  2ZM6 Q;  2JQO A;  1XJV A;  4A3F G;  1K8G A;  3I4N G;  4B3R Q;  4JI8 L;  1NTG A;  2RHQ B;  1CKN A;  1UWV A;  1OXV A;  3CCR A;  1TWG H;  2DGY A;  1AE2 A;  3STB D;  4BA1 I;  5FJ8 H;  1YJW A;  1S40 A;  4QY7 A;  5LMU Q;  4IOA A;  1Y14 B;  2K5N A;  3BZC A;  4PZ8 A;  2Q2H A;  1A63 A;  4A3C H;  4X66 Q;  3PO3 G;  1K3R A;  3K81 C;  3T1H Q;  3J7Z C;  3RLN A;  3H3V I;  1SN8 A;  1Y1V H;  4LUV A;  4JG2 A;  3HKS A;  2LXJ A;  1FJG Q;  2B63 G;  3CC2 A;  1YBY A;  1Q46 A;  5C44 H;  1IZ6 A;  1OXS C;  3F2C A;  2VQF Q;  4A75 A;  3PO2 H;  1VQF A;  2JEB I;  1YIT A;  1VQG A;  5ELO A;  1I50 H;  1V43 A;  2LXK A;  4LF8 Q;  2R7Z G;  2L15 A;  4LUZ A;  4LFC L;  2EXD A;  4A4I A;  1P16 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...