1IBXB

Nmr structure of dff40 and dff45 n-terminal domain complex
Total Genus 9
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
9
sequence length
89
structure length
89
Chain Sequence
SGEIRTLKPCLLRRNYSREQHGVAASCLEDLRSKACDILAIDKSLTPVTLVLAEDGTIVDDDDYFLCLPSNTKFVALASNEKWAYNNSD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA FRAGMENTATION FACTOR 40
publication title Solution structure of DFF40 and DFF45 N-terminal domain complex and mutual chaperone activity of DFF40 and DFF45.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase/hydrolase inhibitor
total genus 9
structure length 89
sequence length 89
ec nomenclature
pdb deposition date 2001-03-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF02017 CIDE-N CIDE-N domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.10 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 1ibxB00
2OEDA 5HFYA 1K53A 3GB1A 2LHEA 1HZ6A 1XCTL 2K0PA 1P7FA 1KH0A 1FD6A 1HEZE 1K50A 2KDMA 2KN4A 5JXVA 1HZ5A 1K52A 1IGDA 1GB1A 2GI9A 3UI3A 1UWXA 1P7EA 2JZPA 1K51A 1PGBA 5HG2A 2RPVA 5BMIA 2KQ4X 2N7JA 1XF5L 1FCLA 1JMLA 4HKZE 1YMHE 1MVKA 2PW9A 5HHDG 2N9KA 2EELA 4KGRA 1MHXA 5BMGA 2QSDA 5BMHA 1PGXA 1QKZA 4KGSA 3MP9A 1IBXB 2GB1A 4IKGA 4OZAA 4OZBA 3FILB 2IGHA 2ZW0A 2QMTA 1D4BA 4D2KA 4WH4A 4GLSC 1YNTE 1FCCC 2JXTA 2NMQA 1MHHE 4MACA 1IGCA 2LUMA 1ZXHA 2RMMA 1IBXA 1F2RI 1Q10A 2PTLA 3V3XA 1C9FA 2LHDA 3FILA 4IOIE 2JU6X 2IGDA 2J53A 1XCQL 1MPEA 2J52A 2KWDA 1MI0A 2N9LA 1GB4A 1EM7A 2KACA 1PGAA 2I38A 2JWUA 4OZCA 4HJGE 2PLPA 2ON8A 5HI1A 4KGTA 2I2YA 2IGGA 2JSVX 2ONQA 2ZW1A 1F2RC 2LGIA
chains in the Genus database with same CATH superfamily
2N9XA 3W5UB 1YIWA 4DWFA 4G3XB 4M0WB 4YTPB 1RYJA 2KQ7A 5D6JB 4BVUC 4RM9A 1FD6A 5AZFA 3VXWA 4C7YA 2LJ5A 5G5GA 1F0ZA 4ARIA 3P63A 2KDMA 3N1XC 4XZ4A 3DVNV 5JXVA 4C4VA 5D3IB 3AE3B 3NZUA 5E6NA 3PSEB 4G50A 1TYGB 4WWPA 3BVZA 3UI3A 4GDLB 4WJOA 2O6VA 3WAMA 1J7CA 1WYWB 4TV3A 2RSUA 2L7RA 3DCGA 3KQ4A 3UIOB 3IXSA 1TIFA 2X38A 3RZWC 2ZNVC 1VDVA 2V1YA 1I42A 2INDC 1WYGA 4GU2A 4CO7A 5G5HA 2MH7A 2KWVB 1NYQA 4HEA1 2KWUB 3P2BA 1WGDA 5AUIA 1PGXA 3VUWA 1L0YB 4LNKA 3MP9A 3NRZA 5KHQA 4JX1C 2MP2A 1I4PA 2CU1A 4ASWC 2M4NA 1V2YA 1MHHE 3A4SC 1BUIC 3DVGX 2LZ6A 4IM0A 3PO0A 2M17A 1STEA 1NDDA 3KUCB 3M63B 2FUG1 3PREA 2AYOB 1EM7A 2CR5A 4JIOU 1YN3A 4M02A 1TS3A 1OFFA 2BPSA 3VFKA 1VR9A 2GBMA 4WIPA 2BF8B 2I2YA 3C19A 1VCBA 2LGIA 4AOFA 4PT5A 3RNFC 4LK0M 2REXA 4GB9A 2JRHA 3NY5A 2OOBB 2RGFA 3GOEA 3Q69A 4X57B 2HDEA 3WA0A 1HZ5A 2HTME 1YOVB 3BZDB 2H88B 2NCNA 2ZNVB 2GI9A 1FXTB 3NVWA 5GMVA 3RNCC 2KHWB 5HG2A 2KQ4X 1NYRA 2FUHB 1K8RB 1FPYA 4DXGA 1JMLA 1YN5A 4XE0A 4MM3A 3BYYB 3IFWB 5BMGA 2FCMA 2OHFA 3NS1A 4E71A 3DVNU 3QJZA 2WXQA 3RZFA 3T8MA 1F9JA 1VZ8A 3PGEA 1FFVA 2KMCA 4JGHB 1ET6A 4GSWA 3Q8BA 1VZ7A 2GOWA 1E6EB 1UUPA 2ZCCA 2BW2A 1B1ZA 2JXTA 2PJHA 2KJHB 4K3BA 4KZCA 1I4GA 5IAAC 3QWZB 3ONSA 1C76A 3RNBC 1AWDA 2GMIC 3AE9B 2JU6X 2L52A 3VRAB 2YLMA 3IAS1 1C77A 2CU3A 3RCZA 1VJKA 4OW0A 2ZVNA 3Q6BA 4KV2A 2LGDA 4ITKA 4KGTA 4L2YA 1ZKHA 2AEHA 4EFOA 4XDCA 1FRRA 3M3JA 3A1QA 3WAOA 2WX1A 3HRDD 4NZLB 1EU4A 2LD9A 3VH3B 2WXMA 4MGYE 2Y5BB 2J42A 3AV8A 3LYYA 4BOZB 2G4SA 4K81A 1V9JA 2KDFB 3C8YA 4JWSC 1XQQA 4FULA 3LB8C 1C1YB 4GDKA 1NI3A 3TJPA 3AE4B 1OEYJ 4NPNA 3D32A 1UWXA 5DPRA 1E8WA 1N60A 2J4XA 2M1MA 2BWES 4URKA 2QHOA 2XK5B 1MVKA 5DCNA 1MG4A 1JQ4A 2KO3A 3NVZA 1FNUA 2L0TA 1WJ6A 3H6NA 2RDGA 3B2GA 3RN9C 4K1RB 3AH7A 3M95A 2C9WB 2HD5B 3RNGC 3NVVA 2YEPF 4MDKE 1WXAA 1FO4A 5BO4B 3RNAC 2KMMA 3OLMD 3RYTA 4RGMA 2LUMA 1NENB 3B0AA 5BYSA 3ZXRA 1SIFA 3MTNB 1C9FA 5BYQA 2RDHA 3FILA 3UINB 3Q3OC 2G45B 2WXJA 2K22A 2HJ1A 4LJPB 2BQQA 2WHIA 5LNK1 1CK1A 5JZEB 4F8CB 1TS4A 2VRRB 3KUZA 2DAJA 1LO5D 1M4VA 3DOWA 2JVCA 2MBEA 4A3PA 2N1VA 4TSSA 1SE4A 3DBHI 1OGWA 4B9KA 5AEKB 1I4QA 4LTUA 3KVFB 4AWJA 2XNAC 3J9CA 1V80A 3TL5A 5JHAA 4JQWC 1Q1OA 3TUOA 2QCZA 2UU7A 1SE9A 1RFKA 4NAWA 5EDSA 2PE6B 1BXTA 2AQ2B 4IDIA 1ZE3D 3MC8A 2IZVB 3N20C 3WALA 4FA6A 1KLGD 1E90A 3AECB 4NJ6A 4HKZE 2NVUI 1DOXA 2NBWB 3O65B 1TY0A 1FEHA 3VAWA 3Q2AC 2KFKA 2VZKB 1ZOYB 5G55A 2MWSB 2QDFA 3A9KB 1ZW7A 2WXPA 5FR6A 1WR6E 3ZGZA 1FRDA 1OEYA 4RCOA 4W9KA 2CKHB 1FXIA 4EEWA 2O6VD 2NMQA 2L32A 3AEDB 4E3CA 2BB6A 2M56B 2V4IB 1ROEA 4EOYA 4J3OD 2LVQA 2O2VA 1H8CA 2LUEA 4ZRJA 3VUYA 4EKUA 1MJDA 1SXTA 3EGRA 3NVYA 2BKRB 2IGDA 2FE8A 4XGAB 3DBRI 4ANXA 2WX0A 4ICUA 1T0SC 3AU5A 4PYUA 3MC9A 2NR2A 1KRHA 2DZKA 1TKGA 5L95C 1WX8A 5IA7A 3VUXA 1CQVA 3B1LX 4DK5A 2DYOA 4K7SA 1VZ6A 5FKAC 3V6EB 1QQRA 4PS7A 5IKCM 2HTHA 2EKIA 3PLVA 3R2TA 3QX1A 2JYEA 4HWIB 2IBIB 2LEKA 4DXFA 3JSVB 1IPGA 1XLQA 4IW0A 5IN7A 3IBEA 1LM8B 3P4SB 4PK1A 3PZDA 1KTKA 3HVDA 1FMAD 4IC7B 1E7UA 3AE1B 4II3B 3Q8EA 3Q8AA 4FLHA 2QEJC 4IWQA 2MRPA 4B6WA 3IHPC 4MJSB 5LXHA 1R7SA 3KWVA 5HHDG 1V1PA 5J2RA 2JXXA 1GG3A 3E56A 4ZHPA 3A4RA 3TEXA 1NI2A 2MJ3A 2KTRA 1GNUA 4A55A 3W1YA 4WURA 2PIAA 1DYQA 3ZNZB 1HTQA 3DHIC 2KJRA 2JF5A 4LDTD 1JRUA 1BMLC 2LVPA 3R3MA 3V3XA 1T0QC 2BT6A 4BBNC 2CS4A 2KLGA 5DPTA 2ZEQA 2L8JA 2I1KA 3TMPB 5LLIA 1MI0A 2D3BA 4H2AA 3ETRA 4P16A 4W9DA 3NZSA 3DVGY 2KACA 2IYDB 2NS5A 2WNMA 4HRSA 1ZDVA 4RGOS 4A8XC 4I6PA 3CWIA 1KJTA 1D3ZA 2HJ8A 1YJIA 2NPTB 2ONQA 2ZW1A 1UELA 2WXRA 1C4PA 2K6DB 2DZIA 2BB5A 3L0WB 2W3RA 3ZDMC 1KH0A 1V5TA 4ARCA 5E6PA 2KJ6A 3WCQA 1YJJA 4WJQA 3ML8A 4MH8A 1EU3A 3U7DA 4YT0B 4HCPB 3AEEB 3JVZX 3BY4B 1YMHE 1WXMA 2NBVB 3CF6E 3ABVB 3PRPB 3VR8B 5BMHA 1GC7A 2AQ3B 4CHKA 4OVZA 4IKGA 4AJYB 1WGHA 4B0MA 2SAKA 1J8CA 2QC8A 4PYZA 2Y5CA 4D2KA 4M00A 3RFZB 1WMHB 1PFDA 1AARA 1IGCA 2WXFA 1N5WA 2UWQA 2PTLA 3PPAA 2MBOA 1DOIA 4FHJA 2Z59B 3L16A 4HVBA 1PDXA 5DPWA 1B9RA 5I4DA 3TBLD 3KWLA 2CJOA 2GBRA 3MJWA 3VVWB 1I4RA 2A4ZA 4K7WA 1ZXIA 1M94A 3CIRB 1KFYB 3NG0A 1V1OA 3CSTA 2KNBA 5AZGA 4E74A 1TS5A 1WGGA 1F77A 2OJWA 4C7ZA 2D07B 2KD0A 1QT9A 3MHSD 2ZJDA 2WYQA 3DBHB 1EWCA 3BIID 1LXDA 1WY8A 4WJPA 1UGMA 2J7QB 2MEKA 2MBHA 4HDQA 5CTRC 5BYRA 1N63A 4DBGA 5GXGB 3ENEA 4L1BA 4ANWA 2LGXA 1Y56A 2KK8A 4QAYA 2R2QA 3H8HA 2AWTA 2GRIA 3KH0A 2WDTB 5MPOA 3AULA 4EUTA 3HVZA 5D2MB 2DAFA 2W82A 3UQAA 2EMSA 1VRAB 2K25A 3Q3NC 1IBXB 4OZAA 3PHXB 4CQNA 1N5XA 3ZVVA 2ZW0A 2EMTA 2WU5B 4LLGM 4N58A 1WH3A 2M0XA 4GLSC 2WXGA 1YJ1A 2Z8LA 1UD7A 3QAQA 4YXDB 1JWBD 2WQYB 1HTOA 3KUDB 2KFJA 2NBUA 1CMXB 3R7RA 1L0VB 3KYDD 1WF9A 1KM7A 3ALBA 2X8XX 1DOYA 1FXAA 2KQSA 4XC2A 2DZMA 2KVRA 1ESFA 5J17A 1C79A 4YTNB 2LI5A 2IDYA 2E6XA 1WIAA 1UF0A 2CJNA 1UZXB 1BT0A 4F7ZA 1G6JA 4P7IA 1YX5B 2KVZA 3WIMA 4A9AA 3P4PB 1RWSA 1WRDB 5D7GA 3DBRB 2C7HA 1SJED 2RDBC 2SEBD 4IG7B 2CHXA 3A9JA 4RF1A 4C4VB 2C60A 4GXBA 2LHEA 1H4RA 5D94A 1HZ6A 1E9MA 2W54A 1TKYA 1ISNA 3N3KB 1HEZE 2R2OA 1FFUA 4II2B 1V86A 3UF8A 1K52A 3SHQA 5JHBA 1E8ZA 3APFA 4P1CC 2VH2A 2E3TA 3LJ3A 3ZJUA 4LCDE 1PGBA 2RPVA 3DBLB 2ASQA 3APCA 3A9KA 2MP2B 1WM2A 2IO0B 4RFBA 5H92C 3AE6B 1A5RA 2N9KA 1PQSA 3Q8CA 3TEYA 3P4QB 4ANVA 4OVUA 2WP9B 1UH6A 2IJ0A 3Q3FA 2H89B 4FHKA 1DGJA 2J0MA 2KMAA 3PRZA 4KGSA 2L0FA 4RMAA 2AL6A 1T3QA 2VH1A 3N30A 3FAHA 3P4RB 2D5GA 2QMTA 2BS4B 2C7NB 4FN2A 3QHTA 1E10A 2D10A 1E7PB 3K9PB 1J7BA 4ZHOA 1XLNA 2LXAA 4MSMB 3CSFA 3U8ZA 2N0SB 1AW7A 2BS3B 3P42A 5AUKA 1SF0A 1XCQL 1L4DB 1MPEA 4HLEA 3MFGA 4YL8A 1GB4A 1XO3A 1E0ZA 5D3DA 3GS2A 5TR5A 3TSSA 1WXQA 4DDID 1WE6A 4JWUC 5E6OA 2JYTA 2PMVA 2G3QB 4N6EB 5HI1A 1F52A 2N9EB 2IGGA 4AQ7A 2BS2B 1P98A 4LNOA 3JSVA 3EECA 1SE3A 2WXIA 1K53A 1T5XD 4W9FA 1SIJA 2WXOA 2KLCA 4G0NB 4JPSA 2D3AA 3ZDTA 2N7DA 1D6EC 3QQ8B 4W9GA 1ZUD2 1FNWA 2ICIA 4MGIE 1TJEA 3HHMA 2AQ1B 4CYEA 3NZ3A 1E7VA 1ZGUB 2FBWB 2INPE 3EHVA 1YX6B 3KYCD 1T0YA 1XF5L 1S3SG 1ET9A 3EC8A 4KIKA 1V81A 2BYVE 5L83A 2J0KA 5C2TB 3PVLA 2ACZB 2B3AA 2BGFA 3E9SA 2LRUA 1XLPA 4L23A 2N7EA 4NY0A 1HQRD 2K8HA 3MJ5A 1EWYC 1QZEA 2GBJA 3TEWA 3ZIMA 4ANUA 2N9PC 3AMZA 2FIFA 1WM3A 4DDGD 4DHJB 1SSNA 1Z5SB 1RFAA 2ZPYA 1Y8RC 4GIVA 3LDZE 2UYZB 1P3QU 3BWUD 2WGSA 1Q0WB 2LJIA 3I3TB 1JROA 3A1QB 3AU4A 4JLCA 1PUTA 1WJ4A 3IT6B 4OZCA 5JH5C 4US8A 4LNNA 4M8MA 1Q10A 4I6NB 2PEAA 4MGKE 2MX2A 3UGBB 5HFYA 3R66C 4GDKB 3V05A 2M8SA 2KOXA 2MHJA 4IUMB 2DZJA 4KKJA 2IO2B 2K39A 1QOBA 1TBEA 1V5OA 2W9NA 2KAJA 1XEEA 4M0WA 1RRBA 1JWSD 1QF6A 1P7EA 1C78A 4ZYNA 3W9CB 5AZHA 1FCLA 1YQBA 3DBLI 2MBQA 3L54A 3OWEB 4IM3A 3EFCA 4K3CA 2EELA 1ZDXA 3RI7C 3QK0A 4MELA 2N1WA 2ZZPB 4GDLA 1KOTA 2QSDA 4DQOC 2L00B 2KN5A 4RM8A 3U2SC 1OTRB 4XYCA 3T3NA 2GB1A 2ZVOA 5IOIA 1T0RC 3NHEB 1MFWA 4OZBA 3FILB 4KKIA 4W9IA 5FR3A 2G9HD 3T3OA 5FK9C 2WXHA 1WJUA 3U30A 4MACA 2PVOD 3Q3JA 4XDDA 1ZXHA 3IAM1 3L4PA 4WWNA 4M8NA 3V62A 2J53A 4ZRKA 2K8BA 2KWDA 2N9LA 4FBJB 2C5LC 4HROA 4HK2A 3Q14C 2I38A 2JWUA 1YD8U 1X1MA 4HJGE 3L13A 4W9LA 4MH0E 2YVCA 4IWOA 2B76B 3ZUNA 2WU2B 2Z0DB 1D5ZC 1LGRA 2DBYA 4NAWB 2K5PA 3VHTC 3N9YC 3N1YC 5G2NA 1U4AA 1V8CA 3ZXVA 3AN1A 2K3UA 4B95A 4G11A 4UDUC 4KX6B 3AEAB 2JUOA 2KX3A 3X0WA 4MSQB 4DXAB 3AE7B 4FJZA 2WDRB 3A33B 4MGZE 4BKSD 2KFKB 3NOBA 1QOAA 1OQRA 3U52E 4YSYB 4GMVA 5BMIA 1TZ1A 2JZ3B 3AEBB 4M01A 1L0XB 2LRWA 1GC6A 1QOFA 1GPXA 3RPFC 4BAXA 4N9F4 5CHWA 4YSZB 4KGRA 1V6EA 4YSXB 4BBNF 1R4MI 2O2VB 3AE2B 3HUIA 1J0GA 1RM6C 3R2IA 3R8BA 3RMKC 3L08A 4LNFA 3M62B 1T6BX 3UIPB 1VLBA 3DHHC 1WSPA 3CMMB 2VZKD 3R7QA 3AE8B 4TKNA 4LNIA 3ZKJC 4KVGB 4FJVB 2IPKD 3PS6A 1OQQA 2KWCA 4IM2A 1SJHD 3H7PB 1PGAA 2MLBA 5IP4D 3QCAA 4KDLB 2ZPNA 5EE0A 1HXYD 2JSVX 2V3PA 4MEMA 3ZQ4A 1FM0D 4EZLA 3BK2A 1NBFC 1R4NI 3EA6A 1E8XA 3AEGB 2M0AA 3BK1A 3B08A 3GB1A 1JWMD 2G4DB 4HPMB 4RGNA 3W1SC 1WWTA 1XCTL 2K0PA 4BKGA 5IO9A 1J19A 1SBBB 3TEZA 1D5MC 2IO1B 1ACCA 4GOCA 4PS8A 3O13A 3W5VB 3PLUA 3GP7A 1HE8A 1V1PB 3VRBB 3AB5A 2JWZA 1TKEA 4NAMA 4J6IA 4KSKC 1GOZA 4DHZB 1TT5B 2FAZA 4RNAA 4ZDVA 2MJDA 4HDOA 1AYFA 4OVVA 1EO6A 4TQ1A 1ZPSA 2K6QA 2KTRB 2L83A 4TUUA 1E8YA 1I4XA 3VTVA 1NVID 5TSSA 2MQJA 4C00A 1OQYA 3SFEB 1KLVA 3K9OB 2KTFA 2XK5A 1D5XC 2Y3AA 2MA9B 1D4BA 2M19A 1TGZB 3URYA 1JALA 4S17A 3ZYYX 1WGYA 1XXGA 3B2FA 4O1NA 1HA5A 4WQOB 3QIJA 4FADA 1WGKA 3NS8A 4BOSC 3EFUA 1LQBA 2LHDA 2FIDA 2BYFA 5CHVC 4AP4C 3NJTA 5CHFA 3U7ZA 1L5PA 2BWFA 4HXDA 4NJCA 3W2DA 3PHWB 3SD5A 3SU8X 2OJRA 4GGQA 4BFRA 2ON8A 1KLUD 2JZZA 1WI0A 2BYEA 5LXIB 4AJWA 2XEWA 2LASA 3RD2A 2OEDA 5EE3A 2JT4B 2QILA 3APDA 4AUQC 2DLBA 1JWUD 3ZRCA 2BTEA 1JWAD 3SEBA 3ZNID 1WXSA 3TIXA 1UBQA 4B0EA 1K50A 2W3SA 2IY0B 3I57A 4BKSA 3X23A 4HPPA 1SB3C 3PZ8A 3HK0A 3DPDA 1L6VA 1SGHA 2NTSA 2V3SA 4KSLC 1UGJA 3GZNI 2BKFA 2GLSA 2N7JA 2QIEB 1N62A 3SDLC 3ZNHB 2O6VB 3OAWA 4XWWA 3H9DA 3JYUA 2PW9A 4A6QA 1GJZA 4W9JA 2IY1B 2WDVB 4ACFA 2WXLA 1LFDA 3VH4B 1QKZA 2RR9A 5H8YE 1YQ3B 3N32A 5HKHA 3I9V1 1SEBD 2D3CA 4WJNA 4TQ0A 1UWMA 2D3GA 3UQBA 4KDIC 2KXJA 2D11A 1F2RI 1XT9B 1JCKB 3MC0B 2PE9A 2V4LA 4BZAA 3V60A 2IO3B 1WX7A 4R3DA 3V6CB 1L6UA 3HM6X 3DBSA 4A3OA 4YTMB 3IG3A 1WE7A 2PKOA 2HE7A 4RH6A 5CX3A 2JRIB 3LXFA 2V3NA 2K1FA 2LGSA 1I4HA 2MW5A 3ML9A 2K8CA 1XD3B 1QILA 2WXNA 3U4EG 4HKQA 4ZRIA 2N4FA 2GBKA 3HIZA 3BINA 1PYWD 4ZRQA 3V61A 4GN1A 3GE8C 3ZLZA 4A90A 3BVMA 2L1AA 1GB1A 2G1EA 2EKEC 2KX0A 2DYBA 4I6LB 1FIQA 2W55A 5DPSA 1WX9A 1C4AA 2KDIA 1TZOA 2JQRB 3S2AA 1QLBB 2GBNA 3PZ7A 5EE1A 1CJEA 4LDTB 1WR1A 1AN8A 1WGRA 5C3JB 4C80A 4AS1A 3BYTB 1JRPA 3ZO5B 4MM3B 4MJSA 5E6JA 3KW5B 2MCNB 4P1BC 4N59A 2C7MB 2IGHA 3ZNGC 2RPQA 2PVGC 4WH4A 1YNTE 1GAQB 1RAXA 4WQMA 2WLBA 1R4MB 2YEPB 1V49A 1C4CA 4IOIE 2INNE 3VDZA 2BVCA 2J52A 2LXCA 4MT5A 1RLFA 1P1AA 4ZYSA 2RD0A 3A9JB 1Z2MA 1WRIA 3FC4A 2Z0EB 1WJNA 4WWMA 1J7AA 2FCQA 2WXKA 4FXCA 3ZRFA 2JX5A 3L17A 3DDCB 1IP9A 2A5UA 2MBBB 4IWPA 2KT7A 2AX5A 1WFYA 1FNVA 2KDBA 3RUIB 4WAFA 1NEKB 3QARA 1QOGA 3ZW3A 1I7HA 2DWQA 4BKTA 2NPTA 5EE9A 3AI5A 4XWTA 3T9LA 3MHZA 2Q5WD 2KKCA 3H7SA 1IYFA 2KN4A 2KANA 1R4NB 3SR6A 4Q2JA 3ZJVA 4ZRPA 2BYTA 5T8IA 3GE3C 2QJLA 3PRMB 2J0JA 1EF1A 4S0RA 1K51A 2JPHA 4RGTA 3Q3MC 2V0GA 2JY6A 1V97A 1VD2A 3IVFA 2Y5PA 2XBBC 2MJEA 1TS2A 2LVOA 3RNEC 1S1QB 3B9JA 3VR9B 1I35A 3AE5B 2BBCA 3RT3B 3ECIA 3ZTDA 1CZPA 2AL3A 1EUVB 1SE2A 1Q5WB 2MSED 2FCSA 3AEFB 2FCNA 3BVGA 4YWGG 1FCCC 1C3TA 4HCNB 3I63C 4W9EA 4NNJB 2I1JA 2R61A 3WANA 2L76A 2DENB 3JW0X 5C23A 2V9HA 2PPHA 1E5WA 2XN9C 2D2QA 3H7PA 4K7UA 1L4ZB 2CHZA 2LFIA 3AXCA 2INCC 1WMHA 3PV1A 2WS3B 3C0RB 3H1UA 1L2NA 1MG8A 1IUEA 1XLOA 2L05A 4P6VF 2KDEB 4NJ7A 3VQIA 5KHOA 4JE3B 3NUHB 3AM9A 2KC1A 3P1MA 4RF0A 2TSSA 1F2RC 2KC2A 4A20A 1P9DU 2CHWA 2LMCA 3KLSX 4ICVA 1YN4A 3Q8FA 2L3ZA 1UBIA 1P7FA 3IT4B 4NQKE 1WZ0A 3ZTCA 3L10B 4W9CA 3DHGC 2DX5B 3PTFC 4WAAA 2NTTA 2WDQB 4F1SA 3HM3A 1TTNA 2ZCBA 3WAPA 4KIKB 1IGDA 2WWZA 2LWPA 1L7YA 3VTWA 3ZJTA 3EUB2 2JZPA 1F1HA 3OJ4B 3DQVA 3DWGC 4USAA 3I5JC 4NQLB 4LJOB 1MHXA 4XX5A 4EE2A 4JL9A 4EZKA 3OG5A 1KF6B 5J18A 2LGYA 3GZNB 1N6ZA 4WWOA 3SFDB 3FKYA 1ENFA 4C56C 4PS3A 1YQ4B 4OHJA 3VTUA 1UNSA 3RULA 1TY2A 2RMMA 2FNJB 1IBXA 4REZA 1WZ3A 1JW9D 2DYMA 1N61A 1P0RA 3TCAA 4TMAB 3PT2B 4US9A 2DNFA 4FJYA 1GUAB 2KZRA 3OJ3A 3DWMA 1WXVA 3W1SA 4KZ0A 4W9HA 2K9XA 3QA8A 4DHJD 4ZOHC 4DHZE 3N1ZC 2KYWA 4EZJA 2DHZA 3QC8B 1A70A 1EF5A 2PLPA 4HJKA 1ZP0B 4HPLB 5C1ZA
chains in the Genus database with same CATH topology
1QQRA 2OEDA 3W5UB 5EE3A 1SE3A 2QILA 1K53A 2WXIA 1T5XD 2EKIA 2DLBA 1JWUD 3R2TA 2BTEA 1JWAD 4YTPB 3SEBA 1SIJA 1RYJA 2WXOA 2JYEA 4B0EA 2LEKA 4DXFA 1FD6A 1K50A 4JPSA 2W3SA 4C7YA 1D6EC 1XLQA 5G5GA 1F0ZA 4ARIA 3P63A 3I57A 2KDMA 1ZUD2 1FNWA 2ICIA 3P4SB 1KTKA 1TJEA 5JXVA 3HVDA 1FMAD 1SB3C 2AQ1B 3PZ8A 5D3IB 3AE1B 3AE3B 3NZ3A 1L6VA 2FBWB 3Q8EA 1TYGB 2INPE 3Q8AA 3BVZA 3UI3A 4GDLB 2QEJC 1J7CA 2NTSA 1UGJA 2N7JA 2QIEB 3KQ4A 1N62A 3IXSA 2X38A 1XF5L 1VDVA 1R7SA 3KWVA 1ET9A 4XWWA 2PW9A 5HHDG 1V1PA 1WYGA 4A6QA 5G5HA 2MH7A 2WDVB 1NYQA 4HEA1 5C2TB 3E56A 2WXLA 5AUIA 1PGXA 2ACZB 4ZHPA 1L0YB 1QKZA 5H8YE 3E9SA 1YQ3B 3MP9A 3NRZA 3TEXA 1XLPA 4JX1C 2MJ3A 4L23A 3I9V1 1SEBD 1I4PA 4A55A 4WURA 2PIAA 1HQRD 1DYQA 3MJ5A 1EWYC 3TEWA 1BMLC 4TQ0A 1MHHE 3AMZA 1UWMA 1BUIC 1F2RI 1SSNA 3V3XA 1JCKB 3PO0A 3MC0B 2BT6A 1STEA 2FUG1 4R3DA 1L6UA 3BWUD 1MI0A 4H2AA 2LJIA 3ETRA 4P16A 1JROA 1EM7A 1PUTA 2KACA 1YN3A 1TS3A 1OFFA 3IT6B 2WNMA 4OZCA 4HRSA 4YTMB 1ZDVA 4US8A 1VR9A 2PKOA 4RGOS 4WIPA 4A8XC 4RH6A 3CWIA 2I2YA 1YJIA 3LXFA 2ONQA 2V3NA 1Q10A 2ZW1A 2LGIA 1I4HA 2WXRA 4PT5A 4LK0M 1C4PA 1QILA 2WXNA 5HFYA 4GDKB 2BB5A 3U4EG 3V05A 4HKQA 2W3RA 1KH0A 4KKJA 4ARCA 1PYWD 3WCQA 1QOBA 1YJJA 4ZRQA 3Q69A 2HDEA 4MH8A 2KAJA 4A90A 1HZ5A 1EU3A 3BVMA 1XEEA 2HTME 2L1AA 1GB1A 3BZDB 2G1EA 2H88B 4M0WA 4YT0B 1FIQA 2GI9A 3AEEB 3NVWA 1JWSD 1QF6A 1P7EA 1C78A 2W55A 5HG2A 3W9CB 1C4AA 2KQ4X 1TZOA 2JQRB 1NYRA 1QLBB 3PZ7A 4DXGA 1JMLA 1YN5A 1FCLA 4XE0A 5EE1A 1YMHE 1CJEA 3OWEB 3ABVB 2EELA 1ZDXA 3VR8B 3BYYB 1AN8A 5C3JB 4AS1A 5BMGA 2QSDA 2OHFA 3NS1A 3BYTB 4C80A 4DQOC 1JRPA 5BMHA 3U2SC 2WXQA 4MM3B 3T3NA 5E6JA 2AQ3B 1VZ8A 2GB1A 4IKGA 1FFVA 4OVZA 1ET6A 4B0MA 4N59A 2SAKA 4OZBA 3FILB 4KKIA 3Q8BA 5FR3A 2G9HD 2IGHA 1VZ7A 1E6EB 1UUPA 2Y5CA 3T3OA 4D2KA 2PVGC 4WH4A 2BW2A 5FK9C 1B1ZA 2WXHA 1YNTE 2JXTA 3RFZB 1GAQB 4MACA 2PVOD 1PFDA 1IGCA 4XDDA 1I4GA 1ZXHA 1N5WA 2WXFA 3IAM1 3L4PA 2PTLA 1C76A 4WQMA 2WLBA 1DOIA 2YEPB 1AWDA 1C4CA 3AE9B 1PDXA 2INNE 2JU6X 4IOIE 1B9RA 2J53A 5I4DA 2L52A 3VRAB 2J52A 3IAS1 2KWDA 2N9LA 3KWLA 1C77A 2CU3A 2CJOA 4MT5A 1VJKA 4OW0A 4ZYSA 4HROA 1I4RA 2I38A 2JWUA 1WRIA 1ZXIA 4HJGE 3CIRB 3FC4A 1KFYB 2B76B 4WWMA 2WU2B 1V1OA 4ITKA 1D5ZC 1J7AA 4KGTA 1TS5A 4L2YA 1F77A 2WXKA 2DBYA 4FXCA 4NAWB 4C7ZA 2K5PA 4XDCA 2JX5A 1FRRA 3HRDD 4NZLB 1EU4A 1QT9A 2WXMA 3N9YC 2AX5A 1FNVA 2J42A 3AV8A 3LYYA 4WAFA 1NEKB 1QOGA 1EWCA 1I7HA 1V8CA 2DWQA 5EE9A 4XWTA 3BIID 3AN1A 2K3UA 3MHZA 3C8YA 2Q5WD 4UDUC 4KX6B 4JWSC 3AEAB 2KN4A 2MEKA 5BYRA 3LB8C 3SR6A 4Q2JA 1N63A 1NI3A 4ZRPA 5GXGB 3AE7B 2BYTA 2WDRB 5T8IA 2QJLA 3ZJVA 3AE4B 4L1BA 1QOAA 1UWXA 1OQRA 3U52E 4YSYB 1K51A 1N60A 1Y56A 4RGTA 5BMIA 2J4XA 2V0GA 3H8HA 1V97A 2GRIA 3AEBB 1L0XB 1QOFA 5MPOA 1GPXA 3RPFC 1MVKA 2Y5PA 3HVZA 1JQ4A 2MJEA 1TS2A 4YSZB 3NVZA 4KGRA 1FNUA 2W82A 3B9JA 3VR9B 2RDGA 3B2GA 1VRAB 3AE5B 4YSXB 2BBCA 1IBXB 3AH7A 4OZAA 4CQNA 1CZPA 1N5XA 1SE2A 3AE2B 3NVVA 2YEPF 2ZW0A 3HUIA 1RM6C 3R2IA 2WU5B 3AEFB 4LLGM 4N58A 1FO4A 4GLSC 2WXGA 3R8BA 2Z8LA 3BVGA 4YWGG 1FCCC 1T6BX 1VLBA 4YXDB 1WSPA 1JWBD 2WQYB 2KMMA 2VZKD 4RGMA 2LUMA 1NENB 2R61A 5BYSA 3AE8B 1L0VB 1C9FA 5BYQA 2RDHA 3FILA 2XN9C 1DOYA 1FXAA 2WXJA 2K22A 1L4ZB 2IPKD 1CK1A 2LFIA 5LNK1 1ESFA 1TS4A 1OQQA 2WS3B 1C79A 4YTNB 1LO5D 1M4VA 1IUEA 2IDYA 1SJHD 1XLOA 2E6XA 1PGAA 4TSSA 1SE4A 4P6VF 2CJNA 3VQIA 4JE3B 3NUHB 3AM9A 1I4QA 4LTUA 3P1MA 4RF0A 5EE0A 4A9AA 3P4PB 1HXYD 2JSVX 2TSSA 2V3PA 3ZQ4A 1FM0D 1F2RC 2XNAC 1RWSA 3J9CA 5D7GA 3BK2A 3EA6A 1SJED 3AEGB 2SEBD 2LMCA 2M0AA 3BK1A 3KLSX 4RF1A 3GB1A 1JWMD 1YN4A 3Q8FA 4RGNA 2LHEA 1WWTA 1HZ6A 1E9MA 1XCTL 2K0PA 2W54A 1TKYA 1P7FA 3IT4B 1SBBB 3TUOA 3TEZA 1HEZE 1D5MC 1FFUA 1RFKA 1ACCA 2NTTA 2WDQB 1BXTA 3O13A 2AQ2B 3W5VB 4IDIA 3GP7A 1K52A 1ZE3D 1IGDA 1V1PB 3VRBB 3AB5A 1TKEA 4NAMA 2E3TA 1GOZA 3ZJTA 3ZJUA 3EUB2 2JZPA 1PGBA 4RNAA 2RPVA 1KLGD 2MJDA 3DWGC 3AECB 1AYFA 4USAA 4HKZE 4TQ1A 1DOXA 1ZPSA 4RFBA 1TY0A 5H92C 1FEHA 2L83A 3AE6B 2N9KA 3Q8CA 3TEYA 2VZKB 1ZOYB 1MHXA 1I4XA 3P4QB 2WP9B 4EE2A 1NVID 5TSSA 2IJ0A 2H89B 3SFEB 1KF6B 2WXPA 1DGJA 4KGSA 3ZGZA 1FRDA 4RCOA 1T3QA 1FXIA 3FAHA 1D5XC 2Y3AA 3SFDB 3P4RB 2D5GA 2QMTA 1D4BA 2BS4B 2M19A 3URYA 1JALA 1ENFA 4C56C 1YQ4B 3ZYYX 1E10A 1XXGA 2NMQA 1E7PB 2L32A 1UNSA 3AEDB 3B2FA 4OHJA 1J7BA 4ZHOA 2BB6A 2M56B 1HA5A 1XLNA 1TY2A 2V4IB 4O1NA 2RMMA 1IBXA 4REZA 1ROEA 1WGKA 4J3OD 1JW9D 2DYMA 2LHDA 2N0SB 1AW7A 2BS3B 1N61A 3P42A 1SXTA 3EGRA 3NVYA 5AUKA 2IGDA 2FE8A 1SF0A 1XCQL 1L4DB 1MPEA 3U7ZA 1L5PA 4TMAB 4US9A 3MFGA 1GB4A 1XO3A 1E0ZA 5D3DA 3GS2A 3DWMA 1KRHA 3TSSA 4NJCA 3W2DA 1TKGA 3W1SA 1WXQA 4JWUC 2K9XA 2JYTA 2ON8A 1CQVA 1KLUD 2PMVA 4N6EB 5HI1A 4ZOHC 2DYOA 2IGGA 1VZ6A 4AQ7A 1A70A 2BS2B 2PLPA 1ZP0B 5FKAC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2OED A;  5HFY A;  1K53 A;  3GB1 A;  2LHE A;  1HZ6 A;  1XCT L;  2K0P A;  1P7F A;  1KH0 A;  1FD6 A;  1HEZ E;  1K50 A;  2KDM A;  2KN4 A;  5JXV A;  1HZ5 A;  1K52 A;  1IGD A;  1GB1 A;  2GI9 A;  3UI3 A;  1UWX A;  1P7E A;  2JZP A;  1K51 A;  1PGB A;  5HG2 A;  2RPV A;  5BMI A;  2KQ4 X;  2N7J A;  1XF5 L;  1FCL A;  1JML A;  4HKZ E;  1YMH E;  1MVK A;  2PW9 A;  5HHD G;  2N9K A;  2EEL A;  4KGR A;  1MHX A;  5BMG A;  2QSD A;  5BMH A;  1PGX A;  1QKZ A;  4KGS A;  3MP9 A;  1IBX B;  2GB1 A;  4IKG A;  4OZA A;  4OZB A;  3FIL B;  2IGH A;  2ZW0 A;  2QMT A;  1D4B A;  4D2K A;  4WH4 A;  4GLS C;  1YNT E;  1FCC C;  2JXT A;  2NMQ A;  1MHH E;  4MAC A;  1IGC A;  2LUM A;  1ZXH A;  2RMM A;  1IBX A;  1F2R I;  1Q10 A;  2PTL A;  3V3X A;  1C9F A;  2LHD A;  3FIL A;  4IOI E;  2JU6 X;  2IGD A;  2J53 A;  1XCQ L;  1MPE A;  2J52 A;  2KWD A;  1MI0 A;  2N9L A;  1GB4 A;  1EM7 A;  2KAC A;  1PGA A;  2I38 A;  2JWU A;  4OZC A;  4HJG E;  2PLP A;  2ON8 A;  5HI1 A;  4KGT A;  2I2Y A;  2IGG A;  2JSV X;  2ONQ A;  2ZW1 A;  1F2R C;  2LGI A; 
#chains in the Genus database with same CATH topology
 2N9X A;  3W5U B;  1YIW A;  4DWF A;  4G3X B;  4M0W B;  4YTP B;  1RYJ A;  2KQ7 A;  5D6J B;  4BVU C;  4RM9 A;  1FD6 A;  5AZF A;  3VXW A;  4C7Y A;  2LJ5 A;  5G5G A;  1F0Z A;  4ARI A;  3P63 A;  2KDM A;  3N1X C;  4XZ4 A;  3DVN V;  5JXV A;  4C4V A;  5D3I B;  3AE3 B;  3NZU A;  5E6N A;  3PSE B;  4G50 A;  1TYG B;  4WWP A;  3BVZ A;  3UI3 A;  4GDL B;  4WJO A;  2O6V A;  3WAM A;  1J7C A;  1WYW B;  4TV3 A;  2RSU A;  2L7R A;  3DCG A;  3KQ4 A;  3UIO B;  3IXS A;  1TIF A;  2X38 A;  3RZW C;  2ZNV C;  1VDV A;  2V1Y A;  1I42 A;  2IND C;  1WYG A;  4GU2 A;  4CO7 A;  5G5H A;  2MH7 A;  2KWV B;  1NYQ A;  4HEA 1;  2KWU B;  3P2B A;  1WGD A;  5AUI A;  1PGX A;  3VUW A;  1L0Y B;  4LNK A;  3MP9 A;  3NRZ A;  5KHQ A;  4JX1 C;  2MP2 A;  1I4P A;  2CU1 A;  4ASW C;  2M4N A;  1V2Y A;  1MHH E;  3A4S C;  1BUI C;  3DVG X;  2LZ6 A;  4IM0 A;  3PO0 A;  2M17 A;  1STE A;  1NDD A;  3KUC B;  3M63 B;  2FUG 1;  3PRE A;  2AYO B;  1EM7 A;  2CR5 A;  4JIO U;  1YN3 A;  4M02 A;  1TS3 A;  1OFF A;  2BPS A;  3VFK A;  1VR9 A;  2GBM A;  4WIP A;  2BF8 B;  2I2Y A;  3C19 A;  1VCB A;  2LGI A;  4AOF A;  4PT5 A;  3RNF C;  4LK0 M;  2REX A;  4GB9 A;  2JRH A;  3NY5 A;  2OOB B;  2RGF A;  3GOE A;  3Q69 A;  4X57 B;  2HDE A;  3WA0 A;  1HZ5 A;  2HTM E;  1YOV B;  3BZD B;  2H88 B;  2NCN A;  2ZNV B;  2GI9 A;  1FXT B;  3NVW A;  5GMV A;  3RNC C;  2KHW B;  5HG2 A;  2KQ4 X;  1NYR A;  2FUH B;  1K8R B;  1FPY A;  4DXG A;  1JML A;  1YN5 A;  4XE0 A;  4MM3 A;  3BYY B;  3IFW B;  5BMG A;  2FCM A;  2OHF A;  3NS1 A;  4E71 A;  3DVN U;  3QJZ A;  2WXQ A;  3RZF A;  3T8M A;  1F9J A;  1VZ8 A;  3PGE A;  1FFV A;  2KMC A;  4JGH B;  1ET6 A;  4GSW A;  3Q8B A;  1VZ7 A;  2GOW A;  1E6E B;  1UUP A;  2ZCC A;  2BW2 A;  1B1Z A;  2JXT A;  2PJH A;  2KJH B;  4K3B A;  4KZC A;  1I4G A;  5IAA C;  3QWZ B;  3ONS A;  1C76 A;  3RNB C;  1AWD A;  2GMI C;  3AE9 B;  2JU6 X;  2L52 A;  3VRA B;  2YLM A;  3IAS 1;  1C77 A;  2CU3 A;  3RCZ A;  1VJK A;  4OW0 A;  2ZVN A;  3Q6B A;  4KV2 A;  2LGD A;  4ITK A;  4KGT A;  4L2Y A;  1ZKH A;  2AEH A;  4EFO A;  4XDC A;  1FRR A;  3M3J A;  3A1Q A;  3WAO A;  2WX1 A;  3HRD D;  4NZL B;  1EU4 A;  2LD9 A;  3VH3 B;  2WXM A;  4MGY E;  2Y5B B;  2J42 A;  3AV8 A;  3LYY A;  4BOZ B;  2G4S A;  4K81 A;  1V9J A;  2KDF B;  3C8Y A;  4JWS C;  1XQQ A;  4FUL A;  3LB8 C;  1C1Y B;  4GDK A;  1NI3 A;  3TJP A;  3AE4 B;  1OEY J;  4NPN A;  3D32 A;  1UWX A;  5DPR A;  1E8W A;  1N60 A;  2J4X A;  2M1M A;  2BWE S;  4URK A;  2QHO A;  2XK5 B;  1MVK A;  5DCN A;  1MG4 A;  1JQ4 A;  2KO3 A;  3NVZ A;  1FNU A;  2L0T A;  1WJ6 A;  3H6N A;  2RDG A;  3B2G A;  3RN9 C;  4K1R B;  3AH7 A;  3M95 A;  2C9W B;  2HD5 B;  3RNG C;  3NVV A;  2YEP F;  4MDK E;  1WXA A;  1FO4 A;  5BO4 B;  3RNA C;  2KMM A;  3OLM D;  3RYT A;  4RGM A;  2LUM A;  1NEN B;  3B0A A;  5BYS A;  3ZXR A;  1SIF A;  3MTN B;  1C9F A;  5BYQ A;  2RDH A;  3FIL A;  3UIN B;  3Q3O C;  2G45 B;  2WXJ A;  2K22 A;  2HJ1 A;  4LJP B;  2BQQ A;  2WHI A;  5LNK 1;  1CK1 A;  5JZE B;  4F8C B;  1TS4 A;  2VRR B;  3KUZ A;  2DAJ A;  1LO5 D;  1M4V A;  3DOW A;  2JVC A;  2MBE A;  4A3P A;  2N1V A;  4TSS A;  1SE4 A;  3DBH I;  1OGW A;  4B9K A;  5AEK B;  1I4Q A;  4LTU A;  3KVF B;  4AWJ A;  2XNA C;  3J9C A;  1V80 A;  3TL5 A;  5JHA A;  4JQW C;  1Q1O A;  3TUO A;  2QCZ A;  2UU7 A;  1SE9 A;  1RFK A;  4NAW A;  5EDS A;  2PE6 B;  1BXT A;  2AQ2 B;  4IDI A;  1ZE3 D;  3MC8 A;  2IZV B;  3N20 C;  3WAL A;  4FA6 A;  1KLG D;  1E90 A;  3AEC B;  4NJ6 A;  4HKZ E;  2NVU I;  1DOX A;  2NBW B;  3O65 B;  1TY0 A;  1FEH A;  3VAW A;  3Q2A C;  2KFK A;  2VZK B;  1ZOY B;  5G55 A;  2MWS B;  2QDF A;  3A9K B;  1ZW7 A;  2WXP A;  5FR6 A;  1WR6 E;  3ZGZ A;  1FRD A;  1OEY A;  4RCO A;  4W9K A;  2CKH B;  1FXI A;  4EEW A;  2O6V D;  2NMQ A;  2L32 A;  3AED B;  4E3C A;  2BB6 A;  2M56 B;  2V4I B;  1ROE A;  4EOY A;  4J3O D;  2LVQ A;  2O2V A;  1H8C A;  2LUE A;  4ZRJ A;  3VUY A;  4EKU A;  1MJD A;  1SXT A;  3EGR A;  3NVY A;  2BKR B;  2IGD A;  2FE8 A;  4XGA B;  3DBR I;  4ANX A;  2WX0 A;  4ICU A;  1T0S C;  3AU5 A;  4PYU A;  3MC9 A;  2NR2 A;  1KRH A;  2DZK A;  1TKG A;  5L95 C;  1WX8 A;  5IA7 A;  3VUX A;  1CQV A;  3B1L X;  4DK5 A;  2DYO A;  4K7S A;  1VZ6 A;  5FKA C;  3V6E B;  1QQR A;  4PS7 A;  5IKC M;  2HTH A;  2EKI A;  3PLV A;  3R2T A;  3QX1 A;  2JYE A;  4HWI B;  2IBI B;  2LEK A;  4DXF A;  3JSV B;  1IPG A;  1XLQ A;  4IW0 A;  5IN7 A;  3IBE A;  1LM8 B;  3P4S B;  4PK1 A;  3PZD A;  1KTK A;  3HVD A;  1FMA D;  4IC7 B;  1E7U A;  3AE1 B;  4II3 B;  3Q8E A;  3Q8A A;  4FLH A;  2QEJ C;  4IWQ A;  2MRP A;  4B6W A;  3IHP C;  4MJS B;  5LXH A;  1R7S A;  3KWV A;  5HHD G;  1V1P A;  5J2R A;  2JXX A;  1GG3 A;  3E56 A;  4ZHP A;  3A4R A;  3TEX A;  1NI2 A;  2MJ3 A;  2KTR A;  1GNU A;  4A55 A;  3W1Y A;  4WUR A;  2PIA A;  1DYQ A;  3ZNZ B;  1HTQ A;  3DHI C;  2KJR A;  2JF5 A;  4LDT D;  1JRU A;  1BML C;  2LVP A;  3R3M A;  3V3X A;  1T0Q C;  2BT6 A;  4BBN C;  2CS4 A;  2KLG A;  5DPT A;  2ZEQ A;  2L8J A;  2I1K A;  3TMP B;  5LLI A;  1MI0 A;  2D3B A;  4H2A A;  3ETR A;  4P16 A;  4W9D A;  3NZS A;  3DVG Y;  2KAC A;  2IYD B;  2NS5 A;  2WNM A;  4HRS A;  1ZDV A;  4RGO S;  4A8X C;  4I6P A;  3CWI A;  1KJT A;  1D3Z A;  2HJ8 A;  1YJI A;  2NPT B;  2ONQ A;  2ZW1 A;  1UEL A;  2WXR A;  1C4P A;  2K6D B;  2DZI A;  2BB5 A;  3L0W B;  2W3R A;  3ZDM C;  1KH0 A;  1V5T A;  4ARC A;  5E6P A;  2KJ6 A;  3WCQ A;  1YJJ A;  4WJQ A;  3ML8 A;  4MH8 A;  1EU3 A;  3U7D A;  4YT0 B;  4HCP B;  3AEE B;  3JVZ X;  3BY4 B;  1YMH E;  1WXM A;  2NBV B;  3CF6 E;  3ABV B;  3PRP B;  3VR8 B;  5BMH A;  1GC7 A;  2AQ3 B;  4CHK A;  4OVZ A;  4IKG A;  4AJY B;  1WGH A;  4B0M A;  2SAK A;  1J8C A;  2QC8 A;  4PYZ A;  2Y5C A;  4D2K A;  4M00 A;  3RFZ B;  1WMH B;  1PFD A;  1AAR A;  1IGC A;  2WXF A;  1N5W A;  2UWQ A;  2PTL A;  3PPA A;  2MBO A;  1DOI A;  4FHJ A;  2Z59 B;  3L16 A;  4HVB A;  1PDX A;  5DPW A;  1B9R A;  5I4D A;  3TBL D;  3KWL A;  2CJO A;  2GBR A;  3MJW A;  3VVW B;  1I4R A;  2A4Z A;  4K7W A;  1ZXI A;  1M94 A;  3CIR B;  1KFY B;  3NG0 A;  1V1O A;  3CST A;  2KNB A;  5AZG A;  4E74 A;  1TS5 A;  1WGG A;  1F77 A;  2OJW A;  4C7Z A;  2D07 B;  2KD0 A;  1QT9 A;  3MHS D;  2ZJD A;  2WYQ A;  3DBH B;  1EWC A;  3BII D;  1LXD A;  1WY8 A;  4WJP A;  1UGM A;  2J7Q B;  2MEK A;  2MBH A;  4HDQ A;  5CTR C;  5BYR A;  1N63 A;  4DBG A;  5GXG B;  3ENE A;  4L1B A;  4ANW A;  2LGX A;  1Y56 A;  2KK8 A;  4QAY A;  2R2Q A;  3H8H A;  2AWT A;  2GRI A;  3KH0 A;  2WDT B;  5MPO A;  3AUL A;  4EUT A;  3HVZ A;  5D2M B;  2DAF A;  2W82 A;  3UQA A;  2EMS A;  1VRA B;  2K25 A;  3Q3N C;  1IBX B;  4OZA A;  3PHX B;  4CQN A;  1N5X A;  3ZVV A;  2ZW0 A;  2EMT A;  2WU5 B;  4LLG M;  4N58 A;  1WH3 A;  2M0X A;  4GLS C;  2WXG A;  1YJ1 A;  2Z8L A;  1UD7 A;  3QAQ A;  4YXD B;  1JWB D;  2WQY B;  1HTO A;  3KUD B;  2KFJ A;  2NBU A;  1CMX B;  3R7R A;  1L0V B;  3KYD D;  1WF9 A;  1KM7 A;  3ALB A;  2X8X X;  1DOY A;  1FXA A;  2KQS A;  4XC2 A;  2DZM A;  2KVR A;  1ESF A;  5J17 A;  1C79 A;  4YTN B;  2LI5 A;  2IDY A;  2E6X A;  1WIA A;  1UF0 A;  2CJN A;  1UZX B;  1BT0 A;  4F7Z A;  1G6J A;  4P7I A;  1YX5 B;  2KVZ A;  3WIM A;  4A9A A;  3P4P B;  1RWS A;  1WRD B;  5D7G A;  3DBR B;  2C7H A;  1SJE D;  2RDB C;  2SEB D;  4IG7 B;  2CHX A;  3A9J A;  4RF1 A;  4C4V B;  2C60 A;  4GXB A;  2LHE A;  1H4R A;  5D94 A;  1HZ6 A;  1E9M A;  2W54 A;  1TKY A;  1ISN A;  3N3K B;  1HEZ E;  2R2O A;  1FFU A;  4II2 B;  1V86 A;  3UF8 A;  1K52 A;  3SHQ A;  5JHB A;  1E8Z A;  3APF A;  4P1C C;  2VH2 A;  2E3T A;  3LJ3 A;  3ZJU A;  4LCD E;  1PGB A;  2RPV A;  3DBL B;  2ASQ A;  3APC A;  3A9K A;  2MP2 B;  1WM2 A;  2IO0 B;  4RFB A;  5H92 C;  3AE6 B;  1A5R A;  2N9K A;  1PQS A;  3Q8C A;  3TEY A;  3P4Q B;  4ANV A;  4OVU A;  2WP9 B;  1UH6 A;  2IJ0 A;  3Q3F A;  2H89 B;  4FHK A;  1DGJ A;  2J0M A;  2KMA A;  3PRZ A;  4KGS A;  2L0F A;  4RMA A;  2AL6 A;  1T3Q A;  2VH1 A;  3N30 A;  3FAH A;  3P4R B;  2D5G A;  2QMT A;  2BS4 B;  2C7N B;  4FN2 A;  3QHT A;  1E10 A;  2D10 A;  1E7P B;  3K9P B;  1J7B A;  4ZHO A;  1XLN A;  2LXA A;  4MSM B;  3CSF A;  3U8Z A;  2N0S B;  1AW7 A;  2BS3 B;  3P42 A;  5AUK A;  1SF0 A;  1XCQ L;  1L4D B;  1MPE A;  4HLE A;  3MFG A;  4YL8 A;  1GB4 A;  1XO3 A;  1E0Z A;  5D3D A;  3GS2 A;  5TR5 A;  3TSS A;  1WXQ A;  4DDI D;  1WE6 A;  4JWU C;  5E6O A;  2JYT A;  2PMV A;  2G3Q B;  4N6E B;  5HI1 A;  1F52 A;  2N9E B;  2IGG A;  4AQ7 A;  2BS2 B;  1P98 A;  4LNO A;  3JSV A;  3EEC A;  1SE3 A;  2WXI A;  1K53 A;  1T5X D;  4W9F A;  1SIJ A;  2WXO A;  2KLC A;  4G0N B;  4JPS A;  2D3A A;  3ZDT A;  2N7D A;  1D6E C;  3QQ8 B;  4W9G A;  1ZUD 2;  1FNW A;  2ICI A;  4MGI E;  1TJE A;  3HHM A;  2AQ1 B;  4CYE A;  3NZ3 A;  1E7V A;  1ZGU B;  2FBW B;  2INP E;  3EHV A;  1YX6 B;  3KYC D;  1T0Y A;  1XF5 L;  1S3S G;  1ET9 A;  3EC8 A;  4KIK A;  1V81 A;  2BYV E;  5L83 A;  2J0K A;  5C2T B;  3PVL A;  2ACZ B;  2B3A A;  2BGF A;  3E9S A;  2LRU A;  1XLP A;  4L23 A;  2N7E A;  4NY0 A;  1HQR D;  2K8H A;  3MJ5 A;  1EWY C;  1QZE A;  2GBJ A;  3TEW A;  3ZIM A;  4ANU A;  2N9P C;  3AMZ A;  2FIF A;  1WM3 A;  4DDG D;  4DHJ B;  1SSN A;  1Z5S B;  1RFA A;  2ZPY A;  1Y8R C;  4GIV A;  3LDZ E;  2UYZ B;  1P3Q U;  3BWU D;  2WGS A;  1Q0W B;  2LJI A;  3I3T B;  1JRO A;  3A1Q B;  3AU4 A;  4JLC A;  1PUT A;  1WJ4 A;  3IT6 B;  4OZC A;  5JH5 C;  4US8 A;  4LNN A;  4M8M A;  1Q10 A;  4I6N B;  2PEA A;  4MGK E;  2MX2 A;  3UGB B;  5HFY A;  3R66 C;  4GDK B;  3V05 A;  2M8S A;  2KOX A;  2MHJ A;  4IUM B;  2DZJ A;  4KKJ A;  2IO2 B;  2K39 A;  1QOB A;  1TBE A;  1V5O A;  2W9N A;  2KAJ A;  1XEE A;  4M0W A;  1RRB A;  1JWS D;  1QF6 A;  1P7E A;  1C78 A;  4ZYN A;  3W9C B;  5AZH A;  1FCL A;  1YQB A;  3DBL I;  2MBQ A;  3L54 A;  3OWE B;  4IM3 A;  3EFC A;  4K3C A;  2EEL A;  1ZDX A;  3RI7 C;  3QK0 A;  4MEL A;  2N1W A;  2ZZP B;  4GDL A;  1KOT A;  2QSD A;  4DQO C;  2L00 B;  2KN5 A;  4RM8 A;  3U2S C;  1OTR B;  4XYC A;  3T3N A;  2GB1 A;  2ZVO A;  5IOI A;  1T0R C;  3NHE B;  1MFW A;  4OZB A;  3FIL B;  4KKI A;  4W9I A;  5FR3 A;  2G9H D;  3T3O A;  5FK9 C;  2WXH A;  1WJU A;  3U30 A;  4MAC A;  2PVO D;  3Q3J A;  4XDD A;  1ZXH A;  3IAM 1;  3L4P A;  4WWN A;  4M8N A;  3V62 A;  2J53 A;  4ZRK A;  2K8B A;  2KWD A;  2N9L A;  4FBJ B;  2C5L C;  4HRO A;  4HK2 A;  3Q14 C;  2I38 A;  2JWU A;  1YD8 U;  1X1M A;  4HJG E;  3L13 A;  4W9L A;  4MH0 E;  2YVC A;  4IWO A;  2B76 B;  3ZUN A;  2WU2 B;  2Z0D B;  1D5Z C;  1LGR A;  2DBY A;  4NAW B;  2K5P A;  3VHT C;  3N9Y C;  3N1Y C;  5G2N A;  1U4A A;  1V8C A;  3ZXV A;  3AN1 A;  2K3U A;  4B95 A;  4G11 A;  4UDU C;  4KX6 B;  3AEA B;  2JUO A;  2KX3 A;  3X0W A;  4MSQ B;  4DXA B;  3AE7 B;  4FJZ A;  2WDR B;  3A33 B;  4MGZ E;  4BKS D;  2KFK B;  3NOB A;  1QOA A;  1OQR A;  3U52 E;  4YSY B;  4GMV A;  5BMI A;  1TZ1 A;  2JZ3 B;  3AEB B;  4M01 A;  1L0X B;  2LRW A;  1GC6 A;  1QOF A;  1GPX A;  3RPF C;  4BAX A;  4N9F 4;  5CHW A;  4YSZ B;  4KGR A;  1V6E A;  4YSX B;  4BBN F;  1R4M I;  2O2V B;  3AE2 B;  3HUI A;  1J0G A;  1RM6 C;  3R2I A;  3R8B A;  3RMK C;  3L08 A;  4LNF A;  3M62 B;  1T6B X;  3UIP B;  1VLB A;  3DHH C;  1WSP A;  3CMM B;  2VZK D;  3R7Q A;  3AE8 B;  4TKN A;  4LNI A;  3ZKJ C;  4KVG B;  4FJV B;  2IPK D;  3PS6 A;  1OQQ A;  2KWC A;  4IM2 A;  1SJH D;  3H7P B;  1PGA A;  2MLB A;  5IP4 D;  3QCA A;  4KDL B;  2ZPN A;  5EE0 A;  1HXY D;  2JSV X;  2V3P A;  4MEM A;  3ZQ4 A;  1FM0 D;  4EZL A;  3BK2 A;  1NBF C;  1R4N I;  3EA6 A;  1E8X A;  3AEG B;  2M0A A;  3BK1 A;  3B08 A;  3GB1 A;  1JWM D;  2G4D B;  4HPM B;  4RGN A;  3W1S C;  1WWT A;  1XCT L;  2K0P A;  4BKG A;  5IO9 A;  1J19 A;  1SBB B;  3TEZ A;  1D5M C;  2IO1 B;  1ACC A;  4GOC A;  4PS8 A;  3O13 A;  3W5V B;  3PLU A;  3GP7 A;  1HE8 A;  1V1P B;  3VRB B;  3AB5 A;  2JWZ A;  1TKE A;  4NAM A;  4J6I A;  4KSK C;  1GOZ A;  4DHZ B;  1TT5 B;  2FAZ A;  4RNA A;  4ZDV A;  2MJD A;  4HDO A;  1AYF A;  4OVV A;  1EO6 A;  4TQ1 A;  1ZPS A;  2K6Q A;  2KTR B;  2L83 A;  4TUU A;  1E8Y A;  1I4X A;  3VTV A;  1NVI D;  5TSS A;  2MQJ A;  4C00 A;  1OQY A;  3SFE B;  1KLV A;  3K9O B;  2KTF A;  2XK5 A;  1D5X C;  2Y3A A;  2MA9 B;  1D4B A;  2M19 A;  1TGZ B;  3URY A;  1JAL A;  4S17 A;  3ZYY X;  1WGY A;  1XXG A;  3B2F A;  4O1N A;  1HA5 A;  4WQO B;  3QIJ A;  4FAD A;  1WGK A;  3NS8 A;  4BOS C;  3EFU A;  1LQB A;  2LHD A;  2FID A;  2BYF A;  5CHV C;  4AP4 C;  3NJT A;  5CHF A;  3U7Z A;  1L5P A;  2BWF A;  4HXD A;  4NJC A;  3W2D A;  3PHW B;  3SD5 A;  3SU8 X;  2OJR A;  4GGQ A;  4BFR A;  2ON8 A;  1KLU D;  2JZZ A;  1WI0 A;  2BYE A;  5LXI B;  4AJW A;  2XEW A;  2LAS A;  3RD2 A;  2OED A;  5EE3 A;  2JT4 B;  2QIL A;  3APD A;  4AUQ C;  2DLB A;  1JWU D;  3ZRC A;  2BTE A;  1JWA D;  3SEB A;  3ZNI D;  1WXS A;  3TIX A;  1UBQ A;  4B0E A;  1K50 A;  2W3S A;  2IY0 B;  3I57 A;  4BKS A;  3X23 A;  4HPP A;  1SB3 C;  3PZ8 A;  3HK0 A;  3DPD A;  1L6V A;  1SGH A;  2NTS A;  2V3S A;  4KSL C;  1UGJ A;  3GZN I;  2BKF A;  2GLS A;  2N7J A;  2QIE B;  1N62 A;  3SDL C;  3ZNH B;  2O6V B;  3OAW A;  4XWW A;  3H9D A;  3JYU A;  2PW9 A;  4A6Q A;  1GJZ A;  4W9J A;  2IY1 B;  2WDV B;  4ACF A;  2WXL A;  1LFD A;  3VH4 B;  1QKZ A;  2RR9 A;  5H8Y E;  1YQ3 B;  3N32 A;  5HKH A;  3I9V 1;  1SEB D;  2D3C A;  4WJN A;  4TQ0 A;  1UWM A;  2D3G A;  3UQB A;  4KDI C;  2KXJ A;  2D11 A;  1F2R I;  1XT9 B;  1JCK B;  3MC0 B;  2PE9 A;  2V4L A;  4BZA A;  3V60 A;  2IO3 B;  1WX7 A;  4R3D A;  3V6C B;  1L6U A;  3HM6 X;  3DBS A;  4A3O A;  4YTM B;  3IG3 A;  1WE7 A;  2PKO A;  2HE7 A;  4RH6 A;  5CX3 A;  2JRI B;  3LXF A;  2V3N A;  2K1F A;  2LGS A;  1I4H A;  2MW5 A;  3ML9 A;  2K8C A;  1XD3 B;  1QIL A;  2WXN A;  3U4E G;  4HKQ A;  4ZRI A;  2N4F A;  2GBK A;  3HIZ A;  3BIN A;  1PYW D;  4ZRQ A;  3V61 A;  4GN1 A;  3GE8 C;  3ZLZ A;  4A90 A;  3BVM A;  2L1A A;  1GB1 A;  2G1E A;  2EKE C;  2KX0 A;  2DYB A;  4I6L B;  1FIQ A;  2W55 A;  5DPS A;  1WX9 A;  1C4A A;  2KDI A;  1TZO A;  2JQR B;  3S2A A;  1QLB B;  2GBN A;  3PZ7 A;  5EE1 A;  1CJE A;  4LDT B;  1WR1 A;  1AN8 A;  1WGR A;  5C3J B;  4C80 A;  4AS1 A;  3BYT B;  1JRP A;  3ZO5 B;  4MM3 B;  4MJS A;  5E6J A;  3KW5 B;  2MCN B;  4P1B C;  4N59 A;  2C7M B;  2IGH A;  3ZNG C;  2RPQ A;  2PVG C;  4WH4 A;  1YNT E;  1GAQ B;  1RAX A;  4WQM A;  2WLB A;  1R4M B;  2YEP B;  1V49 A;  1C4C A;  4IOI E;  2INN E;  3VDZ A;  2BVC A;  2J52 A;  2LXC A;  4MT5 A;  1RLF A;  1P1A A;  4ZYS A;  2RD0 A;  3A9J B;  1Z2M A;  1WRI A;  3FC4 A;  2Z0E B;  1WJN A;  4WWM A;  1J7A A;  2FCQ A;  2WXK A;  4FXC A;  3ZRF A;  2JX5 A;  3L17 A;  3DDC B;  1IP9 A;  2A5U A;  2MBB B;  4IWP A;  2KT7 A;  2AX5 A;  1WFY A;  1FNV A;  2KDB A;  3RUI B;  4WAF A;  1NEK B;  3QAR A;  1QOG A;  3ZW3 A;  1I7H A;  2DWQ A;  4BKT A;  2NPT A;  5EE9 A;  3AI5 A;  4XWT A;  3T9L A;  3MHZ A;  2Q5W D;  2KKC A;  3H7S A;  1IYF A;  2KN4 A;  2KAN A;  1R4N B;  3SR6 A;  4Q2J A;  3ZJV A;  4ZRP A;  2BYT A;  5T8I A;  3GE3 C;  2QJL A;  3PRM B;  2J0J A;  1EF1 A;  4S0R A;  1K51 A;  2JPH A;  4RGT A;  3Q3M C;  2V0G A;  2JY6 A;  1V97 A;  1VD2 A;  3IVF A;  2Y5P A;  2XBB C;  2MJE A;  1TS2 A;  2LVO A;  3RNE C;  1S1Q B;  3B9J A;  3VR9 B;  1I35 A;  3AE5 B;  2BBC A;  3RT3 B;  3ECI A;  3ZTD A;  1CZP A;  2AL3 A;  1EUV B;  1SE2 A;  1Q5W B;  2MSE D;  2FCS A;  3AEF B;  2FCN A;  3BVG A;  4YWG G;  1FCC C;  1C3T A;  4HCN B;  3I63 C;  4W9E A;  4NNJ B;  2I1J A;  2R61 A;  3WAN A;  2L76 A;  2DEN B;  3JW0 X;  5C23 A;  2V9H A;  2PPH A;  1E5W A;  2XN9 C;  2D2Q A;  3H7P A;  4K7U A;  1L4Z B;  2CHZ A;  2LFI A;  3AXC A;  2INC C;  1WMH A;  3PV1 A;  2WS3 B;  3C0R B;  3H1U A;  1L2N A;  1MG8 A;  1IUE A;  1XLO A;  2L05 A;  4P6V F;  2KDE B;  4NJ7 A;  3VQI A;  5KHO A;  4JE3 B;  3NUH B;  3AM9 A;  2KC1 A;  3P1M A;  4RF0 A;  2TSS A;  1F2R C;  2KC2 A;  4A20 A;  1P9D U;  2CHW A;  2LMC A;  3KLS X;  4ICV A;  1YN4 A;  3Q8F A;  2L3Z A;  1UBI A;  1P7F A;  3IT4 B;  4NQK E;  1WZ0 A;  3ZTC A;  3L10 B;  4W9C A;  3DHG C;  2DX5 B;  3PTF C;  4WAA A;  2NTT A;  2WDQ B;  4F1S A;  3HM3 A;  1TTN A;  2ZCB A;  3WAP A;  4KIK B;  1IGD A;  2WWZ A;  2LWP A;  1L7Y A;  3VTW A;  3ZJT A;  3EUB 2;  2JZP A;  1F1H A;  3OJ4 B;  3DQV A;  3DWG C;  4USA A;  3I5J C;  4NQL B;  4LJO B;  1MHX A;  4XX5 A;  4EE2 A;  4JL9 A;  4EZK A;  3OG5 A;  1KF6 B;  5J18 A;  2LGY A;  3GZN B;  1N6Z A;  4WWO A;  3SFD B;  3FKY A;  1ENF A;  4C56 C;  4PS3 A;  1YQ4 B;  4OHJ A;  3VTU A;  1UNS A;  3RUL A;  1TY2 A;  2RMM A;  2FNJ B;  1IBX A;  4REZ A;  1WZ3 A;  1JW9 D;  2DYM A;  1N61 A;  1P0R A;  3TCA A;  4TMA B;  3PT2 B;  4US9 A;  2DNF A;  4FJY A;  1GUA B;  2KZR A;  3OJ3 A;  3DWM A;  1WXV A;  3W1S A;  4KZ0 A;  4W9H A;  2K9X A;  3QA8 A;  4DHJ D;  4ZOH C;  4DHZ E;  3N1Z C;  2KYW A;  4EZJ A;  2DHZ A;  3QC8 B;  1A70 A;  1EF5 A;  2PLP A;  4HJK A;  1ZP0 B;  4HPL B;  5C1Z A; 
#chains in the Genus database with same CATH homology
 1QQR A;  2OED A;  3W5U B;  5EE3 A;  1SE3 A;  2QIL A;  1K53 A;  2WXI A;  1T5X D;  2EKI A;  2DLB A;  1JWU D;  3R2T A;  2BTE A;  1JWA D;  4YTP B;  3SEB A;  1SIJ A;  1RYJ A;  2WXO A;  2JYE A;  4B0E A;  2LEK A;  4DXF A;  1FD6 A;  1K50 A;  4JPS A;  2W3S A;  4C7Y A;  1D6E C;  1XLQ A;  5G5G A;  1F0Z A;  4ARI A;  3P63 A;  3I57 A;  2KDM A;  1ZUD 2;  1FNW A;  2ICI A;  3P4S B;  1KTK A;  1TJE A;  5JXV A;  3HVD A;  1FMA D;  1SB3 C;  2AQ1 B;  3PZ8 A;  5D3I B;  3AE1 B;  3AE3 B;  3NZ3 A;  1L6V A;  2FBW B;  3Q8E A;  1TYG B;  2INP E;  3Q8A A;  3BVZ A;  3UI3 A;  4GDL B;  2QEJ C;  1J7C A;  2NTS A;  1UGJ A;  2N7J A;  2QIE B;  3KQ4 A;  1N62 A;  3IXS A;  2X38 A;  1XF5 L;  1VDV A;  1R7S A;  3KWV A;  1ET9 A;  4XWW A;  2PW9 A;  5HHD G;  1V1P A;  1WYG A;  4A6Q A;  5G5H A;  2MH7 A;  2WDV B;  1NYQ A;  4HEA 1;  5C2T B;  3E56 A;  2WXL A;  5AUI A;  1PGX A;  2ACZ B;  4ZHP A;  1L0Y B;  1QKZ A;  5H8Y E;  3E9S A;  1YQ3 B;  3MP9 A;  3NRZ A;  3TEX A;  1XLP A;  4JX1 C;  2MJ3 A;  4L23 A;  3I9V 1;  1SEB D;  1I4P A;  4A55 A;  4WUR A;  2PIA A;  1HQR D;  1DYQ A;  3MJ5 A;  1EWY C;  3TEW A;  1BML C;  4TQ0 A;  1MHH E;  3AMZ A;  1UWM A;  1BUI C;  1F2R I;  1SSN A;  3V3X A;  1JCK B;  3PO0 A;  3MC0 B;  2BT6 A;  1STE A;  2FUG 1;  4R3D A;  1L6U A;  3BWU D;  1MI0 A;  4H2A A;  2LJI A;  3ETR A;  4P16 A;  1JRO A;  1EM7 A;  1PUT A;  2KAC A;  1YN3 A;  1TS3 A;  1OFF A;  3IT6 B;  2WNM A;  4OZC A;  4HRS A;  4YTM B;  1ZDV A;  4US8 A;  1VR9 A;  2PKO A;  4RGO S;  4WIP A;  4A8X C;  4RH6 A;  3CWI A;  2I2Y A;  1YJI A;  3LXF A;  2ONQ A;  2V3N A;  1Q10 A;  2ZW1 A;  2LGI A;  1I4H A;  2WXR A;  4PT5 A;  4LK0 M;  1C4P A;  1QIL A;  2WXN A;  5HFY A;  4GDK B;  2BB5 A;  3U4E G;  3V05 A;  4HKQ A;  2W3R A;  1KH0 A;  4KKJ A;  4ARC A;  1PYW D;  3WCQ A;  1QOB A;  1YJJ A;  4ZRQ A;  3Q69 A;  2HDE A;  4MH8 A;  2KAJ A;  4A90 A;  1HZ5 A;  1EU3 A;  3BVM A;  1XEE A;  2HTM E;  2L1A A;  1GB1 A;  3BZD B;  2G1E A;  2H88 B;  4M0W A;  4YT0 B;  1FIQ A;  2GI9 A;  3AEE B;  3NVW A;  1JWS D;  1QF6 A;  1P7E A;  1C78 A;  2W55 A;  5HG2 A;  3W9C B;  1C4A A;  2KQ4 X;  1TZO A;  2JQR B;  1NYR A;  1QLB B;  3PZ7 A;  4DXG A;  1JML A;  1YN5 A;  1FCL A;  4XE0 A;  5EE1 A;  1YMH E;  1CJE A;  3OWE B;  3ABV B;  2EEL A;  1ZDX A;  3VR8 B;  3BYY B;  1AN8 A;  5C3J B;  4AS1 A;  5BMG A;  2QSD A;  2OHF A;  3NS1 A;  3BYT B;  4C80 A;  4DQO C;  1JRP A;  5BMH A;  3U2S C;  2WXQ A;  4MM3 B;  3T3N A;  5E6J A;  2AQ3 B;  1VZ8 A;  2GB1 A;  4IKG A;  1FFV A;  4OVZ A;  1ET6 A;  4B0M A;  4N59 A;  2SAK A;  4OZB A;  3FIL B;  4KKI A;  3Q8B A;  5FR3 A;  2G9H D;  2IGH A;  1VZ7 A;  1E6E B;  1UUP A;  2Y5C A;  3T3O A;  4D2K A;  2PVG C;  4WH4 A;  2BW2 A;  5FK9 C;  1B1Z A;  2WXH A;  1YNT E;  2JXT A;  3RFZ B;  1GAQ B;  4MAC A;  2PVO D;  1PFD A;  1IGC A;  4XDD A;  1I4G A;  1ZXH A;  1N5W A;  2WXF A;  3IAM 1;  3L4P A;  2PTL A;  1C76 A;  4WQM A;  2WLB A;  1DOI A;  2YEP B;  1AWD A;  1C4C A;  3AE9 B;  1PDX A;  2INN E;  2JU6 X;  4IOI E;  1B9R A;  2J53 A;  5I4D A;  2L52 A;  3VRA B;  2J52 A;  3IAS 1;  2KWD A;  2N9L A;  3KWL A;  1C77 A;  2CU3 A;  2CJO A;  4MT5 A;  1VJK A;  4OW0 A;  4ZYS A;  4HRO A;  1I4R A;  2I38 A;  2JWU A;  1WRI A;  1ZXI A;  4HJG E;  3CIR B;  3FC4 A;  1KFY B;  2B76 B;  4WWM A;  2WU2 B;  1V1O A;  4ITK A;  1D5Z C;  1J7A A;  4KGT A;  1TS5 A;  4L2Y A;  1F77 A;  2WXK A;  2DBY A;  4FXC A;  4NAW B;  4C7Z A;  2K5P A;  4XDC A;  2JX5 A;  1FRR A;  3HRD D;  4NZL B;  1EU4 A;  1QT9 A;  2WXM A;  3N9Y C;  2AX5 A;  1FNV A;  2J42 A;  3AV8 A;  3LYY A;  4WAF A;  1NEK B;  1QOG A;  1EWC A;  1I7H A;  1V8C A;  2DWQ A;  5EE9 A;  4XWT A;  3BII D;  3AN1 A;  2K3U A;  3MHZ A;  3C8Y A;  2Q5W D;  4UDU C;  4KX6 B;  4JWS C;  3AEA B;  2KN4 A;  2MEK A;  5BYR A;  3LB8 C;  3SR6 A;  4Q2J A;  1N63 A;  1NI3 A;  4ZRP A;  5GXG B;  3AE7 B;  2BYT A;  2WDR B;  5T8I A;  2QJL A;  3ZJV A;  3AE4 B;  4L1B A;  1QOA A;  1UWX A;  1OQR A;  3U52 E;  4YSY B;  1K51 A;  1N60 A;  1Y56 A;  4RGT A;  5BMI A;  2J4X A;  2V0G A;  3H8H A;  1V97 A;  2GRI A;  3AEB B;  1L0X B;  1QOF A;  5MPO A;  1GPX A;  3RPF C;  1MVK A;  2Y5P A;  3HVZ A;  1JQ4 A;  2MJE A;  1TS2 A;  4YSZ B;  3NVZ A;  4KGR A;  1FNU A;  2W82 A;  3B9J A;  3VR9 B;  2RDG A;  3B2G A;  1VRA B;  3AE5 B;  4YSX B;  2BBC A;  1IBX B;  3AH7 A;  4OZA A;  4CQN A;  1CZP A;  1N5X A;  1SE2 A;  3AE2 B;  3NVV A;  2YEP F;  2ZW0 A;  3HUI A;  1RM6 C;  3R2I A;  2WU5 B;  3AEF B;  4LLG M;  4N58 A;  1FO4 A;  4GLS C;  2WXG A;  3R8B A;  2Z8L A;  3BVG A;  4YWG G;  1FCC C;  1T6B X;  1VLB A;  4YXD B;  1WSP A;  1JWB D;  2WQY B;  2KMM A;  2VZK D;  4RGM A;  2LUM A;  1NEN B;  2R61 A;  5BYS A;  3AE8 B;  1L0V B;  1C9F A;  5BYQ A;  2RDH A;  3FIL A;  2XN9 C;  1DOY A;  1FXA A;  2WXJ A;  2K22 A;  1L4Z B;  2IPK D;  1CK1 A;  2LFI A;  5LNK 1;  1ESF A;  1TS4 A;  1OQQ A;  2WS3 B;  1C79 A;  4YTN B;  1LO5 D;  1M4V A;  1IUE A;  2IDY A;  1SJH D;  1XLO A;  2E6X A;  1PGA A;  4TSS A;  1SE4 A;  4P6V F;  2CJN A;  3VQI A;  4JE3 B;  3NUH B;  3AM9 A;  1I4Q A;  4LTU A;  3P1M A;  4RF0 A;  5EE0 A;  4A9A A;  3P4P B;  1HXY D;  2JSV X;  2TSS A;  2V3P A;  3ZQ4 A;  1FM0 D;  1F2R C;  2XNA C;  1RWS A;  3J9C A;  5D7G A;  3BK2 A;  3EA6 A;  1SJE D;  3AEG B;  2SEB D;  2LMC A;  2M0A A;  3BK1 A;  3KLS X;  4RF1 A;  3GB1 A;  1JWM D;  1YN4 A;  3Q8F A;  4RGN A;  2LHE A;  1WWT A;  1HZ6 A;  1E9M A;  1XCT L;  2K0P A;  2W54 A;  1TKY A;  1P7F A;  3IT4 B;  1SBB B;  3TUO A;  3TEZ A;  1HEZ E;  1D5M C;  1FFU A;  1RFK A;  1ACC A;  2NTT A;  2WDQ B;  1BXT A;  3O13 A;  2AQ2 B;  3W5V B;  4IDI A;  3GP7 A;  1K52 A;  1ZE3 D;  1IGD A;  1V1P B;  3VRB B;  3AB5 A;  1TKE A;  4NAM A;  2E3T A;  1GOZ A;  3ZJT A;  3ZJU A;  3EUB 2;  2JZP A;  1PGB A;  4RNA A;  2RPV A;  1KLG D;  2MJD A;  3DWG C;  3AEC B;  1AYF A;  4USA A;  4HKZ E;  4TQ1 A;  1DOX A;  1ZPS A;  4RFB A;  1TY0 A;  5H92 C;  1FEH A;  2L83 A;  3AE6 B;  2N9K A;  3Q8C A;  3TEY A;  2VZK B;  1ZOY B;  1MHX A;  1I4X A;  3P4Q B;  2WP9 B;  4EE2 A;  1NVI D;  5TSS A;  2IJ0 A;  2H89 B;  3SFE B;  1KF6 B;  2WXP A;  1DGJ A;  4KGS A;  3ZGZ A;  1FRD A;  4RCO A;  1T3Q A;  1FXI A;  3FAH A;  1D5X C;  2Y3A A;  3SFD B;  3P4R B;  2D5G A;  2QMT A;  1D4B A;  2BS4 B;  2M19 A;  3URY A;  1JAL A;  1ENF A;  4C56 C;  1YQ4 B;  3ZYY X;  1E10 A;  1XXG A;  2NMQ A;  1E7P B;  2L32 A;  1UNS A;  3AED B;  3B2F A;  4OHJ A;  1J7B A;  4ZHO A;  2BB6 A;  2M56 B;  1HA5 A;  1XLN A;  1TY2 A;  2V4I B;  4O1N A;  2RMM A;  1IBX A;  4REZ A;  1ROE A;  1WGK A;  4J3O D;  1JW9 D;  2DYM A;  2LHD A;  2N0S B;  1AW7 A;  2BS3 B;  1N61 A;  3P42 A;  1SXT A;  3EGR A;  3NVY A;  5AUK A;  2IGD A;  2FE8 A;  1SF0 A;  1XCQ L;  1L4D B;  1MPE A;  3U7Z A;  1L5P A;  4TMA B;  4US9 A;  3MFG A;  1GB4 A;  1XO3 A;  1E0Z A;  5D3D A;  3GS2 A;  3DWM A;  1KRH A;  3TSS A;  4NJC A;  3W2D A;  1TKG A;  3W1S A;  1WXQ A;  4JWU C;  2K9X A;  2JYT A;  2ON8 A;  1CQV A;  1KLU D;  2PMV A;  4N6E B;  5HI1 A;  4ZOH C;  2DYO A;  2IGG A;  1VZ6 A;  4AQ7 A;  1A70 A;  2BS2 B;  2PLP A;  1ZP0 B;  5FKA C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...