1IC4H

Crystal structure of hyhel-10 fv mutant(hd32a)-hen lysozyme complex
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
114
structure length
114
Chain Sequence
DVQLQESGPSLVKPSQTLSLTCSVTGDSITSAYWSWIRKFPGNRLEYMGYVSYSGSTYYNPSLKSRISITRDTSKNQYYLDLNSVTTEDTATYYCANWDGDYWGQGTLVTVSAA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural evidence for entropic contribution of salt bridge formation to a protein antigen-antibody interaction: the case of hen lysozyme-HyHEL-10 Fv complex.
pubmed doi rcsb
source organism Mus musculus
molecule tags Protein binding/hydrolase
molecule keywords LYSOZYME BINDING IG KAPPA CHAIN
total genus 27
structure length 114
sequence length 114
ec nomenclature
pdb deposition date 2001-03-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF07686 V-set Immunoglobulin V-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1ic4H00
5DHVA 1ZLUH 3VD7A 3I6GA 4KKCD 3SDDD 4HXAH 3LRGA 5SWSB 4Q2ZA 1ZS8A 4U7KA 1F6AA 4LU5L 2W1NA 3AS3A 1WTLA 2B2XH 1U6AL 3ULVC 1M05B 1EEYA 5D8JH 5CEZL 5ESAB 2WM0A 4G9FB 2QQLL 2BNQE 4BFEA 4XNMB 4KKBC 5F7HA 4YGVB 4JO2H 5JA9A 4D3CH 2VQTA 3KYNA 3NZHL 2HAZA 1JTPA 4NQUA 2ARJB 1FFPA 1IAIM 1OD7A 1Z9OA 2A38A 1A1NA 5DQ9A 1NEZG 2OSLB 3A67H 4KQ3L 1UA6L 1LO0L 4V2CB 3PP4L 4K94C 3B9KA 4RZCB 5T3XH 1QRNA 3H0TA 1CU4L 2H9GB 4QOKE 1VFAB 1NMBH 5EA0L 4KVNH 2XN9A 2QQNL 4YFEA 5KS9E 4OUUB 2DL9A 1T5WA 5GGRA 2ZKHH 2AERT 4TUOA 2XI9A 4KKBD 4Y4HD 1M7IB 1MCJA 5L8KB 2O5YH 1G1CA 4PP1D 4YLQT 5F7DA 2VQ1A 1G9MH 3BFOA 4MB5A 3FT3B 3UO1L 1K8IB 4V1DD 1PX3A 3SBWC 1KPUA 4EN3A 5CGTA 3W9DA 3M1BB 4Q2ZB 3MRIA 4FG6D 3BPCA 5DQJB 3SDDC 1YNKL 3I75B 3KPMB 5DC4B 4PUBL 1MJ8H 2B20A 4Z8FH 3K8MA 3TBYB 5BOZG 1ES0A 2XN9E 4YHKL 1PY4A 1JF5A 2OS7A 4QO1A 2D9QB 4E41D 3HZKA 4HV8B 1D6EB 5F93C 1XR8A 1A7PL 3TN0B 2VXUH 2VN7A 4C4KO 4HK0A 1U3JA 2IADA 5TE4H 5C6WH 3DV6B 4ZDHA 3NCFB 4K3DL 1A7OH 2FJGB 4XB8A 4RZCA 4J3VA 2FB4H 4I2XB 1MJUH 2IGFH 3MREB 5C6PB 3ARFC 2V7NA 1XF2A 3HI5H 3AS0A 1AXSB 1AO7B 1U93B 4NM8H 1NMAH 4NM4H 3TNNA 4GRWH 4M7JL 5KSAA 4MAYA 4NJAH 3SGDH 2NCMA 5D1ZC 3VGFA 2H1PH 5FK9B 3UPCA 1YEKH 1UH2A 5TQ0L 5C0RH 3V4VH 5EUOA 4KH2A 4NQSA 2A6DA 3RBSA 1BD2A 1EHLL 1JYXA 5JQHC 2J88L 1XEDA 2BY3A 5IB1A 2VDRH 5INCB 1Y6KR 3B5TA 3K1DA 2BVPB 3QIWC 1S7QA 3O2VH 1IILE 1S3KH 2UZYB 3I6LD 5BXFB 3S4SG 5CBEB 2HN7A 3ECBB 4LSPL 1XCTB 4KRNA 3FRUA 2AQ2A 1IT9H 1J0HA 2X89A 1T7WA 1ETZA 4JFFA 3C60C 3LV3B 1LO0H 5K9QI 4U3XA 2DRUA 4NT6A 4DN3H 3MGTB 1T20B 2VH5H 2WBWB 4CAGA 1F58H 5TF1H 2DWEA 3FOLB 4MLIA 4M4PA 3E6HA 3PDOB 5DK3A 4X6EA 3AS2A 1JYWA 3CFJA 2HLAA 4NQDE 3RHWK 3SCMB 1RURL 3MCLH 1G7JA 3LDBB 3U4AA 1J87A 5CBAA 4PJ5B 1MLBA 2VDMH 2M8XA 4MX7A 4NKQB 4AK1A 1T21B 3K8KA 4X7TA 4YDIH 1OAXH 3S8WA 1IAKB 3TM6A 3V52L 2YR3A 4X80L 4N8VA 3O6FA 2PKDA 3TYGL 5KS9B 3E1F1 1QG3A 4R7DB 1W72H 3R06A 4JFDB 3UAJD 4AMKL 5F6HJ 1X7QB 3U4BL 1OT1A 2FJHA 2BSED 4FNLL 4RX4A 1FFOB 2WP3T 3QNZB 4L4TD 4I4WA 2IF7A 4NKIH 1TZGL 3KJ6L 2JJTC 3U46A 2NY6D 3BIAX 3S96A 3MBED 3K4DA 5D93B 2DMBA 1OY3B 3IDUA 3RIFF 3QQNA 1XF1A 3VXPA 2IGFL 3ROLA 5IFJA 2ITDB 3QWRA 3HI5L 5DRZA 4G9FE 4Z7WE 4UT9L 5IIEA 3FFCD 4RWYL 2NY1B 4Y2DA 3RGVC 4JPVH 4ZUWA 3C60B 1F3DH 4OKDA 5CBAB 3O6KL 1AE6H 3VXOB 4ZUSB 5I73C 4OFVA 1A1MA 4PG9A 1FORL 1AD0A 5TQ0H 3V4VL 1WBXB 5IB4B 5HI3D 3WLWC 3AUVA 2OLDA 3SDXF 3SE3A 2J4WL 2VDRL 1QRKA 2VLJD 2EH7H 3ZKMC 3CPLB 5D7JB 3C6LA 4HX1B 4NHUB 5ECJE 3FONB 5IOPA 3EDJA 1JMXA 2FGWH 2QHRH 4WI5A 4QRSA 3GI9L 1T89A 5D4QA 3T2NH 4DN3L 2CRIA 5HYFA 1F58L 1Q9OB 1UACH 1QSFD 5EZOH 4BQBA 1BAFL 1KN4L 1PSKH 1WBZB 1BFOA 2JB5H 4GRLC 2VZUA 3QNYB 2YRPA 1CR9H 1O5DT 3DXAB 3ROLB 4P9ML 1JUFA 1RURH 2JJSC 4NQED 4BQ6A 5K9KA 3P4MA 4CN6A 4GAFB 1FL3B 2DKSA 4Y5VB 1MAKA 3ZSSA 1XF5A 3EFDL 4XGZA 1M7XA 3MRQA 1IGYB 4X80H 4CDGC 3KGRA 2GAZA 4PJ8C 2V2XB 4YBQD 3K80A 2IFGA 1CXLA 3O6LL 4NKDA 2IPKA 1A14L 1KCRH 3C5ZC 4U0RB 1O0VA 3ARBD 2Y23A 3SO3C 1YMHB 4FNLH 25C8L 4PRHA 4Z78B 3OTTA 5DK2A 5KN5A 1GXEA 1GOGA 3O11A 1Q0YH 4JFOA 1CDYA 3SKOA 7CGTA 4J4PD 1TZGH 4E5XB 5FYJH 4M6AA 2VKXA 4MAYB 3MRLB 3GMPA 4HS6B 3QPQC 1FYHB 5F97E 5FCSH 5ANMA 4MD0B 4Z7OE 2XKNA 1VESA 4TYUA 2A2QT 4I77H 1C08A 3TO4B 1DUZA 3DRQA 4K3JH 3N85H 3T0BA 3FMGL 5HI3C 3WHXA 2IWGA 4JFEE 1MJJB 1HSBB 1ZHKA 1YMMB 1Z3GH 2AW2A 5DFVD 4OZFB 5IBLD 2XQBL 3X3GL 3MYJB 3O6KH 2PCPB 2YMXL 3GHEH 3BEVB 4P48A 3WL9B 1NUNB 1X5HA 1C5DA 4H1LG 1KCUL 1YN7B 4IOIA 1GL4B 4OFYD 4OCXL 5HPMB 2DJ4A 2J4WH 3MRCB 5D7IB 4XC3L 3MBEC 2DM4A 4FFVC 4MDIA 5IVXE 4K9EH 4NIKB 3V6FB 4IIQA 4OZGB 3O3UN 4OZIF 5EU4A 1VFOA 4KKAC 2FCBA 1BQSA 2FECI 3TNNB 3LOWA 4HGMA 4MX7B 4NC1E 4RDQF 2WINB 4HLZG 2G9HB 4N0FB 4U1JA 3DLQR 3DECA 3AY4C 4OLYL 3PGDA 4P99A 2GT9B 3AREB 4QRPD 1OWWA 3EIFA 3IRPX 1QFWH 2M2DA 3A6CH 4P5TC 2EE2A 3L1OH 2AJ3A 4OLUL 5J3HD 1MCNA 4M7KH 5E2TL 1U8HB 5ETUB 4Z77A 3ZTNH 5IESH 2AEQL 3V5DB 4DN4L 3DX7B 4GQ9H 2VMFA 4HZLA 5INDA 1CXIA 3ZDYE 3TFKD 4U7SA 3VU2A 5JOFA 5CJOL 1A14H 4M1GH 1LO2H 4Z7WF 4NGHL 1F4WL 1T5XA 4OQTA 2E9IA 4CNIA 3LN4A 4PJXE 2OZ4A 3EZ8A 4H88L 5I8KL 2SEBA 3SPVA 5FYJL 2A9NH 4FQPA 1NANI 1QLEL 2YWYA 5D93C 3AB0B 3O2WL 4P46C 2BC4A 2HVKA 3C08H 4G6ML 4PS4L 3M45A 4XMPL 3VGGA 3KHQA 4U1IA 3IDXL 2EH8L 2YBRA 3FMGH 3VI3F 5LGHH 3QI9C 3JV6B 3S36H 3JZ7A 3G08B 3BUYB 2N1KA 1UJ3B 4ONHB 2V7HA 3QUMH 2YPVL 3EYFB 5CP7A 1I7TA 3BO8A 5D1ZD 5DJXA 2NX5D 1A4JB 2DAVA 4O4YL 1I8IB 1IC7L 1P4LB 1ZT7B 1TETH 4M62L 3ARFD 1MWAL 1CGTA 32C2B 1R5IB 2BSSA 5E8EB 4OCXH 1JRHI 4LRNL 4RDQG 4XVSL 3T3PF 1U3HB 4HJJL 3CFDA 4HIEA 2ZCLL 5HHOD 4F9LC 2XACC 1CLCA 43CAB 1A6TA 1UQSA 3VH8B 5FB8A 3WFZA 4HWZB 5FA4B 5EO1B 2GK0A 1T03L 5D6DA 1DBJL 4L4VB 4ONGL 1NBYA 4P2YA 4JG1H 5IQ9A 3O0RH 4EUPH 4RFEB 3X12A 2DI9A 2VL4A 2P48B 2RCSH 1DP0A 3W5MA 1JHLL 1WQVT 3TJHC 3QO0B 1UWGH 3LKOB 4LAJH 5KZCB 5DJ0B 1IGTB 1S7SA 1WIOA 4P57B 3O3DB 4M7KL 1GPOL 1NGYA 3B9EA 3QO1B 5J7CC 4XC1H 3KPSB 4H8WL 5EU6D 4Y5XB 3GBLA 2ZCHH 2CD0A 3MNZB 4K3GA 3FCTB 5DS8A 5HDQL 1VFUA 4Y5YB 2HA1A 4MXWH 1XIWA 2FECL 1CDGA 4NZUL 1QR4A 3T3PE 2UUDH 1Q0XH 3O6MH 4YQXH 1L9MA 3MMEA 3N1PC 4G43B 4W6WB 3ARDB 1Q9LA 3EBAA 2I9TA 4HWEH 2JCCF 4XPFL 5JDSB 5I66B 2A9NL 1PLGH 3HZKB 3VG9C 3H2WA 3O2WH 1W0YT 4X5WA 3TWCH 4EDWL 5L7XH 2EE9A 3D85D 5EO1A 5T1DL 3BEVA 5GS3A 4U49A 3OX8A 1MRFH 4TNVF 4O2FA 1JZ4A 3S36L 2H2SD 3ULUF 3G9AB 3ZHKA 3JTSA 2EXYD 4MD4A 3P0YL 1IMHC 1KIPA 1MHPL 4WV1A 5TDNA 4U6XA 3GRWA 4MA3B 3LEXB 1WZ1L 1X4YA 3O11B 4LEXL 1JNLL 3BXNB 1J12A 5MHSD 1IZJA 4XP1L 3RGVB 1ULVA 5I1HL 1JI2A 3HTLX 3BZDA 2NW3A 3OAUH 1FZKA 1ZV5A 2NY3D 3GJFB 5IROC 3B9VA 4Z7NF 3QRFM 5ISZE 2A6DB 3ZHDA 1VERA 4GG8A 3KPMA 4PJFF 1OAZH 2HKFL 3WIIL 4PJDF 3O6FC 2VB5A 4Y1AE 4ZFOL 3G5ZB 3H9ZA 3RVXC 2RIKA 3P9WB 3QUXC 4ZQKB 2CUHA 3QT2A 3WUWA 1KGCE 5JNYA 4JG1L 3L3JB 1F4YL 3L95B 2GSIA 4E41A 4ZOEA 1E4WH 3DTXB 4DEPB 3LQAL 3MOAL 1B2WH 1IAIL 4X9IA 3TGXA 1WLHA 2L7UA 3GBNH 4HJGB 4PJEE 4PJEB 1WEJH 2PXYA 1TVHB 2XKSA 2QSQA 5FO8A 4L9LA 3WE6B 5DJCB 1DSFH 1DBMH 2HFFB 4AG4H 3LHPH 1NKOA 2BVEA 4PJFE 4NZUH 4W68A 3TF7C 1Q0XL 3O6ML 2GJ6D 5E8OA 2ITCA 3G6AB 1D5BB 4R7NB 4UOW0 1SMAA 1FZMA 5JTWA 3MOBL 5C0JB 1FRGH 3L7FA 2MPAH 4K23H 3U7AA 4IJ3B 4WFFE 4H1LA 1QSEE 3ZTJH 5GRUH 1F45A 5C3LD 3EYOA 1PLGL 1AD9B 4KTEH 1AI1L 1AGEA 5HHPA 2ICWJ 4GS7B 5BS0A 1ZGLM 3L7EB 3HMXL 4LLDB 4PJ7E 1B88A 1KXTB 3PWJB 4DVBB 5L2KD 5FUOH 4B0MM 3B2VL 4TRPL 5HGBA 1MHPH 1MFNA 3ME0A 3QCVL 4PGBA 4TULH 3MLWL 4XWOD 1GCFA 4F7TB 5K9OB 2HKHL 1NMCB 4GAGH 1KENL 4BH8B 3RVWD 4QWWC 4XP1H 5I1HH 3KYNB 1QLFB 1ACZA 3IJYB 1KCVL 3OAUL 3K0WA 5TDOB 3ALXA 3EJJX 2OL3A 1T66C 2V9QA 3OKEA 1J5OL 4OFKA 4D0DA 1T1WB 3VRLE 2BNQB 3MACL 4KVCL 1K6QL 4GKZA 5KS9A 2CIKB 2BHYA 4NQEE 4Z7VE 3EOYG 4J1UA 5GQBA 4JKLA 5KVEL 3KPNA 3NIFE 3I6LE 1CL7L 5K9JL 3KS0H 5IVZB 4ZXBB 4LLMB 5IT2H 1F4YH 3D0LB 4Y4FB 3T0VA 2V17H 4WUKL 4CL7A 3AMLA 1MFEL 4Y4KB 3MRPA 1GZQA 1HSAA 3MOAH 3CDGA 5ALBH 3K46A 2X70B 4HF5L 3O8XA 4PTTA 4OCYH 4RQQA 4HIEB 5J1AA 4ELMA 2Q3AA 2LE9A 1WEJL 1MIEH 2EDBA 5LQBH 5EBMA 2PTUA 3GMQA 3GMOA 3IXAB 4PJDE 3KPQA 3FQNA 3UJTH 5D2NC 4MDJA 1KYOK 1X5JA 2AP2A 4CGTA 4AG4L 5MI0B 4Y5VA 1K3IA 5EOQL 1K2DA 5I1CH 4TSBH 2W65A 2FHCA 1FPTH 4NFDA 4G7VH 2W9DL 1UG9A 4QHNA 3HS0A 2R69H 4I3RL 3FO9B 4WUUD 4J1UB 4FFZH 1J86A 1KPVB 4XNZB 4GG6A 4WDIB 1EAPA 4FQ2L 2XQYG 4OGXH 3FQUB 4KV5E 5IK3A 3PP3K 4XX1G 4EI6A 4Y5YA 1N6VA 3VDAA 2NY4B 5F3HA 1QVOA 2MWCA 3UP1A 3TBWA 3QCVH 4N0YH 4XBEL 3WHXB 3HZMB 2XIDA 3REWB 1GZPA 1RZKC 1LMKA 1JIBA 3O3EB 1CN4A 1A6UL 4UB0L 5FYKL 3HZVB 4OZHF 4P49A 1MI5D 1RUQH 5C0AE 1T6VN 4JM2B 1QQDA 2C3GA 4NYLB 2MKLC 4JQIH 4AEFA 5JR1L 1G7MB 3VFMB 5EULV 1KB9J 2XNAB 3MLZH 4CKVX 5FHAH 1CGSL 1NAML 2GAZB 4JCLA 4FQJL 2R9HC 1K85A 4WFED 4OV5B 2HLAB 4MDIB 1S7TB 4R9HA 3ULUE 3NZ8A 1X5IA 4JRYD 1UB6A 5K9JH 2V5RA 4F57H 1UM6L 1U8LA 5IB2A 3FO2A 4MNQB 1E4KA 4AT6A 3QIUA 2Z31D 2Z31A 4KXZI 4KXZH 5I15L 3VRIA 5ALBL 1I3VA 3Q3GA 4JJ5B 3PHOA 1KEGH 2EIBA 4W70A 3WFHA 3MRRA 4GG8B 3PWPB 1KLUB 1YPZB 1X7QA 9CGTA 1NGWA 3QUZA 2WWMC 3HAEB 1BQUA 2C1OB 2JTDA 1G7LB 4V1DE 1OF2A 4XP4H 2ICWI 4E0RA 2APFA 4UNUA 4N0UE 1N2RA 4AEIH 3MV8A 4LSVH 3TO4C 5DUPL 1FE8L 5LXGH 4ORGA 4RGNB 5CWSA 3CZJA 1EDQA 1FVCA 3QIWA 2W9DH 1KJ2L 3OPZL 3RTQB 1T0MB 1YZZA 2NLJB 3VW3L 3CJJA 5IWLC 2MFNA 4I3RH 1LD9A 1HYSC 2AXGB 3UYOD 3ZT5A 3MV9E 4UIMB 4FQ2H 1I7ZB 4BSWA 3JWOL 2AJUL 5F7FA 5ISZA 2YA0A 1H5BB 2FX9L 3C60A 2CRMA 5M95B 3UTSB 4U6VH 4ZPVB 1UZ6E 4LSTL 3VG9B 2YZ8A 4JHWL 3IFOA 2UVFA 4EQ2A 4UQ2A 1FLRL 3EW3B 4P2QB 3O3AB 3QSKB 5GRJH 2I25N 3CFBA 1NAMB 1FNSH 5CHNB 3PV7A 3ULUD 1QP1A 4G8GE 1SJEA 1N6QH 4YWGL 5T3ZE 3ZYOA 2C4FU 4UB0H 1CZ8H 1NCAH 4KAQL 4G6AC 4HSQA 5CD5C 2VDNL 2HRPL 3CNKA 3TBVA 3TPKA 4R0LB 3O9WA 2ADJB 1HQ4A 3F7YB 4YK4C 3CSYB 4F7MB 1BQHB 3MLZL 1MH5A 3BJLA 1KB9K 1XCQB 3S88H 5J06A 1JFQL 2B1AL 4K3EL 1MIMH 3UTZB 2EDYA 1P7KB 3EO9H 1F90H 3GMOB 1Z5LA 2BNRB 1F42A 3GMQB 3V5KA 1FBIL 3BE1H 1RZFL 4QT5B 4FRWA 2NXZD 4XNYH 3VCLA 5FA4A 1MCKA 2OTWA 5J8OA 3S98A 1JPSH 3EHBD 3QHZH 3EYVB 1NCCL 1TJIH 1G6RB 1T7YA 4U3CA 3V79C 5CD3B 3IVKA 5ID1B 2IQ9H 4OZGE 3RWCA 2NY5C 3HMWH 3P11H 2DQJH 1K5NA 4QHUA 1NCBH 3LKOA 1S9WA 1Y6MR 3G6DH 4XP4L 1NC4B 2YD1A 3ROOA 2DLHA 4LSVL 1S7VA 5DUPH 2R29H 5F1IB 4JY5L 3M17A 3MJ7B 3KPRB 1UKQA 3D85A 1U8KA 3GSXA 1J10A 5DUBA 4LCWB 1P9MC 2Q1EA 3OPZH 4JANB 5CJQH 2NQCA 2A1WH 2FDBP 1UYWL 4H5SB 1BFOB 3HMXA 5BMFL 1N4XL 4MGXA 4U2YA 5DEZA 1NJ9A 4YGAB 2ITDA 3KR3H 4F7EA 1GOHA 1R3IL 1NLBL 3U0PA 5MEOB 3DX6B 4IOFD 3OKNB 2VDPL 4MJIE 4XP5H 1PZ5B 3HE7D 5E2UH 3HZYA 4QTHA 4MWFA 3X11B 5J9PB 4JZNA 1FLRH 2DJSA 1U2HA 2NY0D 3LD8C 1E4XL 2P5WB 3Q6FB 2CXGA 1G7HB 1DVFA 5JPNB 4GLRH 2V2TB 3NGBC 1JTTA 3QJHB 3MRBA 2EZ0C 4RMQA 3TVMC 4CADB 5BVPL 3BZEB 4OUOA 5DJ2B 2ED8A 1LDSA 5IW1B 4LASL 4N8PA 4W4OC 2IBBA 4MA1B 1H3PH 5E6ZA 1KXQE 4CRPA 2KZWA 3HE7C 4R4NC 3QQ9C 1KB5A 3S37L 1DCLA 1W0WB 4ZODA 1Z0MA 2Q76B 2R0KH 3PWUB 3RWIB 3GMPB 4P4RA 5FUZH 3W0WE 4NO3A 4E42A 4POUB 1E28B 4J3SA 1U8QA 1LO4L 3SQOL 5JQ6H 3I75A 2CDGB 3EO9L 3RI5F 4CJ1A 1FBIH 3DUUB 4FZEL 5FDWB 2VDKH 3FN9A 1W8NA 5KSBA 4MJ6A 2W60B 3W9EB 3QIBC 1JNHA 4EZMA 5F9JB 1A7QL 3ARYA 4RNRA 1DLFH 1EGJA 1FN4A 3HZYB 5HGHA 4NWTL 3RWEB 2IQ9L 1RJZB 3O4LE 35C8L 2OZ4H 3I02B 4KI5D 1NCBL 5SWZA 1QSED 4GG6F 2P8LB 3G6DL 3LH2H 1DQDH 1AC6A 3FJTA 4NP4L 1E6OH 2H9GA 3V6FA 4G3YH 4DGIL 4KJQD 3HLAB 4ZFGH 2R29L 4WU7B 1G9NL 5CEZE 3RBGA 5KSAB 4K2UL 1FVEA 2NXZC 4ZTPL 2V5YA 3R1GL 4MZ2A 3VRIB 4I18C 4P46B 1UYWH 5DURB 1HHKB 1K9TA 4NUJB 1YYLH 4WGVB 3NCEB 4W4OA 4G42B 1EVUA 3H9SB 4OD2A 3GB7A 1SJEB 4U1NB 3DYPA 4D0CB 1YEJH 3DUUA 1YEEL 4R90H 4XCCL 4X6DF 2H26A 2J2ZA 1JZ8A 5E00B 3TA3B 1N26A 4NKMA 2A0LC 3UC0H 3QQ4B 1XR8B 2HRLA 5I71B 2H32A 4DJMA 2CSPA 1MVFA 5J12C 3U6RA 4LCUB 5C71A 3BGMB 3IF1A 3H9YA 1V7NH 5DYOA 2JK5B 3V6BR 2F8OA 2PO6B 4Z0BL 1LD9B 3TH2T 2QSCL 1MFDH 5E99L 3OXSB 1F00I 1KPRB 1IGIH 3WFCL 4HULB 1F5WA 1MNUH 4G5ZH 1J0IA 3WNPA 1HEZB 3EO0A 1Z2KA 1RVFL 5FUZL 2HVKB 1D5MB 4HG4K 4XNXH 4OZ4A 1UH4A 3M07A 5LG1A 1G9EA 1HWGB 1SBSL 5JQ6L 3BPNC 2E5EA 5KSAD 4Z7UE 3R06B 4JFDA 3UBXI 3BUYA 1MUJB 1OAKL 5TDPB 4FTVD 3BN9C 5HYEA 2X4UB 1RMFH 3JV0A 2Z93B 1VACA 3MA7B 2PTTB 1ZHLA 1J0JA 3ZE1E 5E6IA 3KNBA 1DLFL 3RWFA 2NYYC 3M17B 1JPFA 5GGVH 2NY1D 4ONFH 4LCWA 1HIML 3O2DL 5ESQB 5I74C 5C07B 3JWNC 4M43H 4D2NA 2X70A 4RQQB 4ELMB 1JK8B 1U3HA 3IDNB 1XMWA 3HRZA 3Q0HA 3MXVH 1OP5H 3PDOA 4DGIH 3I84A 1OAUH 3PABB 3LN4B 4HAFA 4NWUL 2JIXA 4UU9A 5EPMA 3UTPD 2ZCKH 1XAUA 1JGEB 4YZFF 1ZT1A 3BZ4A 3RWHB 4N8CH 4M02A 3REVA 1MLBB 2X4RB 3T09A 2JJVA 1AD0B 4HFUL 4L4VA 3GMRA 1G6RA 1AXIB 3DVNA 4LVOB 4OLWH 3SY0B 1KTLB 1JRHH 5GS0H 1XGQB 3ARGD 4M00A 2BNQA 5DHYA 4XPHL 1PDKA 3JV6A 5HGAB 3QH3B 4XPTH 1UJ3A 4LCIL 3ZKXC 3DROB 1FL6A 2EDLA 5IFHH 1XH3B 2VXTH 1YEDB 5I16A 5JOEA 1QFPA 3SOBH 3OV6A 2EDHA 2OI9B 1MF2H 3LEYH 5JW4M 2VDOH 1UXWA 1UM5L 1KFAH 4Y16D 3QI9B 4RWHA 3SCMD 1S8DB 5J11C 3V2AR 5B39G 1WSST 4OI9A 4R26L 1UM4H 2Q7YB 1AO7E 5E99H 4PJDA 3GSWB 1E0OB 3MLRL 4P5KB 4DTGH 4NQCE 3UPRB 1YJDC 2HVJA 4XP6L 3BHBA 3IU3A 1NBVL 4RRPA 5I8CA 5EBLA 2XZAH 5C07D 4OKVB 1KEMH 1TVDA 5IVNA 2DQDL 3C5ZA 1YEIH 2VLME 5JZ7D 4L4TE 3QFJE 4D9RE 1P53A 1ADQA 3W11C 3TA3D 3NMEA 1U3YA 3VFRB 1AR2A 1MRCL 3H9SD 1EFXD 2GI7A 2VKWA 3W2DL 1CGUA 5DJ2A 5DD3L 3C2AL 3W39A 3HE6A 5DURD 5I1KL 4OM1L 1F8TH 4NDMA 3UROR 2DDQL 2P43B 5HJ3B 2ZOKA 5IGXL 1HE7A 3PJSA 3QHTC 2H41A 4WUUA 3VXMB 1UEYA 2ITCB 3I9GL 3PHQA 2NW3B 5GS2D 2VQUA 4EI5A 3QB7C 4KDWA 4A6YL 3I50H 4PJHB 3GUTA 1NCDH 4NC2B 4NO0D 3FKUS 5FUCC 1KCLA 4ODXB 3VFVB 3S97C 4QRRD 4CMMA 4WHYH 1DLHB 4ZO9A 5JO5A 4I18B 4QOKB 1J1PH 2P46B 3S35X 1S9KC 5IROA 4K7PH 1RZJH 5D6CB 4UUJA 4Q97A 2XY2A 5HGHB 3OZ9H 4DCQA 1JRHL 1C12B 3MO1B 3QG7L 4TSAL 5ALCL 1RHHB 5FKAA 1A7BA 1ACYL 3T77A 1K4DB 1SVZA 3EGSA 2ZNWA 3ORJA 2Y7QB 4HMEA 2XXCB 3SOBL 4P3WA 3QQ3A 3BD5A 4JJHA 4ZFZB 3TH4T 4LCCB 4YHPB 1RK0B 3QFJD 4D9RD 2VXQL 2QHLA 3FQTB 3G5YB 5GPRA 3BVNB 1L6ZA 3L5IA 2C7UA 4P4KA 4X9FA 4P2QA 2DQFB 4XTRD 3AS1A 4Z76A 3MUY1 3SGDI 3LEVL 4L9LC 4W81A 2P24A 4MQSB 5FYLL 2O93L 3SDXE 4OD2B 3TT3H 2IH3B 2I27N 1CFQA 4WFFD 2DTML 3CFEB 3BWUC 1FFNB 1PJ9A 2NY0B 2IFFH 3ES6B 1EJOH 1JZ3A 2R56H 5C8JA 4ZO7A 3O9WB 2ADJA 1XCTA 4NQTA 3BEWB 5T1MB 1OCWH 1ZLVH 1Y6NR 1YN6A 2J8OA 1RFDH 1BBJA 5F7WC 1I1YA 1Y0LA 1RI8A 2HH0H 1IZKA 4L9DA 5IFJB 3NFPA 1T83C 3B6SA 3OKDA 2YSSA 5BZWB 3VXRA 4XCFL 4GW4A 2YN5A 3QUYC 4X6CA 4NC1C 3HNTL 2H3NB 1D5MA 3MRHB 3DVNB 5FGCB 1MCPL 4H25A 3WSQH 1YNTB 3QWOB 5GJTL 1GIGL 4O58L 4QHUB 1ZAGA 4R7DA 2BDNL 3GJFH 1LNUB 2ZUXA 1V5JA 3C6LB 4NHUA 3ULVL 3GK8L 1AR1C 4PGDB 1TENA 2XPGA 4HXAL 5EOTB 1F13A 1IRAY 1RZJL 3U1SH 3FQXA 1Z0NA 3X3FH 2Z91A 1TLKA 1T3FB 3NTCL 1BLNA 3VG0H 3L7EA 1RHFA 4TSAH 5GIRB 4HZLB 4B53A 1Q9WA 1EMTH 5HD8D 5KVDL 1OHQA 1T7XA 2NNAB 4YAQA 4Z7NE 5IW3A 5CCKH 3N1FC 3IXTB 3MGOA 4RIRB 1TPXC 4PJDB 3NPZB 2VE6B 2WQ8A 4HWUA 1BWMA 1B6UA 2Y6SD 1JZ6A 1ZXQA 4KQ3H 3L5XL 3PP4H 1HHHB 4LCWD 1P5UA 1MCBA 1XGUA 1QLFA 3RA7H 2KQNA 1H0DB 5IHUL 1A1MB 3NIDE 1UC6A 3IFNH 3ARVA 2XTJD 5GZOD 4KVNL 2I5YL 2QQNH 3MLVL 4ODTH 2BVOB 4NPYA 4LHJB 2PO6C 4MXVE 2O5YL 2QLVB 3K2UH 1AHWB 3OJDA 1R3JB 1B4RA 5BRZE 2R0WL 3ZDZE 5ADPL 4KK5C 5KSVA 1IGJB 4TNWK 5I8OL 3RDTC 1OCWL 3LSOB 3QXDA 2Z91B 1MJ8L 4JM4H 4XXDB 4AJ0A 1IM9B 2ADIA 3PWNB 4DW2L 4HUVA 4O02H 5DJ6B 1A7PH 4GXVH 3MGOB 1D9KA 4EDXB 4N0CD 1ZLWK 4XCFH 3GNMH 2X4OB 3UDWC 5EO9A 3DHJA 5F8QC 5MP6H 4R6UA 4P59H 4JZJA 1LO5B 2R1WB 4K3DH 2DQIH 4QTHB 2DKMA 3G6JF 4M9PA 3X11A 3WL9A 4JFXB 2IADB 4IM8A 1CWVA 3WSQL 3KYAA 2PYEB 5SWQB 4O58H 1KT2A 1MFCL 5F44A 4MQ7A 3GSNB 4NM4L 3GGWB 3WLBB 3ZDZF 5JIIA 1TVHA 5E9DA 4KI1A 3L3KA 3ZT6A 1R3JA 3BH9B 1IAII 3FZUC 4MAUH 5LAXB 1K3ZA 4EXKA 5C0RL 3U1SL 2VZSA 1JTOA 3NTCH 1X3DA 2Z31B 2BNQD 2CMRL 1Q9KA 5LKNA 2AJZB 2WUCH 4M7LT 4M6OL 5JOPE 2D31B 2QADD 1F2QA 1NDMB 4HH9B 1TNMA 2JJSA 5KG9B 4M3KB 5TQ2L 4G8FB 1KLUA 1YPZA 5IEHA 3QWRD 1IT9L 3WMSA 2FO4B 3ZKXB 5FO7A 5JO5B 3EHBC 3VMOA 2QKIB 5D2NB 5T1MA 5ELIA 4M03A 3DX7A 5INDB 3DVFA 4FHBD 4JM2A 3IKKA 4JZOB 3MCLL 4QEGA 5C0FA 1CK0H 1J8HB 2QADC 5FEBA 2P7TB 3FOLA 2ADGB 4JPIB 4X98B 5EZLA 1BX2B 2VDML 2D7QA 4PJEA 5LWYL 2AXGA 4PJ7F 2MJWA 4R97C 5E8DL 4LHUD 3SDXA 1C7TA 1FZOA 2OMBA 5GGTA 5I8OH 3V52H 1YA5A 1CQKA 4FOMA 4LARH 2CDFB 3IETA 1DEDA 4KKNA 3FQTA 3TBSA 2C7UB 4P4KB 4UQ2B 4Y88A 2DQFA 3IKCA 4P4KD 2VDLH 4JRYB 4FQCL 5EUOB 4HK3N 4UMGA 3V6ZA 1ZVSB 2E7MA 3D2UA 2V7HB 5CP7B 1S9VA 1A4JA 4Y2DD 3WFEH 1FNEA 1OF2B 5E0QA 4E0RB 4P59L 4ZUUB 2ZUTA 5DJZA 5HPOA 1LP9A 4H20H 3CZFA 5HHOA 3S3JA 4NFCA 1EZVY 32C2A 3FFCA 4OI8A 3NACL 5FV1L 4UT9H 5DRNA 1XGRA 4R97B 3BH8A 4FABH 2LFGA 5GRVK 2O5ZH 4EOWL 4P2RE 3IJHB 2VIRB 5EBMB 4DZ8B 4M8QB 4O51A 3P4LA 1KV3A 1CFTB 3D39B 4I2XE 1SYVB 4MD5B 2WK2A 5HHQA 1ITBB 1BHGA 1M71B 1EEZA 4OCSL 4Z7VF 1U58A 1PX4A 2HFFA 5I1IH 3L3IA 3NABL 3NCJH 4X4ME 4L3EA 4OFPA 1ZMYA 2IEPA 2Z8RA 3MZGB 1S7XB 5D2LE 1CFVH 3GMLB 2NW2B 4CW1B 4CVXA 5TQ2H 3N1MC 3OJDB 1AHWA 1YYML 1QD0A 1S9XA 2ESVB 5EBWA 1FV1A 1HDMA 2EECA 5EB9A 2VISB 4P2OB 2VNCA 3CD4A 4Z7WB 4LHUB 2PXYD 4KDVA 4OIIH 4OGYH 3QXDB 1N5YH 3KPRE 3CZFB 3A0OA 1R5IA 2NZIA 2CH8A 1YECL 2GJZB 5CFHA 3PP3H 4A2LA 3DURB 3QRGL 4JG0L 4X7SH 4MCZA 5HD8C 3V9FA 2OJZL 4LFHD 5LWYH 2D7TH 1AGFB 1U8OB 4RFOL 1A8JH 3OL2A 3CFIC 1P7KA 3EFDH 4YBHA 4YPJA 3PG2A 5F9WB 3V5KB 1DBBH 4GRLA 4O51B 3NOIA 5CJBA 1P9MA 4PBVC 5CMAA 1XGTB 3T3ME 1GYAA 1LHZA 1R3KB 1B4JH 1TTGA 4I3SL 2GK2A 3MRQB 3SEPA 3VFOB 5BQ7B 25C8H 3VWJD 3ZYZA 4FQCH 4X5XA 1TMCB 3F7QA 4PJ8D 2DD8L 4WFHE 4WTXA 4PRAA 1CIUA 2ESVD 3HE6B 4DGVH 3VFPA 4OBSA 5KAQG 5EU7E 4P23A 3P3YA 1XH3A 4R4BA 1M6OA 4FFYH 3N85L 3UJIH 4KKLD 4S0SD 4K7PY 1BFSA 2EDEA 5FK9A 1QBLL 1ZHNA 4TNWF 2X1PA 3EOAA 4XXDA 1TNNA 3WKNA 5CGYD 3SO5A 1OGAE 4PLKD 1G7LA 4LNRB 4U1SB 3QZWB 4NZTL 2VLJE 5C0IB 5FM8A 1WC7B 5D5MF 3F8UB 5GS0D 1K4CB 3QAZB 3QEGH 4NJ9H 3TESA 3I2CL 4XC3H 3D48R 1NUFA 2D4DA 3FAWA 3S5LG 1KG0A 2C3HA 2ENYA 4JZOA 1UCBH 1RHHA 1CFVL 4NN5C 4KZEH 5I8EB 2GEEA 3HG1A 1CBVH 4XTRC 5F9WC 1YYMH 3U2SA 5LJYH 4JFPB 3H0TB 3BQUC 4HJ0C 5EWIL 3F5WB 2AJSH 1SM3L 3PXHA 5FXCH 2Y9RT 1MSPA 3LQMA 2A74A 1KF9B 4JHAH 4LLWA 1C16B 3RGVD 4LQFL 3RGVA 5F6HI 1ZANL 3NPSB 2WQRA 4YHIA 1N5YL 4MQTB 1I1CA 3LKSB 4TQEH 4ODVH 4FQHA 3HCVB 4I3GA 4KPHH 4NRYB 4C57C 3JWDL 1EV2E 4RMRA 3W9DB 2AEQH 3QAZC 4J8RB 4M3JA 1S9VB 4GQ9L 1DBBL 3PWPE 4U1SA 1R0AH 1J8HD 1X4ZA 3VA6A 4CVWA 2DQTL 5IWLA 3BZFB 5HSFA 2W0LA 4NGHH 4I3SH 1Q1JH 1WICA 2IALB 3QDGE 2LVEA 4XAKD 3L5HA 3SDDA 4YDLC 5I8KH 4HZAA 4F8QA 2E7LC 1WITA 1HHGB 4HHAA 4DUWA 4N90D 4WI6A 4PGBB 1OWRM 3BGFB 1RUKL 3MLXH 2YSSB 1S5IH 3QQ3B 4TUJA 1SYVA 3CSGA 2DQGH 5GS0C 1FNGA 2YUZA 4HDIA 5IMMA 1I3UA 1WZKA 1FVEB 5I1GL 5T33H 1IGMH 2DJUA 3AXLA 4QXGH 5FYKE 5F72S 2OK0L 1GHFH 4UOJA 3SGKC 2GTZB 4D0BA 5DT1H 3C6SB 1IBGL 4Z5RA 5FDYA 1ZHBB 3MRNA 5BOPA 1INDL 3DROA 2ARWA 4TPRL 1FV1B 1HDMB 2H45A 3W11D 2VUYA 4Z9KB 1JN6A 3HAEA 3NPSC 1DANT 3MJ9L 2PYED 2G2RA 2EDJA 5IV2A 3ULUL 2W0FA 4EBQH 5HVWA 4XVSH 4YUEL 1JHKH 2DLIA 1TVBA 3WXWL 2UYLB 3D85B 1BLNB 3GSXB 5GGRY 1NSNH 4XPGL 4PJ9D 4YXLH 2IALA 3K74B 4LPTA 5GS2H 5C0BD 2B4CH 3L3OA 3MROB 1WIPA 4JFFD 3SCMC 5F1KC 3CFDB 3BPLB 1EZVX 1BD2E 1L0XA 4PBWD 4M8QA 3D6GA 4QOKD 3WKML 1J1OL 4G8GB 3ARDD 4LP4A 4JHAL 5CINL 4GRWE 4OTXH 4R8WH 5L2JB 4JDTH 4WHCA 3V7AG 3O4OB 3QUMB 2GTWB 1C8PA 4LEOA 3EYVA 2AABH 4WEUD 1LO3L 1T1XB 4OZHB 1T21A 4KMLB 3O6FD 3AXLB 4X7TB 3UYPA 3OXRB 3VFOA 3VXUB 1LP9E 1JWMB 1QEWB 4EEEA 4OB5H 1FIGH 2ZOLB 1FYTE 1HCVA 2BJML 3IFLH 4UTBH 3KPNB 1MUJA 5HDQH 3EYFA 4PRHB 2FJFB 1L7TL 3GM8A 4KMTH 2DBJA 4X6BA 1JZ2A 1CLZL 4JHBA 4YR6A 1QR1B 3MA7A 4YQXL 3K3QA 2PW2B 4XCNB 4L8SA 3VFUA 5GHWH 2IH1A 3GSNH 5I18L 1AY1H 4AL8H 1ZT7A 4TTGA 4XPFH 4DFIA 1CLOL 3R4DA 3STLA 5ESQA 3UTSE 4GXUM 5I75B 4WI9A 2HJKB 3J7HA 3ZDYF 2JKXA 1EIBA 2GYSA 4HIIA 1I9IL 4I0CC 4KK6D 1FFRA 1CXEA 1KJ2B 1MCDA 5JDSA 4NQEB 1BOGA 4L4JA 5JUEH 4UIKL 4PJXB 5C0DB 4F2MB 1S7RB 2RFXB 2DI7A 3BT2L 3U30B 3BN9D 1GHFL 5DRWB 2JELL 4ZUSA 1EO7A 3RAJL 3IS1X 4OZHA 3NA9L 3G5XB 5E5UB 5BV7H 2DKUA 3MFGB 1JNLH 4TPRH 3RL1B 5JORA 5A1AA 3BRDA 5TDNB 3KLSA 1S9WB 2F8VA 5DDHA 3DMMC 5T3XL 4C83A 1P4IL 4W6YB 5L2KE 3WXWH 5IK3B 4BUGA 3KLAB 1OAZL 2BRQA 2HKFH 3WIIH 4P46A 2AJZA 5TE7H 2KZ1B 4YXLL 3O8XC 1A5FH 2HMID 2B4CL 1Q72L 4ETYA 4NO5A 1YY8A 2YK1H 1MCFA 5EU7C 4UDUA 1JNNH 5GJSH 1IQDA 3EDDA 5B8CB 3MOQA 1FL5A 1LEIB 1QFHA 1VADA 2WZPD 1G9ML 1O7SA 4LPYA 3QZWA 1EXUB 4YHNA 4P5KA 5CINH 2A0LD 4Y5VC 5CS7A 2O5XH 2FGZA 4RCAA 5DRXB 1I1AD 4JB9H 4M5YH 5C09D 1FC1A 4RNRB 3U6RB 3CSBA 4Z8FL 4JZNB 3S5LB 4YHKH 2M26A 3MO1A 4OLVL 2AQ3A 2H8PB 4Y16B 2J5LB 5BZDA 1SYSA 4HFWB 2AQ1A 4FXGA 5CILH 4K8RH 1KIUA 4GJTB 1YUHB 3WLBA 4KMTL 3NZ8B 4WTZA 3CLFH 5JORB 2WBJB 3DVGA 3V4PH 3LAFA 4HS8L 3MV11 2ZG2A 1FRGL 4JFEB 1DEEB 2MPAL 4K23L 1BGXL 1NFIA 3QEHA 1AGDB 4U1IB 2R15A 3L6FA 4P4RB 1FZKB 2Y5EA 1WFUA 2BY2A 2IG2H 4A2MA 2LU3A 3KJ4B 3DV4B 2CXKA 5FO9B 3BKJL 4NJAL 1NFDF 4D0CA 3SKNB 5JUEL 3HMXH 3VFGL 3EYSL 4Q9RH 3QIBD 1EHLH 1KCKA 3T0AA 2AGJL 5F1OB 1KACB 3MLWH 4GBXC 5D96B 1S3KL 4GAJL 2YN3A 3RUGF 2CGRH 3GI8L 1YQVL 5E1HB 1YMMD 1XF4A 1QFUL 1S7UB 1WV7T 2ILLA 2UWEF 2VERN 2IBZX 1RD6A 1KC5L 4CU8A 3B6SB 2LQRA 1YNLH 1XGPA 4GW1B 4NO0B 4E9LA 1WFNA 3HR5B 5TF1L 1JF1A 5IB5B 3BX7C 5J3HC 3NFNA 5TE7L 2BP3A 1KB5H 2YA2A 3LPWA 4J4PA 1DN2A 2E6JA 1IAOA 4O9HL 1Q72H 1WWWX 3NCBB 3PGDB 1ZVHA 3MNVA 1AKJD 2FWOB 4G8IB 4RA0C 3CSPA 4YIQA 3SDYL 3VGDA 5IQ7L 5EBWB 4F80A 2GSGA 1LNUA 4WUKH 4H1LB 3RPKA 2IH3A 5JW4Q 1GGBH 4U1NA 3MNWA 4IOFC 5JHDD 5HDBE 3KYKH 2QR0B 4HF5H 4DKEH 3RU8L 4YE4H 3U4BH 3KJ4C 5HHVH 3FFCB 1NL0H 2PO6D 4JANA 2NTFB 4QYOB 3UJTL 1TZIB 5FA3A 3TZVD 4NKIL 5GRWA 1L7IL 3ZT7A 3U7WL 2AK4B 1FNHA 3DSNA 1NJ9B 4QRRA 3D25B 5F8RC 1Z5LB 3IU3B 3V4PL 4HGWB 1JGEA 4JO4H 2D03H 4NO0A 4HUXB 1BIIB 1XF5B 1BGXH 5E6ID 1LE9A 2Y6SC 5J9PA 3VXOA 5L0QC 2ICWB 3VFRA 5DQ9B 2P5WA 1SVCP 2JB6B 4M1DL 3H42H 2J5LC 4PJ5E 4JPVL 1JL8A 4JFDD 5E5MB 4JFZH 3RVVC 1NMCC 4HKZB 3UMTA 2JCCB 5E9DB 2VZTA 4NN5B 5LAXA 1OP3H 4U6HB 1WCQA 5DJXB 3P4OB 5LVEA 2XZQH 1E6JH 4J4PC 5D1XD 4JGUA 1ZE3C 2C3WA 3PHQB 2LABA 4GAJH 4YPGB 1T3FA 5KANI 1DJSA 2EC9U 3FTGA 3WNNA 1YQVH 5GIRA 3SDAC 4DOHE 1NFKA 4MVBD 5F89A 2FEDD 1A6UH 4OZIB 2HTLC 2OJEB 1Q38A 1DL7L 4WTZG 5CSZB 3PABA 3P73A 1BAFH 1KN4H 1N6UA 2HLFC 5FYJU 2ATKA 2ICEA 5C08A 5FHAL 5B22A 3ARFA 5BVJB 2I60H 3NIGF 4IHOA 1CR9L 1KB5L 3VFSB 2V9RA 1MHCB 4W6XB 2EDDA 4UTAH 3IDMB 3SGJA 5I19L 4PJIE 3KPRD 4PJCE 4F57L 4LSQL 5KTEH 4KV5F 4CBPA 4S10A 4OZGA 3WUZA 3QZWG 5EOCJ 4FMFA 3OF6A 4ZFZA 3QCTL 1M6OB 1GGYA 3D3VA 3O6LH 1KCRL 1KEGL 3DRTA 4JE4B 1CCZA 2EICA 4YE4L 2E7CA 1Q9KB 1HYSD 4NO5B 5E8PB 1N7ML 1OGTA 5AYQA 1J11A 1EK3A 1TQBC 1EFXA 5I0ZA 5IVXA 1ZEAH 4OD1H 4LNRA 5AG8A 3HUJE 1JPST 5E94A 5KSUB 4OFDA 4LVHC 4RA3A 4MJ4A 3V5DA 5C07E 4PJAF 1HKFA 4O5LL 5CWSB 2WLYA 5EC2A 3WV0A 5AUMA 1WJ3A 5HXMA 1QKZL 4YNYB 2YMXH 5E2JA 4I2XA 2Y7QA 5C2BH 4JHWH 3OXSA 1KCUH 2WBJA 5EZJA 5ACMA 1UB6B 4JM2C 3HUJA 5ENWB 3AVEA 1DBAL 4PV8A 4UZGA 3T4AB 4LSDA 3AU1B 2VLKD 5DMIL 1CL7I 5GGQH 3O45B 2G9HA 4N0FA 4U1JB 1MCEA 2P5ED 5D7SH 1N6QL 3HNSL 1NCAL 2G5RA 2UWEE 3DO7A 1DL7H 4D9QE 1AP2A 1BZQK 4OLYH 3PWPA 5TDPA 3DPBA 5INCA 5IB1B 2FRGP 1QSEB 3V4UL 2C1OA 4GBXA 3ZE0F 3MLSL 1CDIA 4C55A 1HZHH 1BVLB 4PD4J 4WEBH 2I60L 3HC3H 4ALAL 3MRDB 1T83A 2J12B 5IBTH 1YN6B 1MQ8A 1OTTD 2RBLA 5AAWA 1BQHA 4N0UA 4JFFB 3L3JA 4ORZC 1ADQH 3L1OL 4E41B 2BHUA 2AV7A 4PRBA 1I1YB 1R5WA 1V3LA 2OTUA 1T5XB 4JPKL 1VEPA 3WYRA 1EEYB 3EO1B 3HRPA 4HGWA 1UXSB 1NCCH 1XGPB 4GW1A 4V1DB 3J8F7 3S7GA 4HUWB 1H9VA 1LO2L 3PWPD 2J6EL 2IBZY 2O26U 3W81A 4BH7A 4BZYA 2D2OA 1SHMA 3L3IB 4FS0A 5D2LF 3BVNA 4F15B 1KTLA 3RL2A 4RFEA 3VXUA 1CE1L 3BUTA 1N7MH 1OTSD 1QLEH 4F33B 4Z76B 3KLHC 2GKIA 1FGNL 4G6MH 2J8UA 4PS4H 2QL1A 4YEFA 4OBRA 2DOCA 3D69A 2EH8H 1HNGA 1V05A 4HC1L 3FONA 4GS7C 3QDJB 4NZDA 2GW5A 3ROOB 1NC2A 2GIYA 5CJQL 3JWDC 3RWDB 3LS4H 1CFQB 2A1WL 1FNLA 3CFCL 1PD6A 1CDBA 1QO3B 5FYLD 4YX2H 4O5LH 2VQ1B 2YPVH 4JQXC 5HYQA 1JPFB 3UTTA 1N4XH 2YXFA 1DQLH 3UYRL 1A6AA 4M7LL 4N0UB 1VSCA 2W9EH 5B38A 4K71B 4OZIA 2H6PA 1HOCB 2EEBA 4ODSL 5IP4A 2Z35B 4M62H 1ED3A 3TBYA 4KRPC 1JUFB 2XICA 1NCTA 2F8XC 2K7PA 3E3QC 5DEFB 5SWSD 3OKDB 1CVSC 1JHTB 3VE0B 2R2CA 2BVUA 1HH6B 5GGQL 2HWZH 2A6IA 3DETC 4UQ3A 5BVPH 1H15A 2MNUA 4POZD 1FNAA 3RNQA 1JGUL 3CXDL 3IGAA 3OR7A 4LASH 15C8H 2XNAA 1MCWM 1JBJA 5GRZA 2N7BA 1H3PL 4HCRH 3WS6C 2YUWA 5EFIA 3S4SA 4Z0XB 2OYPA 3T0EE 1AXSA 3LEXA 2NYYD 3MLSH 3O3DA 3FO2B 2VISA 4P2OA 4WEBL 3VGHA 3PQYE 5C9KA 4OAWB 4JFQB 1NC2B 2OM5A 2YEZB 3RVWC 1LO4H 5HGDB 3SQOH 5IBTL 4WW1A 4HS6A 3FHQA 1I7RA 3PNWA 1ZHNB 1ADQL 1T0NB 3FTGB 1EHAA 3KPRA 3CVHB 1FSKB 4NRYA 4JZJC 4YHZH 4H8WH 1IKNC 1A7NL 2ZCHL 4QF1B 1EGJH 1Q9WB 1CD8A 1A0QL 2PUQT 3LMJL 3MRIB 2IANA 2Y5TA 2E9BA 3QUZB 5IEKB 5MENE 3KPOB 2WP3O 3P73B 3QUYB 2R0ZH 3V5HA 1BWWA 1MFBH 3C5ZB 3KYOA 3QDGA 3JTTA 4X4XB 4I0PB 2I24N 3HI1B 3ZLQC 1FN4B 1M4KA 4L4TA 4PB9L 3S5LA 3JUYA 4DK6A 1XIWD 1ODAA 1DVFB 3T2OA 1RSFA 1UJ3C 4EDWH 5L7XL 1G9NH 1SYSB 2HJLB 1AQDB 5GGUB 5T1DH 1IEHA 1CG9A 4M6NH 1XZ0A 1F4XL 3L3GB 5EG6C 3FO9A 1LVEA 3VXNB 4NBZB 4P5TA 1EAPB 3TIEA 5JPMA 3GM0A 4LLQB 5JMRA 4X7FC 1MY5A 3UYRH 3U0WL 1WZ1H 4ETQA 3CVHA 3PL6B 1BMGA 4K8RD 5DJ8A 5FGBA 1V3JA 1TCMA 1DE4B 3P0VL 5HDLA 5DMKA 1HK6A 3WCYA 4YDKL 3H9SA 4ZTOH 1MJJA 3REWA 2FJHB 3SKNA 4G6FB 1D9KB 1XGYL 4EDXA 3AMKA 4GMTL 4PIRF 3V5HB 4DZBA 1T2QH 3CXDH 1CFSA 4TN9A 1MFDL 5L88H 1TJHL 1OSZA 2R39A 4HCRL 5TPWH 4YXKL 5GSRA 2XY1A 4NRZA 4UT7H 4MZ3A 3ARUA 4HWBL 2PXYB 3BN3B 3F5WA 4JGJA 3GJEB 5DK0B 4EVNA 1B2WL 3O4LD 4P5TB 3D9AL 1IAIH 2R2HB 1LK2A 5I76A 5JHDA 2BSRA 3GBNL 5D71L 3MRHA 2OL3B 4HQQH 4HEME 4HC1A 4OLEA 5F71A 3SJVE 4D0BB 1A0QH 3LMJH 3BW9A 3WFDL 5IJKC 3F7VB 3D5OF 5DLMH 5KJRH 1TZHB 3HN3A 1I7TB 2MKWA 2IPTH 2X05A 2R0ZL 1PG7X 2Z8VC 5GGSB 2E7HA 2XZZA 2A6JB 3NA4A 3VWKB 4I8DA 3MJ7A 3OJVC 3P2TA 3CX5K 4PB9H 4N9OB 4G6KL 3CDFA 2VXVH 3BOVA 2EZ0D 4IRJA 1HOCA 4LF3A 4IOSD 3GIZH 3E6FB 3VDCA 1H5BC 1Z9LA 4RBPK 4BKLA 3QJFA 3CFJB 3RGHA 3SDCC 4V1DA 2VZVA 2NPLX 2CLRA 4DGYL 3RZCA 2D9CA 3SE8H 3ZE2E 3SE9L 2R4SL 2BXYA 4KFZC 1IC5L 2HKHH 4IRSB 4JAMA 4QXTA 3RL2B 1G7HA 3TJHD 4NC0B 1KCSH 1A21A 4FQXB 5C09E 5ITFB 5A2FA 2Y1VA 3IS0X 3LEYL 2VLJA 2BMKB 4ONHA 3MV7B 4XMLH 1J5OH 4GMTH 4ZNEE 1T5WB 2EO9A 2P49B 4POZC 2Z93A 4X6BB 3CIQA 1I8IA 2QQQA 4U0RC 3MACH 4KVCH 4OCRH 4JO1H 2W0FB 1IEBB 1ZVYA 1J05A 2C1PA 1I75A 1UM4L 1INQB 1TJHH 4KRPD 4H8WC 5E5RB 5CKGA 2NTFA 4UDUB 1NBVH 2H6PB 1Q8MA 4UT7L 2EDQA 3QNYA 1MAJA 2W91A 1GGCL 3T04D 5KSBB 3IXAA 3QUYA 2YA1A 4G8GA 1WC7A 1JHTA 3D9AH 1QYGL 3MJ9A 4H26B 3LN5B 3KXFB 1NAKL 1MREH 1C5DB 1QQDB 2XOTA 3C2AH 4NYLA 4P23C 4Y4FD 3BPOB 4X9BA 3KLHD 1F8TL 2CKBB 5DLML 4P2OC 5KJRL 3QDHA 5AZ2L 4OLXL 3KPSD 3TNMB 4X6FB 3DVGB 2BK8A 2R1YB 1NC4A 5DO2C 3A6OA 4JO3H 3JVGA 5CD5D 4JFQA 2FIKB 3G04A 2Q8AL 2WBJC 5EIIA 1ZSDB 5BRZD 3UX9B 2MSPA 4XNQA 3O4LA 5H8DA 4BK4A 2R0LH 3HPJA 1OARL 4JRYE 5IMOB 1UXWB 4Y7MA 2ORBH 5DR5H 3BPNB 4FFWD 4HUVB 3D87B 4JFYB 3CU1A 5T3ZD 4U2ZA 1FJ1A 1KTDA 3RPIA 5J57B 4JGMA 4KK8C 4N90E 5DEGB 3N0PB 1GAFH 3NFSH 2BVPA 5D7LE 4F9PA 3GSWA 3FB6B 3OZ9L 4Y5XC 1F97A 5DVOA 2HVJB 4F7EB 2ICES 4NQEA 2P8PB 1NFDA 2IPUK 3F12B 2R4SH 1ACYH 4ZO6A 4NO2B 3PWVA 2F58L 4XGZB 4KJWC 1RUPH 3A6BL 2W07A 2PYEA 3V7MA 3VD4A 3FB8A 4M8VA 3QXTA 1U91B 1CDJA 3QULB 2ZPKL 4PR5A 3U4EA 4CNIB 2VXQH 1U3HC 4WV1B 2AK1H 1CGSH 1NAMH 3KAAA 4FQJH 4BFGA 1ORSB 1N64L 3UJJH 2CUIA 2WWMD 2BY0A 1FO0L 2DL2A 5ANMB 4ETQB 1I8KA 1UM6H 2EDOA 1C08B 3MLTB 4OGAC 5F1NA 4XP9L 5C1MB 4KROB 4L4VD 1KTRL 3PV6B 4NQVA 4LGRB 3HE7A 3MV9A 4PJAE 2RJMA 2YKLL 2E7LA 1EAJA 4JR9H 2BSTB 4JY4A 5KVFL 2ZUQC 2K9UA 4KY1H 5CSBA 3O3BB 2B4CC 2X1XR 4WW2A 3U46B 2HTKC 3ARZA 4YFLF 4DCQB 1U3HD 2OBGA 3QCUH 1KG0B 1XGRB 5J56B 3PXJA 1J8HA 5F7YC 5CSGA 5KSBE 4NBYB 2OXHA 1FVDA 3TYFA 1NQBA 1UGNA 5E1AB 5F7UA 2C3XA 5DRZB 4F7TA 2QQKL 3QPQD 4KHXL 5K9OA 3IDJB 4UT6L 3DVIA 5FYLE 3V0WH 1I9JH 4BZ2L 1BD2D 2R0LL 4HAGA 4NQCD 3OGCA 3LQAC 2WWKO 2CO6B 4Y4HA 5J6GA 1WAAF 2FX9H 1C1EL 1KJ3L 3C9NA 3GIVB 4YBQC 2UV3A 4RAVA 4OD3L 2X1QA 3MRKB 2DQCH 3CXHK 3MV7E 2OR9L 1ZLSH 3DUHA 4HX1A 5I16B 3GB7B 1D7FA 4LDOB 5IUSA 3Q1SL 2YPLE 5SV4A 1HKLH 3GKZA 3UBXG 2GJJA 5T1LB 1RUAL 2YD6A 5EORL 2F53A 2H32B 4G8GD 4PPTA 2VSCA 3KLDA 4LHUG 3EYUL 3HAEG 4HXBL 4APQA 3LKRB 4NUGL 4NN6C 3UZEA 3O9WD 5C6TH 5IHUH 2ZUYA 3WEXA 5DEFA 3G9VA 2KL6A 3IDJA 3MLVH 5IFAH 1N64H 1JFQH 4YO0B 3UJJL 5HHQB 4C4KT 3D0VB 3ULVE 3N9GL 4XCEB 1FO0H 4MAYC 3DX8A 3BE1L 5T3ZH 2B1HL 4KUCD 1T1WA 5ADPH 3FT2A 3MNVB 2GTZA 1UZ8B 3C9NB 3GIVA 5BRZB 4GKOA 4Z95L 1F11B 3T0DA 2VLLA 3T0EC 3F7RA 5DWUH 2WAHA 3SJVB 3Q5YA 3QDJA 2FIKA 3G04B 2PW2A 4JR9L 4M7ZB 1UFUA 1QNZH 3P11L 4N68A 2BNUB 4RGOL 5AWNL 3BP7A 1EJ6A 4EI5B 1A02N 2PN5A 1DQTA 4V2BA 4F9LA 5AD0A 3BGFC 3AGVA 1KYOJ 5HHMD 1A6ZA 3C2SA 1PFCA 1UWXK 4L29B 2MCPL 4MB4A 5E94B 2W60A 2XV6B 3DOSA 3DXAD 3OBAA 3SDAA 3BRFA 3ARFB 5BVJA 1L0QA 4WNQA 1TCRA 1UADC 3OKYA 2GSIB 1CGXA 4XWOC 4Y1AD 1C1EH 1IGYA 1NBYB 4PG9B 4IRZL 4MAUL 4PRIB 3VI3E 2VDPH 2OR9H 1SJVA 4X4MA 5D1ZB 4HJGA 3QA3B 1TJGL 4I1NB 3VXMD 2Q86A 2WUCL 3MUHL 5KOMC 3B2UD 4WDIA 7FABH 3VXNA 3V7AE 2DLFH 3BKYH 3GKWL 3SJVA 1ORSA 5L0QB 3MRMB 2D7PA 4PTUA 3B9KC 2E3VA 3H6JA 1IAMA 4LOUD 3Q6GH 2BX5A 4L4VE 4F7CB 5I1JL 3MRJB 5H35B 3STLB 2CK2A 1S8DA 4HH9A 3H3BC 3KPTA 4GKSA 5EH1A 3NH7L 3C60D 4TSCH 5D72L 5IJVB 1AIFB 1WZLA 1GZPB 2YXMA 4MJ6B 1CLYH 2DIJA 4ZAKC 4P2QE 3MLYL 3RHWF 4HK0B 5A16A 4DVBA 5T3ZL 2VDKL 3WNLA 3VFMA 2LAGB 3DGGB 4M48L 4LARL 5FECB 4HT1L 4P3DA 3HC0B 4U1LB 2CJUH 1CE6B 4PJGF 4P3CL 4Y0GA 2XFXB 4HUWA 4OV6F 1G7JB 5JOPD 4ZS7H 4LHQB 5ENWA 3QUXD 2VDLL 4FN0A 1DFBL 5AWNH 3SE4A 4C83B 1DQDL 4NP4H 3U0TA 3PIQA 1EERB 1HH9A 4X9GA 3RZCC 4OZ4B 3LKSA 3ILPA 4H25B 3WFEL 4R4FH 5DJ8B 4HIXH 2BZDA 2E27L 2V5SA 3BP6A 4K2UH 4PJ8B 4XBGA 4ZOCA 5C0AB 2L4OA 5MEND 1BZ7A 3BO8B 5HHNB 2X4UA 4Q9QL 2FHBA 3HHRB 2XPGB 2PTTA 1EXUA 4YHNB 1I1AC 4R96B 3VFTB 3VFWB 1VHPA 1V8HA 2QJDA 3B83A 4HKJB 5DZOA 3VWKA 5IMLA 4E41E 3JV4A 5DD1L 1RIVL 4IRZH 3TO2A 4JFFE 4LCUA 4R90L 5B38B 5IG7B 3LS5H 1JZ5A 3QG6A 3NCMA 4ZPTA 1KIRB 2GY7B 2H2SC 4PRHE 5FKAB 4HUNB 1BBDL 2HMIC 2DF3A 1D5XB 5C7XL 1SY6L 3O8XD 2EIZB 1OP5K 1P7QA 2JIXB 2BOCB 4GSDL 1V7NL 3GKWH 2WV3A 3OB8A 5CEXB 4EVNB 3T1FA 4Z0BH 4FTVB 5CZVH 3RJDA 3IFOB 3QEQB 4OJFL 5EO0A 4PYHA 5I1JH 3MYZA 4U1KB 4ZG1A 3IKCB 3L6FB 12E8H 3STZA 4FQXA 1FZMB 1RUMH 4ACPA 1B0RB 3KHOA 1BJ1J 1FO0B 4OAWA 3P4OA 1EHXA 1JN6B 4H0HB 3SE4C 3EYOB 3N1QC 4R3SA 1NANH 2PW1B 3FT4A 4XRCA 4XNZC 4RGMC 1HHIB 1RJYA 4RFOH 4Z7UF 1F6FB 3WXVL 3CSYA 1OTUC 2GJZA 4H0GA 3TBWB 4M48H 4LPXA 4IRJB 2E6QA 1A9EB 3X13B 1T04A 5GGVL 2VC2H 1HIMH 3O2DH 3MV01 5F7EL 5BZWA 3VXRB 4B41A 4P9HC 5E2VH 1A3QA 4KRPB 4AH2B 5IB5A 2YPLD 4BA8A 2ZUQB 1OAUL 5T3XD 4DGVL 2CLVA 2ZCKL 3SY0A 3HKFA 3OXRA 3QYCA 4GMSH 3DO3A 4HIXL 1AQDA 4PRPA 2CKBA 5T5FL 1QEWA 3WIFA 3C8HA 4FFYL 3TH3T 2YPKA 3LKPB 1I8MB 3UJIL 5IR1B 5JHLH 2VLJB 2D0GA 4MA3A 4OLWL 4NQCA 1S7SB 4PJHF 5DDHB 4UILL 4X6DE 4XHJD 4WV1C 1VPOH 2ICCA 3RWGB 4XPTL 4CN1A 5DD1H 3GO1L 4Y19D 4CVUA 1N59B 3NCYP 3SE3C 4PJHA 2BSSB 5E8EA 3DRQB 2CIIA 1U8QB 5DGQA 4PJ9C 4I48B 2A73B 5DJDB 5C0EA 3S9DB 1UM5H 4J7RA 3UPRA 4D9LH 3OAZH 1BOGB 3FQRB 5J1TC 1T6WA 1WWAX 4CU7A 4KZEL 4K94L 1MRDH 5CZVL 4R2GC 4GH7B 4F2MA 2GY5A 4OJFH 3MLRH 3L95A 1WGOA 4DTGL 3WDHA 1C12A 1F4HA 4QXUL 2AJSL 1OPGH 3IB4A 2C5DC 2DQDH 1MCOL 3FB5B 3N1GC 3NCYS 3TCLB 1S9YA 3CC5A 4HCRA 2B5IC 4FQQA 3TFKC 4BQ8A 3GSOB 1CF8L 1VA9A 1B3JA 2Z92B 4ODVL 3TIEB 3QO1A 3MRMA 3IU4H 3N06B 3BQUA 2A6KB 5J11B 2X10A 2UZXB 4MD0A 5I1KH 4P5TD 5FYKD 1R0AL 1E28A 5CHNA 3U9PH 2DQTH 2CIIB 4KQ4L 4QF1A 1FDLH 1V7MH 5DTFA 4AENB 4ZAKA 5ISZD 4A6YH 1HSBA 4LSRL 4MA7L 1DUYA 1F3JA 4ZO8A 4HLJA 4GAYB 4KKAD 5I1AB 2BSTA 4JY4B 4DZBB 2ATKB 2C3VB 5F21B 2R1WA 4K9EC 3FRUB 1YEGH 2ADFL 5MHSE 5D7LD 3TPUB 3LV3A 1AJ7L 3CX5J 3CH8A 1J1PL 3SDDB 5GS1B 4L1DA 1D5XA 4LQ1A 5I1GH 3VXSB 1U8IB 3L3KB 5DK0A 2J7LA 1CGYA 4RAUB 4JO2L 1OM3L 1NC4D 4NQXA 5B39A 1PAMA 2CLZB 1GC1H 4LP5A 4PJGA 3RDTB 4PJFB 3MJ9H 1UA6H 2ZWLT 5J6HA 4YUEH 5C0AA 3B4NA 4ODUB 1JHKL 4OM0L 1CXHA 3MRGA 4AQOA 2LTQC 3VWKC 3L9RB 4NSKA 3H9SE 1D6VH 1VACB 5GRVL 3RWDA 3DI2B 5TE6H 2EDRA 5IF0B 1MRDL 3FL7A 3I3BA 5BJTA 4F7PA 1N0XL 4L8BB 5FYLH 3B3IB 3TT3L 3ARBC 3LKQA 3U36B 2YRLA 1J1OH 3C5ZD 1MCOH 4QYOA 4MCZB 2NNAA 4YAQB 3UO1H 1UT9A 1PQZA 1HYRC 3CMOH 2R4RH 4XZUB 2AABL 3IDIB 3KPQB 4UU9B 1RFDL 5E4EB 3L3HB 5ISZB 5EZJB 1CXKA 5CEXA 4YBLC 4ZYKB 1IJ9A 3RWHA 3JSSA 2XWJA 2ENSA 3AU1A 1ND0B 2VXUL 3BJ91 4JDZA 4CU6A 4S1QH 5BQ7A 3WIFB 4KQ4H 4F33A 1P84J 1FDLL 1V7ML 4R7NA 3VWJC 5EU6A 1L9NA 1G84A 1U8MA 4LAQL 4N5EC 3ZHLA 2FB4L 4AL8L 4GG6B 4YHLL 5CLWA 4MA7H 2AEWA 5D1XC 5BO1L 3TLRA 1GIGH 2QSVA 5IV2B 1D3CA 2AI0L 4UAOB 3RWGA 2F53E 1QBAA 2BDNH 1NMAL 4JKWA 2W92A 3BP7B 4M7JH 5IBUB 2EKJA 3WFBH 1U8KB 2H1PL 1MH5B 3RTQD 5F7MC 5DEGA 4PREB 4XAWL 2VLRA 2R23B 2X09A 4WI8A 4PJBA 2JELH 4WO4A 1OSPH 5EPMB 1K4CA 2DM2A 2VOTA 5BV7L 5L2JA 4K3HA 2ZZUT 5D7JC 3QXWA 3GMRB 1R6VA 1FGVL 3T2PA 4L3EB 3FRPA 1XGQA 5CGMA 3QDJD 5FYJD 5CJXA 1JWUA 3OKLA 1D5ZA 1RZKL 1D6VL 1NDGB 3R8BB 4QNPF 2BCKB 2I5YH 3CPLA 4FXLA 3IDYB 4ZD3H 4NDMB 1JYVA 3FO0H 4XHQA 5EUOE 5IVZA 2PR4H 4PY8J 4U1GB 2VLKB 1FQ9C 1BJMA 4NZJA 5DD0H 1VGKA 4PFEA 1B90A 4WENB 3QIUC 1HHKA 4X6CE 4HS3B 2W59A 3C09C 3SO3B 4WCYL 5I9QC 1MAML 3CMOL 3SGKA 5GZND 1EPFA 1MOEA 5DMGD 4M5YL 1NEUA 3BESR 2FO4A 1N2RB 4LDEB 5JXAH 2P8PA 3V6OA 4Q9BA 1NGQL 4K8RL 3CK0L 4YZFE 4DQOH 1YN7A 1ZKAA 3SQBA 3TYFB 4F3FB 5D96C 2JLLA 5T1KA 1IE5A 3SCMA 1RZIB 1Y18B 2Z9TA 3QEUB 4EIZC 4M5ZH 4U6XB 1CYGA 5JXEC 3EDEA 5FGBC 3MODH 5GGVY 3ZE2F 4NNYB 5ICXA 1DTUA 2R2BB 2ZUUA 1AKJB 1I4FB 4QRPA 4AYFA 1S5HA 1FORH 4NNXB 3EOAB 3MRKA 4Q9RL 3BP6B 2EEAA 4RRPG 1A9BA 5DZNA 2QQLH 5FO7B 2G2RB 1DLHA 3L3DB 5FGSA 1YMME 2H26B 2AJ3B 3F12A 2FGWL 1PGRB 1OGAA 3K4ZA 5B4MD 4PP2B 3GI9H 4LDLB 1FGVH 5D9SB 4KZDL 1KIRA 4F15C 2OTUB 1P69B 1G7QB 5LGJB 3L5WA 4X4ZA 4N1HB 3MCG1 4P9MH 3DIFB 2FX7H 5IJKA 1CK0L 3LY6A 1CDHA 5EU4B 2PR4L 1NKRA 5I76B 5D7IF 2IAMA 5E8DH 4KTYA 5E8OB 2XZCH 2BXZA 4FG6C 3HA0A 4ZMAT 4L3AA 3QH3A 3SHSA 1MEXL 1CICD 4MXQD 1PYWA 4HMCA 2VWEC 3C5JB 2Q8BH 4PJ8A 3QEQD 3QFJA 2EXWD 1JGDB 1G0DA 1VFBB 3RU8H 5GXBB 5JW5A 2VWEE 3HPLB 4DAGL 3Q5OA 4PGDA 5DJYA 4Y4HC 3CFEA 4D94A 4LHUA 2YWZA 4CJ0A 1Q0YL 5HVHC 3SKJL 3DARA 5E8NB 5TE4L 2ZG3A 3F6LA 4N0CC 4L3EE 4LRIA 3IF1B 5C07A 1FVCB 5FA3B 4LF3B 1H3WM 1MJUL 2VABB 4GG6E 3VGAC 5I8CB 5TFSL 3TT1L 4FXKB 4GRLB 4M1DH 3MODL 4NM8L 1MPAH 1I7ZA 4BSWB 2LVCA 3VFNA 3TN0C 3RUGE 3IAPA 3X3GH 1F3RB 4QRTB 2B7DT 3VD5A 3ULVD 3OJMB 2EE6A 5KBNC 5ITFA 4CADA 2BVOA 5D1XA 3D18A 5EFIB 1ZHBA 1E6JL 2YPKB 3LKPA 4KKCC 2XTJC 1NFDE 4HKZA 1IC1A 3NCJL 3O2VL 5JW4R 2XN9B 2YRZA 3QUXB 1T2JA 2F5AH 5EIIB 4KTDL 1OW0A 4LSPH 3E2HC 4PJXF 3GMNA 2BNUA 4ZSOB 1INQA 3EJZD 1XF3B 4NRXA 3LRSA 5DUBB 5ICYA 4LLUB 2VH5L 3I6GB 4KZDH 2F54D 4U33A 5F89B 1NBQA 1FJ1B 4Y2OA 4OGYL 1BVKB 4UBDC 4XPBL 4GXUN 2AK4A 2VABA 1H3VA 2FX7L 5I66A 3W5NA 2HFGL 2BNRA 5EUOF 1T7VA 3QDGB 5SX5K 3NAAL 1QFWI 4OLUH 5K33A 4QRRE 2EDTA 5IESL 4KI5E 5J13B 3OX8B 1QFOA 2MQ0A 3BP4A 2V2TA 1MEXH 3FB8B 3UTTD 2Q8BL 2NY3B 5CD3A 4F3FA 4MJID 3HC0A 1S9YB 1W72L 3TC9A 3PL6C 4M1GL 1RZIA 3QEUA 3DJ9A 1A6VL 2AAVA 1XF2B 1KPVA 3HLAA 3SJVD 5DJ0A 1MQKH 3EJZC 4H88H 2VLRE 3QHFH 4M1CD 4YHPA 3UPAA 2YEZA 1U41A 3SKJH 2DD8H 3U9UA 2C26A 4MB3A 4HWBA 1ZEAL 3HAEH 4L8DB 5E4IA 4PRPD 4XMPH 3Q3GB 4JJ5A 1K8IA 4M4RA 4CDHA 3GJFA 1J18A 3MRJA 5D5MA 1SMOA 5KG9A 5HHNA 4Y1AB 2MTPA 5CEYA 5TFSH 3TT1H 1ZWIB 2PNDA 2FBOJ 3DXAA 4ZOBA 3RJQB 1MPAL 4CMMB 3ZE0E 5J4MA 5L8LB 3P4MB 2H32H 1IFHL 5KVMC 3KPLA 1NGPH 1WCBA 2QSTA 1LDPH 2V5TA 5CP3H 5C2BL 3BGMA 1G7MA 4NZTH 4WY7H 2Y06H 2RGSA 4FP8H 4PRIA 2EIDA 1AXTH 4NJ9L 4YHML 3QBTB 2D0FA 2EH7L 2M1KA 5AAMA 4XH2A 1VENA 5F9AC 4MNGA 4UIMA 1BP3B 1UCBL 2F5AL 3K4AA 3QISA 4D8PB 1I9RH 5D2LB 3WIHL 4PJ5A 3U7YH 4LLQA 4IMKC 1CBVL 1JGLH 5KZCD 2R2BA 2KPNA 2MQ3A 2NY5H 3T2NL 2AJVH 1IKNA 1VEMA 2X9XA 1SM3H 3I6KA 2PYFA 4JFED 2Y72A 4LLYA 5DC9B 5JIPA 2FR4A 3V4UH 2XKNB 2JB5L 3PL6A 4F7CA 1UKSA 1QSZA 1HZHL 4TVPD 5H35A 4Q74A 2RCSL 1DE4A 1ZANH 1QA9B 4QRUB 4ZSOE 1VFBA 3IRZA 3D39E 1M7DA 2HFGH 4JFHD 4GBXB 1U8NA 4NQDD 3OB0H 3MV8B 4NCC1 3MV8E 5FDWA 1A6WL 3JWDH 2BRRL 4XC1L 4HKJA 5IMLB 4LPVA 4JPKH 5BCAA 1WZMA 1I1AB 1CFNB 3MXWH 4YEEA 4X7CC 2OMNA 2XG5A 2MMXA 1RJZA 2F15A 1EX0A 5HPMA 2J6EH 3CDCA 1G7QA 4OF6A 1Q1JL 2ZSVB 1SEBB 1JZ7A 4MJ5B 5IW6A 2ZSWB 1UQSB 2F53D 2FATL 4YO0A 3HUJB 4PJCA 1X5AA 3RZCB 4ZYKA 5E7BA 3T1FB 3F62A 2R8SL 4ZUTB 4I77L 3X12B 1MRFL 1S5IL 2GT9A 8CGTA 1WBXA 2XG4A 1FLTX 4K3JL 3RWCB 2DQGL 2C4FT 2VR5A 2XA8H 3D3VE 3STZB 4C56B 3DO7B 1G6RL 1JV5A 1RK1A 3W82A 1P84K 4FMKA 5HI4D 5IHZA 3NIGE 1WK0A 3O41A 5ERWB 1DQLL 5IOPB 3TA3C 4JM2F 1PZUB 3TCXA 3K2MC 1IFHH 2W9EL 4ODBD 1JWSB 5GGSA 1G0YR 5BJTB 1INDH 1OD9A 1JPGA 5E8NA 1LDPL 4ODWA 4WY7L 2Y06L 5HYSB 1KELL 4AY0A 2BNRD 5DRNB 4FP8L 1UJTA 4YHMH 3MROA 2AV7B 4PRBB 4ZPTB 2AEIT 2O61B 1R5WB 3PHSA 2VZOA 1KLGA 3EFFB 4P2RB 3BSZL 5FUCE 1RZGA 3B8SA 1JGUH 3VXRE 15C8L 5K9KB 3U7YL 2CKBH 4N5UA 4NCDA 3MV9D 1JF1B 2NY5L 1KJVA 1LE5B 3B2UC 3DMMB 1K2DB 4RMWA 2RR3A 1WBYA 1KN2H 3JUZA 3TCLA 3B9KB 1A4KA 5GZNC 2DM7A 4N9GA 2Y25A 4BSVA 4WFGD 1N3NB 4Z7UA 1O7VA 3GHBH 2ZUSA 5JW4N 1OB1B 2PXYC 2BRRH 4RFNC 1FIGL 3MNWB 3RKDD 5JDJA 2EC8A 5JXEA 1DSFL 1OOAA 4UTBL 3ZDXF 5T1LA 3BAEL 3VWJB 4HK3J 4QNPE 3MXWL 1YEFL 3MRPB 5DTFB 5SWSA 5GHWL 3VGBA 1F4WH 4F8TA 1BFVH 3ISWA 5FM5M 4LLVA 2NY1C 4ERSH 3R0MA 5HDBF 5HY9B 2PTVA 4Q6IC 5DA4A 2FO1A 2D7MA 3VE0A 4XBPB 3KXFA 3GRWH 3CLEL 1WCBB 1WIUA 1G0XA 2X4NB 5EIVA 1ROWA 1CT8A 3DTXA 5KSAC 3V8CA 5FUOL 2V2XA 1G6RH 4PRPB 5D1ZA 3B2VH 1U91A 4K7FA 3QUML 5MEPA 2MHAB 2VL5B 1OLZA 4DVRL 4FQQB 4LKCB 3I3EA 3U0WH 4MAYD 3V0VA 3BH9A 3C87A 1BFTA 1FL6B 4WU7A 5DHXB 3MV7D 4GAGL 4NQXB 1ZSDA 1X5GA 1X5ZA 4XCYA 3FOMA 3BIBX 5DD6B 1P6FA 5FCUH 4QLRA 4DK3A 1KELH 3ARGA 4NO3B 4E42B 4YDJB 3WD5L 1IQDB 4ODXA 4P4KC 3UDWA 1T2QL 3RPIB 3ARQA 3BSZH 3PWLA 1NEZB 3UTQA 4J23A 2DQEL 5L88L 1G1YA 2WWKT 3NN8B 1ES0B 3ES6A 1CL7H 1FP5A 3BHBB 5E00A 4YC2B 1T03H 4YXKH 5MERB 5J13C 3HZVA 2E8YA 5IT2L 4HUUB 1HINH 3QNXA 1A1OB 3BP5B 1ETZB 3O0RL 3UZQA 2V17L 1KN2L 4Y8DC 4JB9L 1UWGL 1NUGA 3GHBL 4OCYL 3MLUL 4OGZA 4XH2B 1FH5H 4K7FB 4PRDB 4Q6IA 5MEPB 1PEZA 2FLBT 4NQDA 4ODHH 4ELKB 5DMYA 2EIEA 4GUPB 3D39A 2NTSP 1E27B 3WS3A 2Z92A 2DBLH 2RAMA 1C16A 3WFDH 2XN9D 3BAEH 3SGJC 1ZGLB 4XAKE 4PGEB 4U1MB 2IPTL 4FQXD 3EYQD 4TSBL 4KI5C 5EZIL 3HE6D 3PE9A 4G7VL 5J6HB 1QA9A 2VO5A 5LGKA 4R0LC 2CQVA 1DBKH 4L5FL 3OR6B 2R69L 4G6KH 4EXPX 4ISVA 2X2YA 1T4KA 3MUZ1 5IM7B 2IG2L 3FHAA 4OGXL 4I18A 3BKJH 3CLEH 1PKQB 3MJ8B 2WMPA 3DHMA 1W0VA 3UTPE 4Y4KA 1I3RA 1P5VA 4WI4A 4WRLA 2FSEA 3ESVF 5L2KA 2B8OT 3GMMA 2JK5A 2XTLA 4OGAD 1XF4B 1HHGA 3P0YH 3SE8L 1PQZB 2AEPH 3AFLA 4NRZB 3FFDB 3SE9H 4DVRH 2V5MA 1U92A 1JPTH 4G9FA 3V0AC 3C8KA 2CLRB 1KCSL 2XTJE 2GK0B 1A22B 2OP4H 4UV7L 4LPUA 5D1QC 4PV8B 3T4AA 2DMCA 1NGXA 2UY7A 4OZGF 1KC5H 43C9B 1MHHA 4G8EA 4A6YB 4EI5C 4JRXB 3G6AA 2FWOA 3TVMD 1J9CT 4RAVB 3C5JA 2NY4C 3ZTJG 2DQEH 3ULSB 4O9HH 1QHOA 5GGRB 2QTEA 1FNEB 1M7IA 3HC4L 4IDJL 3GMNB 4LPWA 3KNBB 5HGGS 4OQTH 2A6JA 5F88B 3P9LA 1XIWB 1GGCH 2R2EA 1E4WL 2J8HA 4LLDA 3V95A 2IMNA 4RGNE 2E9WA 1T04B 3BH8B 3MLUH 4OFIA 4BZ1L 4ODHL 5DSCA 3U83A 1NL0L 1M05A 5ESAA 5C08B 4R2GD 4ENEC 3QUZD 4X4XA 2OX5A 2B39A 2NR6C 1FE8H 1CT8B 5DO2D 5AZ2H 5LXGL 4OLXH 4OCLC 4JO4L 5EZIH 1JWMA 3OKEB 3S36X 2WIIA 4WO4C 2MCG1 4U1KA 4P2OD 2EDXA 2JCCE 2ZOLA 5IR1A 4I13B 1DBKL 2I07A 4GO6B 4L5FH 4GT7A 2AJXL 1D5ZB 3RY6C 4P23D 4Y4FC 5IB3A 2GJ6B 1AI1H 2APXA 3WNKA 4WI2A 5KN5B 3LD8B 4R4BB 4JFZL 1EFQA 3BQUB 3RWIA 3LB6C 1IM3B 4LSTH 3IYLW 2ZUVA 4U1HB 5F7DB 4GRMB 4PJHE 2Q6WA 5JIKA 2D31A 2FX8L 4TRPH 3WUWG 3AAZB 3MMEB 1P7QD 4KUZH 2JF1A 4TULL 4Y1AA 5GISL 1A9EA 5IJVA 3E2HB 4K07A 5EN2B 2J8UE 5DVKA 3RIAK 1KENH 4PJBE 1CD0A 1RUPL 3A6BH 5KAQF 2OP4L 3QUYD 1JVKA 1CZ8L 1H3XA 4X83A 4IIQC 4PP2A 3RVUD 1B6DA 4G7YH 1RZ7L 3P4NB 2A83B 4JHZA 1A1NB 4WVRA 3RWEA 5SWQA 5J12B 3RKPA 3UXFA 5GSRB 1K6QH 2W65B 5C0GB 5E6YA 1OTUD 2XWBB 3VI4E 5MI0C 1H5BA 5I19H 4L9LB 3LPFA 2YD8A 4OQTL 5HJ3A 3O45A 3U0TB 1NBZB 1I1FB 1JPSL 4ZFFB 5ADOL 2VJXA 4XVJL 3AREA 1I85A 3CFBB 3INUH 4N8VB 1PYWB 4FQHB 3RY6A 4NUJA 3HMWL 3PWLB 2FEEI 5LQBL 2EKSB 4KDTA 1UEMA 3CVIH 4ZXBC 3G5ZA 5H2BB 4LMQI 4ZUUA 5KSUA 1GOFA 1U8HA 1T89C 3GEWB 3MJ8A 1FYTA 3FRPG 5HI5D 3SN6N 4OD1L 1LEGA 4DWHA 5I1CL 4EJ1C 4M93C 5CIPB 5C0BE 2WUBH 1M1SA 2QQKH 4KHXH 4LKXA 4WEMB 2ZJSH 5F6IB 2N56A 1OGAD 3V0WL 1D9KD 1BM3L 1FVDB 4FXGB 2LU7A 4XZUA 1L4IA 2BHZA 2AJXH 2APTA 3VMPA 5I75C 4FFZL 3RUGA 2XWTA 5LGJA 1WAAA 1NCNA 2XWBA 2WLZA 4IIQB 1HI6A 3ALPA 1KPRA 4G80B 4TUJB 1RQ5A 2YZ1A 1U8LB 3VD3A 4XMKH 1ZGLA 3QEQE 4XP5L 3RDTA 2NY7L 1UKTA 5ITBH 2P5EB 3PGFL 1E4XI 1YC7A 1E4XH 4KJYA 2YBRB 1DBAH 5CKAA 1IAKA 1JP5A 5CLTA 4N0YL 1IL1A 3CAFA 2EDFA 1BZ7B 1X5XA 1M7DB 1VCAA 5JA8B 5FYKH 4XWGL 4WW2F 4QRSB 4WWID 3OSKA 3JVGC 3EYUH 1U42A 1RZ7H 4HXBH 1C7SA 3VRJA 4LBEA 5EU3B 5EDXA 3QUKA 5C6TL 4WWKA 1W72B 4X6DB 2X6MA 4LSUL 4OQ1A 2VLRB 5I1DA 1X6NA 3LDBC 2EIZA 2KH2B 1RV6X 1ZOXA 4JN1L 1RJLA 4LL9A 3U0PB 2Y4SA 1J8HE 1QSFA 2B1HH 4ZAKD 5JZ7C 2BERA 1EBPA 3RNQB 5F6IC 5ADOH 3H7BB 4Z95H 2D4FA 1A7QH 1T22A 3INUL 1FAKT 5EOCH 4NKDB 3MQIA 1YNTA 3C6SA 4MMZC 1XIWC 2DTSA 1F6LL 4Z7UB 1VGEL 1LEKB 2Y36L 1IGTA 4AEIL 1E6OL 1K8DB 4MJ2A 1YDPB 4G3YL 3W0WA 1EA9C 1YEDA 2P1YA 2CR6A 1ZLVK 3DYMA 4ZFGL 2FLRT 1ITCA 2VLKA 4DUXA 3GBMH 3QXAB 1AGBB 2OQJA 3C8DA 3OQ3B 3WN5A 5DHVB 5BW7C 3FFCE 3DURA 4JPWH 1GGIH 2A9MH 1Q9OA 2Y07H 1TZIA 1BM3H 1FL5B 4S2SB 5C2UB 3ARGC 1RZJC 4X6DA 2IANB 1YYLL 2EE3A 4LLAA 2VE6A 3LKRA 3EFFA 4P2RA 3G5VB 4L1HA 2WANA 1EO8L 1KBGL 5CSZA 3HI6L 1MCQA 3VXTB 5EO9B 1YEJL 4XCCH 3EOTH 5EBLB 43CAA 1F4AA 2ICEB 4XMKL 1CFTA 3QDAA 3SDAB 1G7PB 3S35H 5CEZD 5C0DA 1TCRB 3PGFH 4HD9A 1A2YB </